BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9084_g2_i1 len=771 path=[749:0-770]

Length=771
                                                                      Score     E

ref|XP_009777240.1|  PREDICTED: miraculin-like                          160   1e-44   
ref|XP_009608866.1|  PREDICTED: miraculin-like                          160   2e-44   
gb|ACL12055.1|  Kunitz trypsin inhibitor                                159   3e-44   Nicotiana tabacum [American tobacco]
ref|XP_009803614.1|  PREDICTED: miraculin-like                          159   3e-44   
ref|XP_009793041.1|  PREDICTED: miraculin-like                          159   3e-44   
ref|XP_009615974.1|  PREDICTED: miraculin-like                          155   8e-43   
ref|XP_006347376.1|  PREDICTED: miraculin-like                          152   2e-41   
ref|XP_006347377.1|  PREDICTED: miraculin-like                          150   1e-40   
ref|XP_004241480.1|  PREDICTED: miraculin-like                          150   1e-40   
ref|XP_004241479.1|  PREDICTED: miraculin-like                          150   1e-40   
ref|XP_010537532.1|  PREDICTED: miraculin                               137   1e-35   
gb|ACS92516.1|  Kunitz-type protease inhibitor KPI-D12                  136   2e-35   Populus trichocarpa x Populus deltoides
ref|XP_010101167.1|  hypothetical protein L484_005403                   135   3e-35   
ref|XP_010041216.1|  PREDICTED: miraculin-like                          134   8e-35   
ref|XP_006372633.1|  hypothetical protein POPTR_0017s03430g             133   3e-34   
ref|XP_006372632.1|  hypothetical protein POPTR_0017s03420g             133   3e-34   
ref|XP_010041215.1|  PREDICTED: miraculin-like                          133   4e-34   
ref|XP_006372654.1|  hypothetical protein POPTR_0017s03600g             132   6e-34   
gb|ADW95380.1|  Kunitz-type trypsin inhibitor                           132   6e-34   
ref|XP_002305034.2|  hypothetical protein POPTR_0004s06610g             132   6e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010042449.1|  PREDICTED: miraculin-like                          133   1e-33   
gb|KCW48670.1|  hypothetical protein EUGRSUZ_K02326                     131   2e-33   
gb|AEK26927.1|  Kunitz-type trypsin inhibitor B4                        131   2e-33   
ref|XP_010037029.1|  PREDICTED: miraculin-like                          132   3e-33   
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...    130   3e-33   
gb|ADK62529.1|  miraculin-like protein                                  129   8e-33   
dbj|BAA05474.1|  tumor-related protein                                  127   1e-32   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_011046091.1|  PREDICTED: miraculin-like                          128   3e-32   
ref|XP_009627067.1|  PREDICTED: miraculin                               128   4e-32   
gb|KCW48668.1|  hypothetical protein EUGRSUZ_K02323                     127   4e-32   
gb|AAC49969.1|  tumor-related protein                                   128   4e-32   Nicotiana tabacum [American tobacco]
ref|XP_009792285.1|  PREDICTED: miraculin                               128   4e-32   
ref|XP_008238584.1|  PREDICTED: miraculin-like                          127   5e-32   
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg             127   6e-32   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg             127   8e-32   
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg             127   1e-31   
ref|XP_006495063.1|  PREDICTED: miraculin-like                          126   1e-31   
ref|XP_006493432.1|  PREDICTED: miraculin-like                          129   1e-31   
ref|XP_006441436.1|  hypothetical protein CICLE_v10023581mg             126   1e-31   
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg             126   2e-31   
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg             125   2e-31   
emb|CDP20822.1|  unnamed protein product                                125   3e-31   
gb|ACV52580.1|  endopeptidase inhibitor                                 122   4e-31   Nicotiana benthamiana
ref|XP_006441457.1|  hypothetical protein CICLE_v10024528mg             122   4e-31   
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg             125   6e-31   
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg             124   6e-31   
ref|XP_006441460.1|  hypothetical protein CICLE_v10024584mg             122   1e-30   
ref|XP_004137639.1|  PREDICTED: miraculin-like                          123   2e-30   
emb|CAN65022.1|  hypothetical protein VITISV_027379                     123   2e-30   Vitis vinifera
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg             123   2e-30   
ref|XP_004299457.1|  PREDICTED: miraculin-like                          123   2e-30   
ref|XP_002266302.2|  PREDICTED: miraculin-like                          122   2e-30   Vitis vinifera
ref|XP_006495064.1|  PREDICTED: miraculin-like                          123   3e-30   
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg             122   3e-30   
emb|CAN81015.1|  hypothetical protein VITISV_025776                     122   3e-30   Vitis vinifera
ref|XP_002270111.1|  PREDICTED: miraculin                               122   4e-30   Vitis vinifera
ref|XP_006493430.1|  PREDICTED: miraculin-like                          122   5e-30   
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...    122   5e-30   
ref|XP_002265965.1|  PREDICTED: miraculin                               122   6e-30   Vitis vinifera
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg             122   7e-30   
ref|XP_002266430.1|  PREDICTED: miraculin                               121   8e-30   Vitis vinifera
gb|ADD51186.1|  tumor-related protein                                   121   9e-30   Vitis cinerea var. helleri x Vitis riparia
ref|XP_011072079.1|  PREDICTED: miraculin                               121   1e-29   
ref|XP_006351546.1|  PREDICTED: miraculin-like                          120   2e-29   
ref|XP_008437082.1|  PREDICTED: miraculin                               120   3e-29   
emb|CBI35464.3|  unnamed protein product                                120   4e-29   
emb|CAN75396.1|  hypothetical protein VITISV_028636                     119   6e-29   Vitis vinifera
ref|XP_006493433.1|  PREDICTED: miraculin-like                          120   6e-29   
ref|NP_173228.1|  kunitz family trypsin and protease inhibitor pr...    119   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437058.1|  PREDICTED: miraculin-like                          119   9e-29   
ref|XP_003534081.1|  PREDICTED: miraculin-like                          118   2e-28   
gb|KHM99737.1|  Miraculin                                               118   2e-28   
emb|CBI35466.3|  unnamed protein product                                115   2e-28   
ref|XP_004234331.1|  PREDICTED: miraculin                               118   2e-28   
ref|XP_009401850.1|  PREDICTED: miraculin-like                          117   2e-28   
ref|XP_006495061.1|  PREDICTED: miraculin-like                          117   2e-28   
gb|AAQ96377.1|  miraculin-like protein                                  117   3e-28   Solanum palustre
ref|XP_004137534.1|  PREDICTED: miraculin-like                          117   4e-28   
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                        117   6e-28   
emb|CBI35470.3|  unnamed protein product                                114   9e-28   
ref|XP_006372631.1|  trypsin protein inhibitor 3                        116   9e-28   
emb|CDO98552.1|  unnamed protein product                                115   1e-27   
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...    116   2e-27   Synsepalum dulcificum [miracle fruit]
ref|XP_003622420.1|  Endopeptidase inhibitor                            115   2e-27   
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3                 115   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006347379.1|  PREDICTED: miraculin-like                          115   2e-27   
ref|XP_011046090.1|  PREDICTED: miraculin-like                          115   2e-27   
ref|XP_002305032.2|  trypsin protein inhibitor 3                        115   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011035401.1|  PREDICTED: miraculin-like                          115   3e-27   
emb|CBI35471.3|  unnamed protein product                                122   3e-27   
gb|AEK26936.1|  Kunitz-type trypsin inhibitor B3                        114   4e-27   
gb|ADW95389.1|  Kunitz-type trypsin inhibitor                           114   4e-27   
ref|XP_009758946.1|  PREDICTED: miraculin-like                          115   4e-27   
dbj|BAA82843.1|  miraculin homologue                                    112   8e-27   Solanum melongena [aubergine]
ref|XP_010476950.1|  PREDICTED: miraculin-like                          113   1e-26   
gb|AHJ25677.1|  Kunitz-type trypsin inhibitor                           113   1e-26   
ref|XP_010683192.1|  PREDICTED: miraculin-like                          113   2e-26   
ref|XP_009601782.1|  PREDICTED: miraculin-like                          113   2e-26   
ref|XP_010249125.1|  PREDICTED: miraculin-like                          112   3e-26   
ref|XP_008437071.1|  PREDICTED: miraculin-like                          112   3e-26   
ref|XP_010459406.1|  PREDICTED: miraculin-like                          111   4e-26   
gb|KHM99742.1|  Miraculin                                               110   4e-26   
gb|KHM99743.1|  Miraculin                                               111   5e-26   
ref|XP_006304577.1|  hypothetical protein CARUB_v10011616mg             111   6e-26   
ref|XP_002890252.1|  trypsin and protease inhibitor family protein      111   6e-26   
gb|KHM99740.1|  Miraculin                                               109   7e-26   
ref|XP_003620188.1|  Miraculin                                          111   7e-26   
ref|NP_001238098.1|  uncharacterized protein LOC100306134 precursor     111   7e-26   
emb|CDY19181.1|  BnaC05g13820D                                          110   8e-26   
ref|XP_009110379.1|  PREDICTED: miraculin-like                          110   8e-26   
gb|AFK41478.1|  unknown                                                 111   8e-26   
gb|KHM99741.1|  Miraculin                                               110   9e-26   
ref|XP_010663911.1|  PREDICTED: miraculin-like                          110   9e-26   
ref|NP_001237312.1|  uncharacterized protein LOC100527782 precursor     110   1e-25   
emb|CDX96746.1|  BnaA08g22890D                                          110   1e-25   
gb|KHM99744.1|  Miraculin                                               109   2e-25   
ref|XP_006416660.1|  hypothetical protein EUTSA_v10008818mg             109   2e-25   
ref|XP_010498164.1|  PREDICTED: miraculin-like                          109   2e-25   
ref|XP_003534080.1|  PREDICTED: miraculin-like                          109   2e-25   
emb|CDX83886.1|  BnaC08g17590D                                          109   2e-25   
ref|XP_003534079.1|  PREDICTED: miraculin-like                          109   2e-25   
ref|XP_003534078.1|  PREDICTED: miraculin-like                          109   3e-25   
gb|KHM99738.1|  Miraculin                                               109   3e-25   
ref|XP_006442417.1|  hypothetical protein CICLE_v10022911mg             107   3e-25   
emb|CDY26209.1|  BnaA06g12080D                                          108   6e-25   
ref|XP_009149240.1|  PREDICTED: miraculin                               108   6e-25   
ref|XP_010683194.1|  PREDICTED: miraculin-like                          108   6e-25   
ref|XP_004237191.1|  PREDICTED: miraculin-like                          108   6e-25   
ref|XP_004301214.1|  PREDICTED: miraculin-like                          109   6e-25   
ref|XP_003620174.1|  Pathogen-inducible trypsin-inhibitor-like pr...    108   7e-25   
ref|XP_003620175.1|  Pathogen-inducible trypsin-inhibitor-like pr...    108   7e-25   
gb|KHN24493.1|  Miraculin                                               108   8e-25   
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg                108   9e-25   
emb|CDO98557.1|  unnamed protein product                                107   1e-24   
ref|XP_010683390.1|  PREDICTED: miraculin-like                          108   1e-24   
gb|KFK42293.1|  hypothetical protein AALP_AA2G237000                    107   1e-24   
ref|XP_011035408.1|  PREDICTED: miraculin-like                          107   2e-24   
ref|XP_003548288.1|  PREDICTED: miraculin-like                          107   2e-24   
ref|XP_006351548.1|  PREDICTED: miraculin-like                          107   2e-24   
gb|AFL91234.1|  Kunitz-like protease inhibitor                          105   5e-24   
gb|KFK42291.1|  hypothetical protein AALP_AA2G236700                    105   6e-24   
ref|XP_003548289.1|  PREDICTED: miraculin-like                          105   8e-24   
gb|KFK42292.1|  hypothetical protein AALP_AA2G236900                    105   1e-23   
ref|XP_010279465.1|  PREDICTED: miraculin-like                          105   1e-23   
emb|CDP22082.1|  unnamed protein product                                105   1e-23   
emb|CDP21540.1|  unnamed protein product                                105   1e-23   
ref|XP_011092684.1|  PREDICTED: miraculin-like                          105   2e-23   
emb|CDP21544.1|  unnamed protein product                                104   2e-23   
ref|NP_001241106.1|  uncharacterized protein LOC100790688 precursor     104   2e-23   
emb|CDO98554.1|  unnamed protein product                                103   4e-23   
gb|ACS92500.1|  Kunitz-type protease inhibitor KPI-D9                   103   4e-23   Populus trichocarpa x Populus nigra
emb|CDP21024.1|  unnamed protein product                                103   4e-23   
gb|AFL91230.1|  Kunitz-like protease inhibitor                          102   6e-23   
gb|AFL91229.1|  Kunitz-like protease inhibitor                          102   7e-23   
gb|AFL91226.1|  Kunitz-like protease inhibitor                          102   7e-23   
gb|ACS92519.1|  Kunitz-type protease inhibitor KPI-D8                   103   8e-23   Populus trichocarpa x Populus nigra
ref|XP_010683193.1|  PREDICTED: miraculin-like                          102   9e-23   
gb|AFL91231.1|  Kunitz-like protease inhibitor                          102   9e-23   
emb|CDP20533.1|  unnamed protein product                                103   9e-23   
gb|AFL91227.1|  Kunitz-like protease inhibitor                          102   9e-23   
emb|CDO98555.1|  unnamed protein product                                103   9e-23   
emb|CDO98560.1|  unnamed protein product                                102   9e-23   
gb|AFL91232.1|  Kunitz-like protease inhibitor                          102   1e-22   
gb|AFL91233.1|  Kunitz-like protease inhibitor                          102   1e-22   
ref|XP_006442410.1|  hypothetical protein CICLE_v10022211mg             102   1e-22   
gb|AEK31191.1|  miraculin-like protein 1                                102   1e-22   
ref|XP_006477860.1|  PREDICTED: 21 kDa seed protein-like                102   1e-22   
gb|AEK31190.1|  miraculin-like protein 1                                101   1e-22   
emb|CDP21543.1|  unnamed protein product                                102   1e-22   
ref|XP_009782174.1|  PREDICTED: miraculin-like                          102   1e-22   
ref|XP_006477857.1|  PREDICTED: 21 kDa seed protein-like                102   1e-22   
ref|XP_006441437.1|  hypothetical protein CICLE_v10023565mg           99.0    1e-22   
gb|KFK31885.1|  hypothetical protein AALP_AA6G171300                    102   1e-22   
ref|XP_007152537.1|  hypothetical protein PHAVU_004G138500g             102   2e-22   
ref|XP_009406658.1|  PREDICTED: miraculin-like                          102   2e-22   
pdb|3IIR|A  Chain A, Crystal Structure Of Miraculin Like Protein ...    101   2e-22   
ref|XP_010918417.1|  PREDICTED: miraculin-like                          101   2e-22   
gb|ACS37303.1|  trypsin inhibitor                                       102   2e-22   
gb|KHM99732.1|  Miraculin                                               101   2e-22   
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor     101   3e-22   
ref|XP_002305033.1|  trypsin protein inhibitor 3                        100   9e-22   Populus trichocarpa [western balsam poplar]
ref|XP_006477858.1|  PREDICTED: 21 kDa seed protein-like isoform X1     100   1e-21   
ref|XP_003620172.1|  21 kDa seed protein                              99.8    1e-21   
emb|CDP18338.1|  unnamed protein product                              99.8    1e-21   
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg           99.4    1e-21   
gb|AFS33546.1|  Kunitz-type protease inhibitor                        97.4    2e-21   
ref|XP_008778295.1|  PREDICTED: miraculin                             99.0    2e-21   
gb|AFL91228.1|  Kunitz-like protease inhibitor                        98.6    2e-21   
ref|XP_006441455.1|  hypothetical protein CICLE_v10023253mg           96.7    2e-21   
ref|XP_003620184.1|  Pathogen-inducible trypsin-inhibitor-like pr...  99.4    2e-21   
emb|CDP19136.1|  unnamed protein product                              99.4    2e-21   
gb|AEK31192.1|  miraculin-like protein 1                              98.2    2e-21   
ref|XP_009782173.1|  PREDICTED: miraculin-like                        99.8    2e-21   
emb|CDO98558.1|  unnamed protein product                              99.0    3e-21   
ref|XP_006495062.1|  PREDICTED: miraculin-like                        97.1    3e-21   
ref|XP_011035403.1|  PREDICTED: 21 kDa seed protein-like              99.0    3e-21   
ref|XP_010279488.1|  PREDICTED: miraculin-like                        98.6    3e-21   
gb|AEK26926.1|  Kunitz-type trypsin inhibitor B1                      99.0    3e-21   
ref|XP_003534100.1|  PREDICTED: miraculin-like                        99.0    3e-21   
ref|XP_006847953.1|  hypothetical protein AMTR_s00029p00141480        98.2    3e-21   
emb|CDP19138.1|  unnamed protein product                              99.0    3e-21   
ref|XP_011035402.1|  PREDICTED: 21 kDa seed protein-like              98.6    3e-21   
gb|AFK39812.1|  unknown                                               98.6    4e-21   
ref|XP_009614755.1|  PREDICTED: miraculin-like                        98.2    4e-21   
emb|CAN63617.1|  hypothetical protein VITISV_041430                   98.2    6e-21   Vitis vinifera
gb|AAQ84217.1|  Kunitz trypsin inhibitor 4                            98.2    6e-21   Populus trichocarpa x Populus deltoides
ref|XP_004235409.1|  PREDICTED: miraculin-like                        97.8    6e-21   
gb|KDO37403.1|  hypothetical protein CISIN_1g035912mg                 95.9    6e-21   
emb|CDP21779.1|  unnamed protein product                              97.4    9e-21   
gb|ABK96521.1|  unknown                                               97.4    9e-21   Populus trichocarpa x Populus deltoides
ref|XP_006353931.1|  PREDICTED: miraculin-like                        97.4    1e-20   
gb|ACO40080.1|  kunitz trypsin inhibitor 4                            96.7    1e-20   Populus balsamifera [balsam poplar]
emb|CDP21726.1|  unnamed protein product                              97.1    1e-20   
ref|XP_006847952.1|  hypothetical protein AMTR_s00029p00141300        95.9    1e-20   
ref|XP_006478228.1|  PREDICTED: uncharacterized protein LOC102606959    100   2e-20   
gb|ACO40078.1|  kunitz trypsin inhibitor 4                            95.5    2e-20   Populus balsamifera [balsam poplar]
ref|XP_003620169.1|  Kunitz-type trypsin inhibitor alpha chain        95.5    4e-20   
dbj|BAA82842.1|  miraculin homologue                                  93.6    6e-20   Taraxacum officinale [dandelion]
gb|AFK33359.1|  unknown                                               94.7    7e-20   
ref|XP_009614754.1|  PREDICTED: miraculin-like                        95.5    7e-20   
gb|KHM99735.1|  Miraculin                                             93.6    8e-20   
ref|XP_007036743.1|  21 kDa seed protein                              94.7    9e-20   
ref|XP_010536414.1|  PREDICTED: miraculin-like                        94.7    9e-20   
prf||1802409A  albumin                                                94.7    9e-20
gb|ABG47463.1|  vegetative storage protein                            94.7    1e-19   Litchi chinensis [litchi]
emb|CAZ64526.1|  Kunitz trypsin inhibitor                             92.4    1e-19   Populus trichocarpa [western balsam poplar]
gb|KHN45554.1|  Miraculin                                             90.9    2e-19   
emb|CDP16462.1|  unnamed protein product                              93.6    2e-19   
ref|XP_003534083.1|  PREDICTED: miraculin-like                        93.6    3e-19   
gb|ACO40144.1|  kunitz trypsin inhibitor 4                            92.8    3e-19   Populus balsamifera [balsam poplar]
ref|XP_003620187.1|  Miraculin                                        93.2    3e-19   
dbj|BAA82840.1|  miraculin homologue                                  91.3    4e-19   Youngia japonica
emb|CBJ94877.1|  kunitz trypsin inhibitor                             91.3    4e-19   Populus balsamifera [balsam poplar]
gb|AAV41233.1|  putative 21 kDa trypsin inhibitor                     92.8    4e-19   Theobroma bicolor
ref|XP_009614753.1|  PREDICTED: miraculin-like                        93.2    5e-19   
gb|ABK01288.1|  miraculin-like protein                                92.4    5e-19   Coffea arabica [arabica coffee]
ref|XP_006353919.1|  PREDICTED: miraculin-like                        93.2    6e-19   
ref|XP_009782172.1|  PREDICTED: miraculin-like                        92.8    7e-19   
gb|AFK34345.1|  unknown                                               92.0    8e-19   
gb|ACO40100.1|  kunitz trypsin inhibitor 4                            91.3    8e-19   Populus balsamifera [balsam poplar]
gb|ACO40081.1|  kunitz trypsin inhibitor 4                            91.3    8e-19   Populus balsamifera [balsam poplar]
gb|ACO40074.1|  kunitz trypsin inhibitor 4                            91.3    9e-19   Populus balsamifera [balsam poplar]
gb|KDO39799.1|  hypothetical protein CISIN_1g039827mg                 89.0    1e-18   
gb|ACO40119.1|  kunitz trypsin inhibitor 4                            90.9    1e-18   Populus balsamifera [balsam poplar]
gb|ACO40082.1|  kunitz trypsin inhibitor 4                            90.9    1e-18   Populus balsamifera [balsam poplar]
ref|XP_006441440.1|  hypothetical protein CICLE_v10022156mg           91.3    1e-18   
