BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c90831_g1_i1 len=1462 path=[1440:0-1461]

Length=1462
                                                                      Score     E

dbj|BAH66920.1|  metal transporter                                      379   2e-124   Nicotiana tabacum [American tobacco]
ref|XP_006353723.1|  PREDICTED: zinc transporter 5-like                 378   3e-124   
ref|XP_004243896.1|  PREDICTED: zinc transporter 5-like                 378   3e-124   
ref|XP_011100401.1|  PREDICTED: zinc transporter 8-like                 377   1e-123   
gb|EYU42826.1|  hypothetical protein MIMGU_mgv1a009106mg                376   2e-123   
ref|XP_011100402.1|  PREDICTED: zinc transporter 8-like                 374   3e-122   
ref|XP_010036079.1|  PREDICTED: zinc transporter 8-like                 370   4e-121   
gb|KCW47600.1|  hypothetical protein EUGRSUZ_K01344                     370   9e-121   
ref|XP_008229644.1|  PREDICTED: zinc transporter 8-like                 364   1e-118   
ref|XP_003601469.1|  Zinc transporter                                   365   1e-118   
gb|AES71719.2|  ZIP zinc/iron transport family protein                  364   1e-118   
ref|XP_010036078.1|  PREDICTED: zinc transporter 8-like                 363   2e-118   
ref|XP_003601470.1|  Zinc transporter                                   364   2e-118   
ref|XP_007217784.1|  hypothetical protein PRUPE_ppa020051mg             363   2e-118   
ref|XP_002264621.1|  PREDICTED: zinc transporter 8                      363   3e-118   Vitis vinifera
ref|XP_006429781.1|  hypothetical protein CICLE_v10012062mg             363   3e-118   
ref|XP_008229645.1|  PREDICTED: zinc transporter 8-like                 363   3e-118   
gb|KEH35205.1|  ZIP zinc/iron transport family protein                  363   4e-118   
ref|XP_009769157.1|  PREDICTED: zinc transporter 5-like                 362   4e-118   
ref|XP_006481378.1|  PREDICTED: zinc transporter 8-like                 363   5e-118   
gb|EYU42823.1|  hypothetical protein MIMGU_mgv1a019299mg                362   1e-117   
gb|KCW47598.1|  hypothetical protein EUGRSUZ_K01343                     363   1e-117   
ref|XP_007215607.1|  hypothetical protein PRUPE_ppa007779mg             362   1e-117   
ref|XP_003601468.1|  Zinc transporter                                   365   1e-117   
ref|XP_009363255.1|  PREDICTED: zinc transporter 1-like                 361   2e-117   
gb|KDP35622.1|  hypothetical protein JCGZ_09060                         360   4e-117   
ref|XP_006353722.1|  PREDICTED: zinc transporter 5-like                 360   5e-117   
emb|CAN74488.1|  hypothetical protein VITISV_029272                     360   5e-117   Vitis vinifera
gb|EYU42857.1|  hypothetical protein MIMGU_mgv1a025410mg                360   6e-117   
ref|XP_004293836.1|  PREDICTED: zinc transporter 1-like                 359   1e-116   
gb|AAR08414.1|  metal transport protein                                 360   1e-116   Medicago truncatula
ref|XP_010036080.1|  PREDICTED: zinc transporter 8-like                 358   2e-116   
ref|XP_006429779.1|  hypothetical protein CICLE_v10011940mg             360   2e-116   
ref|XP_002527722.1|  zinc/iron transporter, putative                    358   4e-116   Ricinus communis
ref|XP_006481377.1|  PREDICTED: zinc transporter 8-like                 357   9e-116   
ref|XP_002307858.2|  hypothetical protein POPTR_0006s00840g             356   9e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010093125.1|  Zinc transporter 5                                 357   2e-115   
ref|XP_009610335.1|  PREDICTED: zinc transporter 5                      355   3e-115   
gb|ACJ84426.1|  unknown                                                 355   4e-115   Medicago truncatula
ref|XP_007213802.1|  hypothetical protein PRUPE_ppa007253mg             356   4e-115   
gb|AAR08413.1|  metal transport protein                                 355   7e-115   Medicago truncatula
ref|XP_002307860.2|  zinc transporter protein ZIP1                      354   9e-115   Populus trichocarpa [western balsam poplar]
gb|AFK49414.1|  unknown                                                 354   1e-114   
ref|XP_011002389.1|  PREDICTED: zinc transporter 8-like                 354   1e-114   
gb|KEH35211.1|  ZIP zinc/iron transport family protein                  353   2e-114   
gb|KEH35212.1|  ZIP zinc/iron transport family protein                  353   2e-114   
ref|XP_008371921.1|  PREDICTED: zinc transporter 1-like                 353   3e-114   
ref|XP_010109875.1|  Zinc transporter 1                                 352   7e-114   
ref|XP_008383275.1|  PREDICTED: zinc transporter 1-like                 352   7e-114   
ref|XP_008225897.1|  PREDICTED: zinc transporter 8-like                 352   1e-113   
gb|AFK48496.1|  unknown                                                 350   1e-113   
ref|XP_009775150.1|  PREDICTED: zinc transporter 5-like                 350   2e-113   
ref|XP_004243649.1|  PREDICTED: zinc transporter 5-like                 350   4e-113   
ref|XP_008799797.1|  PREDICTED: zinc transporter 8-like                 348   1e-112   
emb|CAN83129.1|  hypothetical protein VITISV_029537                     350   2e-112   Vitis vinifera
ref|XP_010036084.1|  PREDICTED: zinc transporter 1-like                 348   2e-112   
ref|XP_008357510.1|  PREDICTED: zinc transporter 8-like                 347   3e-112   
ref|XP_008464645.1|  PREDICTED: zinc transporter 5-like                 348   3e-112   
ref|XP_004146060.1|  PREDICTED: zinc transporter 1-like                 348   3e-112   
ref|XP_008378335.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    347   6e-112   
ref|XP_007145986.1|  hypothetical protein PHAVU_006G003300g             347   1e-111   
ref|XP_007022739.1|  Zinc transporter 1 precursor                       347   1e-111   
ref|XP_007145957.1|  hypothetical protein PHAVU_006G001000g             346   1e-111   
emb|CDP16373.1|  unnamed protein product                                347   1e-111   
gb|KHG11077.1|  Zinc transporter 5 -like protein                        346   1e-111   
ref|XP_004167569.1|  PREDICTED: zinc transporter 1-like                 346   2e-111   
ref|XP_008226052.1|  PREDICTED: zinc transporter 1-like                 345   4e-111   
ref|XP_009354003.1|  PREDICTED: zinc transporter 1-like                 345   6e-111   
gb|ADF43066.1|  zinc transporter protein                                344   7e-111   
emb|CBI27217.3|  unnamed protein product                                350   7e-111   
ref|XP_009340286.1|  PREDICTED: zinc transporter 1-like                 344   9e-111   
ref|XP_010260702.1|  PREDICTED: zinc transporter 8-like                 344   9e-111   
gb|AAX28838.1|  zinc transporter protein ZIP2                           343   1e-110   Fragaria x ananassa
ref|XP_011085461.1|  PREDICTED: zinc transporter 5-like                 343   2e-110   
gb|ABH01187.1|  zinc transporter protein                                343   3e-110   Ammopiptanthus mongolicus
ref|XP_007049130.1|  Zinc transporter 5 precursor                       342   6e-110   
ref|XP_009396993.1|  PREDICTED: zinc transporter 8-like                 342   9e-110   
gb|AFK42181.1|  unknown                                                 342   1e-109   
ref|XP_009397090.1|  PREDICTED: zinc transporter 8-like                 340   2e-109   
ref|XP_008378330.1|  PREDICTED: zinc transporter 8-like                 340   2e-109   
ref|XP_011014118.1|  PREDICTED: zinc transporter 1-like                 341   2e-109   
ref|XP_006422260.1|  hypothetical protein CICLE_v10005248mg             340   2e-109   
ref|XP_002274548.2|  PREDICTED: zinc transporter 5                      350   3e-109   Vitis vinifera
ref|XP_007212798.1|  hypothetical protein PRUPE_ppa020164mg             339   3e-109   
gb|AAR08412.1|  metal transport protein                                 339   6e-109   Medicago truncatula
ref|XP_007149187.1|  hypothetical protein PHAVU_005G048900g             339   6e-109   
ref|XP_010922622.1|  PREDICTED: zinc transporter 8-like isoform X1      339   7e-109   
ref|XP_004303952.1|  PREDICTED: zinc transporter 1-like                 339   7e-109   
ref|XP_002315075.2|  metal transport family protein                     339   9e-109   Populus trichocarpa [western balsam poplar]
ref|XP_010922623.1|  PREDICTED: zinc transporter 8-like isoform X2      338   1e-108   
ref|XP_002264603.2|  PREDICTED: zinc transporter 1                      338   2e-108   Vitis vinifera
emb|CAN72264.1|  hypothetical protein VITISV_008114                     338   2e-108   Vitis vinifera
emb|CAN72265.1|  hypothetical protein VITISV_008115                     338   3e-108   Vitis vinifera
ref|XP_002312231.1|  metal transport family protein                     337   5e-108   Populus trichocarpa [western balsam poplar]
gb|KDP23905.1|  hypothetical protein JCGZ_27105                         337   6e-108   
gb|AID21515.1|  ZIP transporter                                         336   8e-108   
emb|CDP03480.1|  unnamed protein product                                336   9e-108   
ref|XP_006493801.1|  PREDICTED: zinc transporter 1-like                 339   2e-107   
ref|XP_006422259.1|  hypothetical protein CICLE_v10005306mg             335   2e-107   
ref|XP_011014627.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    335   2e-107   
ref|XP_002532140.1|  zinc/iron transporter, putative                    335   3e-107   Ricinus communis
ref|XP_009400783.1|  PREDICTED: zinc transporter 8-like                 333   1e-106   
ref|XP_003546826.1|  PREDICTED: zinc transporter 1-like                 333   1e-106   
ref|XP_007049047.1|  Zinc transporter 5 precursor                       333   1e-106   
ref|XP_009794548.1|  PREDICTED: zinc transporter 8-like                 333   2e-106   
gb|KHN48870.1|  Zinc transporter 1                                      332   2e-106   
ref|XP_006858211.1|  hypothetical protein AMTR_s00062p00183460          332   4e-106   
gb|KCW88546.1|  hypothetical protein EUGRSUZ_A00918                     332   7e-106   
ref|XP_004502089.1|  PREDICTED: zinc transporter 5-like                 331   1e-105   
ref|XP_010044870.1|  PREDICTED: zinc transporter 1-like                 331   2e-105   
ref|XP_006658416.1|  PREDICTED: zinc transporter 8-like                 328   2e-105   
gb|AAX28837.1|  zinc transporter protein ZIP1                           330   2e-105   Fragaria x ananassa
ref|XP_002265102.1|  PREDICTED: zinc transporter 8                      330   3e-105   Vitis vinifera
gb|KHN21378.1|  Zinc transporter 1                                      329   4e-105   
gb|AFN88220.1|  zinc transporter protein                                329   6e-105   
emb|CAN67594.1|  hypothetical protein VITISV_000700                     329   6e-105   Vitis vinifera
ref|XP_008447078.1|  PREDICTED: zinc transporter 1                      329   7e-105   
ref|XP_003531480.1|  PREDICTED: zinc transporter 1-like                 329   8e-105   
ref|NP_001059239.1|  Os07g0232800                                       328   1e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009379338.1|  PREDICTED: zinc transporter 8-like                 328   2e-104   
ref|XP_004139841.1|  PREDICTED: zinc transporter 1-like                 328   2e-104   