gb|KDO40321.1|  hypothetical protein CISIN_1g028238mg                 91.3    1e-18   
ref|XP_004515059.1|  PREDICTED: miraculin-like                        90.9    2e-18   
ref|XP_006441443.1|  hypothetical protein CICLE_v10023590mg           87.4    2e-18   
ref|XP_003534101.1|  PREDICTED: 21 kDa seed protein-like              90.5    2e-18   
ref|NP_001237597.1|  uncharacterized protein LOC100527288 precursor   90.5    2e-18   
dbj|BAA82841.1|  miraculin homologue                                  89.0    2e-18   Youngia japonica
gb|ACO40104.1|  kunitz trypsin inhibitor 4                            89.4    4e-18   Populus balsamifera [balsam poplar]
gb|ACO40093.1|  kunitz trypsin inhibitor 4                            89.4    4e-18   Populus balsamifera [balsam poplar]
gb|ACO40145.1|  kunitz trypsin inhibitor 4                            89.4    4e-18   Populus balsamifera [balsam poplar]
gb|ACO40153.1|  kunitz trypsin inhibitor 4                            89.4    4e-18   Populus balsamifera [balsam poplar]
gb|ACO40084.1|  kunitz trypsin inhibitor 4                            89.4    4e-18   Populus balsamifera [balsam poplar]
gb|ACO40073.1|  kunitz trypsin inhibitor 4                            89.4    4e-18   Populus balsamifera [balsam poplar]
gb|ACO40154.1|  kunitz trypsin inhibitor 4                            89.4    4e-18   Populus balsamifera [balsam poplar]
gb|ACO40077.1|  kunitz trypsin inhibitor 4                            89.4    4e-18   Populus balsamifera [balsam poplar]
ref|XP_006441469.1|  hypothetical protein CICLE_v10024002mg           89.7    6e-18   
ref|XP_007152529.1|  hypothetical protein PHAVU_004G138000g           88.6    6e-18   
gb|ACO40086.1|  kunitz trypsin inhibitor 4                            88.6    7e-18   Populus balsamifera [balsam poplar]
gb|ACO40133.1|  kunitz trypsin inhibitor 4                            88.6    8e-18   Populus balsamifera [balsam poplar]
ref|XP_003534082.1|  PREDICTED: miraculin-like                        89.0    1e-17   
ref|XP_010279489.1|  PREDICTED: miraculin-like                        88.6    1e-17   
gb|KHN24496.1|  Miraculin                                             88.6    1e-17   
ref|XP_006441433.1|  hypothetical protein CICLE_v10023442mg           85.9    1e-17   
gb|AEK31201.1|  miraculin-like protein 2                              87.8    1e-17   
emb|CAI77770.1|  kunitz trypsin inhibitor                             88.6    2e-17   Populus tremula [European aspen]
gb|AAV41231.1|  putative 21 kDa trypsin inhibitor                     88.2    2e-17   Theobroma cacao [chocolate]
emb|CAI77764.1|  kunitz trypsin inhibitor                             88.2    2e-17   Populus tremula [European aspen]
emb|CAI77774.1|  kunitz trypsin inhibitor                             87.8    2e-17   Populus tremula [European aspen]
emb|CAI77766.1|  kunitz trypsin inhibitor                             87.8    2e-17   Populus tremula [European aspen]
gb|ACF74332.1|  Kunitz trypsin inhibitor 4                            87.4    2e-17   Arachis hypogaea [goober]
ref|XP_010428237.1|  PREDICTED: miraculin-like                        87.4    3e-17   
emb|CAI77767.1|  kunitz trypsin inhibitor                             87.4    3e-17   Populus tremula [European aspen]
gb|ACJ51124.1|  talisin                                               87.0    3e-17   Talisia esculenta [pitomba]
emb|CAI77785.1|  kunitz trypsin inhibitor                             87.4    3e-17   Populus tremula [European aspen]
emb|CAI77771.1|  kunitz trypsin inhibitor                             87.4    3e-17   
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     87.4    3e-17   
emb|CAI77786.1|  kunitz trypsin inhibitor                             87.4    3e-17   
emb|CAI77798.1|  kunitz trypsin inhibitor                             87.4    3e-17   
emb|CAI77765.1|  kunitz trypsin inhibitor                             87.4    3e-17   
emb|CAI77773.1|  kunitz trypsin inhibitor                             87.4    4e-17   
emb|CAI77775.1|  kunitz trypsin inhibitor                             87.4    4e-17   
emb|CAI77800.1|  kunitz trypsin inhibitor                             87.4    4e-17   
emb|CAI77790.1|  kunitz trypsin inhibitor                             87.4    4e-17   
emb|CAI77777.1|  kunitz trypsin inhibitor                             87.4    4e-17   
emb|CAI77769.1|  kunitz trypsin inhibitor                             87.0    4e-17   
emb|CAI77793.1|  kunitz trypsin inhibitor                             87.0    4e-17   
gb|AEO27900.1|  miraculin-like protein 2                              86.3    4e-17   
emb|CAI77772.1|  kunitz trypsin inhibitor                             87.0    4e-17   
emb|CAI77782.1|  kunitz trypsin inhibitor                             87.0    4e-17   
ref|XP_004235412.1|  PREDICTED: miraculin-like                        87.8    4e-17   
emb|CAI77803.1|  kunitz trypsin inhibitor                             87.0    4e-17   
emb|CAI77795.1|  kunitz trypsin inhibitor                             87.0    5e-17   
gb|AAL85644.1|  trypsin inhibitor                                     85.9    5e-17   
emb|CAI77768.1|  kunitz trypsin inhibitor                             86.7    6e-17   
gb|AAL85645.1|  trypsin inhibitor                                     85.5    6e-17   
gb|AAL85648.1|  trypsin inhibitor                                     85.5    6e-17   
emb|CAI77783.1|  kunitz trypsin inhibitor                             86.7    6e-17   
gb|AEO27899.1|  miraculin-like protein                                85.1    1e-16   
ref|XP_009608941.1|  PREDICTED: serine protease inhibitor 4-like      84.7    1e-16   
ref|XP_003620185.1|  21 kDa seed protein                              85.5    1e-16   
gb|AAG52121.1|AC010556_3  putative trypsin inhibitor; 19671-20297     85.5    2e-16   
ref|NP_565061.1|  kunitz trypsin inhibitor 1                          85.5    2e-16   
gb|KFK41765.1|  hypothetical protein AALP_AA2G169300                  84.7    2e-16   
ref|XP_010416116.1|  PREDICTED: miraculin-like                        84.7    3e-16   
gb|ABX76298.1|  sexual organ expressed protein                        85.1    3e-16   
gb|AAN15685.1|  putative trypsin inhibitor                            84.3    3e-16   
gb|AEK31202.1|  miraculin-like protein 2                              83.6    3e-16   
gb|ABX76297.1|  stigma expressed protein                              84.0    7e-16   
ref|XP_006478136.1|  PREDICTED: 21 kDa seed protein-like              83.6    7e-16   
ref|XP_006478132.1|  PREDICTED: 21 kDa seed protein-like              83.2    1e-15   
gb|AAL85643.1|  trypsin inhibitor                                     81.6    1e-15   
ref|XP_006441467.1|  hypothetical protein CICLE_v10022124mg           83.2    1e-15   
dbj|BAE79511.1|  miraculin-like protein 2                             82.8    1e-15   
gb|AFR54471.1|  miraculin-like protein 2                              82.8    1e-15   
gb|AAL85652.1|  trypsin inhibitor                                     81.6    1e-15   
gb|AEK31196.1|  miraculin-like protein 2                              82.0    1e-15   
gb|AAL85651.1|  trypsin inhibitor                                     81.6    1e-15   
gb|AAL85650.1|  trypsin inhibitor                                     81.6    1e-15   
ref|XP_006441465.1|  hypothetical protein CICLE_v10022129mg           82.4    2e-15   
gb|AEK31197.1|  miraculin-like protein 2                              80.9    3e-15   
gb|AAL85654.1|  trypsin inhibitor                                     80.1    4e-15   
gb|AEO27901.1|  miraculin-like protein 2                              80.5    4e-15   
ref|XP_006353924.1|  PREDICTED: miraculin-like                        80.9    4e-15   
ref|XP_006465039.1|  PREDICTED: 21 kDa seed protein-like              80.9    6e-15   
ref|XP_010539107.1|  PREDICTED: 21 kDa seed protein-like              80.9    6e-15   
ref|XP_007152533.1|  hypothetical protein PHAVU_004G1383001g          77.4    7e-15   
ref|XP_004515058.1|  PREDICTED: miraculin-like                        80.5    7e-15   
ref|XP_006353921.1|  PREDICTED: cysteine protease inhibitor 9-like    80.9    7e-15   
ref|XP_006432185.1|  hypothetical protein CICLE_v10002395mg           80.5    9e-15   
emb|CDY11118.1|  BnaC06g23700D                                        80.1    9e-15   
gb|AAF15901.1|AF208020_1  putative proteinase inhibitor               80.5    1e-14   
ref|XP_010471385.1|  PREDICTED: trypsin inhibitor BvTI-like           79.7    1e-14   
ref|XP_006302823.1|  hypothetical protein CARUB_v10020954mg           79.3    2e-14   
ref|XP_007036750.1|  21 kDa seed protein                              79.0    3e-14   
ref|XP_010673342.1|  PREDICTED: miraculin-like                        79.0    3e-14   
ref|XP_007036746.1|  21 kDa seed protein                              79.0    3e-14   
ref|XP_010673346.1|  PREDICTED: miraculin-like                        78.6    3e-14   
gb|AAL85661.1|  trypsin inhibitor                                     77.4    3e-14   
gb|AAL85653.1|  trypsin inhibitor                                     77.4    4e-14   
gb|AEK31199.1|  miraculin-like protein 2                              77.8    4e-14   
emb|CCI52775.1|  Stigma expressed protein                             78.6    4e-14   
ref|XP_002888920.1|  hypothetical protein ARALYDRAFT_476458           77.8    6e-14   
ref|XP_006478135.1|  PREDICTED: miraculin-like                        77.8    9e-14   
gb|AAG38518.1|AF283533_1  miraculin-like protein 2                    77.4    1e-13   
ref|XP_004235491.1|  PREDICTED: cysteine protease inhibitor 8-like    77.4    1e-13   
gb|AAL85660.1|  trypsin inhibitor                                     76.3    1e-13   
gb|AAK96757.1|  putative trypsin inhibitor                            77.0    1e-13   
ref|XP_006390572.1|  hypothetical protein EUTSA_v10019151mg           76.6    2e-13   
ref|XP_006441461.1|  hypothetical protein CICLE_v10022001mg           76.6    2e-13   
gb|KDO44067.1|  hypothetical protein CISIN_1g031474mg                 75.1    2e-13   
gb|AAL85640.1|  trypsin inhibitor                                     75.1    3e-13   
gb|KDO40852.1|  hypothetical protein CISIN_1g046118mg                 75.9    3e-13   
ref|XP_007036748.1|  21 kDa seed protein, putative                    75.9    4e-13   
ref|XP_009789071.1|  PREDICTED: cysteine protease inhibitor 8-like    75.9    4e-13   
ref|XP_006441434.1|  hypothetical protein CICLE_v10023743mg           73.6    4e-13   
ref|XP_006427451.1|  hypothetical protein CICLE_v10027262mg           75.5    5e-13   
gb|AAL85642.1|  trypsin inhibitor                                     74.3    5e-13   
gb|AAL85637.1|  trypsin inhibitor                                     73.9    6e-13   
gb|AFK41530.1|  unknown                                               75.1    6e-13   
ref|XP_010264783.1|  PREDICTED: miraculin-like                        74.3    6e-13   
ref|XP_010253721.1|  PREDICTED: miraculin-like                        74.7    8e-13   
ref|XP_007041756.1|  21 kDa seed protein                              73.9    1e-12   
gb|AAL85659.1|  trypsin inhibitor                                     72.4    2e-12   
ref|XP_006442412.1|  hypothetical protein CICLE_v10023557mg           72.4    3e-12   
ref|XP_010261301.1|  PREDICTED: uncharacterized protein LOC104600157  75.1    4e-12   
ref|XP_006353927.1|  PREDICTED: cysteine protease inhibitor 8-like    72.8    5e-12   
gb|AAL85657.1|  trypsin inhibitor                                     71.2    6e-12   
ref|XP_010253746.1|  PREDICTED: 21 kDa seed protein-like              72.4    6e-12   
gb|KDO42306.1|  hypothetical protein CISIN_1g047198mg                 69.3    7e-12   
emb|CDY11117.1|  BnaC06g23690D                                        70.9    1e-11   
gb|AAL85656.1|  trypsin inhibitor                                     70.1    1e-11   
gb|AAL85655.1|  trypsin inhibitor                                     70.1    2e-11   
ref|XP_009104823.1|  PREDICTED: trypsin inhibitor BvTI-like           70.5    2e-11   
gb|KGN64218.1|  hypothetical protein Csa_1G043210                     69.3    2e-11   
gb|AAS75739.1|  thermoinhibition-associated THB-6 protein             68.2    3e-11   
ref|XP_002265535.2|  PREDICTED: alpha-amylase/subtilisin inhibito...  68.9    6e-11   
gb|KDO47404.1|  hypothetical protein CISIN_1g048141mg                 68.6    1e-10   
gb|AEK31200.1|  miraculin-like protein 2                              67.8    1e-10   
ref|XP_006347378.1|  PREDICTED: miraculin-like                        67.8    2e-10   
gb|KHN26247.1|  Miraculin                                             66.6    2e-10   
ref|XP_007041758.1|  21 kDa seed protein, putative                    66.6    2e-10   
ref|XP_008226352.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  66.2    6e-10   
ref|XP_004242148.1|  PREDICTED: miraculin-like                        65.9    6e-10   
ref|XP_007212054.1|  hypothetical protein PRUPE_ppa011448mg           65.5    1e-09   
ref|XP_010277875.1|  PREDICTED: miraculin-like                        65.5    1e-09   
emb|CBJ94886.1|  kunitz trypsin inhibitor                             63.2    2e-09   
ref|XP_009344613.1|  PREDICTED: miraculin-like                        64.7    3e-09   
ref|XP_009344614.1|  PREDICTED: miraculin-like                        64.7    3e-09   
gb|KDO42543.1|  hypothetical protein CISIN_1g031740mg                 63.2    4e-09   
gb|AAV41232.1|  putative 21 kDa trypsin inhibitor                     63.5    5e-09   
emb|CDX72969.1|  BnaC06g34170D                                        63.5    6e-09   
ref|XP_010248438.1|  PREDICTED: 21 kDa seed protein-like              63.9    7e-09   
gb|KDO77364.1|  hypothetical protein CISIN_1g0437192mg                62.8    7e-09   
ref|XP_004295679.1|  PREDICTED: miraculin-like                        62.8    8e-09   
ref|XP_006468645.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  62.8    1e-08   
ref|XP_007041757.1|  21 kDa seed protein, putative                    63.2    1e-08   
ref|XP_006448699.1|  hypothetical protein CICLE_v10016767mg           62.8    1e-08   
emb|CDX96460.1|  BnaA07g30710D                                        62.4    1e-08   
ref|XP_009105978.1|  PREDICTED: trypsin inhibitor BvTI-like           62.8    2e-08   
ref|XP_010250347.1|  PREDICTED: 21 kDa seed protein-like              63.5    2e-08   
ref|XP_010250345.1|  PREDICTED: 21 kDa seed protein-like              62.4    3e-08   
pdb|4IHZ|A  Chain A, Crystal Structure Of Cratabl, A Trypsin Inhi...  60.8    3e-08   
sp|U3KRG0.2|LECB1_CRATA  RecName: Full=Bark lectin isoform 1; Sho...  60.5    4e-08   
gb|AFK38218.1|  unknown                                               59.3    5e-08   
ref|XP_010250346.1|  PREDICTED: 21 kDa seed protein-like              61.2    6e-08   
ref|XP_006441431.1|  hypothetical protein CICLE_v10023623mg           59.3    6e-08   
gb|AEK31198.1|  miraculin-like protein 2                              60.1    7e-08   
gb|KEH16752.1|  Kunitz type trypsin inhibitor                         60.5    8e-08   
ref|XP_004294173.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  60.1    9e-08   
ref|XP_003603351.1|  Trypsin protein inhibitor                        60.5    1e-07   
gb|KEH16836.1|  Kunitz type trypsin inhibitor                         60.1    1e-07   
gb|AAF15902.1|AF208022_1  biotic cell death-associated protein        60.5    1e-07   
gb|KHN26623.1|  Miraculin                                             58.2    2e-07   
gb|KDO39703.1|  hypothetical protein CISIN_1g043243mg                 58.2    2e-07   
ref|XP_006441458.1|  hypothetical protein CICLE_v10023748mg           57.4    2e-07   
emb|CBJ94870.1|  kunitz trypsin inhibitor                             57.4    2e-07   
emb|CAN82891.1|  hypothetical protein VITISV_005058                   58.5    2e-07   
emb|CDQ51987.1|  alpha amylase/subtilisin inhibitor                   58.9    3e-07   
gb|KEH16150.1|  Kunitz type trypsin inhibitor                         58.9    3e-07   
ref|XP_004511146.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  58.9    3e-07   
pdb|3TC2|A  Chain A, Crystal Structure Of Potato Serine Protease ...  58.5    3e-07   
ref|XP_003620167.1|  Kunitz trypsin inhibitor                         56.6    3e-07   
emb|CAC40756.1|  putative miraculin                                   58.5    4e-07   
gb|AIS71915.1|  hypothetical protein                                  58.9    4e-07   
ref|XP_003548287.1|  PREDICTED: trypsin inhibitor A-like              58.5    4e-07   
ref|XP_009630289.1|  PREDICTED: miraculin-like                        58.9    4e-07   
gb|AAB23101.1|  bifunctional subtilisin/alpha-amylase inhibitor, ...  57.4    7e-07   
gb|KEH19472.1|  Kunitz type trypsin inhibitor                         57.8    8e-07   
sp|C0HJA4.1|LECB2_CRATA  RecName: Full=Bark lectin isoform 2; Sho...  56.6    1e-06   
emb|CDX72972.1|  BnaC06g34200D                                        57.4    1e-06   
ref|NP_001275101.1|  Kunitz-type protease inhibitor precursor         57.0    2e-06   
gb|KEH16370.1|  Kunitz type trypsin inhibitor                         56.6    2e-06   
ref|XP_003628506.1|  Alpha-amylase/subtilisin inhibitor               56.6    2e-06   
sp|P58515.1|SPI2_SOLTU  RecName: Full=Serine protease inhibitor 2...  55.8    3e-06   
ref|XP_009588833.1|  PREDICTED: latex serine proteinase inhibitor...  56.2    3e-06   
gb|AIT42196.1|  Kunitz-type inhibitor B                               56.2    3e-06   
gb|AIT42184.1|  Kunitz-type inhibitor B                               56.2    3e-06   
gb|AFK41125.1|  unknown                                               55.8    3e-06   
gb|AIT42183.1|  Kunitz-type inhibitor B                               56.2    3e-06   
ref|XP_006351514.1|  PREDICTED: probable serine protease inhibito...  56.2    4e-06   
ref|XP_006353925.1|  PREDICTED: cysteine protease inhibitor 8-like    55.5    4e-06   
ref|XP_009775241.1|  PREDICTED: latex serine proteinase inhibitor...  56.2    4e-06   
ref|NP_001275427.1|  Kunitz-type protease inhibitor precursor         55.8    4e-06   
emb|CBK52316.1|  Nb cell deth marker                                  55.5    4e-06   
ref|XP_002525871.1|  Alpha-amylase/subtilisin inhibitor precursor...  55.5    4e-06   
ref|XP_006360663.1|  PREDICTED: miraculin-like                        55.8    4e-06   
gb|AFM38166.1|  Kunitz-type protease inhibitor group A                55.5    5e-06   
ref|XP_004234308.1|  PREDICTED: serine protease inhibitor 5-like      55.8    5e-06   
gb|ABB72793.1|  Kunitz-type protease inhibitor-like protein           55.5    5e-06   
gb|ADL60120.1|  alpha-amylase inhibitor                               55.1    5e-06   
gb|KDO46146.1|  hypothetical protein CISIN_1g047893mg                 54.3    5e-06   
gb|AIT42197.1|  Kunitz-type inhibitor B                               55.5    5e-06   
ref|XP_007133280.1|  hypothetical protein PHAVU_011G166500g           55.5    6e-06   
ref|NP_001053363.1|  Os04g0526600                                     55.1    6e-06   
gb|AIT42180.1|  Kunitz-type inhibitor B                               55.5    6e-06   
gb|ACV65034.1|  alpha-amylase inhibitor                               54.7    6e-06   
ref|NP_001237751.1|  Kunitz trypsin protease inhibitor-like precu...  55.1    7e-06   
gb|AIT42191.1|  Kunitz-type inhibitor B                               55.5    7e-06   
gb|AAX47263.1|  Kunitz-type proteinase inhibitor group B1             54.7    7e-06   
gb|AIT42172.1|  Kunitz-type inhibitor B                               55.5    7e-06   
gb|AAX47266.1|  Kunitz-type proteinase inhibitor group B4             54.7    8e-06   
gb|KHM98864.1|  Alpha-amylase/subtilisin inhibitor                    55.1    8e-06   
emb|CAA45723.1|  aspartic proteinase inhibitor                        55.1    8e-06   
gb|AAX47267.1|  Kunitz-type proteinase inhibitor group B5             54.7    8e-06   
gb|AIT42175.1|  Kunitz-type inhibitor B                               55.1    8e-06   
sp|P30941.2|SPI7_SOLTU  RecName: Full=Serine protease inhibitor 7...  55.1    8e-06   
dbj|BAA04150.1|  proteinase inhibitor                                 55.1    9e-06   
sp|Q41433.1|SPI6_SOLTU  RecName: Full=Probable serine protease in...  55.1    9e-06   
ref|XP_007133321.1|  hypothetical protein PHAVU_011G169900g           54.7    9e-06   
gb|AIT42199.1|  Kunitz-type inhibitor B                               55.1    9e-06   
gb|AAN04125.1|  Kunitz-type proteinase inhibitor precursor            54.3    9e-06   
ref|NP_001238584.1|  uncharacterized protein LOC100306165 precursor   54.7    1e-05   
gb|AAU09272.1|  Kunitz-type proteinase inhibitor group B              54.3    1e-05   
gb|AGF39573.1|  Kunitz-type protease inhibitor A                      53.9    1e-05   
gb|AIT42170.1|  Kunitz-type inhibitor B                               54.7    1e-05   
gb|AIT42195.1|  Kunitz-type inhibitor B                               55.1    1e-05   
gb|AIT42182.1|  Kunitz-type inhibitor B                               54.7    1e-05   
gb|AFZ77402.1|  Kunitz-type proteinase inhibitor PKI2                 54.7    1e-05   
gb|AFC88891.1|  Kunitz-type proteinase inhibitor group A1             54.3    1e-05   
ref|XP_007152524.1|  hypothetical protein PHAVU_004G137600g           54.7    1e-05   
ref|NP_001274866.1|  Kunitz-type enzyme inhibitor P4E1 precursor      54.7    1e-05   
gb|AIT42188.1|  Kunitz-type inhibitor B                               54.7    1e-05   
gb|AAM10744.1|AF492769_1  putative kunitz-type proteinase inhibit...  54.3    1e-05   
gb|AIT42190.1|  Kunitz-type inhibitor B                               54.3    1e-05   
sp|Q41484.1|SPI5_SOLTU  RecName: Full=Serine protease inhibitor 5...  54.3    2e-05   
ref|XP_010689900.1|  PREDICTED: 21 kDa seed protein-like              54.3    2e-05   
gb|AFK48705.1|  unknown                                               53.9    2e-05   
ref|XP_003598537.1|  Alpha-amylase/subtilisin inhibitor               53.9    2e-05   
gb|AIT42186.1|  Kunitz-type inhibitor B                               53.9    2e-05   
gb|AAU04570.1|  Kunitz-type proteinase inhibitor                      53.5    2e-05   
sp|P58514.2|SPI1_SOLTU  RecName: Full=Serine protease inhibitor 1...  53.9    2e-05   
ref|XP_003598532.1|  Alpha-amylase/subtilisin inhibitor               53.5    2e-05   
gb|AAX47264.1|  Kunitz-type proteinase inhibitor group B2             53.5    2e-05   
gb|AIT42187.1|  Kunitz-type inhibitor B                               53.9    2e-05   
ref|XP_004235492.2|  PREDICTED: kunitz-type trypsin inhibitor alp...  53.5    2e-05   