ref|XP_004231600.1|  PREDICTED: zinc transporter 8-like                 327   2e-104   
ref|XP_008792254.1|  PREDICTED: zinc transporter 8-like                 327   3e-104   
emb|CAN83128.1|  hypothetical protein VITISV_029536                     327   3e-104   Vitis vinifera
gb|AAP92123.1|  iron transporter Fe2                                    327   5e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004306552.1|  PREDICTED: zinc transporter 1-like                 326   1e-103   
gb|ACU24645.1|  unknown                                                 325   2e-103   Glycine max [soybeans]
ref|XP_006363493.1|  PREDICTED: zinc transporter 8-like                 325   3e-103   
ref|XP_010931295.1|  PREDICTED: zinc transporter 8-like                 325   3e-103   
ref|XP_010275878.1|  PREDICTED: zinc transporter 5-like                 323   1e-102   
ref|XP_009625957.1|  PREDICTED: zinc transporter 8-like                 323   1e-102   
ref|XP_004961773.1|  PREDICTED: zinc transporter 9-like                 323   2e-102   
ref|XP_010051825.1|  PREDICTED: zinc transporter 1-like                 323   3e-102   
ref|XP_004488546.1|  PREDICTED: zinc transporter 1-like                 320   3e-101   
ref|XP_002461715.1|  hypothetical protein SORBIDRAFT_02g006960          320   6e-101   Sorghum bicolor [broomcorn]
emb|CDP16431.1|  unnamed protein product                                317   7e-101   
ref|XP_003557360.1|  PREDICTED: zinc transporter 8-like                 319   7e-101   
ref|XP_010941688.1|  PREDICTED: zinc transporter 4                      318   1e-100   
ref|XP_008799796.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    318   1e-100   
gb|EMT08252.1|  Zinc transporter 1                                      318   2e-100   
gb|EPS66222.1|  zinc transporter protein                                317   2e-100   
ref|XP_007041017.1|  Zinc transporter 1 precursor                       325   3e-100   
ref|XP_006468557.1|  PREDICTED: zinc transporter 8-like isoform X2      317   3e-100   
ref|XP_010044860.1|  PREDICTED: zinc transporter 5-like                 317   4e-100   
gb|EMT08251.1|  Zinc transporter 1                                      317   7e-100   
ref|XP_006448619.1|  hypothetical protein CICLE_v10015713mg             316   8e-100   
ref|XP_009402753.1|  PREDICTED: zinc transporter 8-like                 315   1e-99    
ref|XP_010260697.1|  PREDICTED: zinc transporter 8-like                 326   1e-99    
gb|ABF55690.1|  putative zinc transporter                               315   5e-99    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ25747.1|  zinc transporter                                       314   9e-99    
gb|EAZ03299.1|  hypothetical protein OsI_25442                          314   1e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_003542170.1|  PREDICTED: zinc transporter 8-like isoform X1      312   1e-98    
ref|XP_009393263.1|  PREDICTED: zinc transporter 4-like                 312   2e-98    
gb|EYU33801.1|  hypothetical protein MIMGU_mgv1a008434mg                313   3e-98    
ref|XP_010922625.1|  PREDICTED: zinc transporter 8-like                 311   3e-98    
ref|XP_004976446.1|  PREDICTED: zinc transporter 9-like                 311   4e-98    
ref|XP_011095751.1|  PREDICTED: zinc transporter 1-like                 311   4e-98    
dbj|BAJ91221.1|  predicted protein                                      312   7e-98    
ref|XP_009384788.1|  PREDICTED: zinc transporter 5-like                 313   7e-98    
ref|XP_006468556.1|  PREDICTED: zinc transporter 8-like isoform X1      311   8e-98    
gb|KDO77256.1|  hypothetical protein CISIN_1g018362mg                   310   1e-97    
ref|XP_009419521.1|  PREDICTED: zinc transporter 3-like                 312   1e-97    
emb|CBI34138.3|  unnamed protein product                                309   3e-97    
ref|XP_007212363.1|  hypothetical protein PRUPE_ppa014732mg             309   4e-97    
dbj|BAK07315.1|  predicted protein                                      309   5e-97    
ref|XP_008812441.1|  PREDICTED: zinc transporter 3-like                 311   6e-97    
gb|EMT15077.1|  Zinc transporter 1                                      311   9e-97    
ref|XP_006468555.1|  PREDICTED: zinc transporter 5-like                 308   1e-96    
emb|CDP03484.1|  unnamed protein product                                307   1e-96    
dbj|BAJ90473.1|  predicted protein                                      309   1e-96    
ref|XP_008225896.1|  PREDICTED: zinc transporter 5-like                 307   1e-96    
gb|ACN38063.1|  zinc transporter protein                                308   2e-96    Sedum alfredii
ref|NP_001236499.1|  zinc transporter protein ZIP1 precursor            307   2e-96    
ref|XP_010922621.1|  PREDICTED: zinc transporter 8-like                 306   6e-96    
ref|XP_010693319.1|  PREDICTED: zinc transporter 1-like                 306   8e-96    
gb|AAC17441.1|  root iron transporter protein                           304   3e-95    Pisum sativum [garden pea]
ref|XP_009363363.1|  PREDICTED: zinc transporter 8-like                 301   2e-94    
gb|ACN93833.1|  metal ion transporter ZIP5                              302   2e-94    Hordeum vulgare [barley]
gb|EYU27582.1|  hypothetical protein MIMGU_mgv1a008839mg                302   3e-94    
ref|XP_002445166.1|  hypothetical protein SORBIDRAFT_07g005140          302   3e-94    Sorghum bicolor [broomcorn]
ref|XP_011035492.1|  PREDICTED: zinc transporter 1-like                 301   5e-94    
ref|XP_003568257.1|  PREDICTED: zinc transporter 9-like                 301   1e-93    
gb|KCW47601.1|  hypothetical protein EUGRSUZ_K01345                     298   1e-93    
gb|EMS45894.1|  Zinc transporter 5                                      298   1e-93    
ref|XP_008371976.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    300   1e-93    
gb|EMS55273.1|  Zinc transporter 8                                      302   3e-93    
gb|KHG04713.1|  Zinc transporter 1 -like protein                        298   5e-93    
ref|XP_009363337.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    297   8e-93    
ref|XP_010691362.1|  PREDICTED: zinc transporter 1-like                 298   9e-93    
ref|XP_002879377.1|  hypothetical protein ARALYDRAFT_320968             297   1e-92    
ref|XP_007213568.1|  hypothetical protein PRUPE_ppa015743mg             294   2e-92    
ref|XP_010557015.1|  PREDICTED: zinc transporter 5-like                 296   3e-92    
gb|ACN93834.1|  metal ion transporter ZIP8                              296   3e-92    Hordeum vulgare [barley]
emb|CDP18202.1|  unnamed protein product                                296   3e-92    
ref|XP_011096784.1|  PREDICTED: fe(2+) transport protein 2              296   5e-92    
ref|XP_010242082.1|  PREDICTED: fe(2+) transport protein 1-like         296   6e-92    
ref|XP_006363198.1|  PREDICTED: zinc transporter 5-like                 295   6e-92    
gb|AAY29147.1|  Zrt- and Irt-related protein 3                          294   1e-91    Arabidopsis halleri subsp. gemmifera
ref|XP_010676218.1|  PREDICTED: zinc transporter 1-like                 295   1e-91    
gb|KDP31427.1|  hypothetical protein JCGZ_11803                         294   1e-91    
ref|XP_006418042.1|  hypothetical protein EUTSA_v10008057mg             294   2e-91    
ref|XP_004232649.1|  PREDICTED: zinc transporter 3-like                 293   5e-91    
ref|XP_003607852.1|  Zinc transporter                                   293   5e-91    
ref|XP_008243768.1|  PREDICTED: fe(2+) transport protein 1-like         293   5e-91    
ref|XP_009802160.1|  PREDICTED: probable zinc transporter 10            293   5e-91    
gb|AFK47100.1|  unknown                                                 292   8e-91    
ref|XP_009412061.1|  PREDICTED: zinc transporter 3-like                 294   1e-90    
ref|XP_010522316.1|  PREDICTED: zinc transporter 5                      291   1e-90    
emb|CDP17625.1|  unnamed protein product                                292   1e-90    
ref|XP_007225019.1|  hypothetical protein PRUPE_ppa020099mg             292   1e-90    
ref|XP_009141213.1|  PREDICTED: zinc transporter 3-like                 291   1e-90    
ref|XP_006654534.1|  PREDICTED: zinc transporter 5-like                 292   1e-90    
ref|NP_001055818.1|  Os05g0472700                                       292   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|NP_180786.1|  zinc transporter 3                                    291   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293827.1|  PREDICTED: zinc transporter 8-like isoform 1       291   2e-90    
ref|XP_010544345.1|  PREDICTED: zinc transporter 1                      291   2e-90    
ref|XP_009772860.1|  PREDICTED: probable zinc transporter 10            291   2e-90    
ref|XP_010475216.1|  PREDICTED: zinc transporter 5-like                 291   4e-90    
ref|XP_010242080.1|  PREDICTED: fe(2+) transport protein 1-like         291   4e-90    
ref|XP_003566152.1|  PREDICTED: zinc transporter 5-like                 291   4e-90    
emb|CDY48278.1|  BnaA05g10760D                                          290   4e-90    
ref|XP_002282425.1|  PREDICTED: fe(2+) transport protein 1              291   5e-90    Vitis vinifera
ref|XP_007045694.1|  Zinc transporter 7 precursor, putative             291   5e-90    
emb|CAI77926.2|  hypothetical protein                                   290   7e-90    Noccaea caerulescens
ref|XP_006362613.1|  PREDICTED: fe(2+) transport protein 1-like         290   8e-90    
ref|XP_006295925.1|  hypothetical protein CARUB_v10025062mg             290   8e-90    
gb|AAC24199.1|  putative zinc transporter                               290   8e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002514554.1|  zinc/iron transporter, putative                    290   1e-89    Ricinus communis
ref|XP_006410360.1|  hypothetical protein EUTSA_v10016884mg             289   1e-89    
ref|XP_010557016.1|  PREDICTED: zinc transporter 3-like                 290   1e-89    
ref|XP_002884924.1|  hypothetical protein ARALYDRAFT_897485             289   2e-89    
ref|XP_002322355.2|  root iron transporter family protein               288   2e-89    Populus trichocarpa [western balsam poplar]
ref|NP_172022.1|  zinc transporter 5                                    289   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143963.1|  PREDICTED: zinc transporter 3                      288   2e-89    
ref|XP_011040375.1|  PREDICTED: fe(2+) transport protein 1-like         288   4e-89    
ref|XP_009772024.1|  PREDICTED: zinc transporter 1-like                 288   6e-89    
ref|XP_008225789.1|  PREDICTED: fe(2+) transport protein 1-like         288   6e-89    
ref|XP_007214341.1|  hypothetical protein PRUPE_ppa027114mg             288   6e-89    
gb|AAR08416.1|  metal transport protein                                 288   7e-89    Medicago truncatula
ref|XP_010469621.1|  PREDICTED: zinc transporter 3                      287   7e-89    
ref|XP_011085164.1|  PREDICTED: probable zinc transporter 10            287   7e-89    
ref|NP_001234248.1|  iron-regulated transporter 1 precursor             287   9e-89    
ref|XP_010538635.1|  PREDICTED: probable zinc transporter 12            287   9e-89    