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+FFTPT+C+ ET+W++G YDE LK+YFIVTGGVEGNPGP T++NWFKIEKL +DYK
Sbjct  106  DLNVRFFTPTICARETIWKLGTYDEKLKQYFIVTGGVEGNPGPLTVSNWFKIEKLGTDYK  165

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
             VFCPSVC+ C+V+C DVGIY    G +FLALSD+P  V FKR F
Sbjct  166  FVFCPSVCTFCKVICKDVGIY-NKDGVRFLALSDTPFRVMFKRTF  209



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+FFTPT+C+ ET+W+VG +DE LK+YF+VTGGVEGNPGP+T++NWFKIEKL +DYK
Sbjct  106  DLNVRFFTPTICARETIWKVGDFDEKLKQYFVVTGGVEGNPGPQTVSNWFKIEKLGTDYK  165

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
             VFCPSVCS C+V+C DVGI+    G +FLALSD+P  V FK+ F
Sbjct  166  FVFCPSVCSFCKVICKDVGIFT-KNGVRFLALSDTPFRVMFKKTF  209



>gb|ACL12055.1| Kunitz trypsin inhibitor [Nicotiana tabacum]
Length=209

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+FFTPT+C+ ET+W++G YD+ LK+YFIVTGGVEGNPGP+T+++WFKIEKL +DYK
Sbjct  106  DLNVRFFTPTICARETIWKLGTYDDKLKQYFIVTGGVEGNPGPQTLSSWFKIEKLGTDYK  165

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
             VFCPSVC IC+V+C DVGIY    G +FLALSD+PL V FK+ F
Sbjct  166  FVFCPSVCKICKVICKDVGIYT-KDGVRFLALSDTPLRVMFKKTF  209



>ref|XP_009803614.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=210

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+FFTPT+C+ ET+W++G YD+ LK+YF+VTGGVEGNPGP+T+++WFKIEKL +DYK
Sbjct  106  DLNVRFFTPTICARETIWKLGTYDDKLKQYFMVTGGVEGNPGPQTLSSWFKIEKLGTDYK  165

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
             VFCPSVC IC+V+C DVGIY    G +F+ALSD+P  V FK+ F
Sbjct  166  FVFCPSVCKICKVICKDVGIYSTKDGVRFMALSDTPFRVMFKKTF  210



>ref|XP_009793041.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+FFTPT+C+ ET+W++G YD+ LK+YFIVTGGVEGNPGP+T+++WFKIEKL +DYK
Sbjct  106  DLNVRFFTPTICARETIWKLGTYDDKLKQYFIVTGGVEGNPGPQTLSSWFKIEKLGTDYK  165

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
             VFCPSVC IC+V+C DVGIY    G +FLALSD+PL V FK+ F
Sbjct  166  FVFCPSVCKICKVICKDVGIYT-KDGVRFLALSDTPLRVMFKKTF  209



>ref|XP_009615974.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 89/105 (85%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+F+TPT+C+ ET+W++G YD+ LK+YFIVTGGVEGNPGP+T+++WFKIEKL +DYK
Sbjct  106  DLNVRFYTPTICARETIWKLGTYDDKLKQYFIVTGGVEGNPGPQTVSSWFKIEKLGTDYK  165

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
             +FCPSVC IC+V+C DVGIY    G +FLALSD+P  V FK+ F
Sbjct  166  FLFCPSVCKICKVICKDVGIYT-KDGVRFLALSDTPFRVMFKKTF  209



>ref|XP_006347376.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=202

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+F+TPT+C+ ET+W++G+YDE LK+YF+VTGGVEGNPG +T+ NWFKIEK ES YK
Sbjct  98   DVNVRFYTPTICARETIWKLGEYDENLKQYFVVTGGVEGNPGLKTVGNWFKIEKFESGYK  157

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
             V+CPSVC  C+V+C DVGI +   G + LALSD+P  V FK+ F
Sbjct  158  FVYCPSVCKFCKVICKDVGILITKDGVRLLALSDTPYKVMFKKTF  202



>ref|XP_006347377.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=210

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+F+TPT+C+ ET+W++G YD+ LK+YF+VTGGVEGNPGP+T+ NWFKIEK  SDYK
Sbjct  107  DVNVRFYTPTICARETIWKLGAYDDKLKQYFVVTGGVEGNPGPQTVGNWFKIEKFGSDYK  166

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
             VFCPSVC   +V+C DVG+++   G +FLALSD+P  V FK+ F
Sbjct  167  FVFCPSVCEFYKVICKDVGVFM-KDGVRFLALSDTPFKVMFKKTF  210



>ref|XP_004241480.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=211

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+FFTPT+C+ ET+W++G YD+ LK+YF+VTGGVEGNPGP+T+ NWFKI K  S YK
Sbjct  108  DVNVRFFTPTICARETIWKLGAYDDKLKQYFVVTGGVEGNPGPKTVGNWFKIVKFGSGYK  167

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
             VFCPSVC  C+V+C DVG+++   G +FLALSD+P  VKFK+ F
Sbjct  168  FVFCPSVCKFCKVICKDVGVFM-KDGVRFLALSDTPFEVKFKKTF  211



>ref|XP_004241479.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=200

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+F+TPT+C+ ET+W++G YD+ LK+YF+VTGGVEGNPG +T+ NWFKIE+  S YK
Sbjct  96   DVNVRFYTPTICARETIWKLGDYDDKLKKYFVVTGGVEGNPGLKTVGNWFKIERFGSGYK  155

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
            +V+CPSVC  C+V+C DVGI++   G + LALSD+P  V FK+ F
Sbjct  156  LVYCPSVCKFCKVICKDVGIFITNDGVRLLALSDTPYKVMFKKTF  200



>ref|XP_010537532.1| PREDICTED: miraculin [Tarenaya hassleriana]
Length=202

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D NVKF   T+C   TVW++  +DE  K++F+ TGGVEGNPG ETI+NWFKIEKL +DYK
Sbjct  100  DQNVKFSAATICVQSTVWKLESFDETTKQWFVTTGGVEGNPGRETISNWFKIEKLGNDYK  159

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC+ C+V+C D+G++V   G + LALSD PL V FKRA
Sbjct  160  LVFCPTVCNFCKVICRDIGVFV-QDGKRRLALSDVPLKVMFKRA  202



>gb|ACS92516.1| Kunitz-type protease inhibitor KPI-D12 [Populus trichocarpa x 
Populus deltoides]
Length=206

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F   ++C   T W++G YDE  K++F+ T GVEGNPGPET  NWFKIEK E  YK
Sbjct  103  DLNIRFSAASICHQSTAWKLGSYDEWTKQWFVTTNGVEGNPGPETTNNWFKIEKFEDKYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+V+C D+GIYV   G + LALS  PL V FK+A
Sbjct  163  LVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALSSVPLKVMFKKA  206



>ref|XP_010101167.1| hypothetical protein L484_005403 [Morus notabilis]
 gb|EXB87528.1| hypothetical protein L484_005403 [Morus notabilis]
Length=197

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +DE L ++F+ +GGVEGNPG +TI+NWFKIEK   DYK
Sbjct  95   DLNIKFSAATTCAQSTVWKLDSFDESLGQWFVTSGGVEGNPGRQTISNWFKIEKYNDDYK  154

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC+ C+V+C DVGIY+   G + LALSD P +V FKRA
Sbjct  155  LVFCPTVCNFCKVLCRDVGIYI-KDGIRRLALSDQPFIVGFKRA  197



>ref|XP_010041216.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=175

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV      +C + TVWR+G Y+E +K+YF+ +GGV GNPG ETI+NWFKIEK++ DYK
Sbjct  58   DLNVWLDAAKICMHSTVWRLGAYNEEVKQYFVESGGVLGNPGRETISNWFKIEKVDEDYK  117

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+V+C DVG+YV  G T+ LALSD P  V FK+A
Sbjct  118  LVFCPTVCDTCKVICRDVGVYV-DGATRRLALSDEPFRVMFKKA  160



>ref|XP_006372633.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
 gb|ERP50430.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
Length=206

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F   ++C   T W++  YDE  K++F+ T GVEGNPGPET  NWFKIEK E  YK
Sbjct  103  DLNIRFSAASICHQSTAWKLDNYDEWTKQWFVTTDGVEGNPGPETTNNWFKIEKFEDKYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+V+C D+GIYV   G + LAL++ PL V FK+A
Sbjct  163  LVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTNVPLKVMFKKA  206



>ref|XP_006372632.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
 gb|ERP50429.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
Length=206

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F   ++C   T W++  YDE  K++F+ T GVEGNPGPET  NWFKIEK E  YK
Sbjct  103  DLNIRFSAASICHQSTAWKLDNYDEWTKQWFVTTDGVEGNPGPETTNNWFKIEKFEDKYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+V+C D+GIYV   G + LAL++ PL V FK+A
Sbjct  163  LVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTNVPLKVMFKKA  206



>ref|XP_010041215.1| PREDICTED: miraculin-like [Eucalyptus grandis]
 gb|KCW44534.1| hypothetical protein EUGRSUZ_L01961 [Eucalyptus grandis]
Length=203

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV F   T+C   TVWR+  +DE +K+YF+ +GGV GNPG ET++NWFKIEK++ DY 
Sbjct  101  DLNVWFDAATICVQSTVWRLAAFDEEVKQYFVESGGVLGNPGRETVSNWFKIEKMDEDYN  160

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
              FCP+VC  C+V+C DVGIYV  G T+ LALSD P  VKFK+A
Sbjct  161  FRFCPTVCDTCKVICRDVGIYV-DGATRRLALSDEPFRVKFKKA  203



>ref|XP_006372654.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
 gb|ERP50451.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
Length=206

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F   ++C   T W++  YDE  K++F+ T GVEGNPGPET  NWFKIEK E  YK
Sbjct  103  DLNIRFSAGSICHQSTAWKLDNYDEWTKQWFVTTDGVEGNPGPETTNNWFKIEKFEDKYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+V+C D+GIYV   G + LAL++ PL V FK+A
Sbjct  163  LVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTNVPLKVMFKKA  206



>gb|ADW95380.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=210

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF  P  C+   VW+V KYDE+  + FI T GVEGNPGPET+ NWFKIEK  +DYK
Sbjct  106  DLNIKFPGPASCAATAVWKVEKYDELTSQMFISTSGVEGNPGPETVDNWFKIEKYGNDYK  165

Query  182  IVFCPSVCS-ICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +VFCP+VC+  C+V+C D+GIYV   G K LALSD PL VKFK+
Sbjct  166  LVFCPTVCNDHCKVLCKDIGIYVDKEGFKRLALSDVPLKVKFKK  209



>ref|XP_002305034.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
 gb|EEE85545.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
Length=207

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF  P  C+   VW+V KYDE+  + FI T GVEGNPGPET+ NWFKIEK  +DYK
Sbjct  103  DLNIKFPGPASCAATAVWKVEKYDELTSQMFISTSGVEGNPGPETVDNWFKIEKYGNDYK  162

Query  182  IVFCPSVCS-ICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +VFCP+VC+  C+V+C D+GIYV   G K LALSD PL VKFK+
Sbjct  163  LVFCPTVCNDHCKVLCKDIGIYVDKEGFKRLALSDVPLKVKFKK  206



>ref|XP_010042449.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV F   T+C   TVWR+  +DE +K+YFI +GGV GNPG ET++NWFKIEK++ DY 
Sbjct  160  DLNVWFDAATICVQSTVWRLAAFDEEVKQYFIESGGVLGNPGRETVSNWFKIEKVDEDYN  219

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
              FCP+VC  C+V+C DVGIYV  G T+ LALSD P  VKF++A
Sbjct  220  FRFCPTVCDTCRVICRDVGIYVD-GSTRRLALSDEPFRVKFRKA  262



>gb|KCW48670.1| hypothetical protein EUGRSUZ_K02326 [Eucalyptus grandis]
Length=203

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV F   T+C   TVWR+  +DE +K+YF+ +GGV GNPG ET++NWFKIEK++ DY 
Sbjct  101  DLNVWFDAATICVQSTVWRLAAFDEEVKQYFVESGGVLGNPGRETVSNWFKIEKVDEDYN  160

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
              FCP+VC  C+V+C DVGIYV  G T+ LALSD P  VKF++A
Sbjct  161  FRFCPTVCDTCRVICRDVGIYV-DGSTRRLALSDEPFRVKFRKA  203



>gb|AEK26927.1| Kunitz-type trypsin inhibitor B4 [Populus nigra]
Length=211

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF  P  C+   VW+V KYD++  + FI T GVEGNPGPET+ NWFKIEK  +DYK
Sbjct  107  DLNIKFPGPASCAATAVWKVEKYDKLTSQMFISTSGVEGNPGPETVDNWFKIEKYGNDYK  166

Query  182  IVFCPSVCS-ICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +VFCP+VC+  C+V+C D+GIYV   G K LALSD PL VKFK+
Sbjct  167  LVFCPTVCNDHCKVLCKDIGIYVDKEGFKRLALSDVPLKVKFKK  210



>ref|XP_010037029.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV F   T+C   TVWR+  +DE +K+YF+ +GGV GNPG ET++NWFKIEK++ DY 
Sbjct  160  DLNVWFDAATICVQSTVWRLAAFDEEVKQYFVESGGVLGNPGRETVSNWFKIEKVDEDYN  219

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
              FCP+VC  C+V+C DVGIYV  G T+ LALSD P  VKF++A
Sbjct  220  FRFCPTVCDTCRVICRDVGIYVD-GSTRRLALSDEPFRVKFRKA  262



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   T+W++  +D+  +++F+ TGGVEGNPG ETI NWFKIEK E DYK
Sbjct  93   DQNIKFSAATICVQPTLWKLDSFDDSTRQWFVTTGGVEGNPGRETIDNWFKIEKYEDDYK  152

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+V+C DVG+++  GG + LALSD P  V FKRA
Sbjct  153  LVFCPTVCDFCKVMCRDVGVFI-DGGVRRLALSDVPFKVMFKRA  195



>gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana]
Length=205

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   ++C   T+W++  +DE   +YFI  GG EGNPG ETI+NWFKIEK E DYK
Sbjct  103  DLNIKFSAASICVQTTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEKFERDYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC+ C+V+C D+GI++   GT+ LALSD P  V FK+A
Sbjct  163  LVYCPTVCNFCKVICKDIGIFI-QDGTRRLALSDVPFKVMFKKA  205



>dbj|BAA05474.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=125

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   ++C   T+W++  +DE   +YFI  GG EGNPG ETI+NWFKIEK E DYK
Sbjct  23   DLNIKFSAASICVQTTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEKFERDYK  82

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC+ C+V+C DVGI++   G + LALSD P  V FK+A
Sbjct  83   LVYCPTVCNFCKVICKDVGIFI-QDGIRRLALSDVPFKVMFKKA  125



>ref|XP_011046091.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F   ++C   T W++  YDE  K++F+ T GVEGNPG ET  NWFKIEKLE  YK
Sbjct  103  DLNIRFSAASICQQSTAWKLDSYDEWTKQWFVTTNGVEGNPGSETTNNWFKIEKLEDKYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V CP+VC  C+V+C D+GIYV   G + LAL   PL V FK+A
Sbjct  163  LVVCPTVCQHCKVMCKDIGIYVDAIGVRRLALGGVPLKVMFKKA  206



>ref|XP_009627067.1| PREDICTED: miraculin [Nicotiana tomentosiformis]
Length=205

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   ++C   T+W++  +DE   +YFI  GG EGNPG ETI+NWFKI+K E DYK
Sbjct  103  DLNIKFSAASICVQTTLWKLDDFDEATGKYFITIGGNEGNPGRETISNWFKIDKFERDYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC+ C+V+C DVGI++   GT+ LALSD P  V FK A
Sbjct  163  LVYCPTVCNFCKVICKDVGIFI-QDGTRRLALSDVPFKVMFKNA  205



>gb|KCW48668.1| hypothetical protein EUGRSUZ_K02323 [Eucalyptus grandis]
Length=179

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +2

Query  29   TVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCS  208
             +C + TVWR+G Y+E +K+YF+ +GGV G+PG ETI+NWFKIEK++ DYK+VFCP+VC 
Sbjct  71   AICMHSTVWRLGAYNEEVKQYFVESGGVLGSPGRETISNWFKIEKVDEDYKLVFCPTVCD  130

Query  209  ICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             C+V+C DVG+YV  G T+ LALSD P  V FK+A
Sbjct  131  TCKVICRDVGVYV-DGATRRLALSDEPFRVMFKKA  164



>gb|AAC49969.1| tumor-related protein [Nicotiana tabacum]
Length=210

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   ++C   T+W++  +DE   +YFI  GG EGNPG ETI+NWFKIEK E DYK
Sbjct  103  DLNIKFSAASICVQTTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEKFERDYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC+ C+V+C DVGI++   G + LALSD P  V FK+A
Sbjct  163  LVYCPTVCNFCKVICKDVGIFI-QDGIRRLALSDVPFKVMFKKA  205



>ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris]
Length=210

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   ++C   T+W++  +DE   +YFI  GG EGNPG ETI+NWFKIEK E DYK
Sbjct  103  DLNIKFSAASICVQTTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEKFERDYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC+ C+V+C DVGI++   G + LALSD P  V FK+A
Sbjct  163  LVYCPTVCNFCKVICKDVGIFI-QDGIRRLALSDVPFKVMFKKA  205



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T+C   TVW++GK+DE   ++F+ +GGVEGNPG +T +NWFKIEK   DYK
Sbjct  106  DLNIKFSATTICVQSTVWKLGKFDEQTGQWFVTSGGVEGNPGRQTTSNWFKIEKFGDDYK  165

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC+ C+V+C DVGI+    G + LALSD P    FK+A
Sbjct  166  LVFCPTVCNFCKVICRDVGIFF-QDGKRRLALSDVPFRAMFKKA  208



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T C+  TVW++  +D  L ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DFNIKFDAATSCAQSTVWKLDNFDAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +VFCPSVC+ C+ +C DVGI++  GG + LALSD PL V FK+
Sbjct  164  LVFCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPLKVVFKK  205



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            DIN+KF   T C+  TVW++  +D  L ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DINIKFDAATSCAQSTVWKLDNFDAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCPSVC+I + +C DVGI++  GG + LALSD P  V FK+A
Sbjct  164  LVFCPSVCNIFRGLCRDVGIFI-NGGVRRLALSDVPFKVVFKKA  206



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D  L ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DLNIKFDAATSCAQSTVWKLDNFDAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +VFCPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  164  LVFCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPFKVVFKK  205



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D    ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DLNIKFDAATSCAQSTVWKLDNFDTAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +VFCPSVC+ C+ +C DVGI++  GG + LALSD PL V FK+
Sbjct  164  LVFCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPLKVVFKK  205



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D VL ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DLNIKFDAATSCAQSTVWKLDNFDAVLGQWLVTTGGVEGNPGPRTMRNWFKIEKFYGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +VFCPSVC+ C+ +C DVGI++  GG + LALSD PL V FK+
Sbjct  164  LVFCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPLKVVFKK  205


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF         TVW++    +   R   + GGV GNPGP+T  NWF IEK   DYK
Sbjct  270  DLNIKFEVVKTSVQSTVWKLDNLMQYWGRICAI-GGVRGNPGPQTTRNWFMIEKFYGDYK  328

Query  182  IVFCPS  199
            +VF PS
Sbjct  329  LVFYPS  334



>ref|XP_006441436.1| hypothetical protein CICLE_v10023581mg [Citrus clementina]
 gb|ESR54676.1| hypothetical protein CICLE_v10023581mg [Citrus clementina]
Length=187

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D VL ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  85   DLNIKFDAATSCAQSTVWKLDNFDAVLGQWLLTTGGVEGNPGPRTMRNWFKIEKFFGDYK  144

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  145  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPFKVVFKK  186



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D VL ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DLNIKFDAATSCAQSTVWKLDNFDAVLGQWLLTTGGVEGNPGPRTMRNWFKIEKFFGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  164  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPFKVVFKK  205



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T+C   TVW++GK+DE   ++F+ +GGVEGNPG +T +NWFKIEK   DYK
Sbjct  106  DLNIKFSATTICVQSTVWKLGKFDEQTGQWFVTSGGVEGNPGRQTTSNWFKIEKFGDDYK  165

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +VFCP+VC+ C+V+C DVGI+    G + LALSD P    FK+
Sbjct  166  LVFCPTVCNFCKVICGDVGIFF-QDGKRRLALSDVPFRAMFKK  207



>emb|CDP20822.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KFF  T+C   TVW++ ++D  + +Y IV+GG+EGNPG ETI+NWFKIEK + DYK
Sbjct  101  DLNIKFFAATICVQSTVWKL-EFDADISQYVIVSGGIEGNPGRETISNWFKIEKYDQDYK  159

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC+ C+V+C DVGI+V   G + LALSD P  V  K+A
Sbjct  160  LVYCPTVCNFCKVICRDVGIFV-QNGRRRLALSDVPFRVVVKKA  202



>gb|ACV52580.1| endopeptidase inhibitor [Nicotiana benthamiana]
Length=102

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   ++C   T+W++  +DE   +YFI  GG EGNPG ETI+NWFKIEK E DYK
Sbjct  6    DLNIKFSAASICVQTTLWKLDDFDETTGKYFITIGGNEGNPGRETISNWFKIEKFERDYK  65

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPL  292
            +V+CP+VC+ C+V+C D+GI++   GT+ LALSD P 
Sbjct  66   LVYCPTVCNFCKVICKDIGIFI-QDGTRRLALSDVPF  101