ref|XP_002315981.2|  zinc transporter 7 precursor family protein        287   1e-88    Populus trichocarpa [western balsam poplar]
gb|AFK33510.1|  unknown                                                 287   1e-88    
ref|XP_011009052.1|  PREDICTED: fe(2+) transport protein 1-like         287   1e-88    
ref|XP_010484879.1|  PREDICTED: zinc transporter 5                      287   1e-88    
ref|XP_009622108.1|  PREDICTED: fe(2+) transport protein 1-like         287   1e-88    
ref|XP_008439828.1|  PREDICTED: fe(2+) transport protein 1-like         286   1e-88    
ref|XP_006448755.1|  hypothetical protein CICLE_v10015769mg             286   2e-88    
ref|XP_009608181.1|  PREDICTED: zinc transporter 1-like                 287   2e-88    
ref|NP_187881.1|  zinc transporter 1                                    286   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004961772.1|  PREDICTED: zinc transporter 5-like                 286   2e-88    
ref|XP_002892281.1|  hypothetical protein ARALYDRAFT_470527             286   3e-88    
dbj|BAJ85179.1|  predicted protein                                      286   3e-88    
ref|XP_006362610.1|  PREDICTED: probable zinc transporter 10-like       286   3e-88    
ref|XP_010457615.1|  PREDICTED: zinc transporter 5-like                 286   3e-88    
ref|XP_006362611.1|  PREDICTED: fe(2+) transport protein 1-like i...    285   3e-88    
ref|XP_006305175.1|  hypothetical protein CARUB_v10009542mg             286   4e-88    
ref|XP_010510059.1|  PREDICTED: zinc transporter 3-like                 285   4e-88    
ref|XP_009604609.1|  PREDICTED: fe(2+) transport protein 1-like         286   4e-88    
ref|XP_010487001.1|  PREDICTED: zinc transporter 1-like                 286   4e-88    
ref|XP_006468430.1|  PREDICTED: probable zinc transporter 10-like       285   5e-88    
gb|ADA83724.1|  ZIP                                                     281   5e-88    Manihot esculenta [manioc]
ref|XP_007163951.1|  hypothetical protein PHAVU_L002700g                285   5e-88    
ref|XP_002322353.2|  hypothetical protein POPTR_0015s15750g             284   6e-88    Populus trichocarpa [western balsam poplar]
gb|ADC35581.2|  iron-regulated transporter                              284   6e-88    Amaranthus tricolor [Chinese spinach]
ref|XP_010499439.1|  PREDICTED: zinc transporter 1                      285   6e-88    
emb|CDY66215.1|  BnaC05g49110D                                          285   1e-87    
ref|XP_010092655.1|  putative zinc transporter 10                       285   1e-87    
gb|EYU25669.1|  hypothetical protein MIMGU_mgv1a009036mg                285   1e-87    
ref|XP_006853448.1|  hypothetical protein AMTR_s00032p00184330          284   1e-87    
gb|EYU17732.1|  hypothetical protein MIMGU_mgv1a009083mg                285   1e-87    
ref|XP_008459065.1|  PREDICTED: fe(2+) transport protein 1              284   1e-87    
ref|NP_001240277.1|  uncharacterized protein LOC100795511 precursor     285   1e-87    
ref|XP_004145454.1|  PREDICTED: probable zinc transporter 10-like       284   1e-87    
emb|CAI77925.2|  putative Zn transporter                                284   1e-87    Noccaea caerulescens
ref|XP_004157744.1|  PREDICTED: probable zinc transporter 10-like       284   1e-87    
ref|XP_007157804.1|  hypothetical protein PHAVU_002G099700g             284   2e-87    
gb|EYU40848.1|  hypothetical protein MIMGU_mgv1a019253mg                284   2e-87    
ref|XP_009759352.1|  PREDICTED: zinc transporter 1-like                 284   2e-87    
ref|XP_009757202.1|  PREDICTED: fe(2+) transport protein 1-like         284   2e-87    
gb|AAT01414.1|  iron regulated transporter                              283   3e-87    
ref|XP_002510959.1|  zinc/iron transporter, putative                    283   3e-87    
dbj|BAJ34313.1|  unnamed protein product                                283   3e-87    
ref|XP_004293739.1|  PREDICTED: probable zinc transporter 10-like       283   4e-87    
ref|XP_006407300.1|  hypothetical protein EUTSA_v10021018mg             283   4e-87    
ref|XP_010465054.1|  PREDICTED: zinc transporter 1-like                 283   4e-87    
emb|CDY42175.1|  BnaC05g40440D                                          283   5e-87    
ref|XP_010414019.1|  PREDICTED: zinc transporter 3-like                 282   5e-87    
gb|EYU24106.1|  hypothetical protein MIMGU_mgv1a023920mg                283   7e-87    
emb|CDY46862.1|  BnaA10g03460D                                          283   7e-87    
ref|XP_009119168.1|  PREDICTED: zinc transporter 5                      282   7e-87    
ref|XP_010058638.1|  PREDICTED: fe(2+) transport protein 1-like         283   8e-87    
ref|XP_009146590.1|  PREDICTED: zinc transporter 1                      282   8e-87    
ref|NP_001234252.1|  iron-regulated transporter 2 precursor             282   1e-86    
gb|KFK42876.1|  hypothetical protein AALP_AA1G050300                    282   1e-86    
ref|XP_009795595.1|  PREDICTED: fe(2+) transport protein 1-like         283   1e-86    
gb|ACU22900.1|  unknown                                                 281   2e-86    
ref|XP_009597526.1|  PREDICTED: zinc transporter 5-like                 281   2e-86    
ref|XP_006303204.1|  hypothetical protein CARUB_v10011177mg             281   2e-86    
ref|XP_009398318.1|  PREDICTED: fe(2+) transport protein 1-like         281   2e-86    
ref|XP_009796658.1|  PREDICTED: fe(2+) transport protein 1-like         281   2e-86    
ref|XP_008390030.1|  PREDICTED: fe(2+) transport protein 1-like         281   2e-86    
ref|XP_006299048.1|  hypothetical protein CARUB_v10015186mg             281   3e-86    
ref|XP_010056627.1|  PREDICTED: fe(2+) transport protein 1-like         281   3e-86    
ref|XP_010058645.1|  PREDICTED: fe(2+) transport protein 1-like         281   3e-86    
gb|KFK38622.1|  hypothetical protein AALP_AA3G138000                    280   3e-86    
ref|XP_006484359.1|  PREDICTED: fe(2+) transport protein 1-like         280   4e-86    
gb|AAG44949.1|AF292029_1  putative Zn transport protein                 280   4e-86    
ref|XP_006437816.1|  hypothetical protein CICLE_v10033475mg             280   4e-86    
ref|XP_010554256.1|  PREDICTED: zinc transporter 7 isoform X1           280   5e-86    
gb|EYU43694.1|  hypothetical protein MIMGU_mgv1a008730mg                280   8e-86    
ref|XP_002439944.1|  hypothetical protein SORBIDRAFT_09g023160          280   8e-86    
ref|XP_007049049.1|  Zinc transporter 5 precursor                       279   1e-85    
ref|XP_010091672.1|  Fe(2+) transport protein 1                         279   1e-85    
ref|XP_004233216.1|  PREDICTED: fe(2+) transport protein 1-like         279   1e-85    
gb|EPS63182.1|  hypothetical protein M569_11603                         278   2e-85    
ref|XP_006853446.1|  hypothetical protein AMTR_s00032p00182850          278   2e-85    
gb|AAP92124.1|  iron transporter Fe3                                    279   2e-85    
ref|XP_002273179.1|  PREDICTED: probable zinc transporter 10            278   3e-85    
ref|NP_001050853.1|  Os03g0667500                                       279   3e-85    
ref|NP_001274385.1|  probable zinc transporter 10-like precursor        278   5e-85    
ref|XP_003581657.2|  PREDICTED: zinc transporter 3-like isoform X1      278   5e-85    
ref|XP_006369054.1|  zinc transporter protein ZIP1                      275   6e-85    
ref|XP_009357272.1|  PREDICTED: fe(2+) transport protein 1-like         278   6e-85    
ref|XP_009377533.1|  PREDICTED: fe(2+) transport protein 1-like         277   7e-85    
gb|KHG00477.1|  putative zinc transporter 8 -like protein               277   8e-85    
gb|EYU31714.1|  hypothetical protein MIMGU_mgv1a024137mg                277   8e-85    
emb|CDY19126.1|  BnaA04g18660D                                          277   1e-84    
ref|XP_010481654.1|  PREDICTED: fe(2+) transport protein 1-like         276   1e-84    
ref|XP_002875245.1|  hypothetical protein ARALYDRAFT_484307             277   1e-84    
ref|XP_010252544.1|  PREDICTED: fe(2+) transport protein 1-like         276   2e-84    
ref|XP_010686669.1|  PREDICTED: zinc transporter 7-like                 276   3e-84    
ref|XP_010056628.1|  PREDICTED: fe(2+) transport protein 1-like         276   3e-84    
ref|XP_006398157.1|  hypothetical protein EUTSA_v10000942mg             276   3e-84    
ref|XP_010494573.1|  PREDICTED: fe(2+) transport protein 1-like i...    276   3e-84    
ref|XP_008371846.1|  PREDICTED: probable zinc transporter 10            276   3e-84    
gb|AAO17059.1|  root iron transporter protein IRT1                      276   4e-84    
ref|XP_006398156.1|  hypothetical protein EUTSA_v10000941mg             275   4e-84    
ref|XP_007024894.1|  Zinc transporter 10 precursor                      277   4e-84    
ref|XP_002863526.1|  hypothetical protein ARALYDRAFT_330887             275   5e-84    
ref|XP_006652807.1|  PREDICTED: zinc transporter 3-like                 275   6e-84    
ref|XP_010460952.1|  PREDICTED: probable zinc transporter 10 isof...    275   1e-83    
ref|XP_010478570.1|  PREDICTED: probable zinc transporter 10            275   1e-83    
ref|XP_004298331.1|  PREDICTED: fe(2+) transport protein 1-like         273   1e-83    
ref|XP_006282128.1|  hypothetical protein CARUB_v10028380mg             274   1e-83    
ref|XP_008806707.1|  PREDICTED: fe(2+) transport protein 1-like         274   2e-83    
ref|XP_010908609.1|  PREDICTED: fe(2+) transport protein 1-like         273   2e-83    
ref|XP_006306526.1|  hypothetical protein CARUB_v10012540mg             274   2e-83    
ref|XP_010494574.1|  PREDICTED: fe(2+) transport protein 1-like i...    272   3e-83    
ref|XP_004134951.1|  PREDICTED: zinc transporter 7-like                 273   4e-83    
ref|XP_010476366.1|  PREDICTED: zinc transporter 7-like                 273   4e-83    
ref|XP_002273397.1|  PREDICTED: fe(2+) transport protein 1              273   4e-83    
emb|CDY15345.1|  BnaC04g42780D                                          274   4e-83    
ref|XP_010908608.1|  PREDICTED: LOW QUALITY PROTEIN: fe(2+) trans...    273   4e-83    
dbj|BAJ87579.1|  predicted protein                                      273   5e-83    
ref|XP_009400959.1|  PREDICTED: zinc transporter 8-like                 271   7e-83    
gb|ACN93832.1|  metal ion transporter ZIP3                              272   7e-83    
gb|EAZ28054.1|  hypothetical protein OsJ_12020                          272   7e-83    
gb|EAY95519.1|  hypothetical protein OsI_17365                          272   8e-83    
ref|XP_008787315.1|  PREDICTED: fe(2+) transport protein 1              272   1e-82    
ref|NP_001053851.1|  Os04g0613000                                       271   2e-82    
ref|XP_004293828.1|  PREDICTED: zinc transporter 8-like isoform 2       270   2e-82    
ref|XP_010499676.1|  PREDICTED: probable zinc transporter 10            271   2e-82    
ref|XP_010673172.1|  PREDICTED: zinc transporter 7-like                 271   3e-82    
emb|CDP17626.1|  unnamed protein product                                270   3e-82    
ref|XP_006417109.1|  hypothetical protein EUTSA_v10009476mg             270   4e-82    
gb|ABF55689.1|  putative zinc transporter                               270   4e-82    
emb|CDY02372.1|  BnaA09g25300D                                          270   4e-82    
gb|ACJ85162.1|  unknown                                                 270   5e-82    