>ref|XP_006441457.1| hypothetical protein CICLE_v10024528mg, partial [Citrus clementina]
 gb|ESR54697.1| hypothetical protein CICLE_v10024528mg, partial [Citrus clementina]
Length=105

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D    ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  3    DLNIKFDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYK  62

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  63   LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDIPFKVVFKK  104



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D VL ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  147  DLNIKFDAATSCAQSTVWKLDNFDAVLGQWLLTTGGVEGNPGPRTMRNWFKIEKFFGDYK  206

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  + FK+
Sbjct  207  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPFKIVFKK  248



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            DIN+KF   T C+  TVW++  +D  + ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DINIKFDAATSCAQSTVWKLDNFDAAIGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  164  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPFKVVFKK  205



>ref|XP_006441460.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
 gb|ESR54700.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
Length=153

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D    ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  51   DLNIKFDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYK  110

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  111  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPFKVVFKK  152



>ref|XP_004137639.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64219.1| hypothetical protein Csa_1G043220 [Cucumis sativus]
Length=205

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F   T C   TVW+VGK+DE LK+YF+  GG++GNPG ETI NWFK+EK   +YK
Sbjct  103  DLNIQFEANTRCGISTVWKVGKFDEYLKQYFVTMGGMKGNPGRETIENWFKVEKYGKNYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CP+VC  C+VVC DVG++    G + +AL+D+P  V FK+
Sbjct  163  LVYCPTVCKYCKVVCKDVGLFY-KNGRRVIALNDAPFPVMFKK  204



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 75/104 (72%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   T+W++ +YDE   ++F+ TGGVEGNPG ET+ NWFKIEK E DYK
Sbjct  102  DHNIKFSASTICVQSTLWKL-EYDESSGQWFVTTGGVEGNPGRETLDNWFKIEKYEDDYK  160

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+ VC D+GIY+   G + LALSD P  V FK+A
Sbjct  161  LVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA  203



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D  L ++ + TGGVEGNPGP T+ NWFKIEK   +YK
Sbjct  104  DLNIKFDAATSCAQSTVWKLDNFDAALGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGNYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  164  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPFKVVFKK  205



>ref|XP_004299457.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=218

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 78/107 (73%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    DINVKFFTP---TVCSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE  169
            D+N+KF T    T+C N + VW++   DE   + F+ TGGVEGNPGP+TI+NWFKIEK +
Sbjct  112  DLNIKFSTSAAVTICLNTSKVWKLDNLDESTGQRFVTTGGVEGNPGPKTISNWFKIEKYD  171

Query  170  SDYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
             DYK+VFCP+VC+ C+V+C DVGIY+  GG + L LS  PL V FKR
Sbjct  172  KDYKLVFCPTVCNFCKVICGDVGIYL-EGGVRRLVLSKVPLKVMFKR  217



>ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera]
Length=162

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   T+W++ +YDE   + F+ TGGVEGNPG ET+ NWFKIEK E DYK
Sbjct  61   DHNIKFSASTICVQSTLWKL-EYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYK  119

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+ VC D+GIY+   G + LALSD P  V FK+A
Sbjct  120  LVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA  162



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D    ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DLNIKFDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  164  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPFKVVFKK  205



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D    ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DLNIKFDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  164  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDIPFKVVFKK  205



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   T+W++ +YDE   + F+ TGGVEGNPG ET+ NWFKIEK E DYK
Sbjct  102  DHNIKFSASTICVQSTLWKL-EYDESSGQRFVTTGGVEGNPGXETLDNWFKIEKYEDDYK  160

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+ VC D+GIY+   G + LALSD P  V FK+A
Sbjct  161  LVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA  203



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   T+W++ +YDE   + F+ TGGVEGNPG ET+ NWFKIEK E DYK
Sbjct  102  DHNIKFSASTICVQSTLWKL-EYDESSGQRFVTTGGVEGNPGHETLDNWFKIEKYEDDYK  160

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+ VC D+GIY+   G + LALSD P  V FK+A
Sbjct  161  LVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA  203



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D    ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DLNIKFDAATSCAQSTVWKLDNFDAAFGQWVVTTGGVEGNPGPRTMRNWFKIEKFFGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  164  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPFKVVFKK  205



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T+C   TVW++   DE  ++  + TGGVEGNPG ET++NWFKIE+ E DYK
Sbjct  97   DLNIKFSAATICVQSTVWKL-DNDEATQKMVVTTGGVEGNPGIETLSNWFKIERYEDDYK  155

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP VC  C+ VC D+G+++   G + LALSD PL V FKRA
Sbjct  156  LVFCPGVCDFCRPVCGDLGVFI-DAGIRRLALSDVPLKVMFKRA  198



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C+  TVW++ +YDE   + FI TGGVEGNPG  T++NWFKIEK   DYK
Sbjct  103  DHNIKFSAATICAQSTVWKL-EYDESTGQRFITTGGVEGNPGRGTLSNWFKIEKYGDDYK  161

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC+ C+V+C DVG+Y+  G  +    +D+P  V FK+A
Sbjct  162  LVFCPTVCNFCKVICRDVGVYIQKGYRRLALTTDAPFRVMFKKA  205



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 72/103 (70%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            DIN+K    T C+  TVW++  +D    ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DINIKLDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V FK+
Sbjct  164  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDIPFKVVFKK  205



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   T+W++ +YDE   + F+ TGGVEGNPG ET+ NWFKIEK E DYK
Sbjct  102  DHNIKFSASTICVQSTLWKL-EYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYK  160

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+ VC D+GIY+     + LALSD P  VKFK+A
Sbjct  161  LVFCPTVCDFCKPVCGDIGIYI-QNEYRRLALSDVPFKVKFKKA  203



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   T+W++ +YDE   + F+ TGGVEGNPG ET+ NWFKIEK + DYK
Sbjct  102  DHNIKFSASTICVQSTLWKL-EYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYDDDYK  160

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+ VC D+GIY+   G + LALSD P  V FK+A
Sbjct  161  LVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA  203



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   TVW++  YD    +YFI TGGVEG PG ETI+NWFKIE    DYK
Sbjct  103  DQNIKFSGATICVQSTVWKLDNYDASTGKYFITTGGVEGKPGRETISNWFKIETYGDDYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC+ C+V+C DVGI++  G  +     D+P  V  K+A
Sbjct  163  LVFCPTVCNYCKVICKDVGIFMQDGKRRLALTEDAPFRVMLKKA  206



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C   T W++  +DE   +YFI  GG +GNPG ET++NW KIEK + DYK
Sbjct  103  DLNIIFSANSICVQTTQWKLDDFDETTGQYFITLGGTQGNPGRETVSNWIKIEKFDRDYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +++CP+VC IC+V+C D+GI++   G + LALSD+P  V FK+A
Sbjct  163  LLYCPTVCDICKVICKDIGIFI-QDGVRRLALSDAPFKVMFKKA  205



>ref|XP_008437082.1| PREDICTED: miraculin [Cucumis melo]
Length=207

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F   T C   TVW+VGK+D+ LK+YF+  GG +GNPG ETI NWFK+EK   +YK
Sbjct  103  DLNIEFEASTRCGISTVWKVGKFDQYLKQYFVTMGGTKGNPGRETIGNWFKVEKHGKNYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
             V+CP+VC  C+V+C DVG++    G +  AL+D+P  V FK+
Sbjct  163  FVYCPTVCKYCKVMCKDVGLFY-KNGRRIFALNDAPFPVMFKK  204



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   T+W++ +YDE   + F+ TGGVEGNPG ET+ NWFKIEK E DYK
Sbjct  124  DHNIKFSASTICVQSTLWKL-EYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYK  182

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+ VC D+GIY+     + LALSD P  V FK+A
Sbjct  183  LVFCPTVCDFCKPVCGDIGIYI-QNEYRRLALSDVPFKVMFKKA  225



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   T+W++ +YDE   + F+ TGGVEGNPG ET+ NWFKIEK E DYK
Sbjct  102  DHNIKFSASTICVQSTLWKL-EYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYK  160

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+ VC D+GIY+     + LALSD P  V FK+A
Sbjct  161  LVFCPTVCDFCKPVCGDIGIYI-QNXYRRLALSDVPFKVMFKKA  203



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D    ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DLNIKFDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVV  298
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD P  V
Sbjct  164  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSDVPFKV  201



>ref|NP_173228.1| kunitz family trypsin and protease inhibitor protein [Arabidopsis 
thaliana]
 gb|AAF97266.1|AC034106_9 Contains similarity to a tumor-related protein from Nicotiana 
tabacum gb|U66263 and contains a trypsin and protease inhibitor 
PF|00197 domain. ESTs gb|AV561824, gb|T44961, gb|H36186, 
gb|T45060, gb|N38006, gb|F19847 come from this gene [Arabidopsis 
thaliana]
 gb|AAG48779.1|AF332416_1 putative lemir (miraculin) protein [Arabidopsis thaliana]
 gb|AAK48962.1|AF370535_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK95260.1|AF410274_1 At1g17860/F2H15_8 [Arabidopsis thaliana]
 gb|AAM10091.1| unknown protein [Arabidopsis thaliana]
 gb|AAM19885.1| At1g17860/F2H15_8 [Arabidopsis thaliana]
 gb|AEE29645.1| kunitz type trypsin and protease inhibitor domain-containing 
protein [Arabidopsis thaliana]
Length=196

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF +PT     ++W +  +DE  K++FI T GVEGNPG +T+ NWFKI+K E DYK
Sbjct  99   DVNIKF-SPT-----SIWELANFDETTKQWFISTCGVEGNPGQKTVDNWFKIDKFEKDYK  152

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
            I FCP+VC+ C+V+C DVG++V  G  + LALSD PL V FKRA+
Sbjct  153  IRFCPTVCNFCKVICRDVGVFVQDGKRR-LALSDVPLKVMFKRAY  196



>ref|XP_008437058.1| PREDICTED: miraculin-like [Cucumis melo]
Length=205

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+F   T+C   TVW++ K+DE   ++F+  GG  GNPG ET+ NWFKIEK   DYK
Sbjct  103  DLNVQFDASTICVTSTVWKLDKFDESTGQWFVTIGGSRGNPGVETVDNWFKIEKHGKDYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +VFCP+VC+ C+V+C D+GI+    G + LALSD+P  V FK+
Sbjct  163  LVFCPTVCNFCKVMCRDIGIFF-KNGKRALALSDTPFPVMFKK  204



>ref|XP_003534081.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F   T CS   VW++  +D   +++F+ TGGV G+P   TI+NWFKIEK + DYK
Sbjct  112  DLNIEFSMQTSCSQSNVWKIDHFDRATRKWFVTTGGVVGHPSWRTISNWFKIEKYDGDYK  171

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V CP+ C+ C+V C D+G+Y    G K LAL+D+P  V+F++A
Sbjct  172  LVSCPTFCAYCKVQCRDIGVYEDQNGNKRLALTDAPYKVRFQKA  215



>gb|KHM99737.1| Miraculin [Glycine soja]
Length=215

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F   T CS   VW++  +D   +++F+ TGGV G+P   TI+NWFKIEK + DYK
Sbjct  112  DLNIEFSMQTSCSQSNVWKIDHFDRATRKWFVTTGGVVGHPSWRTISNWFKIEKYDGDYK  171

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V CP+ C+ C+V C D+G+Y    G K LAL+D+P  V+F++A
Sbjct  172  LVSCPTFCAYCKVQCRDIGVYEDQNGNKRLALTDAPYKVRFQKA  215



>emb|CBI35466.3| unnamed protein product [Vitis vinifera]
Length=119

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D  +KF T T C   TVW++ +YD+  ++ F+ TGGVE NP  + ++NWF+IEK E DYK
Sbjct  3    DHKIKFSTTTTCVQSTVWKLDEYDQSTRKLFVTTGGVERNPSIQNLSNWFRIEKYEDDYK  62

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAFPF  322
            +VF P+ C  C+ +C D+ IY+   G K LALSD PL V FKRA  +
Sbjct  63   LVFYPTTCDFCRPICGDIDIYIQ-DGYKRLALSDVPLKVMFKRALSW  108



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C   T W++  +DE   +YFI  GG +GNPG ETI+NWFKIEK + DYK
Sbjct  103  DLNIIFSANSICVQTTQWKLDDFDETTGQYFITLGGDQGNPGVETISNWFKIEKYDRDYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +++CP+VC  C+V+C D+GI++   G + LALSD P  V FK+A
Sbjct  163  LLYCPTVCDFCKVICRDIGIFI-QDGVRRLALSDVPFKVMFKKA  205



>ref|XP_009401850.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=203

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKL-ESDY  178
            D+NV F   T+C   TVWR+G  +   +RY +VTGG++G+PG  T++NWFKIE+  ESDY
Sbjct  95   DLNVWFAAETICVQSTVWRLGDAEATGRRY-VVTGGLKGDPGLATVSNWFKIERYGESDY  153

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            K+V CPSVC  C+VVC DVG++V  GG ++L LSD P  V FK A
Sbjct  154  KLVHCPSVCRFCKVVCGDVGVFV-EGGKRWLGLSDEPFPVMFKNA  197



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C+  TVW++  +D    ++ + TGGVEGNPGP T+ NWFKIEK   DYK
Sbjct  104  DLNIKFDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
            +V+CPSVC+ C+ +C DVGI++  GG + LALSD
Sbjct  164  LVYCPSVCNFCRGLCRDVGIFI-NGGVRRLALSD  196



>gb|AAQ96377.1| miraculin-like protein [Solanum palustre]
Length=209

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C   T W++  +DE   +YFI  GG +GNPG ETI+NWFKIEK + DYK
Sbjct  107  DLNIIFSANSICVQTTQWKLDDFDETTGQYFITLGGNQGNPGRETISNWFKIEKFDRDYK  166

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +++CP+VC  C+V+C ++GI++   G + LALSD P  V FK+A
Sbjct  167  LLYCPTVCDFCKVICKEIGIFI-QDGVRRLALSDVPFKVMFKKA  209



>ref|XP_004137534.1| PREDICTED: miraculin-like [Cucumis sativus]
 ref|XP_004165460.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64217.1| Tumor-related protein [Cucumis sativus]
Length=206

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NV+F   T+C   TVW++ K+DE   ++ +  GG  GNPG ET+ NWFKIEK   DYK
Sbjct  104  DLNVQFEASTICVTSTVWKLDKFDESTGQWLVTIGGSRGNPGVETVDNWFKIEKHGKDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +VFCP+VC+ C+V+C D+GI+    G + LALSD+P  V FK+
Sbjct  164  LVFCPTVCNFCKVMCRDIGIFF-KNGERALALSDTPFPVMFKK  205



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   ++C   TVW++ K      ++F+ TGGVEGNPG ETI NWFKIEK + DYK
Sbjct  104  DLNIKFSASSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETITNWFKIEKADDDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKR  310
            +VFCP+VC  C  +C DVGIY+   G + L+LSD+  P +V FK+
Sbjct  164  LVFCPTVCD-CGALCRDVGIYIHDNGVRTLSLSDALQPFLVNFKK  207



>emb|CBI35470.3| unnamed protein product [Vitis vinifera]
Length=119

 Score =   114 bits (284),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D  +KF T T C   TVW++ +YD+  ++ F+ TGG E NP  + ++NWF+IEK E DYK
Sbjct  3    DHKIKFSTTTTCVQSTVWKLNEYDQSTRKLFVTTGGFERNPSIQNLSNWFRIEKYEDDYK  62

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAFPF  322
            +VF P+ C  C+ +C D+ IY+   G K LALSD PL V FKRA  +
Sbjct  63   LVFYPTTCDFCRPICGDIDIYIQ-DGYKRLALSDVPLKVMFKRALSW  108



>ref|XP_006372631.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ERP50428.1| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=209

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C   TVW++ K      ++F+ TGGVEGNPG  T+ NWF+IEK + DYK
Sbjct  99   DLNIKFLAKTTCPQSTVWKITKSSNSKVQWFVSTGGVEGNPGFNTVTNWFQIEKADDDYK  158

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKRAF  316
            IVFCP+    C V+C D+GIY+   GT+ L+LSD+  P  V+FK+A 
Sbjct  159  IVFCPTKVCNCGVLCRDIGIYIEDNGTRTLSLSDALQPFKVQFKKAL  205



>emb|CDO98552.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D NVKF + + C+  +VW++ + D +  +YF+  GGVEGNPGP+T+++WFKIE  +  YK
Sbjct  103  DTNVKFSSTSKCAQSSVWKLSELDALTGKYFVGIGGVEGNPGPKTLSSWFKIETFDRSYK  162

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            + FCPSVC  C+V+C D+GI V   G + LALSD P  V FKR
Sbjct  163  LKFCPSVCKFCKVICKDIGI-VFQNGKRRLALSDDPFKVIFKR  204



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    DINVKF--FTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKL--E  169
            D+N+ F  F P   ++ TVWR+ KYDE   +YF+  GGV+GNPGPETI++WFKIE+    
Sbjct  110  DLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGS  169

Query  170  SDYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAFPF  322
              YK+VFCP+VC  C+V C DVGIY+   G + LALSD P   +F +   F
Sbjct  170  GFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF  220



>ref|XP_003622420.1| Endopeptidase inhibitor [Medicago truncatula]
 gb|AES78638.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=205

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNE--TVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD  175
            D+NV    PT CS    TVW+V K D    + F+ TGGV+GNPG ET+ NWFKIE+ ES 
Sbjct  97   DLNVIHSFPTNCSTSSVTVWKVDKVDVATSQRFVTTGGVQGNPGRETVDNWFKIERFESG  156

Query  176  YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            YK+VFCP+VC  C+VVC D+GI++         LSD P  VKF+RA
Sbjct  157  YKLVFCPTVCRECEVVCKDIGIFLDENRNTRFVLSDFPFGVKFQRA  202



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   ++C   TVW++ K      ++F+ TGGVEGNPG ETI NWFKIEK   DYK
Sbjct  104  DLNIKFSASSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETITNWFKIEKAGDDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKR  310
            +VFCP+VC  C  +C DVGIY+   G + L+LSD+  P +V FK+
Sbjct  164  LVFCPTVCD-CGALCRDVGIYIHDNGVRTLSLSDALQPFLVNFKK  207



>ref|XP_006347379.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=204

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNE-TVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+  F+   C ++ TVW++  YD    +YFI  GGVEGNP P+TI NWFKIEK    Y
Sbjct  97   DLNIAIFSTHGCGDQSTVWQLETYDSKTGKYFIKDGGVEGNPDPKTIRNWFKIEKYGHGY  156

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            K V+CPSVCS C+V+C DVG+Y+   G + LALS+ PLV  FK+
Sbjct  157  KFVYCPSVCSKCKVICKDVGVYM-KNGQRRLALSNVPLVFNFKK  199



>ref|XP_011046090.1| PREDICTED: miraculin-like [Populus euphratica]
Length=209

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C + TVW++ K      ++F+ TGGVEGNPG  T+ NWF+IEK + DYK
Sbjct  99   DLNIKFLDKTTCPHSTVWKIIKSSNSKVQWFVSTGGVEGNPGFNTVGNWFQIEKADDDYK  158

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKRAF  316
            +VFCP+    C V+C D+GIY+   GT+ L+LSD+  P  V+FK+A 
Sbjct  159  LVFCPTKVCKCGVLCRDIGIYIEDNGTRTLSLSDALQPFKVQFKKAL  205



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   ++C   TVW++ K      ++F+ TGGVEGNPG ETI NWFKIEK   DYK
Sbjct  104  DLNIKFSASSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETITNWFKIEKAGDDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKR  310
            +VFCP+VC  C  +C DVGIY+   G + L+LSD+  P +V FK+
Sbjct  164  LVFCPTVCD-CGALCRDVGIYIHDNGVRTLSLSDALQPFLVNFKK  207



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   ++C   TVW++ K      ++F+ TGGVEGNPG ETI NWFKIEK   DYK
Sbjct  104  DLNIKFSASSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETITNWFKIEKAGDDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKR  310
            +VFCP+VC  C  +C D+GIY+   G + L+LSD+  P +V FK+
Sbjct  164  LVFCPTVCD-CGALCRDIGIYIHDNGVRTLSLSDALQPFLVNFKK  207



>emb|CBI35471.3| unnamed protein product [Vitis vinifera]
Length=2095

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +2

Query  2     DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
             D N+KF   T+C   T+W++ +YDE   + F+ TGGVEGNPG ET+ NWFKIEK E DYK
Sbjct  1994  DHNIKFSASTICVQSTLWKL-EYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYEDDYK  2052

Query  182   IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             +VFCP+VC  C+ VC D+GIY+   G + LALSD P  V FK+A
Sbjct  2053  LVFCPTVCDFCKPVCGDIGIYI-QNGYRRLALSDVPFKVMFKKA  2095



>gb|AEK26936.1| Kunitz-type trypsin inhibitor B3 [Populus nigra]
Length=209

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C   TVW++ K      ++F+ TGGVEGNPG  T+ NWF+IEK + DYK
Sbjct  99   DLNIKFLAKTTCPQSTVWKIIKSSNSKVQWFVSTGGVEGNPGFNTVTNWFQIEKADDDYK  158

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKRAF  316
            +VFCP+    C V+C D+GIY+   GT+ L+LSD+  P  V+FK+A 
Sbjct  159  LVFCPTKVCNCGVLCRDIGIYIEDNGTRTLSLSDALQPFKVQFKKAL  205



>gb|ADW95389.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=209

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF   T C   TVW++ K      ++F+ TGGVEGNPG  T+ NWF+IEK + DYK
Sbjct  99   DLNIKFLAKTTCPQSTVWKIIKSSNSKVQWFVSTGGVEGNPGFNTVTNWFQIEKADDDYK  158

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKRAF  316
            +VFCP+    C V+C D+GIY+   GT+ L+LSD+  P  V+FK+A 
Sbjct  159  LVFCPTKVCNCGVLCRDIGIYIEDNGTRTLSLSDALQPFKVQFKKAL  205



>ref|XP_009758946.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=221

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 76/112 (68%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+N+ FF  T+C   T W++G  DE+  R ++++GG+ G PG ET++NWF+IE++ +   
Sbjct  110  DLNIVFFAATICVQSTAWKLGGADEITGRRYVMSGGMTGRPGLETVSNWFRIERIANGSS  169

Query  176  -----YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
                 YKIVFCP VC+ C+VVC +VG++    G ++L L+D PLVV+FK+  
Sbjct  170  INNGYYKIVFCPGVCNNCKVVCGNVGVF-NENGKRWLGLNDEPLVVRFKKVL  220



>dbj|BAA82843.1| miraculin homologue [Solanum melongena]
Length=160

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C   T W++  +DE   +YFI  GG +GNPG ETI+NWFKIEK E DYK
Sbjct  68   DLNIIFSANSICVQTTQWKLDNFDETTGKYFITLGGNQGNPGRETISNWFKIEKFERDYK  127

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
            +V+CP+VC  C+V+C D+GI++   G + LALSD
Sbjct  128  LVYCPTVCDFCKVICKDIGIFI-QDGVRRLALSD  160



>ref|XP_010476950.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 73/104 (70%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF      S+ ++W +  +DE  ++ FI T GVEGNPG  T+ NWFKI+K ++DYK
Sbjct  99   DQNIKF------SSTSIWELADFDEATRQNFISTCGVEGNPGQTTVDNWFKIDKFDNDYK  152

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            I FCP+VC+ C+V+C DVG++V  G  + LALSD PL V FKRA
Sbjct  153  IRFCPTVCNFCKVICRDVGVFVQDGKRR-LALSDVPLKVMFKRA  195



>gb|AHJ25677.1| Kunitz-type trypsin inhibitor [Curcuma longa]
Length=213

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 70/107 (65%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKL-ESDY  178
            D+NV+F   T+C   TVWR+G  D    R ++++GGVEG+PG  T +NWFKIE+  E DY
Sbjct  104  DLNVRFSAATICVQSTVWRLGDVDASTGRRYVISGGVEGSPGAGTASNWFKIERYGERDY  163

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAFP  319
            K+V CPSVC  C+VVC D+G++V  G  ++L L   P  V F  A P
Sbjct  164  KLVHCPSVCQDCKVVCGDLGVFV-EGENRWLGLDGDPFPVMFTNAHP  209



>ref|XP_010683192.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=211

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES---  172
            D+N+ F   T+C   T W +  +DE     ++  GG  GNPG +T++NWF IEK  S   
Sbjct  106  DVNIVFDAATICVQPTGWML-AFDEASGTRYVGIGGTIGNPGVDTLSNWFAIEKAGSGLY  164

Query  173  DYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            DYKI FCP+VC  C V+C DVG+++G GGT+FLAL+D PL+V+FK+A
Sbjct  165  DYKIRFCPAVCIFCTVMCGDVGVFIGEGGTRFLALTDRPLLVRFKKA  211



>ref|XP_009601782.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=221

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKL-----  166
            D+N+ F T T+C   T W++G  DE+  R ++++GG+ G PG ET++NWF+IE++     
Sbjct  110  DLNIVFLTATICVQSTAWKLGGTDEITGRRYVMSGGMTGRPGLETVSNWFRIERIGNVSS  169

Query  167  --ESDYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
                 YKIVFCP VC+ C+VVC +VG++    G ++L L+D PLVV+FK+  
Sbjct  170  INNGYYKIVFCPGVCNNCKVVCGNVGVF-NENGKRWLGLNDEPLVVRFKKVL  220



>ref|XP_010249125.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=211

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 7/110 (6%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F   T+    TVW++G++D   +++F+ T G  GNPGPET+++WFKIE  E DYK
Sbjct  103  DLNIRFAILTLLPQPTVWKLGEFDPSTQQWFVNTCGALGNPGPETLSSWFKIEPYEEDYK  162

Query  182  IVFCPSVCS------ICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VCS       C+V+C D+GI+    G ++LALSD PL +KF + 
Sbjct  163  LVFCPNVCSFSSPRRFCKVICRDLGIFF-KNGIRYLALSDHPLKIKFNKQ  211



>ref|XP_008437071.1| PREDICTED: miraculin-like [Cucumis melo]
Length=212

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 72/106 (68%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKL-ESDY  178
            D+N++F   T C   TVW++G +D  L++YF+  GG +GNPG ET  NWFKIEK  + +Y
Sbjct  107  DLNIEFDATTRCRKSTVWKLGTFDRYLRQYFVTIGGTKGNPGRETTENWFKIEKYGKGNY  166

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
            K+V+CP VC  C+V+C D+GI+    G + L LSD+P  V FK+ +
Sbjct  167  KLVYCPRVCKYCKVMCKDIGIF-ENNGIRGLVLSDTPFPVIFKKVY  211



>ref|XP_010459406.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 73/104 (70%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF +PT     ++W +  +DE   + FI T GVEGNPG  T+ NWFKI+K ++DYK
Sbjct  99   DQNIKF-SPT-----SIWELANFDEATSQNFISTCGVEGNPGQTTVDNWFKIDKFDNDYK  152

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            I FCP+VC+ C+V+C DVG++V  G  + LALSD PL V FKRA
Sbjct  153  IRFCPTVCNFCKVICRDVGVFVQDGKRR-LALSDVPLKVMFKRA  195



>gb|KHM99742.1| Miraculin, partial [Glycine soja]
Length=146

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   TVW++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  44   DLNIYFPVGTSCPQTTVWKLKDYDYSASQWFVTTGGDFGNPGSQTMANWFKIEKYEDAYK  103

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CPSVC+ C   C D+GIY    G K LALS  P  VKF+RA
Sbjct  104  LVYCPSVCNDCSYPCSDIGIYQDEYG-KRLALSSEPYKVKFQRA  146



>gb|KHM99743.1| Miraculin [Glycine soja]
Length=199

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   TVW++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  97   DLNIYFPVATSCPQTTVWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYK  156

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CPSVC+ C   C D+GIY    G K LALS  P  VKF+RA
Sbjct  157  LVYCPSVCNDCSYPCSDIGIYQDEYG-KRLALSSEPYKVKFQRA  199



>ref|XP_006304577.1| hypothetical protein CARUB_v10011616mg [Capsella rubella]
 gb|EOA37475.1| hypothetical protein CARUB_v10011616mg [Capsella rubella]
Length=195

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF      S  ++W +  +DE   + FI T GVEGNPG  T++NWFKI+K + DYK
Sbjct  99   DQNIKF------SQTSIWELANFDETTSQSFISTCGVEGNPGLTTVSNWFKIDKFDKDYK  152

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            I FCP+VC+ C+V+C DVG++V   G + LALS+ PL V FKRA
Sbjct  153  IRFCPTVCNFCKVICRDVGVFV-QDGMRRLALSEVPLKVMFKRA  195



>ref|XP_002890252.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66511.1| trypsin and protease inhibitor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=196

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF +PT     ++W +  +DE   ++FI T GVEGNPG +T+ NWFKI++ E DYK
Sbjct  99   DQNIKF-SPT-----SIWELANFDERTSQWFISTCGVEGNPGQKTVGNWFKIDEFEKDYK  152

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
            I FCP+VC+ C+V+C DVG++V  G  + LALS+ PL V FK+A+
Sbjct  153  IRFCPTVCNFCKVICRDVGVFVQDGKRR-LALSEVPLKVMFKKAY  196



>gb|KHM99740.1| Miraculin [Glycine soja]
Length=142

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   TVW++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  40   DLNIYFPVATSCPQTTVWKLKDYDYSTSQWFVTTGGDFGNPGSQTMANWFKIEKYEDAYK  99

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CPSVC+ C   C D+GIY    G K LALS  P  VKF RA
Sbjct  100  LVYCPSVCNDCSYPCSDIGIYQDQYG-KRLALSSEPYKVKFLRA  142



>ref|XP_003620188.1| Miraculin [Medicago truncatula]
 gb|AES76406.1| Lipid transfer protein [Medicago truncatula]
Length=213

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+K    T C   T+W +  +D    ++F+ TGGV GNPG +T+ NWFKIEK E DYK
Sbjct  109  DLNIKTSLNTSCEESTIWTLDDFDSSTGQWFVTTGGVLGNPGKDTVDNWFKIEKYEDDYK  168

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFK  307
             VFCP+VC+ C+V+C +VGI+  + G + +AL+D P  V+F+
Sbjct  169  FVFCPTVCNFCKVMCRNVGIFRDSNGNQRVALTDVPYKVRFQ  210



>ref|NP_001238098.1| uncharacterized protein LOC100306134 precursor [Glycine max]
 gb|ACU14169.1| unknown [Glycine max]
 gb|KHN24495.1| Miraculin [Glycine soja]
Length=214

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKF-FTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+K   T T CS  TVW++  +D+   ++F+ TGGV GNPG +TI NWFKIE+ + DY
Sbjct  109  DLNIKTSLTNTSCSESTVWKLDAFDDSTGQWFVTTGGVLGNPGKDTIDNWFKIEEYDDDY  168

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFK  307
            K+VFCP+VC+ C+ +C +VG++  + G + +AL+D P  V+F+
Sbjct  169  KLVFCPTVCNFCKPLCRNVGVFRDSNGNQRVALTDEPYKVRFQ  211



>emb|CDY19181.1| BnaC05g13820D [Brassica napus]
Length=192

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 71/104 (68%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N KF     C+  +VW +  YDE   ++F+   GVEGNPG  T+ NWFKIEK E DYK
Sbjct  96   DLNFKF-----CA-ASVWNLDNYDEKTNQWFVTACGVEGNPGQATVDNWFKIEKYEDDYK  149

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            IVFCP+VC+ C+V+C DVG++V   G + L LSD PL V FK+A
Sbjct  150  IVFCPTVCNFCKVMCRDVGVFV-QDGMRRLVLSDVPLKVMFKKA  192



>ref|XP_009110379.1| PREDICTED: miraculin-like [Brassica rapa]
Length=195

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 69/104 (66%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N KF      S  +VW +   DE   ++FI T GVEGNPG  T+ NWFKI+K E  YK
Sbjct  99   DLNFKF------SATSVWNLDNVDEKTNQWFIGTCGVEGNPGRTTVGNWFKIDKYEDHYK  152

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            IVFCPSVC IC+V+C DVG++V   G + L LSD PL V FKRA
Sbjct  153  IVFCPSVCDICRVMCRDVGVFV-QDGIRRLVLSDVPLKVMFKRA  195



>gb|AFK41478.1| unknown [Medicago truncatula]
Length=213

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+K    T C   T+W +  +D    ++F+ TGGV GNPG +T+ NWFKIEK E DYK
Sbjct  109  DLNIKTSLNTSCEESTIWTLDDFDSSTGQWFVTTGGVLGNPGKDTVDNWFKIEKYEDDYK  168

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFK  307
             VFCP+VC+ C+V+C +VGI+  + G + +AL+D P  V+F+
Sbjct  169  FVFCPTVCNFCKVMCRNVGIFRDSNGNQRVALTDVPYKVRFQ  210



>gb|KHM99741.1| Miraculin [Glycine soja]
Length=199

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   TVW++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  97   DLNIYFPVATSCPQTTVWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYK  156

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CPSVC+ C   C D+GIY    G K LALS  P  VKF+RA
Sbjct  157  LVYCPSVCNDCSYPCGDIGIYQDEYG-KRLALSSEPYKVKFQRA  199



>ref|XP_010663911.1| PREDICTED: miraculin-like [Vitis vinifera]
Length=209

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 71/104 (68%), Gaps = 2/104 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N++F   T+C   TVW++ +YDE   + F+ TGGVEGNPG  T++NWFKIEK E D  
Sbjct  108  DHNIEFSAATICIQSTVWKL-EYDESSGQQFVTTGGVEGNPGRGTLSNWFKIEKYEDDNN  166

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +VFCP+VC  C+ VC D+ IY+   G + LALSD P  V FK+A
Sbjct  167  LVFCPTVCDFCKPVCGDIVIYI-QDGYRRLALSDVPFKVMFKKA  209



>ref|NP_001237312.1| uncharacterized protein LOC100527782 precursor [Glycine max]
 gb|ACU16955.1| unknown [Glycine max]
Length=199

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   TVW++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  97   DLNIYFPVGTSCPQTTVWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYK  156

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CPSVC+ C   C D+GIY    G K LALS  P  VKF+RA
Sbjct  157  LVYCPSVCNDCSYPCSDIGIYQDEYG-KRLALSSEPYKVKFQRA  199



>emb|CDX96746.1| BnaA08g22890D [Brassica napus]
Length=195

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 69/104 (66%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N KF      S  ++W +   DE   ++FI T GVEGNPG  T+ NWFKI+K E  YK
Sbjct  99   DLNFKF------SATSIWNLDNVDEKTNQWFIGTCGVEGNPGRTTVGNWFKIDKYEDHYK  152

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            IVFCPSVC IC+V+C DVG++V   G + L LSD PL V FKRA
Sbjct  153  IVFCPSVCDICKVMCRDVGVFV-QDGIRRLVLSDVPLKVMFKRA  195



>gb|KHM99744.1| Miraculin [Glycine soja]
Length=174

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   T W++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  72   DLNIYFPVGTSCPQTTAWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYK  131

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CPSVC+ C   C D+GIY    G K LALS  P  VKF+RA
Sbjct  132  LVYCPSVCNDCSYPCSDIGIYQDEYG-KRLALSSEPYKVKFQRA  174



>ref|XP_006416660.1| hypothetical protein EUTSA_v10008818mg [Eutrema salsugineum]
 gb|ESQ35013.1| hypothetical protein EUTSA_v10008818mg [Eutrema salsugineum]
Length=198

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N KF      S  ++W++  +DE   ++++   GV GNPG +T++NWFKI+K E  YK
Sbjct  102  DLNFKF------SATSIWKLDYFDEATNQWYVSACGVAGNPGQKTVSNWFKIDKFEDAYK  155

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            IVFCPSVC+IC+V+C D+G++V  G  K L LSD PL V FKRA
Sbjct  156  IVFCPSVCNICKVMCRDIGVFVQDGKRK-LVLSDVPLKVVFKRA  198



>ref|XP_010498164.1| PREDICTED: miraculin-like [Camelina sativa]
Length=195

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 72/104 (69%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF +PT     ++W +  +DE   +  I T GVEGNPG  T+ NWFKI+K ++DYK
Sbjct  99   DQNIKF-SPT-----SIWELANFDEATSQNLISTCGVEGNPGQTTVDNWFKIDKFDNDYK  152

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            I FCP+VC+ C+V+C DVG++V   G + LALSD PL V FKRA
Sbjct  153  IRFCPTVCNFCKVICRDVGVFV-QDGKRRLALSDVPLKVMFKRA  195



>ref|XP_003534080.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   TVW++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  97   DLNIYFPVATSCPQTTVWKLKDYDYSTSQWFVTTGGDFGNPGSQTMANWFKIEKYEDAYK  156

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CPSVC+ C   C D+GIY    G K LALS  P  VKF RA
Sbjct  157  LVYCPSVCNDCSYPCSDIGIYQDQYG-KRLALSSEPYKVKFLRA  199



>emb|CDX83886.1| BnaC08g17590D [Brassica napus]
Length=195

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 69/104 (66%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N KF      S  ++W +   DE   ++FI T GVEGNPG  T+ NWFKI+K E  YK
Sbjct  99   DLNFKF------SATSIWNLDNVDEKTNQWFIGTCGVEGNPGRTTVGNWFKIDKYEDHYK  152

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            I+FCPSVC IC+V+C DVG++V   G + L LSD PL V FKRA
Sbjct  153  ILFCPSVCDICRVMCRDVGVFV-QDGIRRLVLSDVPLKVMFKRA  195



>ref|XP_003534079.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   TVW++  YD    + F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  97   DLNIYFPVATSCPQTTVWKLKDYDYSTSQRFVTTGGDFGNPGSQTVANWFKIEKYEDAYK  156

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CPSVC+ C   C D+GIY    G K LALS  P  VKF+RA
Sbjct  157  LVYCPSVCNDCSYPCGDIGIYQDEYG-KRLALSSEPYKVKFQRA  199



>ref|XP_003534078.1| PREDICTED: miraculin-like [Glycine max]
Length=199

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   T W++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  97   DLNIYFPVGTSCPQTTAWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYK  156

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CPSVC+ C   C D+GIY    G K LALS  P  VKF+RA
Sbjct  157  LVYCPSVCNDCSYPCSDIGIYQDEYG-KRLALSSEPYKVKFQRA  199



>gb|KHM99738.1| Miraculin [Glycine soja]
Length=199

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   T W++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  97   DLNIYFPVGTSCPQTTAWKLKDYDYSTSQWFVTTGGDFGNPGSQTVANWFKIEKYEDAYK  156

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CPSVC+ C   C D+GIY    G K LALS  P  VKF+RA
Sbjct  157  LVYCPSVCNDCSYPCSDIGIYQDEYG-KRLALSSEPYKVKFQRA  199



>ref|XP_006442417.1| hypothetical protein CICLE_v10022911mg [Citrus clementina]
 gb|ESR55657.1| hypothetical protein CICLE_v10022911mg [Citrus clementina]
Length=118

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 68/102 (67%), Gaps = 5/102 (5%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NV+F T T C+  TVWRV  YD    ++FI TGGVEGNPG +T+ NWFK E++  D  
Sbjct  7    DLNVRFSTETRCNEPTVWRVDSYDASRGKWFISTGGVEGNPGAQTLKNWFKFERIGRDRA  66

Query  176  -YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVV  298
             YKIV CPSVC  C  +C+DVG  V     + LAL++ P+V+
Sbjct  67   TYKIVHCPSVCESCVSLCNDVG--VSHDHARRLALTNGPVVL  106



>emb|CDY26209.1| BnaA06g12080D [Brassica napus]
Length=192

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N KF     C+  +VW +  YDE+  ++F+   GV GNPG  T+ NWFKIEK + DYK
Sbjct  96   DLNFKF-----CA-ASVWNLDNYDEMTNQWFVTACGVAGNPGQATVDNWFKIEKYQDDYK  149

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            IVFCP+VC+ C+V+C DVG++V   G + L LSD PL V FK+A
Sbjct  150  IVFCPTVCNFCKVMCRDVGVFV-QDGMRRLVLSDVPLKVMFKKA  192



>ref|XP_009149240.1| PREDICTED: miraculin [Brassica rapa]
Length=192

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N KF     C+  +VW +  YDE   ++F+   GV GNPG  T+ NWFKIEK E DYK
Sbjct  96   DLNFKF-----CA-ASVWNLDNYDETTNQWFVTACGVAGNPGQATVDNWFKIEKYEDDYK  149

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            IVFCP+VC+ C+V+C DVG++V   G + L LSD PL V FK+A
Sbjct  150  IVFCPTVCNFCKVMCRDVGVFV-QDGKRRLVLSDVPLKVMFKKA  192



>ref|XP_010683194.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=208

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES---  172
            D+N  F   T+C   T WR+  +DEV  R ++  GG  GNPG  T++NWFKIEK E+   
Sbjct  103  DLNFVFDAATICVQSTQWRLA-FDEVTGRRYVGFGGEIGNPGGNTVSNWFKIEKAETGKY  161

Query  173  DYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            DYKIVFCP VC+ C+V C ++G++V   G + L +++ PL+V FK+A
Sbjct  162  DYKIVFCPGVCNFCKVACGEIGVFVEKDGRRLLGINNQPLLVMFKKA  208



>ref|XP_004237191.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=221

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 72/108 (67%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+N+ F   T+C   T W+VG  DE   R ++++GG  G PG ETI+NWFKIE+  ++  
Sbjct  114  DLNIVFVASTICVQSTAWKVGGADERTGRRYVMSGGTIGRPGIETISNWFKIERYGNNES  173

Query  176  YKIVFCPSVCSI-CQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
            YKIVFCP VCS  C++VC +VG++    G K+L L D PLVV+FK+  
Sbjct  174  YKIVFCPRVCSSNCKIVCGNVGVF-NENGKKWLGLIDEPLVVRFKKVL  220



>ref|XP_004301214.1| PREDICTED: miraculin-like [Fragaria vesca subsp. vesca]
Length=226

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 7/109 (6%)
 Frame = +2

Query  2    DINVKFFTP---TVC-SNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE  169
            D+N+KF T    T+C     VW++ + DE   +  + TGGVEGNP P+T+ NWFKIEK +
Sbjct  118  DLNIKFSTSAAVTLCPQTSKVWKLDEVDESTGQRSVTTGGVEGNPSPKTLMNWFKIEKYD  177

Query  170  SDYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVVKFKR  310
             DYK+VFCP VC  C+V+C DVG+++ + G + LALSD   PL V FKR
Sbjct  178  DDYKLVFCPKVCRFCRVICGDVGVHLES-GVRRLALSDVIVPLKVMFKR  225



>ref|XP_003620174.1| Pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AES76392.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=213

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+KF +   C + + VW++ +++   +++FI  GGV GNPG ETI NWFKIEK    Y
Sbjct  109  DLNIKFSSRATCLHHSMVWKLDRFNVSKRQWFITIGGVAGNPGWETINNWFKIEKYGDAY  168

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            K+VFCPSV    + +C DVG++V   G K LALSD PL VKF++A
Sbjct  169  KLVFCPSVVQSFKHMCKDVGVFVDENGNKRLALSDVPLKVKFQQA  213



>ref|XP_003620175.1| Pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AAT45389.1| pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AES76393.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=213

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+KF +   C + + VW++ +++   +++FI  GGV GNPG ETI NWFKIEK    Y
Sbjct  109  DLNIKFSSRATCLHHSMVWKLDRFNVSKRQWFITIGGVAGNPGWETINNWFKIEKYGDAY  168

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            K+VFCPSV    + +C DVG++V   G K LALSD PL VKF++A
Sbjct  169  KLVFCPSVVQSFKHMCKDVGVFVDENGNKRLALSDVPLKVKFQQA  213



>gb|KHN24493.1| Miraculin [Glycine soja]
Length=200

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C     W++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  97   DLNIYFPIDTSCPLTKAWKLKDYDNSTSQWFVTTGGDFGNPGSQTLANWFKIEKYEDAYK  156

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
            +V+CPSVC  C   C D+GIY    G K LALS  P  VKF+RA+
Sbjct  157  LVYCPSVCKDCSYPCSDIGIYQDQYG-KRLALSSEPYRVKFQRAY  200



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 73/108 (68%), Gaps = 5/108 (5%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKL-ESDY  178
            D N+KF   T+C   TVWR+   DE   +YF+ TGGVEGNPG  +I+NWFKIE    SDY
Sbjct  104  DHNIKFSASTICVQSTVWRLDN-DESTGKYFVNTGGVEGNPGSGSISNWFKIEAYGSSDY  162

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKF-LALSD--SPLVVKFKRA  313
            K++FCP+VC+ C+V+C DVGI V  G  +  L L+D  +P  + FK+A
Sbjct  163  KLLFCPTVCNFCKVICRDVGIVVQDGKRRLGLTLTDDVTPFPIMFKKA  210