ref|XP_010538316.1|  PREDICTED: probable zinc transporter 10            270   5e-82    
gb|KHG00478.1|  putative zinc transporter 10 -like protein              270   5e-82    
ref|NP_001050851.2|  Os03g0667300                                       270   5e-82    
ref|XP_010495426.1|  PREDICTED: zinc transporter 7-like                 270   6e-82    
gb|AAU89149.1|  iron-regulated transporter, putative                    270   6e-82    
gb|KFK41852.1|  hypothetical protein AALP_AA2G179200                    270   7e-82    
ref|XP_002891116.1|  hypothetical protein ARALYDRAFT_313960             270   8e-82    
gb|ADE87884.1|  zinc transporter ZIP1                                   269   9e-82    
gb|AAW68439.1|  zinc transporter ZIP                                    269   1e-81    
gb|ADE87887.1|  zinc transporter ZIP1                                   269   1e-81    
ref|XP_011087053.1|  PREDICTED: zinc transporter 1-like                 266   1e-81    
ref|NP_174411.2|  putative zinc transporter 10                          268   2e-81    
sp|Q0DHE3.3|ZIP9_ORYSJ  RecName: Full=Zinc transporter 9; AltName...    268   2e-81    
emb|CDY51626.1|  BnaCnng21180D                                          268   3e-81    
ref|XP_006413939.1|  hypothetical protein EUTSA_v10025627mg             267   4e-81    
ref|XP_009108125.1|  PREDICTED: probable zinc transporter 10            268   4e-81    
emb|CDY27157.1|  BnaA08g07950D                                          267   5e-81    
ref|XP_002869968.1|  Fe(II) transport protein IRT1                      267   5e-81    
ref|XP_003520144.1|  PREDICTED: fe(2+) transport protein 1-like         267   5e-81    
ref|XP_004301422.1|  PREDICTED: fe(2+) transport protein 1-like         266   7e-81    
ref|XP_004490323.1|  PREDICTED: fe(2+) transport protein 1-like         266   1e-80    
ref|XP_002448514.1|  hypothetical protein SORBIDRAFT_06g028270          266   1e-80    
ref|NP_001152110.1|  zinc transporter 10 precursor                      267   1e-80    
ref|XP_009388364.1|  PREDICTED: fe(2+) transport protein 1-like         265   2e-80    
gb|KFK44912.1|  hypothetical protein AALP_AA1G318900                    266   2e-80    
gb|ADI24871.1|  zinc transporter                                        266   3e-80    
ref|XP_008649739.1|  PREDICTED: zinc transporter 5-like                 265   4e-80    
dbj|BAD94060.1|  putative root iron transporter protein                 265   4e-80    
ref|NP_178488.1|  zinc transporter 7                                    265   5e-80    
ref|XP_008678193.1|  PREDICTED: zinc transporter 4-like                 266   5e-80    
ref|XP_010458812.1|  PREDICTED: zinc transporter 7-like                 265   5e-80    
ref|NP_001149008.1|  zinc transporter 1 precursor                       265   6e-80    
gb|ACR14982.1|  iron-regulated transporter 1                            264   6e-80    
ref|XP_006285709.1|  hypothetical protein CARUB_v10007180mg             264   8e-80    
ref|XP_006651668.1|  PREDICTED: fe(2+) transport protein 2-like         265   8e-80    
ref|XP_004982221.1|  PREDICTED: fe(2+) transport protein 1-like         265   9e-80    
ref|XP_004976785.1|  PREDICTED: zinc transporter 3-like                 264   9e-80    
emb|CDY12221.1|  BnaC04g12510D                                          265   1e-79    
ref|XP_010943751.1|  PREDICTED: fe(2+) transport protein 1-like         263   1e-79    
gb|AET05397.2|  ZIP zinc/iron transport family protein                  265   2e-79    
ref|XP_004986332.1|  PREDICTED: fe(2+) transport protein 2-like         264   2e-79    
ref|NP_567590.3|  Fe(2+) transport protein 1                            262   3e-79    
gb|AAB01678.1|  Fe(II) transport protein                                262   4e-79    
ref|XP_009115004.1|  PREDICTED: probable zinc transporter 10            263   4e-79    
ref|XP_006395658.1|  hypothetical protein EUTSA_v10005271mg             263   4e-79    
emb|CAE30485.1|  Fe(II) transport protein IRT1                          262   5e-79    
emb|CAN77100.1|  hypothetical protein VITISV_033551                     269   6e-79    
ref|XP_002464108.1|  hypothetical protein SORBIDRAFT_01g012430          263   7e-79    
emb|CDY65204.1|  BnaCnng46020D                                          261   7e-79    
ref|XP_006415352.1|  hypothetical protein EUTSA_v10007930mg             262   8e-79    
gb|ACD71460.1|  metal ion transporter-like protein                      262   9e-79    
ref|XP_004489301.1|  PREDICTED: zinc transporter 3-like                 261   9e-79    
ref|XP_002464109.1|  hypothetical protein SORBIDRAFT_01g012440          262   1e-78    
ref|XP_009133165.1|  PREDICTED: fe(2+) transport protein 1-like         261   1e-78    
ref|XP_003630921.1|  Iron regulated transporter                         265   1e-78    
ref|XP_009133184.1|  PREDICTED: fe(2+) transport protein 1              260   2e-78    
gb|KFK28622.1|  hypothetical protein AALP_AA7G023400                    260   2e-78    
gb|EMS62352.1|  Fe(2+) transport protein 1                              266   3e-78    
ref|XP_010439662.1|  PREDICTED: fe(2+) transport protein 1              259   3e-78    
ref|XP_010449308.1|  PREDICTED: fe(2+) transport protein 1-like         259   3e-78    
emb|CDY65203.1|  BnaCnng46010D                                          259   4e-78    
ref|XP_008665793.1|  PREDICTED: fe(2+) transport protein 2-like         260   4e-78    
emb|CDY01612.1|  BnaC07g36020D                                          259   5e-78    
ref|XP_007156150.1|  hypothetical protein PHAVU_003G262400g             259   6e-78    
ref|XP_010480798.1|  PREDICTED: LOW QUALITY PROTEIN: probable zin...    259   7e-78    
emb|CAL25151.1|  putative Fe(II) transporter 1                          259   8e-78    
ref|XP_007156151.1|  hypothetical protein PHAVU_003G262500g             258   8e-78    
ref|XP_010434368.1|  PREDICTED: fe(2+) transport protein 1-like         258   1e-77    
ref|XP_003571530.1|  PREDICTED: zinc transporter 4-like                 261   1e-77    
ref|XP_010691361.1|  PREDICTED: zinc transporter 3-like                 258   1e-77    
gb|AAR87185.1|  putative metal transporter (with alternative spli...    259   2e-77    
ref|XP_009133175.1|  PREDICTED: fe(2+) transport protein 1-like         257   2e-77    
gb|EMT27861.1|  Putative zinc transporter 10                            258   3e-77    
ref|XP_010229515.1|  PREDICTED: fe(2+) transport protein 1-like         257   3e-77    
ref|XP_010538610.1|  PREDICTED: fe(2+) transport protein 1              257   5e-77    
gb|KEH35208.1|  ZIP zinc/iron transport family protein                  253   7e-77    
emb|CAL25150.1|  putative Fe (II) transporter 1                         256   8e-77    
ref|XP_009137017.1|  PREDICTED: fe(2+) transport protein 1-like         256   9e-77    
ref|XP_010686504.1|  PREDICTED: fe(2+) transport protein 1-like         257   1e-76    
gb|KCW88549.1|  hypothetical protein EUGRSUZ_A00921                     254   1e-76    
ref|XP_009128761.1|  PREDICTED: probable zinc transporter 8 isofo...    255   1e-76    
emb|CBI34137.3|  unnamed protein product                                248   2e-76    
emb|CBI20663.3|  unnamed protein product                                255   3e-76    
emb|CDX98631.1|  BnaA03g44160D                                          254   3e-76    
emb|CDP18204.1|  unnamed protein product                                250   4e-76    
gb|KFK44913.1|  hypothetical protein AALP_AA1G319000                    254   6e-76    
sp|Q8S3W4.1|ZIP8_ARATH  RecName: Full=Probable zinc transporter 8...    253   9e-76    
ref|XP_002466763.1|  hypothetical protein SORBIDRAFT_01g013660          254   1e-75    
gb|AFJ05595.1|  iron-regulated transporter 1                            253   1e-75    
ref|XP_010481652.1|  PREDICTED: probable zinc transporter 8 isofo...    253   2e-75    
emb|CDP08261.1|  unnamed protein product                                254   2e-75    
ref|XP_006655401.1|  PREDICTED: zinc transporter 9-like                 251   4e-75    
gb|EYU28997.1|  hypothetical protein MIMGU_mgv1a023045mg                251   4e-75    
ref|XP_010494576.1|  PREDICTED: probable zinc transporter 8             251   5e-75    
ref|XP_002863525.1|  hypothetical protein ARALYDRAFT_330886             250   9e-75    
ref|XP_010441786.1|  PREDICTED: probable zinc transporter 8 isofo...    250   1e-74    
ref|XP_006413940.1|  hypothetical protein EUTSA_v10025555mg             250   2e-74    
ref|XP_010483928.1|  PREDICTED: probable zinc transporter 12            250   2e-74    
emb|CAC86382.1|  putative Fe(II) transporter                            249   3e-74    
gb|KCW73436.1|  hypothetical protein EUGRSUZ_E01913                     246   7e-74    
gb|KFK27947.1|  hypothetical protein AALP_AA8G451900                    248   8e-74    
ref|XP_008344969.1|  PREDICTED: zinc transporter 8-like                 243   9e-74    
ref|XP_010458321.1|  PREDICTED: probable zinc transporter 12            248   1e-73    
gb|KFK31140.1|  hypothetical protein AALP_AA6G073900                    249   2e-73    
gb|AAL38436.1|AF369913_1  putative metal transporter ZIP10              247   2e-73    
ref|XP_002864774.1|  predicted protein                                  247   3e-73    
ref|XP_006282196.1|  hypothetical protein CARUB_v10028462mg             247   3e-73    
gb|AAY29150.1|  Zrt- and Irt-related protein 12                         246   9e-73    
gb|AES73400.2|  ZIP zinc/iron transport family protein                  245   2e-72    
ref|XP_010444067.1|  PREDICTED: probable zinc transporter 12            244   3e-72    
emb|CDY44832.1|  BnaCnng11880D                                          244   3e-72    
ref|XP_010434369.1|  PREDICTED: fe(2+) transport protein 2-like         243   7e-72    
ref|XP_010439663.1|  PREDICTED: fe(2+) transport protein 2              243   7e-72    
sp|O04089.1|ZIP4_ARATH  RecName: Full=Zinc transporter 4, chlorop...    244   8e-72    
ref|XP_001754592.1|  ZIP family transporter                             243   9e-72    
gb|KEH35209.1|  ZIP zinc/iron transport family protein                  238   1e-71    
emb|CDY03774.1|  BnaC01g28910D                                          243   1e-71    
ref|XP_010449310.1|  PREDICTED: fe(2+) transport protein 2-like i...    242   2e-71    
ref|XP_001771931.1|  ZIP family transporter                             241   2e-71    
ref|NP_172566.2|  zinc transporter 4 precursor                          243   3e-71    
ref|XP_009130197.1|  PREDICTED: probable zinc transporter 12            242   3e-71    
emb|CDY30699.1|  BnaA02g33210D                                          242   3e-71    
emb|CDY46195.1|  BnaA01g23170D                                          242   3e-71    
ref|XP_002869970.1|  iron-responsive transporter 2                      241   4e-71    
emb|CDY34862.1|  BnaA09g47880D                                          243   4e-71    
gb|KEH35210.1|  ZIP zinc/iron transport family protein                  236   7e-71    
gb|KCW75652.1|  hypothetical protein EUGRSUZ_D00016                     236   7e-71    
gb|KCW47603.1|  hypothetical protein EUGRSUZ_K01349                     238   8e-71    
ref|XP_004498889.1|  PREDICTED: zinc transporter 4, chloroplastic...    241   8e-71    