>emb|CDO98557.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F  P  C    VWRV  Y + L   F+  GGV GNPGP T+ +WFKI+K   DYK
Sbjct  105  DLNIQFAYPETCGESPVWRVDNYLDPLVDSFVSIGGVVGNPGPATLGSWFKIQKFGYDYK  164

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VCS C V+C DVGI     G + L L+D PL V FK+A
Sbjct  165  LVYCPTVCSNCDVICKDVGILY-QNGERRLFLNDYPLRVVFKQA  207



>ref|XP_010683390.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=224

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 70/111 (63%), Gaps = 8/111 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES---  172
            DIN+ F    +C     W++   D    R ++ TGG  GNPG ET+++WFKIEK++S   
Sbjct  101  DINILFNMVNICLQSAAWKL-SIDHTTWRKYVATGGAIGNPGEETVSSWFKIEKVKSGSY  159

Query  173  ----DYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
                +YKI++CP+VCS C V+C DVG++V   GT+ L LSD P  V FK+A
Sbjct  160  EYDYNYKIMYCPNVCSFCMVMCGDVGVFVQDDGTRLLGLSDRPFYVMFKKA  210



>gb|KFK42293.1| hypothetical protein AALP_AA2G237000 [Arabis alpina]
Length=194

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = +2

Query  38   SNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCSICQ  217
            S  ++W++ + D+   ++F+ T GV GNPG  T+ NWFKI+K E+DYKIVFCPSVC+ C+
Sbjct  105  SKTSIWKLDR-DDTANQWFVSTCGVAGNPGRTTVDNWFKIDKFENDYKIVFCPSVCNFCK  163

Query  218  VVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            V+C D+G++V  GG + L LSD PL V FKRA
Sbjct  164  VMCGDIGVFV-QGGKRSLVLSDVPLKVMFKRA  194



>ref|XP_011035408.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 1/83 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF     C+   VW+V KYDE+  + FI T GVEGNPGPET+ NWFKIEK  +DYK
Sbjct  103  DLNIKFPGTASCAPTAVWKVEKYDELTGQMFISTSGVEGNPGPETVDNWFKIEKYGNDYK  162

Query  182  IVFCPSVCS-ICQVVCDDVGIYV  247
            +VFCP+VC+  C+V+C D+GIYV
Sbjct  163  LVFCPTVCNDHCKVLCKDIGIYV  185



>ref|XP_003548288.1| PREDICTED: miraculin-like [Glycine max]
Length=200

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C     W++  YD    ++F+ TGG  GNPG +T+ANWFKIEK E  YK
Sbjct  97   DLNIYFPIDTSCPLTKAWKLKDYDYSTSQWFVTTGGDFGNPGSQTLANWFKIEKYEDAYK  156

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
            +V+CPSVC  C   C D+GIY    G K LALS  P  VKF+RA+
Sbjct  157  LVYCPSVCKDCSYPCSDIGIYQDQYG-KRLALSSEPYRVKFQRAY  200



>ref|XP_006351548.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=208

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 71/106 (67%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    DINVKFF-TPTVCSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD  175
            D+NV+F  T T+C + + VWR+  Y+   + + I  GGV+GNPG +TI+NWFKI K    
Sbjct  103  DLNVEFTETYTICQHHSNVWRLDHYNPQKEDHMITNGGVKGNPGRDTISNWFKIVKYGVG  162

Query  176  YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            YK VFCPSVC+ C V+C +VG++V   G   L LS+ PL V+FK+ 
Sbjct  163  YKFVFCPSVCNYCDVICKNVGVFVQNNGQTLLTLSNEPLEVRFKKV  208



>gb|AFL91234.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=161

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 69/104 (66%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +Y+    +  I   G  GNPG ETI+NWFKIEK E+DYK
Sbjct  61   DLNIIFSASSICIQSNVWMLEEYE---GQRIISGRGTSGNPGGETISNWFKIEKYENDYK  117

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC +C+ VC D+G+     G++ LA+SD P  +KF++A
Sbjct  118  LVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  161



>gb|KFK42291.1| hypothetical protein AALP_AA2G236700 [Arabis alpina]
Length=192

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query  47   TVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCSICQVVC  226
            T+W++   D+   + FI T GV GNPG  TI+NWFKI+K E DYKI FCP+VC  C+V+C
Sbjct  105  TIWKLENMDQRTNQTFISTCGVGGNPGQTTISNWFKIDKFEDDYKIRFCPTVCDFCRVIC  164

Query  227  DDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             ++G++V  GG + L LSD PL V FKRA
Sbjct  165  RNIGVFV-EGGKRSLVLSDVPLKVMFKRA  192



>ref|XP_003548289.1| PREDICTED: miraculin-like [Glycine max]
Length=201

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    DINVKFFTPTV-CSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+ F + T+ C   TVW++  YD+   ++F+ TGG  G+P  +T+ANWFKIEK E  Y
Sbjct  94   DLNIYFTSYTIFCPQTTVWKLKYYDDSTSQWFVTTGGELGHPSSQTVANWFKIEKYEDAY  153

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRAF  316
            K+V+CPSVCS C   C D+GIY    G K LALS  P  V+F+R +
Sbjct  154  KLVYCPSVCSDCNHQCSDIGIYQDQYG-KRLALSSEPYKVQFERCW  198



>gb|KFK42292.1| hypothetical protein AALP_AA2G236900 [Arabis alpina]
Length=194

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 72/104 (69%), Gaps = 8/104 (8%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N   F+PT     ++W++   DE   + F+ T G  GNPG ET++NWF+I+K E+DYK
Sbjct  99   DLNF-IFSPT-----SIWKLDS-DETTNQRFVSTCGRAGNPGRETVSNWFRIDKFENDYK  151

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            IVFCPSVC+IC+V+C DVG++V  GG + L LS  P  V FKRA
Sbjct  152  IVFCPSVCNICRVICGDVGVFV-QGGKRSLVLSKVPFRVMFKRA  194



>ref|XP_010279465.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=205

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = +2

Query  2    DINVKFFTP-TVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D N+KF  P +   + +VW+VG+Y + + +  + T GV GNPG +T+++WFKIEK + DY
Sbjct  102  DHNIKFAIPISHPPSSSVWKVGEYSKWIGKQLVTTCGVLGNPGRDTLSSWFKIEKYDDDY  161

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            K+VFCPSVC  C+V C  VGI++   G   LAL+D+PL + FK+A
Sbjct  162  KLVFCPSVCKSCKVFCKGVGIFI-KDGVHHLALTDNPLKIMFKKA  205



>emb|CDP22082.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F  P  C    VWRV  Y +     F+  GGV GNPGP T+ +WFKI+K   DYK
Sbjct  105  DLNIEFAYPETCGESPVWRVDNYVDPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYK  164

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VCS C V+C DVGI     G + L L D PL V FK+A
Sbjct  165  LVYCPTVCSYCDVICKDVGILY-QNGERRLFLIDYPLRVVFKQA  207



>emb|CDP21540.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F  P  C    VWRV  Y +     F+  GGV GNPGP T+ +WFKI+K   DYK
Sbjct  105  DLNIEFAYPETCGESPVWRVDNYVDPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYK  164

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VCS C V+C DVGI +   G + L L D PL V FK+A
Sbjct  165  LVYCPTVCSYCDVICKDVGI-LYQNGERRLFLIDYPLRVVFKQA  207



>ref|XP_011092684.1| PREDICTED: miraculin-like [Sesamum indicum]
Length=214

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T C   TVWR G  D    R ++ TGGV G PG ET+  WFKI+K    YK
Sbjct  111  DMNIAFMAATTCVQRTVWRTGVADGTTGRRYVRTGGVLGRPGAETVGEWFKIDKYGKGYK  170

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            I +CPSVCS C+V C ++G++V   G +++ L   P+V+ FK+
Sbjct  171  IGYCPSVCSACRVECGEMGVFV-EDGRRWVGLGGQPIVIAFKK  212



>emb|CDP21544.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F  P  C    VWRV  Y +      +  GGV GNPGP T+ +WFKI+KL  DYK
Sbjct  105  DLNIQFAYPETCGESPVWRVDNYLDPSADSIVSIGGVVGNPGPATLGSWFKIQKLGYDYK  164

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VCS C V+C DVGI     G + L L D PL V FK+A
Sbjct  165  LVYCPAVCSYCDVICKDVGILY-QNGERRLFLIDYPLRVVFKQA  207



>ref|NP_001241106.1| uncharacterized protein LOC100790688 precursor [Glycine max]
 gb|ACU23857.1| unknown [Glycine max]
 gb|KHM99731.1| Miraculin [Glycine soja]
Length=209

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 72/106 (68%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNE--TVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD  175
            D+N+KF   T C  +  TVW++  +D   +++F+ TGGV GNP  ETI NWFKIEK +  
Sbjct  104  DLNIKFSARTSCPRQYSTVWKLDDFDFSKRQWFVTTGGVVGNPSLETIHNWFKIEKYDGA  163

Query  176  YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            YK+V+CPSV    + +C +VG++V   G K LAL+D PL V+F++A
Sbjct  164  YKLVYCPSVVKCPKHLCKNVGLFVDEKGNKRLALTDVPLKVQFQQA  209



>emb|CDO98554.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F  P  C    VWRV  Y +     F+  GGV GNPGP T+ +WFKI+K   DYK
Sbjct  107  DLNIQFAYPETCGESPVWRVDNYLDPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYK  166

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VCS C  +C DVGI     G + L L+D PL V FK A
Sbjct  167  LVYCPAVCSYCDAICKDVGILY-QNGERRLFLNDYPLRVVFKLA  209



>gb|ACS92500.1| Kunitz-type protease inhibitor KPI-D9 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG +T+ NWFKIEK    YK
Sbjct  99   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGIDTLTNWFKIEKAGIGYK  158

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVVKFKRAFPFTA  328
            +V CP     C V+C D+GIY    G K L+LSD  SP +V FK+  P ++
Sbjct  159  LVSCPEDICHCGVLCRDIGIYRENNGRKILSLSDQLSPFLVLFKKVGPLSS  209



>emb|CDP21024.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N++F  P  C    VWRV  Y +     F+  GGV GNPGP T+ +WFKI+K   DYK
Sbjct  105  DLNIEFAYPETCGESPVWRVDNYLDPSADSFVSIGGVVGNPGPATLGSWFKIQKFGYDYK  164

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VCS C V+C DVGI     G + L L D PL V FK A
Sbjct  165  LVYCPTVCSYCDVICKDVGILY-QNGERRLFLIDYPLRVVFKLA  207



>gb|AFL91230.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=159

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +Y+    +  I   G  GNPG ETI+NWFKIEK E+ YK
Sbjct  59   DLNIIFSASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGETISNWFKIEKYENGYK  115

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC +C+ VC D+G+     G++ LA+SD P  +KF++A
Sbjct  116  LVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  159



>gb|AFL91229.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=164

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +Y+    +  I   G  GNPG ETI+NWFKIEK E+ YK
Sbjct  64   DLNIIFSASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGETISNWFKIEKYENGYK  120

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC +C+ VC D+G+     G++ LA+SD P  +KF++A
Sbjct  121  LVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  164



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +Y+    +  I   G  GNPG ETI+NWFKIEK E+ YK
Sbjct  75   DLNIIFSASSICIQSNVWMLEEYE---GQRIISGRGTSGNPGGETISNWFKIEKYENGYK  131

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC +C+ VC D+G+     G++ LA+SD P  +KF++A
Sbjct  132  LVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  175



>gb|ACS92519.1| Kunitz-type protease inhibitor KPI-D8 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG +T+ NWFKIEK    YK
Sbjct  99   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGIDTLTNWFKIEKAGIGYK  158

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVVKFKRAFPFTA  328
            +V CP     C V+C D+GIY    G + L+LSD  SP +V FK+  P ++
Sbjct  159  LVSCPENICHCGVLCRDIGIYRENNGRRILSLSDKLSPFLVLFKKVGPLSS  209



>ref|XP_010683193.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=206

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES---  172
            D+N  F   T C   T W +    E  +RY + TGG  GNPG ET+ NWFKIEK  S   
Sbjct  101  DLNFVFDAATTCVQSTGWSLTIEMETGRRY-VGTGGEIGNPGVETVDNWFKIEKDGSGKY  159

Query  173  DYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            DYKIV+CP VC+ C+V+C DVG+++   G + L  SD PL+V FK+A
Sbjct  160  DYKIVYCPGVCNFCKVMCGDVGVFIEKDGRRLLGFSDQPLLVMFKKA  206



>gb|AFL91231.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +Y+    +  I   G  GNPG ETI+NWFKIEK E+ YK
Sbjct  75   DLNIIFSASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGETISNWFKIEKYENGYK  131

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC +C+ VC D+G+     G++ LA+SD P  +KF++A
Sbjct  132  LVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  175



>emb|CDP20533.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF  P  C    VW +  Y       F+  GGV GNPGP+T+++WFKIEK    DY
Sbjct  110  DLNIKFAYPETCGQSPVWSIDNYVYPSGDSFVNIGGVVGNPGPKTLSSWFKIEKFGYQDY  169

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            K+V+CP+VCS C+V+C DVGI    G  +    +D PL V FK+A
Sbjct  170  KLVYCPAVCSYCKVICKDVGIEYQNGKRRLHLTTDYPLRVVFKKA  214



>gb|AFL91227.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +Y+    +  I   G  GNPG ETI+NWFKIEK E+ YK
Sbjct  75   DLNIIFSASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGETISNWFKIEKYENGYK  131

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC +C+ VC D+G+     G++ LA+SD P  +KF++A
Sbjct  132  LVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  175



>emb|CDO98555.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF  P  C    VW +  Y       F+  GGV GNPGP+T+++WFKIEK    DY
Sbjct  110  DLNIKFAYPQTCGQSPVWSIDNYVYPSGDSFVNIGGVVGNPGPKTLSSWFKIEKFGYQDY  169

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            K+V+CP+VCS C+V+C DVGI    G  +    +D PL V FK+A
Sbjct  170  KLVYCPAVCSYCKVICKDVGIEYQNGKRRLHLTTDYPLRVVFKQA  214



>emb|CDO98560.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKL---ES  172
            D+N++   P  C+  TVWRV   D+   R F+  GGV GNPGPET+ NWFKIEK+    +
Sbjct  109  DLNIQVAFPDTCNQPTVWRVDVSDKSEGRKFVNLGGVIGNPGPETLGNWFKIEKVGDHGN  168

Query  173  DYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             YK+V+CP+VCS C+V C ++GI V   G + LALS  P  V F RA
Sbjct  169  KYKLVYCPTVCSYCKVNCKNLGI-VYQNGLRRLALSHRPFKVIFTRA  214



>gb|AFL91232.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=172

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +Y+    +  I   G  GNPG ETI+NWFKIEK E+ YK
Sbjct  72   DLNIIFSASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGETISNWFKIEKYENGYK  128

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC +C+ VC D+G+     G++ LA+SD P  +KF++A
Sbjct  129  LVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  172



>gb|AFL91233.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +Y+    +  I   G  GNPG ETI+NWFKIEK E+ YK
Sbjct  75   DLNIIFSASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGETISNWFKIEKYENGYK  131

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC +C+ VC D+G+     G++ LA+SD P  +KF++A
Sbjct  132  LVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFKIKFRKA  175



>ref|XP_006442410.1| hypothetical protein CICLE_v10022211mg [Citrus clementina]
 gb|ABL67650.1| putative miraculin-like protein 2 [Citrus hybrid cultivar]
 gb|ESR55650.1| hypothetical protein CICLE_v10022211mg [Citrus clementina]
Length=213

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 64/97 (66%), Gaps = 5/97 (5%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NV+F T T C+  TVWRV  YD    ++FI TGGVEGNPG +T+ NWFK E++  D  
Sbjct  99   DLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRA  158

Query  176  -YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
             YKIV CPSVC  C  +C+DVG  V     + LAL++
Sbjct  159  TYKIVHCPSVCESCVSLCNDVG--VSNDHARRLALTN  193



>gb|AEK31191.1| miraculin-like protein 1 [Citrus aurantiifolia]
 gb|AEK31193.1| miraculin-like protein 1 [Citrus sinensis]
 gb|AEK31194.1| miraculin-like protein 1 [Citrus reticulata]
 gb|AEK31195.1| miraculin-like protein 1 [Murraya paniculata]
Length=172

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NVKF T T C+  TVWRV  YD    ++FI TGGVEGNPG +T+ NWFK+E++ +D  
Sbjct  74   DLNVKFSTETSCNEPTVWRVDNYDPSRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQG  133

Query  176  -YKIVFCPSVCSICQVVCDDVGI  241
             Y+IV CPSVC  C  +C+DVG+
Sbjct  134  TYEIVHCPSVCKSCVFLCNDVGV  156



>ref|XP_006477860.1| PREDICTED: 21 kDa seed protein-like [Citrus sinensis]
Length=212

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 64/97 (66%), Gaps = 5/97 (5%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NV+F T T C+  TVWRV  YD    ++FI TGGVEGNPG +T+ NWFK E++  D  
Sbjct  98   DLNVRFSTGTRCNEPTVWRVDSYDASRGKWFISTGGVEGNPGAQTLKNWFKFERIGRDRA  157

Query  176  -YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
             YKIV CPSVC  C  +C+DVG  V     + LAL++
Sbjct  158  TYKIVHCPSVCESCVSLCNDVG--VSNDHARRLALTN  192



>gb|AEK31190.1| miraculin-like protein 1 [Citrus limonia]
Length=172

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NVKF T T C+  TVWRV  YD    ++FI TGGVEGNPG +T+ NWFK+E++ +D  
Sbjct  74   DLNVKFSTETSCNEPTVWRVDNYDPSRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQG  133

Query  176  -YKIVFCPSVCSICQVVCDDVGI  241
             Y+IV CPSVC  C  +C+DVG+
Sbjct  134  TYEIVHCPSVCKSCVFLCNDVGV  156



>emb|CDP21543.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF  P  C    VW +  Y       F+  GGV GNPGP+T+++WFKIEK    DY
Sbjct  110  DLNIKFAYPETCGQSPVWSIDNYVYPSGDSFVNIGGVVGNPGPKTLSSWFKIEKFGYQDY  169

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            K+V+CP+VCS C+V+C DVGI    G  +    +D PL V FK+A
Sbjct  170  KLVYCPAVCSYCRVICKDVGIEYQNGKRRLHLTTDYPLRVVFKQA  214



>ref|XP_009782174.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=208

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NVKF +  +  + TVWR+   + + +RY +  GGVEGNPG ET++NWFKI+K E  YK
Sbjct  106  DLNVKFTSIHISDSSTVWRINT-EIIPQRYLVTVGGVEGNPGRETLSNWFKIDKYEDAYK  164

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CP VC  C+  C D+GI V          SD PL V F +
Sbjct  165  LVYCPGVCETCRPFCGDIGILVEGSKRVLFVRSDQPLKVTFHK  207



>ref|XP_006477857.1| PREDICTED: 21 kDa seed protein-like [Citrus sinensis]
Length=213

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 64/97 (66%), Gaps = 5/97 (5%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NV+F T T C+  TVWRV  YD    ++FI TGGVEGNPG +T+ NWFK E++  D  
Sbjct  99   DLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRA  158

Query  176  -YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
             YKIV CPSVC  C  +C+DVG  V     + LAL++
Sbjct  159  TYKIVHCPSVCESCVSLCNDVG--VSNDHARRLALTN  193



>ref|XP_006441437.1| hypothetical protein CICLE_v10023565mg, partial [Citrus clementina]
 gb|ESR54677.1| hypothetical protein CICLE_v10023565mg, partial [Citrus clementina]
 gb|KDO39983.1| hypothetical protein CISIN_1g0308341mg, partial [Citrus sinensis]
Length=86

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +2

Query  53   WRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCSICQVVCDD  232
            W++  +D +L ++F+ TGG+EGN GP+T  NWF+IEK   DYK+VFCP VC  C+V+C D
Sbjct  1    WKLDNFDAILGQWFVKTGGIEGNLGPQTTINWFRIEKFYGDYKLVFCPLVCKFCKVLCID  60

Query  233  VGIYVGTGGTKFLALSDSPLVVKF  304
            VGI+V  GG   LALSD    V F
Sbjct  61   VGIFV-NGGVWHLALSDVTFNVTF  83



>gb|KFK31885.1| hypothetical protein AALP_AA6G171300 [Arabis alpina]
Length=192

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 1/89 (1%)
 Frame = +2

Query  47   TVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCSICQVVC  226
            T+W++   DE   + FI T GV GNPG  TI+NW KI+K E  YKI FCP+VC  C+V+C
Sbjct  105  TIWKLENMDERTNQTFISTCGVAGNPGQTTISNWIKIDKFEGAYKIRFCPTVCDFCRVIC  164

Query  227  DDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             ++G++V  GG + L LSD PL V FKRA
Sbjct  165  RNIGVFV-EGGKRSLVLSDVPLKVIFKRA  192



>ref|XP_007152537.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
 gb|ESW24531.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
Length=205

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 6/107 (6%)
 Frame = +2

Query  2    DINVKFF-TPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+K + T T C    VW++ K   +   +F+ TGGVEGNPG +TI NWFKIEK E DY
Sbjct  102  DLNIKSYGTTTSCDKPPVWKLLKV--LTGVWFLSTGGVEGNPGIDTIVNWFKIEKAEKDY  159

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKRA  313
             I FCPSVC  CQ +C ++G+YVG  G K L+LSD      V FKRA
Sbjct  160  VISFCPSVCK-CQTLCRELGLYVGDDGNKHLSLSDKVPSFRVMFKRA  205



>ref|XP_009406658.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=200

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D NV F   T C   TVW++ + DE   RY++V GGV GNPG ET++NWFKIE  +  YK
Sbjct  98   DTNVIFSAFTTCLQSTVWKL-ELDEGEGRYYVVIGGVAGNPGKETLSNWFKIESYQGVYK  156

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLAL-SDSPLVVKFKRA  313
            +VFCP+VC  C+ VC  +G+Y   GG ++L +  D+P   +FKRA
Sbjct  157  LVFCPTVCDYCRPVCGSLGVYE-QGGRQWLGIRDDTPFPFEFKRA  200



>pdb|3IIR|A Chain A, Crystal Structure Of Miraculin Like Protein From Seeds 
Of Mu Koenigii
 pdb|3IIR|B Chain B, Crystal Structure Of Miraculin Like Protein From Seeds 
Of Mu Koenigii
 pdb|3ZC8|A Chain A, Crystal Structure Of Murraya Koenigii Miraculin-like 
Protein At 2.2 A Resolution At Ph 7.0
 pdb|3ZC9|A Chain A, Crystal Structure Of Murraya Koenigii Miraculin-like 
Protein At 2.2 A Resolution At Ph 4.6
Length=190

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NVKF T T C+  TVWRV  YD    ++FI TGGVEGNPG +T+ NWFK+E++ +D  
Sbjct  74   DLNVKFSTETSCNEPTVWRVDNYDPSRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQG  133

Query  176  -YKIVFCPSVCSICQVVCDDVGI  241
             Y+IV CPSVC  C  +C+DVG+
Sbjct  134  TYEIVHCPSVCKSCVFLCNDVGV  156



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 68/106 (64%), Gaps = 3/106 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKL--ESD  175
            D+N+ F   T+C   T W++  +D   +R+++ TGGV GNPG ET+ NWFKI+     S 
Sbjct  95   DLNIVFSAFTICLQSTAWKL-DFDNTTRRFYVTTGGVTGNPGRETLDNWFKIQSASGRSG  153

Query  176  YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            Y +VFCPSVC+IC+ VC  +G+    G  +    SD+PL V+F+RA
Sbjct  154  YNLVFCPSVCNICRPVCGSLGVVREDGRLRLGISSDAPLPVEFRRA  199



>gb|ACS37303.1| trypsin inhibitor [Murraya koenigii]
 gb|ACS37304.1| trypsin inhibitor [Murraya koenigii]
Length=215

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NVKF T T C+  TVWRV  YD    ++FI TGGVEGNPG +T+ NWFK+E++ +D  
Sbjct  99   DLNVKFSTETSCNEPTVWRVDNYDPSRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQG  158

Query  176  -YKIVFCPSVCSICQVVCDDVGI  241
             Y+IV CPSVC  C  +C+DVG+
Sbjct  159  TYEIVHCPSVCKSCVFLCNDVGV  181



>gb|KHM99732.1| Miraculin [Glycine soja]
Length=207

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   SNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCSICQ  217
             + TVW + ++D  + + ++ TGGV GNPG  TI NWFKI+K E  YK+V+CP VC  C 
Sbjct  116  HHSTVWMLDQFDASIGQTYVTTGGVVGNPGEHTILNWFKIQKYEDAYKLVYCPRVCPSCH  175

Query  218  VVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             +C D+G++V       LALSD P  +KFK A
Sbjct  176  HLCKDIGMFVDANRRMHLALSDDPFKIKFKEA  207



>ref|NP_001237333.1| uncharacterized protein LOC100500648 precursor [Glycine max]
 gb|ACU15788.1| unknown [Glycine max]
Length=213

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 0/92 (0%)
 Frame = +2

Query  38   SNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCSICQ  217
             + TVW + ++D  + + ++ TGGV GNPG  TI NWFKI+K E  YK+V+CP VC  C 
Sbjct  122  HHSTVWMLDQFDASIGQTYVTTGGVVGNPGEHTILNWFKIQKYEDAYKLVYCPRVCPSCH  181

Query  218  VVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             +C D+G++V       LALSD P  +KFK A
Sbjct  182  HLCKDIGMFVDANRRMHLALSDDPFKIKFKEA  213



>ref|XP_002305033.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|EEE85544.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92484.1| Kunitz-type protease inhibitor KPI-D1.2 [Populus trichocarpa]
 gb|ADW95379.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=212

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES-DY  178
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG  T+ NWFKIEK  +  Y
Sbjct  99   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGTLGY  158

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVVKFKRAFPFTA  328
            K+VFCP     C V+C D+GIY      + L+LSD  SP VV FK+  P ++
Sbjct  159  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLSPFVVLFKKVGPLSS  210



>ref|XP_006477858.1| PREDICTED: 21 kDa seed protein-like isoform X1 [Citrus sinensis]
 ref|XP_006477859.1| PREDICTED: 21 kDa seed protein-like isoform X2 [Citrus sinensis]
Length=213

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NV+F T T C+  TVW+V  YD    ++FI TGG+EGNPG +T+ NWFK E++  D  
Sbjct  99   DLNVRFSTATRCNEPTVWKVDNYDPSRGKWFITTGGIEGNPGAQTLKNWFKFERIGRDRD  158

Query  176  -YKIVFCPSVCSICQVVCDDVGI  241
             YKIV CPSVC  C  +C+DVG+
Sbjct  159  AYKIVHCPSVCESCVSLCNDVGV  181



>ref|XP_003620172.1| 21 kDa seed protein [Medicago truncatula]
 gb|AES76390.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=205

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 69/107 (64%), Gaps = 6/107 (6%)
 Frame = +2

Query  2    DINVK-FFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+K + T T C+   VW++ K    +  +F+ TGGVEGNPG +TI NWFKIEK + DY
Sbjct  102  DLNIKSYVTKTTCAQSQVWKLNKVLSGV--WFLATGGVEGNPGFDTIFNWFKIEKADKDY  159

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKRA  313
               FCPSVC  CQ +C ++G+YV   G K LALSD      V FKRA
Sbjct  160  VFSFCPSVCK-CQTLCRELGLYVYDHGKKHLALSDQVPSFRVVFKRA  205



>emb|CDP18338.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 5/106 (5%)
 Frame = +2

Query  2    DINVKFFTPTV--CSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD  175
            D+N+KF +P +  C    VW+V  ++E L+++F++T GVEGN G ET ANWFKIE     
Sbjct  100  DLNIKF-SPFINFCRGSNVWKV-HFNEALEQHFVLTDGVEGNSGCETEANWFKIEGNYPF  157

Query  176  YKIVFCPSVC-SICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            YK+VFCP+VC S  + +C DVGIY    GT+ LALSD P VV F +
Sbjct  158  YKLVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALSDRPFVVFFSK  203



>ref|XP_007210537.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
 gb|EMJ11736.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
Length=202

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N+KF   T+C   T+W++ K+DE   ++F+ +GGVEGNPG +T +NWFKIEK + DYK
Sbjct  102  DHNIKFSAATICVQSTMWKLDKFDEQTGQWFVTSGGVEGNPGRQTTSNWFKIEKYDEDYK  161

Query  182  IVFCPSVCSICQVVCD  229
            +VFCP+VC+ C+V  +
Sbjct  162  LVFCPTVCNFCKVASE  177



>gb|AFS33546.1| Kunitz-type protease inhibitor, partial [Nicotiana tabacum]
Length=133

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 68/106 (64%), Gaps = 5/106 (5%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NVKF +  +  + TVWR+   + + +RY +  GGVEGNPG ET++NWF+I+K E  YK
Sbjct  29   DLNVKFTSIHISDSSTVWRINT-ELIPQRYLVTVGGVEGNPGRETLSNWFRIDKYEDAYK  87

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFL---ALSDSPLVVKFKR  310
            +V+CP VC  C+  C ++GI V  G  + L   + SD PL V F +
Sbjct  88   LVYCPGVCETCRPFCGEIGILV-EGSKRVLFIGSRSDQPLKVTFHK  132



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   T+C   TVW++  +D+   R+++ TGGV GNPG ET+ANWFKIE     YK
Sbjct  103  DLNIVFSAVTICVQSTVWKL-DFDDAAGRFYVTTGGVAGNPGRETLANWFKIENDRGAYK  161

Query  182  IVFCPSVCSICQVVCDDVGIY  244
            +VFCP+VC IC+ VC ++G+Y
Sbjct  162  LVFCPTVCDICKPVCGNLGVY  182



>gb|AFL91228.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 66/104 (63%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +Y+    +  I   G  GNPG ETI+NWFKIEK E+ YK
Sbjct  75   DLNIIFSASSICIQSNVWMLEEYE---GQRIISGRGTAGNPGGETISNWFKIEKYENGYK  131

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP+VC +C+ VC D+G+     G++ L + D P  +KF++A
Sbjct  132  LVYCPTVCDLCRPVCGDIGVVFAENGSRXLXIXDVPFKIKFRKA  175



>ref|XP_006441455.1| hypothetical protein CICLE_v10023253mg, partial [Citrus clementina]
 gb|ESR54695.1| hypothetical protein CICLE_v10023253mg, partial [Citrus clementina]
Length=101

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +2

Query  8    NVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIV  187
            N+KF         T+W++  +D  L ++F+  GGVEGNPGP+T  NWFKIEK   DY++V
Sbjct  5    NIKFEVVKTSVQSTIWKLDNFDAALGQWFVTIGGVEGNPGPQTTRNWFKIEKFYGDYELV  64

Query  188  FCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             CP VC  C++ C    I++  GG + LALSD P  V F +A
Sbjct  65   CCPLVCKFCKIFC----IFM-NGGVRHLALSDIPFSVIFLKA  101



>ref|XP_003620184.1| Pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AES76402.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=204

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCS-NETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+ F + + C  + TVW++ ++D    + F+ T G  GNPGP++I+NWFKIEK    Y
Sbjct  100  DLNIMFRSNSSCPYHTTVWKLDRFDASKGKSFVTTDGFIGNPGPQSISNWFKIEKYVEGY  159

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKF  304
            K+V+CP VC  C+  C +VG++    G K LALSD P  VKF
Sbjct  160  KLVYCPIVCPSCKHECKNVGLFEDENGNKRLALSDVPYQVKF  201



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 69/106 (65%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    DINVKFFTP---TVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES  172
            D+N+KF  P     C    VW+V  ++E LK++F++T GVEGN G ET ANWFKIE   +
Sbjct  100  DLNIKFSEPPFINFCRGSNVWKV-HFNEALKQHFVLTDGVEGNSGCETEANWFKIELTGN  158

Query  173  -DYKIVFCPSVC-SICQVVCDDVGIYVGTGGTKFLALSDSPLVVKF  304
              YK VFCP+VC S  + +C DVGIY    GT+ LALSD P VV F
Sbjct  159  VGYKFVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALSDQPFVVFF  204



>gb|AEK31192.1| miraculin-like protein 1 [Citrus maxima]
Length=172

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NVKF T T C+  TVWRV  YD    ++FI TGGVEGNPG +T+ NWFK+E++ +D  
Sbjct  74   DLNVKFSTETSCNEPTVWRVDNYDPSRGKWFITTGGVEGNPGAQTLKNWFKLERVGTDQG  133

Query  176  -YKIVFCPSVCSICQVVCDDVGI  241
             Y+IV CPSVC  C  + +DVG+
Sbjct  134  TYEIVHCPSVCKSCVFLGNDVGV  156



>ref|XP_009782173.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=252

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+K+   T+  + TVWR+   + + +RY +  GGVEGNPG ET++NWFKI+K E  YK
Sbjct  107  DLNIKYTAMTISDSSTVWRINT-ELIPQRYLVTVGGVEGNPGRETLSNWFKIDKYEDAYK  165

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFK  307
              +CP VC  C+  C D+GI V          S+ PL VKF+
Sbjct  166  FAYCPGVCETCRPFCGDIGILVEGSKRVLFVGSNQPLKVKFE  207



>emb|CDO98558.1| unnamed protein product [Coffea canephora]
 emb|CDO98559.1| unnamed protein product [Coffea canephora]
Length=212

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 63/105 (60%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF  P  C    VW V  Y       F+  GGV GNPGPET+++WFKI+K    DY
Sbjct  108  DLNIKFDYPDTCDESPVWSVDNYVYPSDDSFVNIGGVVGNPGPETLSSWFKIQKFGYRDY  167

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            K+VFCP+VCS C V+C DVGI    G  +    +D P  V F++A
Sbjct  168  KLVFCPTVCSYCDVICKDVGITYQDGKRRLSLTTDYPHRVVFQQA  212



>ref|XP_006495062.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=137

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 66/102 (65%), Gaps = 6/102 (6%)
 Frame = +2

Query  8    NVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIV  187
            NV  F  T   + T+W++ K+D  L ++F+  GGVEGNPGP+T  NWFKIEK   DY++V
Sbjct  42   NVALFAKTSVQS-TIWKLDKFDVALGQWFVTIGGVEGNPGPQTTRNWFKIEKFYGDYELV  100

Query  188  FCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             CP VC  C+V+C    I++  GG + LALSD P  V F +A
Sbjct  101  CCPLVCKFCKVLC----IFM-NGGVRHLALSDVPFNVIFLKA  137



>ref|XP_011035403.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG +T+ NWFKIEK     Y
Sbjct  99   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVDTLTNWFKIEKAGILGY  158

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVVKFKRAFPFTA  328
            K+VFCP     C V+C D+GIY      + L+LSD  SP VV FK+  P ++
Sbjct  159  KLVFCPKDICHCGVLCRDIGIYFENNRGRILSLSDQLSPFVVVFKKVGPLSS  210



>ref|XP_010279488.1| PREDICTED: miraculin-like [Nelumbo nucifera]
Length=208

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 68/106 (64%), Gaps = 3/106 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N++F   T+    TVW +G ++E  + + + T G  GNPG ET++NWF+IE  + DYK
Sbjct  104  DQNIRFAIDTLLPQPTVWNLGDFNESARTFLVETCGSIGNPGIETLSNWFRIEPFDDDYK  163

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVVKFKRA  313
            +VFCP+VC+ C+ VC D+GI +   G + LAL     PL +KFK+ 
Sbjct  164  LVFCPTVCNFCRPVCGDLGIAI-QDGVRHLALGSGLEPLKIKFKKG  208



>gb|AEK26926.1| Kunitz-type trypsin inhibitor B1 [Populus nigra]
Length=212

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG  T+ NWFKIEK     Y
Sbjct  99   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGY  158

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVVKFKRAFPFTA  328
            K+VFCP     C V+C D+GIY      + L+LSD  SP VV FK+  P ++
Sbjct  159  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLSPFVVLFKKVGPLSS  210



>ref|XP_003534100.1| PREDICTED: miraculin-like [Glycine max]
 gb|KHM99733.1| Miraculin [Glycine soja]
Length=216

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 69/108 (64%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    DINVKFFTPTV---CSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE  169
            D+N+ F T      C+  + VW++  +D    ++F+ TGG  GNP  ETI NWFKIEK +
Sbjct  108  DLNIMFCTDRTSYSCAEYSPVWKLDHFDVSKGKWFVTTGGSMGNPSWETIRNWFKIEKCD  167

Query  170  SDYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            S Y+IV+CPSVC   + +C DVG++V   G + LALSD P  VKF+ A
Sbjct  168  SAYRIVYCPSVCPSSKHMCKDVGVFVDENGYRRLALSDVPFKVKFQLA  215



>ref|XP_006847953.1| hypothetical protein AMTR_s00029p00141480 [Amborella trichopoda]
 gb|ERN09534.1| hypothetical protein AMTR_s00029p00141480 [Amborella trichopoda]
Length=196

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 8/109 (7%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D N++F   T+C   TVWR   +D+V    F++TGGV GNPG  T++NWF +E+ ES+  
Sbjct  89   DQNIQFEAITICIQSTVWRRSNFDQVTGIQFVITGGVTGNPGRATVSNWFTVER-ESEVV  147

Query  176  ----YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
                YK+VFCP VC IC++ C ++G+Y    G K+LA  D  L + FK+
Sbjct  148  NNGRYKLVFCPGVCDICRINCGNLGVY-EENGNKWLAQVDPALSLVFKK  195



>emb|CDP19138.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 71/106 (67%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    DINVKFFTPTV---CSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES  172
            D+N+KF  P +   C    VW+V  ++E L+++F++T GVEGN G ET ANWFKIE + S
Sbjct  100  DLNIKFAEPPIINFCRGSNVWKV-HFNEALEQHFVLTDGVEGNSGCETEANWFKIEAIGS  158

Query  173  -DYKIVFCPSVC-SICQVVCDDVGIYVGTGGTKFLALSDSPLVVKF  304
              YK+V+CP+VC S  + +C DVGIY     T+ LALSD P +V F
Sbjct  159  LGYKLVYCPAVCDSSSEAICKDVGIYYDDDRTRRLALSDQPFLVVF  204



>ref|XP_011035402.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG +T+ NWFKIEK     Y
Sbjct  99   DLNIKFSIEKACDHSSVWKIQKSSNSEVQWFVTTGGAEGNPGVDTLFNWFKIEKAGILGY  158

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVVKFKRAFPFTA  328
            K+VFCP     C V+C D+GIY      + L+LSD  SP VV FK+  P ++
Sbjct  159  KLVFCPKDICHCGVLCRDIGIYFENNRGRILSLSDQLSPFVVVFKKVGPLSS  210



>gb|AFK39812.1| unknown [Lotus japonicus]
 gb|AFK45182.1| unknown [Lotus japonicus]
Length=208

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 7/107 (7%)
 Frame = +2

Query  2    DINVKF-FTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+K   T T C+   VW++ K  E+   +F+ TGGVEGNPG  TI+NWFKIEK + DY
Sbjct  106  DLNIKSSLTNTTCAKAPVWKLLK--ELSGVWFLATGGVEGNPGMATISNWFKIEKADKDY  163

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKRA  313
               FCPSVC  CQ +C ++GIY   GG K L+LSD   P  + FK+A
Sbjct  164  VFSFCPSVCK-CQTLCRELGIY-DYGGDKHLSLSDQVPPFRIMFKQA  208



>ref|XP_009614755.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=210

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 68/106 (64%), Gaps = 5/106 (5%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NVKF +  +  + TVWR+   + + +RY +  GGVEGNPG ET++NWF+I+K E  YK
Sbjct  106  DLNVKFTSIHISDSSTVWRINT-ELIPQRYLVTVGGVEGNPGRETLSNWFRIDKYEDAYK  164

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFL---ALSDSPLVVKFKR  310
            +V+CP VC  C+  C ++GI V  G  + L   + SD PL V F +
Sbjct  165  LVYCPGVCETCRPFCGEIGILV-EGSKRVLFIGSRSDQPLKVTFHK  209



>emb|CAN63617.1| hypothetical protein VITISV_041430 [Vitis vinifera]
Length=220

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D N++F   T+C   TVW++ +YDE   ++F  TG VEGN G  T++N FKIEK E D  
Sbjct  103  DHNIEFSAATICVQSTVWKL-EYDESSGQWFFTTGWVEGNLGRGTLSNQFKIEKYEDDNN  161

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSP  289
            +VFCP+VC  C+ VC D+GIY+   G + LALSD P
Sbjct  162  LVFCPTVCDFCKPVCGDIGIYI-QDGYRHLALSDVP  196



>gb|AAQ84217.1| Kunitz trypsin inhibitor 4 [Populus trichocarpa x Populus deltoides]
 gb|ACS92488.1| Kunitz-type protease inhibitor KPI-D10.2 [Populus trichocarpa 
x Populus deltoides]
Length=212

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG +T+ NWFKIEK     Y
Sbjct  99   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGIDTLTNWFKIEKAGILGY  158

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVVKFKRAFPFTA  328
            K+V CP     C V+C D+GIY    G + L+LSD  SP +V FK+  P ++
Sbjct  159  KLVSCPEGICHCGVLCRDIGIYRENDGRRILSLSDKLSPFLVLFKKVGPLSS  210



>ref|XP_004235409.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=201

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 63/104 (61%), Gaps = 1/104 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NVKF +  +  + TVWR+   + + +RY +  GGVEGNPG ET+ NWF I+K E  YK
Sbjct  99   DMNVKFTSMEISDSSTVWRI-NTELIPQRYLVTIGGVEGNPGRETLGNWFNIDKYEDAYK  157

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +V+CP VC  C+  C ++GI   +G        D PL V F +A
Sbjct  158  LVYCPVVCETCRPFCGEIGILEESGKRVLFVGRDPPLKVTFHKA  201



>gb|KDO37403.1| hypothetical protein CISIN_1g035912mg, partial [Citrus sinensis]
Length=137

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 5/91 (5%)
 Frame = +2

Query  41   NETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCSICQV  220
              T+W++ K+D  L ++F+  GGVEGNPGP+T  NWFKIEK   DY++V CP VC  C+V
Sbjct  52   QSTIWKLDKFDVALGQWFVTIGGVEGNPGPQTTRNWFKIEKFYGDYELVCCPLVCKFCKV  111

Query  221  VCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            +C    I++  GG + LALSD P  V F +A
Sbjct  112  LC----IFI-NGGVRHLALSDVPFNVIFLKA  137



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 70/106 (66%), Gaps = 7/106 (7%)
 Frame = +2

Query  2    DINVKFFTPTV---CSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKL-E  169
            D+N+KF  P +   C    VW+V  ++E LK++F++T GVEGN G ET ANWFKIE + +
Sbjct  96   DLNIKFAEPPIINFCRGSNVWKV-HFNEALKQHFVLTDGVEGNSGCETTANWFKIEAVSD  154

Query  170  SDYKIVFCPSVC-SICQVVCDDVGIYVGTGGTKFLALSDSPLVVKF  304
             DYK VFCP+VC S  + +C DVGIY+   GT+ LAL   P  V F
Sbjct  155  RDYKFVFCPTVCDSSSEAICKDVGIYM-DDGTRRLALGGQPYAVVF  199



>gb|ABK96521.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ACS92517.1| Kunitz-type protease inhibitor KPI-D11 [Populus trichocarpa x 
Populus deltoides]
Length=212

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 3/112 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG  TI NWFKIEK     Y
Sbjct  99   DLNIKFSIKKDCDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHTITNWFKIEKAGILGY  158

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVVKFKRAFPFTA  328
            K+VFCP     C V+C D+GIY      + L+LSD  SP +V FK+  P ++
Sbjct  159  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLSPFLVLFKKVGPLSS  210



>ref|XP_006353931.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=208

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+NVKF +  +  + TVWR+   + + +RY +  GGVEGNPG ET+ NWF I+K E  YK
Sbjct  106  DMNVKFTSMVISDSSTVWRINT-ELIPERYLVTIGGVEGNPGRETLGNWFNIDKYEDAYK  164

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            +V+CP VC IC+  C ++GI    G        D PL V F +
Sbjct  165  LVYCPVVCEICRPFCGEIGILEENGKRVLFVGRDPPLKVTFHK  207



>gb|ACO40080.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF     C + +VW++ K   +  ++F+ TGG EGNPG +T+ NWFKIEK    YK
Sbjct  84   DLNIKFSIKKACDHSSVWKIQKSSNLEVQWFVTTGGEEGNPGIDTLTNWFKIEKAGIGYK  143

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS  286
            +V CP     C V+C D+GIY    G K L+LSD 
Sbjct  144  LVSCPEDICHCGVLCRDIGIYRENNGRKILSLSDQ  178



>emb|CDP21726.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 71/106 (67%), Gaps = 5/106 (5%)
 Frame = +2