>dbj|BAH66920.1| metal transporter [Nicotiana tabacum]
Length=339

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 206/292 (71%), Positives = 244/292 (84%), Gaps = 11/292 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+ IPALSPE +FFF++KAFAAGVILATGFIHVLPDAFE+LTS  L ++PW +FPF
Sbjct  59    IPVLGKAIPALSPEKNFFFIIKAFAAGVILATGFIHVLPDAFESLTSPCLKENPWGNFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AMV+A+GTLMVD++ATSYFS ++  K     ++GD E G   V  H  A+      
Sbjct  119   SGFIAMVSAMGTLMVDTYATSYFSNKNDTKNGLVAQSGD-EGGAIHVHSHGSASLMG---  174

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                    DSSS+LLR+RV+SQVLE+GIIVHSVIIGIALGAS++PKTI+PLVAALTFHQFF
Sbjct  175   -------DSSSELLRYRVVSQVLEMGIIVHSVIIGIALGASESPKTIRPLVAALTFHQFF  227

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCIAQAKFK+++VAIMALFFSLTTP+GI IG+GITN YDE+SP  LI+EG+FNS
Sbjct  228   EGMGLGGCIAQAKFKTRAVAIMALFFSLTTPVGIAIGLGITNVYDENSPTALIVEGVFNS  287

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVD LAADFM PRM  N KLQ GAN SLLLGAGLM+++AKWA
Sbjct  288   ASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANISLLLGAGLMALIAKWA  339



>ref|XP_006353723.1| PREDICTED: zinc transporter 5-like [Solanum tuberosum]
Length=343

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 203/292 (70%), Positives = 238/292 (82%), Gaps = 7/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+ IPALSPE +FFF++KAFAAGVIL+TGFIHVLPDAFE+LTS  L ++PW +FPF
Sbjct  59    IPVLGKVIPALSPERNFFFIIKAFAAGVILSTGFIHVLPDAFESLTSPCLKENPWGNFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
             CGFVAMV+A+ TLMVD++ATSY++ ++ +      E GD E          H        
Sbjct  119   CGFVAMVSAMATLMVDTYATSYYNKKNLKNGVVTTEGGDEE-------RVIHTHSHAHAH  171

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
               +    DS+S+LLR+RVI+QVLELGIIVHSVIIGIALGAS++PKTIKPLVAALTFHQFF
Sbjct  172   GSTTMMADSNSELLRYRVIAQVLELGIIVHSVIIGIALGASESPKTIKPLVAALTFHQFF  231

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCIAQAK KS+++AIMALFFSLTTP+GI +G+ ITN YDE+SP  LI+EGIFNS
Sbjct  232   EGMGLGGCIAQAKLKSRAIAIMALFFSLTTPVGIAVGLAITNVYDENSPTALIVEGIFNS  291

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVD LAADFM PRM  N KLQ GAN SLLLGAGLMSMLAKWA
Sbjct  292   ASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANVSLLLGAGLMSMLAKWA  343



>ref|XP_004243896.1| PREDICTED: zinc transporter 5-like [Solanum lycopersicum]
Length=342

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 209/292 (72%), Positives = 243/292 (83%), Gaps = 5/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+ IPALSPE +FFF++KAFAAGVIL+TGFIHVLPDAFE+LTS  L +HPW DFPF
Sbjct  56    IPVLGKVIPALSPERNFFFIIKAFAAGVILSTGFIHVLPDAFESLTSPCLPEHPWGDFPF  115

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
             CGFVAMV+A+ TLMVD++ATSY++ ++ +    G E GD E G G    H HA    +  
Sbjct  116   CGFVAMVSAMATLMVDTYATSYYNKKNLKNGVVGTEVGD-EGGVGHTHSHAHAHAHGSTT  174

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
              +     DS+S+LLR+RVISQVLELGIIVHSVIIGIALGAS++PKTIKPLVAALTFHQFF
Sbjct  175   MM----VDSNSELLRYRVISQVLELGIIVHSVIIGIALGASESPKTIKPLVAALTFHQFF  230

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCIAQAK K + + IMALFFSLTTP+GI IG+GITN YDE+SP  LI++GIF+S
Sbjct  231   EGMGLGGCIAQAKLKCREITIMALFFSLTTPVGIGIGLGITNVYDENSPTALIVQGIFDS  290

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVD LAADFM+PRM  N KLQ GAN SLLLGAGLMSMLAKWA
Sbjct  291   ASAGILIYMALVDFLAADFMNPRMQGNGKLQLGANVSLLLGAGLMSMLAKWA  342



>ref|XP_011100401.1| PREDICTED: zinc transporter 8-like [Sesamum indicum]
Length=342

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 211/292 (72%), Positives = 249/292 (85%), Gaps = 4/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPV G+R+PALSPE SFFF+VKAFAAGVIL+TGFIHVLPDAFE+LTS  LS HPW DFPF
Sbjct  55    LPVAGKRVPALSPERSFFFIVKAFAAGVILSTGFIHVLPDAFESLTSPCLSDHPWGDFPF  114

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AM++A+GTLMVD++ATSY+  R+G K     E G A+    VVP HTHATHGHAHG
Sbjct  115   AGFIAMLSAVGTLMVDTYATSYYQRRAGAKA----EMGGADEEEAVVPFHTHATHGHAHG  170

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
              +S+      ++LLRHRVISQVLELGIIVHSVIIGIALGAS++PKTI+PL+AALTFHQFF
Sbjct  171   SLSLELDSGETELLRHRVISQVLELGIIVHSVIIGIALGASESPKTIRPLIAALTFHQFF  230

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QAKF +++VAIMALFFS+TTP+GI +GIGI+N Y E SP  LI+EG+FN+
Sbjct  231   EGIGLGGCITQAKFNTRAVAIMALFFSITTPMGIAVGIGISNIYSETSPTALIVEGVFNA  290

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLL+ADFMSP++  N KLQ GAN SLL+GAG MS+LAKWA
Sbjct  291   ASAGILIYMALVDLLSADFMSPKLQSNGKLQLGANVSLLIGAGCMSLLAKWA  342



>gb|EYU42826.1| hypothetical protein MIMGU_mgv1a009106mg [Erythranthe guttata]
Length=353

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 212/292 (73%), Positives = 247/292 (85%), Gaps = 0/292 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPVVGRR+PALSPE +FFF++KAFAAGVIL+TGFIHVLPDAFE+LTS  +   PW DFPF
Sbjct  62    LPVVGRRVPALSPERNFFFVIKAFAAGVILSTGFIHVLPDAFESLTSPCIPASPWGDFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AMV+AIGTLMVD++ATSY+  RSG K   G  A D E G  VVPVHTHATHGHAHG
Sbjct  122   TGFIAMVSAIGTLMVDTYATSYYRRRSGVKAVEGGGARDEEGGAAVVPVHTHATHGHAHG  181

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
              VS+      ++LLRHRVISQVLELGIIVHSVIIGIALGAS +PKTI+PL+AAL+FHQFF
Sbjct  182   SVSLQSDSGETELLRHRVISQVLELGIIVHSVIIGIALGASQSPKTIRPLIAALSFHQFF  241

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QA+FK ++V IMA+FFS+TTP+GI IGIGITN Y E S   LI++G+FN+
Sbjct  242   EGIGLGGCITQARFKVRAVTIMAVFFSITTPVGIAIGIGITNIYSETSSTALIVQGVFNA  301

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLL+ADFMSP+M  N KLQ GAN SLL+GAG MS++AKWA
Sbjct  302   ASAGILIYMALVDLLSADFMSPKMQSNGKLQLGANLSLLIGAGCMSLIAKWA  353



>ref|XP_011100402.1| PREDICTED: zinc transporter 8-like [Sesamum indicum]
Length=357

 Score =   374 bits (959),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 203/292 (70%), Positives = 238/292 (82%), Gaps = 1/292 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPV+G+R+PALSPE SFFF+VKAFAAGVIL+TGFIHVLPDAFE+LTS  LS+HPW DFPF
Sbjct  67    LPVLGKRVPALSPERSFFFIVKAFAAGVILSTGFIHVLPDAFESLTSPCLSEHPWGDFPF  126

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAMV+AIGTLMVD++ATSY+  R+G K  A   AGD E G  V              
Sbjct  127   TGFVAMVSAIGTLMVDTYATSYYRRRAGAKAAATVVAGDDEEGAVVPVHTHATHGHAHGS  186

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                  D+  + +L RHRVISQVLELGIIVHSVIIGIALGAS++PKTI+PL+AALTFHQFF
Sbjct  187   VSLELDSGETDRL-RHRVISQVLELGIIVHSVIIGIALGASESPKTIRPLIAALTFHQFF  245

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QAKF +++VAIMALFFS+TTP+GI +GIGI+N Y E SP  LI+EG+FN+
Sbjct  246   EGIGLGGCITQAKFNTRAVAIMALFFSITTPMGIAVGIGISNIYSETSPTALIVEGVFNA  305

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLL+ADFMSP++  N KLQ GAN SLL+GAG MS+LAKWA
Sbjct  306   ASAGILIYMALVDLLSADFMSPKLQSNGKLQLGANVSLLIGAGCMSLLAKWA  357



>ref|XP_010036079.1| PREDICTED: zinc transporter 8-like [Eucalyptus grandis]
Length=342