Query  2    DINVKFFTPTV--CSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD  175
            D+N+KF +P +  C    VW+V  ++E L+++F++T GVEGN G ET ANWFKIE     
Sbjct  100  DLNIKF-SPFINFCRGSNVWKV-HFNEALEQHFVLTDGVEGNSGCETEANWFKIEGNYPF  157

Query  176  YKIVFCPSVC-SICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
            Y++VFCP+VC S  + +C DVGIY    GT+ LALSD P  V F +
Sbjct  158  YRLVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALSDRPFGVYFSK  203



>ref|XP_006847952.1| hypothetical protein AMTR_s00029p00141300 [Amborella trichopoda]
 gb|ERN09533.1| hypothetical protein AMTR_s00029p00141300 [Amborella trichopoda]
Length=166

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 62/94 (66%), Gaps = 8/94 (9%)
 Frame = +2

Query  44   ETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD------YKIVFCPSVC  205
             TVWR+G  DE   + F+ TGGV GNPG  T++NWFK+E+ ES+      YK+VFCP VC
Sbjct  73   STVWRLGGLDEATDKRFVTTGGVTGNPGSSTVSNWFKVER-ESEGVDNGRYKLVFCPGVC  131

Query  206  SICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFK  307
            S C+V+C ++G+Y    G  +LAL D  L + FK
Sbjct  132  SFCKVICGNLGVY-NVNGRNWLALGDPALSIVFK  164



>ref|XP_006478228.1| PREDICTED: uncharacterized protein LOC102606959 [Citrus sinensis]
Length=533

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 3/101 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEK---LES  172
            D+ VKF   T C+  TVW+V  YDE   ++FI TGGVEGNPGP+T+ NWFK ++      
Sbjct  142  DLTVKFSAQTRCNEPTVWKVDDYDEPRGKWFITTGGVEGNPGPQTLKNWFKFQRSGTFPD  201

Query  173  DYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLV  295
             YKIV CPSVC+ C  +C +VG+    G  + +  +D  LV
Sbjct  202  TYKIVHCPSVCNSCVSLCKNVGVSHEDGAGRLVLKADDELV  242



>gb|ACO40078.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG +T+ NWFKIEK    YK
Sbjct  84   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGIDTLTNWFKIEKAGIGYK  143

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
            +V CP     C V+C D+GIY    G K L+LSD
Sbjct  144  LVSCPEDICHCGVLCRDIGIYRENNGRKILSLSD  177



>ref|XP_003620169.1| Kunitz-type trypsin inhibitor alpha chain [Medicago truncatula]
 gb|AES76387.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
 gb|AFK40758.1| unknown [Medicago truncatula]
 gb|AFK41434.1| unknown [Medicago truncatula]
Length=203

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    DINVK-FFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+K F T T C    VW++ K  E+   +F+ TGGVEGNP   T+ NWFKIEK + DY
Sbjct  99   DLNIKSFVTKTKCPQTQVWKLLK--ELTGVWFLATGGVEGNPSMATVGNWFKIEKADKDY  156

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKRA  313
             + FCP+    CQ +C ++G++V   G K LALSD      V FKRA
Sbjct  157  VLSFCPAEACKCQTLCRELGLFVDDKGNKHLALSDQIPSFRVVFKRA  203



>dbj|BAA82842.1| miraculin homologue [Taraxacum officinale]
Length=136

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +YD  L    +   GV+GNPG ET++NWFKIEK + DYK
Sbjct  52   DLNIIFSASSICIQSNVWMIEEYDGSL---IVSAHGVQGNPGQETLSNWFKIEKFDDDYK  108

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTK  265
            IVFCP+VC +C+ +C D+G+ +   G +
Sbjct  109  IVFCPAVCDVCRPLCGDIGVEIDENGRR  136



>gb|AFK33359.1| unknown [Medicago truncatula]
Length=202

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +2

Query  2    DINVK-FFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+K + T T C+   VW++ K    +  +F+ TG VEGNPG +TI NWFKIEK + DY
Sbjct  102  DLNIKSYVTKTTCAQSQVWKLNKVLSGV--WFLATGSVEGNPGFDTIFNWFKIEKADKDY  159

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS  286
               FCPSVC  CQ +C ++G+YV   G K LALSD 
Sbjct  160  VFSFCPSVCK-CQTLCRELGLYVYDHGKKHLALSDQ  194



>ref|XP_009614754.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=251

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 62/102 (61%), Gaps = 1/102 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+K+    +    TVWR+   + + +R  +  GGVEGNPG ET++NWFKI+K E  YK
Sbjct  106  DLNIKYTAMIISDLSTVWRINT-ELIPQRNLVTVGGVEGNPGRETLSNWFKIDKYEDAYK  164

Query  182  IVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFK  307
            +V+CP VC  C+  C D+GI V          S+ PL VKF+
Sbjct  165  LVYCPGVCETCRPFCGDIGILVEGSKRVMFVGSNQPLKVKFE  206



>gb|KHM99735.1| Miraculin [Glycine soja]
Length=154

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (65%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    DINVKFFT-PTVCSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD  175
            D+N+ F T  T C+  + VW++  +D    ++F+ TGG  GNP  ETI NWFKIEK +  
Sbjct  47   DLNIMFSTDHTSCAEYSPVWKLDHFDVSKGKWFVSTGGSMGNPSWETIRNWFKIEKCDGA  106

Query  176  YKIVFCPSV--CSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            YKIV+CPSV   S  + +C D+G++V   G + LALS+ P  VKF+RA
Sbjct  107  YKIVYCPSVFPSSSSKHMCKDIGVFVDENGFRRLALSNVPFKVKFQRA  154



>ref|XP_007036743.1| 21 kDa seed protein [Theobroma cacao]
 sp|P32765.1|ASP_THECC RecName: Full=21 kDa seed protein; Flags: Precursor [Theobroma 
cacao]
 pir||S16252 trypsin inhibitor homolog - soybean
 emb|CAA39860.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21244.1| 21 kDa seed protein [Theobroma cacao]
Length=221

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 63/107 (59%), Gaps = 3/107 (3%)
 Frame = +2

Query  2    DINVKF--FTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES-  172
            D+N++F      +CS  TVWR+  YD    ++++ T GV+G PGP T+ +WFKIEK    
Sbjct  103  DVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVL  162

Query  173  DYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             YK  FCPSVC  C  +C D+G +    G   LALSD+     FK+A
Sbjct  163  GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSDNEWAWMFKKA  209



>ref|XP_010536414.1| PREDICTED: miraculin-like [Tarenaya hassleriana]
Length=212

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    DINVKF-FTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+K     T+C   T W + ++D+  K++F+ TG      G E++ ++FKI K  +DY
Sbjct  97   DLNIKTDVAATICIQSTYWWIDEFDKQRKQWFVTTGNALRRSGKESLRSFFKIVKSRNDY  156

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            K VFCP  C  C+ +C DVGI+V   G + LALSD P VV FK+A
Sbjct  157  KFVFCPRDCEFCRPICGDVGIFVDENGIRRLALSDQPFVVMFKKA  201



>prf||1802409A albumin
Length=221

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 63/107 (59%), Gaps = 3/107 (3%)
 Frame = +2

Query  2    DINVKF--FTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES-  172
            D+N++F      +CS  TVWR+  YD    ++++ T GV+G PGP T+ +WFKIEK    
Sbjct  103  DVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVL  162

Query  173  DYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             YK  FCPSVC  C  +C D+G +    G   LALSD+     FK+A
Sbjct  163  GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSDNEWAWMFKKA  209



>gb|ABG47463.1| vegetative storage protein [Litchi chinensis]
Length=225

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 62/98 (63%), Gaps = 7/98 (7%)
 Frame = +2

Query  2    DINVKF-FTPTVCSNE-TVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD  175
            D+N++F   P  CS   TVW+V  YDE    +FI T GV GNPG +TI NWFK EK+ +D
Sbjct  104  DMNIQFNVQPDACSQHSTVWKVDNYDEKGGAWFITTNGVIGNPGSKTIHNWFKFEKVGTD  163

Query  176  ---YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALS  280
               YKIV CPSVC  C  +C DVGI  GT   + LALS
Sbjct  164  LNAYKIVHCPSVCDSCVTLCSDVGINYGT--QRRLALS  199



>emb|CAZ64526.1| Kunitz trypsin inhibitor [Populus trichocarpa]
Length=149

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 63/102 (62%), Gaps = 3/102 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES-DY  178
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG +T+ NWFKIEK  +  Y
Sbjct  46   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVDTLTNWFKIEKAGTLGY  105

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVV  298
            K+VFCP     C V+C D+GIY      + L+LSD  SP VV
Sbjct  106  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLSPFVV  147



>gb|KHN45554.1| Miraculin [Glycine soja]
Length=104

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  50   VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCSICQVVCD  229
            +WR G+ D    + F+ TGGV+GNPG  TI NWFKIE+ ES YKIV+CP+VC  C+V C 
Sbjct  1    MWRFGQVDAATGQRFVTTGGVQGNPGAGTIDNWFKIERFESAYKIVYCPTVCESCEVECK  60

Query  230  DVGIYVGTG-GTKFLALS  280
            DVGI++     T+F+ +S
Sbjct  61   DVGIFLDDDRNTRFVFIS  78



>emb|CDP16462.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 7/94 (7%)
 Frame = +2

Query  2    DINVKFFTPT-VCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEK-LESD  175
            D+N+KF     VC+   VW++  +DE L ++FI+T GVEGNPG  TI NWFKIE      
Sbjct  100  DLNIKFSKAAPVCNESNVWKL-DFDEELGQHFILTNGVEGNPGCGTIHNWFKIEGPYHKS  158

Query  176  YKIVFCPSVCSICQVVCDDVGIY----VGTGGTK  265
            Y++VFCP+VC+IC V+C DVG++    +  GGT+
Sbjct  159  YRLVFCPTVCNICNVICKDVGVFSDRRLALGGTR  192



>ref|XP_003534083.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (65%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    DINVKFFT-PTVCSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD  175
            D+N+ F T  T C+  + VW++  +D    ++F+ TGG  GNP  ETI NWFKIEK +  
Sbjct  108  DLNIMFSTDHTSCAEYSPVWKLDHFDVSKGKWFVSTGGSMGNPSWETIRNWFKIEKCDGA  167

Query  176  YKIVFCPSV--CSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
            YKIV+CPSV   S  + +C D+G++V   G + LALS+ P  VKF+RA
Sbjct  168  YKIVYCPSVFPSSSSKHMCKDIGVFVDENGFRRLALSNVPFKVKFQRA  215



>gb|ACO40144.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40158.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES-DY  178
            D+N+KF+    C + +VW++ K      ++F+ TGG EGNPG  T+ NWFKIEK  +  Y
Sbjct  84   DLNIKFYIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGTLGY  143

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
            K+VFCP     C V+C D+GIY      + L+LSD
Sbjct  144  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>ref|XP_003620187.1| Miraculin [Medicago truncatula]
 gb|AES76405.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=212

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    DINVKFFTP---TVCSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE  169
            D+N+KF      + C N + VW++  + +  +  F+ T GV GNPG  TI NWF+IEK E
Sbjct  107  DLNIKFSNDAYDSRCPNHSLVWKIDPFSK--EETFVTTNGVLGNPGSNTIHNWFQIEKYE  164

Query  170  SDYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
              YK+V+CP+VC  C+ VC D+GIYV       LAL++ P  VKF++A
Sbjct  165  DAYKLVYCPNVCPSCKHVCKDIGIYVYKYREMRLALTNVPFKVKFQKA  212



>dbj|BAA82840.1| miraculin homologue [Youngia japonica]
Length=142

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYK  181
            D+N+ F   ++C    VW + +YD  L    +   GV GNPG ETI+NWFKIEK E DYK
Sbjct  64   DLNIIFSASSICIQSNVWNLEEYDGQL---IVSAHGVAGNPGRETISNWFKIEKYEDDYK  120

Query  182  IVFCPSVCSICQVVCDDVGIYV  247
            IVFCP+VC  C+ VC D+G+ +
Sbjct  121  IVFCPTVCDFCRPVCGDIGVLI  142



>emb|CBJ94877.1| kunitz trypsin inhibitor [Populus balsamifera]
Length=143

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 61/102 (60%), Gaps = 3/102 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG  T+ NWFKIEK     Y
Sbjct  40   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGY  99

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD--SPLVV  298
            K+VFCP     C V+C D+GIY      + L+LSD  SP VV
Sbjct  100  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLSPFVV  141



>gb|AAV41233.1| putative 21 kDa trypsin inhibitor [Theobroma bicolor]
Length=221

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 63/107 (59%), Gaps = 3/107 (3%)
 Frame = +2

Query  2    DINVKF--FTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES-  172
            DIN++F      +CS  TVW++  YD    ++++ T GV G PGP T+ +WFKIE+    
Sbjct  103  DINIEFVPIRDRLCSTSTVWKLDNYDNSAGKWWVTTDGVRGQPGPNTLTSWFKIERAGVL  162

Query  173  DYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
             YK  FCPSVC  C+ +C D+G +    G   LALSD+     FK+A
Sbjct  163  GYKFRFCPSVCDSCKTLCSDIGRHSDDDGQIRLALSDNGWPWMFKKA  209



>ref|XP_009614753.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=251

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+KF +    SN + VWR+   + + +RY +  GGVEGNPG ET++NWF+I+K E  Y
Sbjct  104  DLNIKFTSEITLSNSSNVWRINT-ELIPQRYLVTVGGVEGNPGRETLSNWFRIDKYEDAY  162

Query  179  KIVFCPSVCSIC-QVVCDDVGIYVGTGGTKFLALSDSPLVVKF  304
            K+V+CP VC  C +  C D+GI V          SD PL V F
Sbjct  163  KLVYCPGVCETCSRTFCGDIGILVEGNERVLFVGSDKPLKVTF  205



>gb|ABK01288.1| miraculin-like protein [Coffea arabica]
Length=214

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 70/108 (65%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    DINVKFFTP---TVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKL-E  169
            D+N+KF  P    +CS   VW+V  ++++ +++F++T GVEGN G  T ANWFKIE + +
Sbjct  96   DLNIKFAEPPVGRICSGSNVWKV-HFNDLFEKHFVLTDGVEGNSGCGTTANWFKIEAVGD  154

Query  170  SDYKIVFCPSVC-SICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKR  310
              YK+VFCP+VC S  + +C  VGIY    GT+ LAL   P VV F +
Sbjct  155  RGYKLVFCPTVCDSSSEAICKYVGIYHDDDGTRRLALGGQPFVVFFSK  202



>ref|XP_006353919.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=245

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 63/104 (61%), Gaps = 3/104 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSN-ETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+NVKF +     N  TVW +     + +RY +  GGVEGNPG +T+ NWFKI+K E  Y
Sbjct  100  DLNVKFMSIVFTYNMSTVWTINT-TLIPQRYLVAVGGVEGNPGRDTLGNWFKIDKYEDAY  158

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLAL-SDSPLVVKFK  307
            K V+CP VC  C+  C D+GI V     + L + SD PL VKF+
Sbjct  159  KFVYCPGVCETCRPFCGDIGIIVEPNNKRVLFVGSDKPLKVKFE  202



>ref|XP_009782172.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=252

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +2

Query  2    DINVKFFTPTVCSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+KF +    SN + VWR+   + + +RY +  GGVEGNPG ET++NWFKI+K E  Y
Sbjct  105  DLNIKFTSEITLSNSSNVWRINT-ELIPQRYLVTVGGVEGNPGRETLSNWFKIDKYEDAY  163

Query  179  KIVFCPSVCSIC-QVVCDDVGIYVGTGGTKFLALSDSPLVVKF  304
            K+V+CP VC  C +  C D+GI V          SD PL V F
Sbjct  164  KLVYCPGVCETCSRPFCGDIGILVEGNERVLFVGSDKPLKVTF  206



>gb|AFK34345.1| unknown [Medicago truncatula]
Length=212

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    DINVKFFTP---TVCSNET-VWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE  169
            D+N+KF      + C N + VW++  + +  +  F+ T GV GNPG  TI NWF+IEK E
Sbjct  107  DLNIKFSNDAYDSRCPNHSLVWKIDPFSK--EETFVTTNGVLGNPGFNTIHNWFQIEKYE  164

Query  170  SDYKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDSPLVVKFKRA  313
              YK+V+CP+VC  C+ VC D+GIYV       LAL++ P  VKF++A
Sbjct  165  DAYKLVYCPNVCPSCKHVCKDIGIYVYKYREMRLALTNVPFKVKFQKA  212



>gb|ACO40100.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF+    C + +VW++ K      ++F+ TGG EGNPG  T+ NWFKIEK     Y
Sbjct  84   DLNIKFYIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGY  143

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
            K+VFCP     C V+C D+GIY      + L+LSD
Sbjct  144  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|ACO40081.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF+    C + +VW++ K      ++F+ TGG EGNPG  T+ NWFKIEK     Y
Sbjct  84   DLNIKFYIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGY  143

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
            K+VFCP     C V+C D+GIY      + L+LSD
Sbjct  144  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|ACO40074.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40083.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40091.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40101.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40108.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40117.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40123.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40138.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40148.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40155.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLE-SDY  178
            D+N+KF+    C + +VW++ K      ++F+ TGG EGNPG  T+ NWFKIEK     Y
Sbjct  84   DLNIKFYIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGILGY  143

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
            K+VFCP     C V+C D+GIY      + L+LSD
Sbjct  144  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|KDO39799.1| hypothetical protein CISIN_1g039827mg [Citrus sinensis]
Length=102

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +2

Query  41   NETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCSICQV  220
              T+W++  +D  L ++F+  GGVEGNPGP+T  NWFKIE+   DY++V CP VC  C++
Sbjct  20   QSTIWKLDNFDAALGQWFVTIGGVEGNPGPQTKRNWFKIEEFYGDYELVCCPLVCKFCKI  79

Query  221  VCDDVGIYVGTGGTKFLALSDSPLVVKF  304
             C    I++  GG + LALSD P  V F
Sbjct  80   FC----IFM-NGGVRHLALSDIPFSVIF  102



>gb|ACO40119.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40127.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40130.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40142.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40157.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES-DY  178
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG  T+ NWFKIEK  +  Y
Sbjct  84   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGTLGY  143

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
            K+VFCP     C V+C D+GIY      + L+LSD
Sbjct  144  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|ACO40082.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40094.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40118.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40124.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40128.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40146.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLES-DY  178
            D+N+KF     C + +VW++ K      ++F+ TGG EGNPG  T+ NWFKIEK  +  Y
Sbjct  84   DLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHTLTNWFKIEKAGTLGY  143

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
            K+VFCP     C V+C D+GIY      + L+LSD
Sbjct  144  KLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>ref|XP_006441440.1| hypothetical protein CICLE_v10022156mg [Citrus clementina]
 gb|ESR54680.1| hypothetical protein CICLE_v10022156mg [Citrus clementina]
Length=219

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NVKF     CS+  VW+V  YDE   ++FI TGG EG+PG +T+ NWFK E++ +   
Sbjct  94   DLNVKFSIVDSCSDSLVWKVDNYDEERGKWFITTGGNEGDPGAKTLLNWFKFERIGTSDP  153

Query  176  --YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
              Y+IV+CPSVC+ C  +C +VG+       + +  +D
Sbjct  154  ATYRIVYCPSVCASCLFLCQNVGVSFEDSARRLVLKAD  191



>gb|KDO40321.1| hypothetical protein CISIN_1g028238mg [Citrus sinensis]
Length=211

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +2

Query  2    DINVKFFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD--  175
            D+NVKF     CS+  VW+V  YDE   ++FI TGG EG+PG +T+ NWFK E++ +   
Sbjct  94   DLNVKFSIVDSCSDSLVWKVDNYDEERGKWFITTGGNEGDPGAKTLLNWFKFERIGTSDP  153

Query  176  --YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSD  283
              Y+IV+CPSVC+ C  +C +VG+       + +  +D
Sbjct  154  ATYRIVYCPSVCASCLFLCQNVGVSFEDSARRLVLKAD  191



>ref|XP_004515059.1| PREDICTED: miraculin-like [Cicer arietinum]
Length=204

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 7/108 (6%)
 Frame = +2

Query  2    DINVK--FFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESD  175
            D+N+K  F   T C+   VW++ K    +  +F+ TGGVEGNPG +TI NW+KIEK   D
Sbjct  100  DLNIKSSFTKKTTCAQPPVWKLLKVLSGV--WFLSTGGVEGNPGFQTIGNWYKIEKAGKD  157

Query  176  YKIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKRA  313
            Y + FCPSVC+ C  +C ++G+Y    G K LALSD      V F+RA
Sbjct  158  YVLSFCPSVCN-CHTLCRELGLYTDDKGIKHLALSDQVPSFRVVFQRA  204



>ref|XP_006441443.1| hypothetical protein CICLE_v10023590mg, partial [Citrus clementina]
 gb|ESR54683.1| hypothetical protein CICLE_v10023590mg, partial [Citrus clementina]
Length=74

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  89   YFIVTGGVEGNPGPETIANWFKIEKLESDYKIVFCPSVCSICQVVCDDVGIYVGTGGTKF  268
            +F++  GVEGNPG +T  NWF+IEK   DYK+VFCP VC  C+V+C +VGI++   G + 
Sbjct  1    WFVIIKGVEGNPGLQTTRNWFRIEKFYGDYKLVFCPLVCKFCKVLCSNVGIFM-NDGVQH  59

Query  269  LALSDSPLVVKFKRA  313
            LALSD P  V F +A
Sbjct  60   LALSDVPFNVIFLKA  74



>ref|XP_003534101.1| PREDICTED: 21 kDa seed protein-like [Glycine max]
 gb|KHM99730.1| Miraculin [Glycine soja]
Length=203

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 65/107 (61%), Gaps = 8/107 (7%)
 Frame = +2

Query  2    DINVK-FFTPTVCSNETVWRVGKYDEVLKRYFIVTGGVEGNPGPETIANWFKIEKLESDY  178
            D+N+K +   T C    VW++ K   +   +F+ TGGVEGNPG  T+ NWFKIEK E DY
Sbjct  102  DLNIKSYVKSTTCDKPPVWKLLKV--LTGVWFLSTGGVEGNPGVNTVVNWFKIEKAEKDY  159

Query  179  KIVFCPSVCSICQVVCDDVGIYVGTGGTKFLALSDS--PLVVKFKRA  313
             + FCP   S  Q +C ++G+YVG  G K L+LSD      V FKRA
Sbjct  160  VLSFCP---SFAQTLCRELGLYVGDDGNKHLSLSDKVPSFRVIFKRA  203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1364606714424