 Score =   370 bits (950),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 194/292 (66%), Positives = 234/292 (80%), Gaps = 1/292 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+VG+ +PAL PE S FF++KAFAAGVIL+TGFIHVLPDAFENLTS  LS+ PW DFPF
Sbjct  52    LPIVGKTVPALHPERSIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLSETPWGDFPF  111

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+ A+GTLMVD+ ATSYF  R  +K T   ++GD E            TH     
Sbjct  112   AGFVAMLGALGTLMVDTVATSYFKKRHADK-TVSDKSGDEEKARENQGEVHVHTHATHGH  170

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                   TDS S LLRHRVISQVLELGI+VHSVIIG++LGAS++P+TIKPLVAAL+FHQFF
Sbjct  171   SHGPISTDSESDLLRHRVISQVLELGIVVHSVIIGVSLGASESPQTIKPLVAALSFHQFF  230

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI+QAKFK+++  +MALFFSLTTP+GIVIG+G++N YDE+SP  LI+EGIFN+
Sbjct  231   EGMGLGGCISQAKFKTRATVVMALFFSLTTPVGIVIGLGVSNVYDENSPTALIVEGIFNA  290

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             AS+GIL+YM+LVDLLAADFMS ++  N +L FG N +LLLGAG MS+LAKWA
Sbjct  291   ASSGILVYMSLVDLLAADFMSSKLQNNGRLLFGTNVALLLGAGCMSLLAKWA  342



>gb|KCW47600.1| hypothetical protein EUGRSUZ_K01344 [Eucalyptus grandis]
Length=374

 Score =   370 bits (951),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 194/292 (66%), Positives = 234/292 (80%), Gaps = 1/292 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+VG+ +PAL PE S FF++KAFAAGVIL+TGFIHVLPDAFENLTS  LS+ PW DFPF
Sbjct  84    LPIVGKTVPALHPERSIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLSETPWGDFPF  143

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+ A+GTLMVD+ ATSYF  R  +K T   ++GD E            TH     
Sbjct  144   AGFVAMLGALGTLMVDTVATSYFKKRHADK-TVSDKSGDEEKARENQGEVHVHTHATHGH  202

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                   TDS S LLRHRVISQVLELGI+VHSVIIG++LGAS++P+TIKPLVAAL+FHQFF
Sbjct  203   SHGPISTDSESDLLRHRVISQVLELGIVVHSVIIGVSLGASESPQTIKPLVAALSFHQFF  262

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI+QAKFK+++  +MALFFSLTTP+GIVIG+G++N YDE+SP  LI+EGIFN+
Sbjct  263   EGMGLGGCISQAKFKTRATVVMALFFSLTTPVGIVIGLGVSNVYDENSPTALIVEGIFNA  322

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             AS+GIL+YM+LVDLLAADFMS ++  N +L FG N +LLLGAG MS+LAKWA
Sbjct  323   ASSGILVYMSLVDLLAADFMSSKLQNNGRLLFGTNVALLLGAGCMSLLAKWA  374



>ref|XP_008229644.1| PREDICTED: zinc transporter 8-like [Prunus mume]
Length=356

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 233/295 (79%), Gaps = 4/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL P+ + FF++KAFAAGVILATGFIHVLPDAF+NLTS  L ++PW  FPF
Sbjct  63    IPILGKTIPALHPDRNIFFLIKAFAAGVILATGFIHVLPDAFDNLTSPCLKENPWGKFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRS---GEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAMVAAIGTLMVD+ ATSY+S RS     K       GD E            TH  
Sbjct  123   TGFVAMVAAIGTLMVDASATSYYS-RSHFKNNKAQPAESCGDQEKAGEHEGHVHVHTHAT  181

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                     DT  ++QLLRHRVISQVLELGIIVHSVIIGI+LGAS++P TI+PLVAALTFH
Sbjct  182   HGHAHGSVDTSPTTQLLRHRVISQVLELGIIVHSVIIGISLGASESPDTIRPLVAALTFH  241

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QAKFK++ VAIMALFFSLTTP+GI IGIGI+N Y E+SP  LI+EG+
Sbjct  242   QFFEGMGLGGCISQAKFKARGVAIMALFFSLTTPVGIAIGIGISNVYKENSPTALIVEGV  301

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYM+LVDLLAADFM+P++  N +LQ GAN +LLLGAG MS+LAKWA
Sbjct  302   FNAASAGILIYMSLVDLLAADFMNPKLQSNGRLQAGANIALLLGAGFMSLLAKWA  356



>ref|XP_003601469.1| Zinc transporter [Medicago truncatula]
 gb|AES71720.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=372

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 229/295 (78%), Gaps = 7/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IPALSPE   FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L++HPW DFPF
Sbjct  82    LPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLNEHPWGDFPF  141

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAG---DAEVGpgvvpvhthathgh  741
              GFVAM  A+GTLMVD++AT+YF     ++  A  E+    D E             H  
Sbjct  142   TGFVAMCTAMGTLMVDTYATAYFQNHYSKRAPAQVESQTTPDVE----NEEHTHVHAHAS  197

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                       D SS+LLRHRVISQVLELGIIVHSVIIGI+LGAS++PKTI+PLVAALTFH
Sbjct  198   HSHAHGHISFDQSSELLRHRVISQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTFH  257

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLG CI QA FKS S+ IM LFF+LTTP+GI IG+GI+N YDE+SP  LI EGI
Sbjct  258   QFFEGMGLGSCITQANFKSLSITIMGLFFALTTPVGIGIGLGISNVYDENSPTALIFEGI  317

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYMALVDLLAADFM+PRM KN +LQ G+N SLLLGAG MS++AKWA
Sbjct  318   FNAASAGILIYMALVDLLAADFMNPRMQKNGRLQLGSNISLLLGAGCMSLIAKWA  372



>gb|AES71719.2| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=349

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 229/295 (78%), Gaps = 7/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IPALSPE   FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L++HPW DFPF
Sbjct  59    LPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLNEHPWGDFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAG---DAEVGpgvvpvhthathgh  741
              GFVAM  A+GTLMVD++AT+YF     ++  A  E+    D E             H  
Sbjct  119   TGFVAMCTAMGTLMVDTYATAYFQNHYSKRAPAQVESQTTPDVE----NEEHTHVHAHAS  174

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                       D SS+LLRHRVISQVLELGIIVHSVIIGI+LGAS++PKTI+PLVAALTFH
Sbjct  175   HSHAHGHISFDQSSELLRHRVISQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTFH  234

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLG CI QA FKS S+ IM LFF+LTTP+GI IG+GI+N YDE+SP  LI EGI
Sbjct  235   QFFEGMGLGSCITQANFKSLSITIMGLFFALTTPVGIGIGLGISNVYDENSPTALIFEGI  294

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYMALVDLLAADFM+PRM KN +LQ G+N SLLLGAG MS++AKWA
Sbjct  295   FNAASAGILIYMALVDLLAADFMNPRMQKNGRLQLGSNISLLLGAGCMSLIAKWA  349



>ref|XP_010036078.1| PREDICTED: zinc transporter 8-like [Eucalyptus grandis]
Length=343

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 228/292 (78%), Gaps = 0/292 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ +PAL PE S FF++KAFAAGVIL+TG IHVLPDAFENLTS  LS+ PW +FPF
Sbjct  52    LPILGKTVPALHPERSIFFIIKAFAAGVILSTGLIHVLPDAFENLTSPCLSERPWGEFPF  111

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+ A+GTLMVD+ ATSYF     +   +    GD E            TH     
Sbjct  112   AGFVAMLGALGTLMVDTVATSYFKKLHADNAGSDKSVGDEERARENRGQVPVHTHATHGH  171

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                   TD+ S LLRHRVISQVLELGI+VHSVIIG++LGAS++PKTIKPLVAAL+FHQFF
Sbjct  172   SHGPISTDAESDLLRHRVISQVLELGIVVHSVIIGVSLGASESPKTIKPLVAALSFHQFF  231

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QAKFK+++  +MALFFSLTTP+GI IG+G+T +YDE+SP  LI+EGIFN+
Sbjct  232   EGMGLGGCITQAKFKTRATVVMALFFSLTTPIGICIGLGVTTKYDENSPTALIVEGIFNA  291

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             AS+GIL+YM+LVDLLAADFMSP++  N +L FG N +LLLGAG MS+LAKWA
Sbjct  292   ASSGILVYMSLVDLLAADFMSPKLQNNGRLLFGTNVALLLGAGCMSLLAKWA  343



>ref|XP_003601470.1| Zinc transporter [Medicago truncatula]
 gb|AES71721.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=377

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 229/295 (78%), Gaps = 7/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IPALSPE   FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L++HPW DFPF
Sbjct  87    LPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLNEHPWGDFPF  146

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAG---DAEVGpgvvpvhthathgh  741
              GFVAM  A+GTLMVD++AT+YF     ++  A  E+    D E             H  
Sbjct  147   TGFVAMCTAMGTLMVDTYATAYFQNHYSKRAPAQVESQTTPDVE----NEEHTHVHAHAS  202

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                       D SS+LLRHRVISQVLELGIIVHSVIIGI+LGAS++PKTI+PLVAALTFH
Sbjct  203   HSHAHGHISFDQSSELLRHRVISQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTFH  262

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLG CI QA FKS S+ IM LFF+LTTP+GI IG+GI+N YDE+SP  LI EGI
Sbjct  263   QFFEGMGLGSCITQANFKSLSITIMGLFFALTTPVGIGIGLGISNVYDENSPTALIFEGI  322

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYMALVDLLAADFM+PRM KN +LQ G+N SLLLGAG MS++AKWA
Sbjct  323   FNAASAGILIYMALVDLLAADFMNPRMQKNGRLQLGSNISLLLGAGCMSLIAKWA  377



>ref|XP_007217784.1| hypothetical protein PRUPE_ppa020051mg, partial [Prunus persica]
 gb|EMJ18983.1| hypothetical protein PRUPE_ppa020051mg, partial [Prunus persica]
Length=333

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 232/295 (79%), Gaps = 4/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL P+ + FF++KAFAAGVILATGFIHVLPDAF+NLTS  L ++PW  FPF
Sbjct  40    IPILGKTIPALHPDRNIFFLIKAFAAGVILATGFIHVLPDAFDNLTSPCLKENPWGKFPF  99

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRS---GEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAMVAAIGTLMVD+ ATSY+S RS     K       GD E            TH  
Sbjct  100   TGFVAMVAAIGTLMVDASATSYYS-RSHFKNNKARPAESCGDQEKAGEHEGHVHVHTHAT  158

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                     DT  ++QLLRHRVISQVLELGIIVHSVIIGI+LGAS++P TI+PLVAALTFH
Sbjct  159   HGHAHGAVDTSPTTQLLRHRVISQVLELGIIVHSVIIGISLGASESPDTIRPLVAALTFH  218

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QAKF ++ VAIMALFFSLTTP+GI IGIGI+N Y E+SP  LI+EG+
Sbjct  219   QFFEGMGLGGCISQAKFTARGVAIMALFFSLTTPVGIAIGIGISNVYKENSPTALIVEGV  278

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYM+LVDLLAADFM+P++  N +LQ GAN +LLLGAG MS+LAKWA
Sbjct  279   FNAASAGILIYMSLVDLLAADFMNPKLQSNGRLQVGANIALLLGAGFMSLLAKWA  333



>ref|XP_002264621.1| PREDICTED: zinc transporter 8 [Vitis vinifera]
Length=351

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 240/295 (81%), Gaps = 5/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL PE + FF++KAFAAGVILATGFIHVLPDAFENLTS  LS++PW +FPF
Sbjct  59    IPILGKTIPALHPEKNVFFIIKAFAAGVILATGFIHVLPDAFENLTSPCLSENPWGNFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAE-VGpgvvpvhthathghah  747
              GFVAMV+AIGTLMVD+ ATSY+S    +K  A    GD E  G     VH H    H H
Sbjct  119   TGFVAMVSAIGTLMVDACATSYYSRSHFKK--AQQAVGDEEKAGEHEGHVHVHTHGTHGH  176

Query  748   ghvSVTDTDS--SSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
              H S +  +   S++L+RHRVISQVLELGI+VHSVIIGI+LGAS++PKTIKPLVAALTFH
Sbjct  177   AHGSASSAEEMGSAELIRHRVISQVLELGIVVHSVIIGISLGASESPKTIKPLVAALTFH  236

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFK ++ AIMALFFSLTTP+GI IGIGI+N YDE+S   LI+EGI
Sbjct  237   QFFEGMGLGGCIVQAKFKLRAAAIMALFFSLTTPVGIAIGIGISNVYDENSSTALIVEGI  296

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGIL+YMALVDLLAADFM+PRM  N +LQ GAN SLL+GAG MS+LAKWA
Sbjct  297   FNAASAGILVYMALVDLLAADFMNPRMQGNGRLQVGANISLLVGAGCMSLLAKWA  351



>ref|XP_006429781.1| hypothetical protein CICLE_v10012062mg [Citrus clementina]
 gb|ESR43021.1| hypothetical protein CICLE_v10012062mg [Citrus clementina]
Length=355

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 200/294 (68%), Positives = 231/294 (79%), Gaps = 2/294 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPV+G+ I ALSPE + FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L +HPW DFPF
Sbjct  62    LPVLGKTIKALSPERNIFFLIKAFAAGVILSTGFIHVLPDAFENLTSPCLDEHPWGDFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG--RSGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
              GF AMVAAIGTLM+D+FATSY +   R      A +   D E            TH   
Sbjct  122   TGFAAMVAAIGTLMIDAFATSYATSYYRKSHFGEAENNVSDEEKVGEHAGHVHVHTHATD  181

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                    +    S+LLRHRVIS VLELGI+VHSVIIGI+LGAS++PKTIKPLVAALTFHQ
Sbjct  182   GHAHGFLEYSGESELLRHRVISLVLELGILVHSVIIGISLGASESPKTIKPLVAALTFHQ  241

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI QAKFKS+ VAI+ALFFSLTTP+GI IGIGI++ YDE+SP  LI+EGIF
Sbjct  242   FFEGMGLGGCITQAKFKSRGVAILALFFSLTTPVGIAIGIGISSVYDENSPTALIVEGIF  301

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+A+AGILIYM+LVDLLAADFM+P+M  N +LQFGAN SLLLGAG MS+LAKWA
Sbjct  302   NAAAAGILIYMSLVDLLAADFMNPKMQTNKRLQFGANVSLLLGAGCMSLLAKWA  355



>ref|XP_008229645.1| PREDICTED: zinc transporter 8-like [Prunus mume]
Length=356

 Score =   363 bits (932),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 232/295 (79%), Gaps = 4/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL P+ + FF++KAFAAGVILATGFIHVLPDAF NLTS  L ++PW  FPF
Sbjct  63    IPILGKSIPALHPDRNIFFLIKAFAAGVILATGFIHVLPDAFHNLTSPCLKENPWGKFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRS---GEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAMVAAIGTLMVD+ ATSY+S RS     +       GD E            TH  
Sbjct  123   TGFVAMVAAIGTLMVDASATSYYS-RSHFKNNRAQPEESVGDEEKAGEHEDHLHVHTHAT  181

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                     DT  ++QLLRHRVISQVLELGIIVHSVIIGI+LGAS++P TI+PLVAALTFH
Sbjct  182   HGHAHGSVDTSPTTQLLRHRVISQVLELGIIVHSVIIGISLGASESPDTIRPLVAALTFH  241

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QAKFK++ VAIMALFFSLTTP+GI IGIGI+N Y E+SP  LI+EG+
Sbjct  242   QFFEGMGLGGCISQAKFKARGVAIMALFFSLTTPVGIAIGIGISNVYKENSPTALIVEGV  301

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYM+LVDLLAADFM+P+M  N +LQ GAN +LLLGAG MS+LAKWA
Sbjct  302   FNAASAGILIYMSLVDLLAADFMNPKMQSNGRLQAGANIALLLGAGCMSLLAKWA  356



>gb|KEH35205.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=361

 Score =   363 bits (932),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 202/300 (67%), Positives = 238/300 (79%), Gaps = 9/300 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPALSPE   FF++K FAAGVIL+TGFIHVLPDAFENLTS  L +HPW DFPF
Sbjct  63    IPLLGKVIPALSPEKDIFFIIKTFAAGVILSTGFIHVLPDAFENLTSPCLKEHPWGDFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA-----GHEAG---DAEVGpgvvpvhth  726
              GFVAM  A+G+LMVD++AT+YF  R  +K +       HEA    + EV      VH H
Sbjct  123   TGFVAMCTAMGSLMVDTYATAYFQNRHSKKASTLTQVKSHEATLDVEKEVVEQQGHVHVH  182

Query  727   athghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVA  906
                 H H H  V+ +D SS+LLRHRVISQVLELGIIVHSVIIGI+LGAS++PKTI+PLVA
Sbjct  183   THASHGHAHGHVS-SDPSSELLRHRVISQVLELGIIVHSVIIGISLGASESPKTIRPLVA  241

Query  907   ALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVL  1086
             ALTFHQFFEGMGLG CI QA FKS S+ IM LFF+LTTP+GI IG+GI+N YDE++P  L
Sbjct  242   ALTFHQFFEGMGLGSCITQANFKSLSITIMGLFFALTTPVGIAIGLGISNVYDENTPTAL  301

Query  1087  IIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             I+EGIFN+ASAGILIYMALVDLLAADFM+PRM K+ KL+ G N SLLLGAG MS+LAKWA
Sbjct  302   IVEGIFNAASAGILIYMALVDLLAADFMNPRMQKSGKLRLGCNLSLLLGAGCMSLLAKWA  361



>ref|XP_009769157.1| PREDICTED: zinc transporter 5-like [Nicotiana sylvestris]
Length=343

 Score =   362 bits (930),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 203/296 (69%), Positives = 239/296 (81%), Gaps = 15/296 (5%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+ IPALSPE +FFF++KAFAAGVILATGFIHVLPDAFE+LTS  L ++PW +FPF
Sbjct  59    IPVLGKAIPALSPEKNFFFIIKAFAAGVILATGFIHVLPDAFESLTSPCLKENPWGNFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK----VTAGHEAGDAEVGpgvvpvhthathg  738
              GF+AMV+A+GTLMVD++ATSYFS ++  K      +G E G   V              
Sbjct  119   SGFIAMVSAMGTLMVDTYATSYFSNKNDTKNGLVAQSGDEGGAIHV-----------HSH  167

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
                   S    DSSS+LLR+RV+SQVLE+GIIVHSVIIGIALGAS++PKTI+PLV ALTF
Sbjct  168   GHAHGSSSLLGDSSSELLRYRVVSQVLEMGIIVHSVIIGIALGASESPKTIRPLVGALTF  227

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCIAQAKFK+++VAIMALFFSLTTP+GI IG+GITN YDE+SP  LI+EG
Sbjct  228   HQFFEGMGLGGCIAQAKFKTRAVAIMALFFSLTTPVGIAIGLGITNVYDENSPTALIVEG  287

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +FNSASAGILIYMALVD LAADFM PRM  N KLQ GAN SLLLGAGLM+++AKWA
Sbjct  288   VFNSASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANVSLLLGAGLMALIAKWA  343



>ref|XP_006481378.1| PREDICTED: zinc transporter 8-like [Citrus sinensis]
Length=355

 Score =   363 bits (931),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 200/294 (68%), Positives = 232/294 (79%), Gaps = 2/294 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPV+G+ I ALSPE + FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L +HPW DFPF
Sbjct  62    LPVLGKTIRALSPERNIFFLIKAFAAGVILSTGFIHVLPDAFENLTSPCLDEHPWGDFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG--RSGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
              GF AMVAAIGTLM+D+FATSY +   R      A + A D E            TH   
Sbjct  122   TGFAAMVAAIGTLMIDAFATSYATSYYRKSHFGEAENNAPDEEKVGEHAGHVHVHTHATD  181

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                    +    S+LLRHRVIS VLELGI+VHSVIIGI+LGAS++PKTIKPLVAALTFHQ
Sbjct  182   GHAHGFLEYSGESELLRHRVISLVLELGILVHSVIIGISLGASESPKTIKPLVAALTFHQ  241

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI QA+FKS+ VAI+ALFFSLTTP+GI IGIGI++ YDE+SP  LI+EGIF
Sbjct  242   FFEGMGLGGCITQARFKSRGVAILALFFSLTTPVGIAIGIGISSVYDENSPTALIVEGIF  301

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+A+AGILIYM+LVDLLAADFM+P+M  N +LQFGAN SLLLGAG MS+LAKWA
Sbjct  302   NAAAAGILIYMSLVDLLAADFMNPKMQTNKRLQFGANVSLLLGAGCMSLLAKWA  355



>gb|EYU42823.1| hypothetical protein MIMGU_mgv1a019299mg [Erythranthe guttata]
Length=345

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 206/292 (71%), Positives = 243/292 (83%), Gaps = 4/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPVVGRR+PALSPE +FFF++KAFAAGVIL+TGFIHVLPDAFE+LTS  +   PW DFPF
Sbjct  58    LPVVGRRVPALSPERNFFFVIKAFAAGVILSTGFIHVLPDAFESLTSPCIPASPWGDFPF  117

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AMV+AIGTLMVD++ATSY+  RS +K   G       +    +PVHTHATHGHAHG
Sbjct  118   TGFIAMVSAIGTLMVDTYATSYYRRRSKDKAAEGVGGAGEGI----LPVHTHATHGHAHG  173

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
              VS+      S +LRHRVISQVLELGIIVHSVIIGIALGAS +PKTI+PL+AAL+FHQFF
Sbjct  174   SVSMEADSGESDVLRHRVISQVLELGIIVHSVIIGIALGASQSPKTIRPLIAALSFHQFF  233

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QA+FK+++V IMA+FFS+TTP GI IGIGITN Y E SP  LI++G+FN+
Sbjct  234   EGIGLGGCITQARFKARAVTIMAIFFSITTPTGIAIGIGITNIYSETSPTALIVQGVFNA  293

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLL+ADFMSP+M  N KLQ GAN SLL+GAG MS++AKWA
Sbjct  294   ASAGILIYMALVDLLSADFMSPKMQSNGKLQLGANLSLLIGAGCMSLIAKWA  345



>gb|KCW47598.1| hypothetical protein EUGRSUZ_K01343 [Eucalyptus grandis]
Length=406

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 228/292 (78%), Gaps = 0/292 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ +PAL PE S FF++KAFAAGVIL+TG IHVLPDAFENLTS  LS+ PW +FPF
Sbjct  115   LPILGKTVPALHPERSIFFIIKAFAAGVILSTGLIHVLPDAFENLTSPCLSERPWGEFPF  174

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+ A+GTLMVD+ ATSYF     +   +    GD E            TH     
Sbjct  175   AGFVAMLGALGTLMVDTVATSYFKKLHADNAGSDKSVGDEERARENRGQVPVHTHATHGH  234

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                   TD+ S LLRHRVISQVLELGI+VHSVIIG++LGAS++PKTIKPLVAAL+FHQFF
Sbjct  235   SHGPISTDAESDLLRHRVISQVLELGIVVHSVIIGVSLGASESPKTIKPLVAALSFHQFF  294

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QAKFK+++  +MALFFSLTTP+GI IG+G+T +YDE+SP  LI+EGIFN+
Sbjct  295   EGMGLGGCITQAKFKTRATVVMALFFSLTTPIGICIGLGVTTKYDENSPTALIVEGIFNA  354

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             AS+GIL+YM+LVDLLAADFMSP++  N +L FG N +LLLGAG MS+LAKWA
Sbjct  355   ASSGILVYMSLVDLLAADFMSPKLQNNGRLLFGTNVALLLGAGCMSLLAKWA  406



>ref|XP_007215607.1| hypothetical protein PRUPE_ppa007779mg [Prunus persica]
 gb|EMJ16806.1| hypothetical protein PRUPE_ppa007779mg [Prunus persica]
Length=356

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 231/295 (78%), Gaps = 4/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P +G+ IPAL P+ + FF++KAFAAGVILATGFIHVLPDAF+ LTS  L ++PW  FPF
Sbjct  63    IPTLGKNIPALHPDRNIFFLIKAFAAGVILATGFIHVLPDAFDKLTSPCLKENPWGKFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRS---GEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAMVAAIGTLMVD+ ATSY+S RS     +       GD E            TH  
Sbjct  123   TGFVAMVAAIGTLMVDASATSYYS-RSHFKNNRAQPAESVGDEEKAGEHEDHMHVHTHAT  181

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                     DT  S+QLLRHRVISQVLELGIIVHSVIIGI+LGAS++P TI+PLVAALTFH
Sbjct  182   HGHAHGSVDTSPSTQLLRHRVISQVLELGIIVHSVIIGISLGASESPDTIRPLVAALTFH  241

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QAKFK++ VAIMALFFSLTTP+GI IGIGI+N Y+E+SP  LI+EG+
Sbjct  242   QFFEGMGLGGCISQAKFKARGVAIMALFFSLTTPVGIAIGIGISNVYEENSPTALIVEGV  301

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYM+LVDLLAADFM+P+M  N +LQ GAN +LLLGAG MS+LA WA
Sbjct  302   FNAASAGILIYMSLVDLLAADFMNPKMQSNGRLQAGANIALLLGAGCMSLLANWA  356



>ref|XP_003601468.1| Zinc transporter [Medicago truncatula]
Length=440

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 229/295 (78%), Gaps = 7/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IPALSPE   FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L++HPW DFPF
Sbjct  150   LPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLNEHPWGDFPF  209

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAG---DAEVGpgvvpvhthathgh  741
              GFVAM  A+GTLMVD++AT+YF     ++  A  E+    D E             H  
Sbjct  210   TGFVAMCTAMGTLMVDTYATAYFQNHYSKRAPAQVESQTTPDVE----NEEHTHVHAHAS  265

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                       D SS+LLRHRVISQVLELGIIVHSVIIGI+LGAS++PKTI+PLVAALTFH
Sbjct  266   HSHAHGHISFDQSSELLRHRVISQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTFH  325

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLG CI QA FKS S+ IM LFF+LTTP+GI IG+GI+N YDE+SP  LI EGI
Sbjct  326   QFFEGMGLGSCITQANFKSLSITIMGLFFALTTPVGIGIGLGISNVYDENSPTALIFEGI  385

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYMALVDLLAADFM+PRM KN +LQ G+N SLLLGAG MS++AKWA
Sbjct  386   FNAASAGILIYMALVDLLAADFMNPRMQKNGRLQLGSNISLLLGAGCMSLIAKWA  440



>ref|XP_009363255.1| PREDICTED: zinc transporter 1-like [Pyrus x bretschneideri]
Length=356

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 235/295 (80%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IPAL+PE   FFM+KAFAAGVILATGFIHVLPDAFE+LTS  LS+ PW +FPF
Sbjct  62    LPMLGKKIPALNPENDIFFMIKAFAAGVILATGFIHVLPDAFESLTSPCLSETPWGNFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AM++AIGT+M+D+FATSY+      K   V    E      G   V  H    H H
Sbjct  122   TGFIAMLSAIGTMMIDTFATSYYRRSHFTKPLLVNEDEEMNGVHEGHVHVHTHATHGHAH  181

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
               G ++  D+ SS +L+RHRVISQVLELGI+VHSVIIGI+LGAS +PKTIKPLVAALTFH
Sbjct  182   GSGVIAAEDSISSFELVRHRVISQVLELGILVHSVIIGISLGASQSPKTIKPLVAALTFH  241

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFKS+++A M LFFSLTTP+GI +G+GI+N Y++ SP  LI+EG+
Sbjct  242   QFFEGMGLGGCITQAKFKSRAIATMVLFFSLTTPIGIGVGMGISNIYNDTSPTALIVEGV  301

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYMALVDLLAADFM+PRM  N ++Q GAN SLLLG G MS+LAKWA
Sbjct  302   FNSASAGILIYMALVDLLAADFMNPRMQNNLRIQLGANVSLLLGCGCMSLLAKWA  356



>gb|KDP35622.1| hypothetical protein JCGZ_09060 [Jatropha curcas]
Length=350

 Score =   360 bits (924),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 193/296 (65%), Positives = 236/296 (80%), Gaps = 10/296 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+ G+ IPAL PE   FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L ++PW  FPF
Sbjct  61    LPIAGKFIPALRPEKDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLDENPWGKFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHE-AGDAEVGpgvvpvhthathg  738
              GF+AMV+AIGTLMVD+FATSY+S    ++ + ++A  E  GD EV       H H+   
Sbjct  121   TGFIAMVSAIGTLMVDAFATSYYSKSHLKNQQSISADEEKVGDGEVHVHTHASHGHSHGM  180

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
                    + +   +S+LLRHRVISQVLELGI+VHSVIIGI+LGAS+ PKTI+PL+AALTF
Sbjct  181   V------LAENSVTSELLRHRVISQVLELGIVVHSVIIGISLGASENPKTIRPLIAALTF  234

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QAKFK+++VAIM+ FFSLTTP+GI IGI I+N YDE+SPK LI++G
Sbjct  235   HQFFEGMGLGGCISQAKFKAKTVAIMSTFFSLTTPVGIAIGIAISNGYDENSPKALIVQG  294

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +FN+AS+GILIYM+LVDLLAADFM+PR+  N KLQ G N  LL GAG MS+LAKWA
Sbjct  295   VFNAASSGILIYMSLVDLLAADFMNPRVQANGKLQLGVNFFLLFGAGCMSLLAKWA  350



>ref|XP_006353722.1| PREDICTED: zinc transporter 5-like [Solanum tuberosum]
Length=339

 Score =   360 bits (923),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 205/292 (70%), Positives = 240/292 (82%), Gaps = 11/292 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+ IPALSPE +FFF++KAFAAGVIL+TGFIHVLPDAFE+LTS  L++HPW DFPF
Sbjct  59    IPVLGKAIPALSPERNFFFIIKAFAAGVILSTGFIHVLPDAFESLTSPCLAEHPWGDFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AMV+A+ TLMVD++ATSY+S ++ +      EAG  E G      H H        
Sbjct  119   SGFIAMVSALATLMVDTYATSYYSKKNLKNGVVATEAG-YEQGVVHAHSHGHVHGL----  173

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                   +DS S+LLR+RVISQVLELGIIVHSVIIGIALGAS++PKTIKPLVAALTFHQFF
Sbjct  174   ------SDSESELLRYRVISQVLELGIIVHSVIIGIALGASESPKTIKPLVAALTFHQFF  227

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCIAQAK K++++AIMALFFSLTTP+GI IG+GITN YDE+SP  LI+EG+FNS
Sbjct  228   EGLGLGGCIAQAKLKTRTIAIMALFFSLTTPIGIGIGLGITNVYDENSPTALIVEGVFNS  287

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVD LAADFM PRM  N KLQ GAN SLLLGAGLMS+LAKWA
Sbjct  288   ASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANISLLLGAGLMSLLAKWA  339



>emb|CAN74488.1| hypothetical protein VITISV_029272 [Vitis vinifera]
Length=351

 Score =   360 bits (924),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 239/295 (81%), Gaps = 5/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL PE + FF++KAFAAGVILATGFIHVLPDAFENLTS  L+++P  DFPF
Sbjct  59    IPILGKTIPALHPEKNVFFIIKAFAAGVILATGFIHVLPDAFENLTSPCLNENPXGDFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAE-VGpgvvpvhthathghah  747
              GFVAMV+AIGTLMVD+ ATSY+S    +K  A    GD E  G     VH H    H H
Sbjct  119   TGFVAMVSAIGTLMVDACATSYYSXSHFKK--AQQAVGDEEKAGEHEGHVHVHTHATHGH  176

Query  748   ghvSVTDTDS--SSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
              H S +  +   S++L+RHRVISQVLELGI+VHSVIIGI+LGAS++PKTIKPLVAALTFH
Sbjct  177   AHGSASSAEEMGSAELIRHRVISQVLELGIVVHSVIIGISLGASESPKTIKPLVAALTFH  236

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFK ++ AIMALFFSLTTP+GI IGIGI+N YDE+S   LI+EGI
Sbjct  237   QFFEGMGLGGCIVQAKFKLRAAAIMALFFSLTTPVGIAIGIGISNVYDENSSTALIVEGI  296

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYMALVDLLAADFM+PRM  N +LQ GAN SLL+GAG MS+LAKWA
Sbjct  297   FNAASAGILIYMALVDLLAADFMNPRMQGNGRLQVGANISLLVGAGCMSLLAKWA  351



>gb|EYU42857.1| hypothetical protein MIMGU_mgv1a025410mg [Erythranthe guttata]
Length=345

 Score =   360 bits (923),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 193/292 (66%), Positives = 230/292 (79%), Gaps = 7/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPVVGRR+PALSPE +FFF++KAFAAGVIL+TGFIHVLPDAFE+LTS  +   PW DFPF
Sbjct  61    LPVVGRRVPALSPERNFFFVIKAFAAGVILSTGFIHVLPDAFESLTSPCIPASPWGDFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AM++AIGTLMVD++ATSY+  RSG K   G    +       V  H H +      
Sbjct  121   TGFIAMLSAIGTLMVDTYATSYYRRRSGVKAVEGGGDEEGGAAVVPVHAHAHGSV-----  175

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
               S+      + LLRHRVISQVLELGIIVHSVIIGIALGAS +PKTI+PL+AAL+FHQFF
Sbjct  176   --SLEPDSGETDLLRHRVISQVLELGIIVHSVIIGIALGASQSPKTIRPLIAALSFHQFF  233

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QA+FK+++V IMALFFS+TTP+GI IGIGITN Y E S   LI++G+FN+
Sbjct  234   EGIGLGGCITQARFKARAVTIMALFFSITTPVGIAIGIGITNIYSETSSTALIVQGVFNA  293

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGIL+YMALVDLLAADFMSP++  N KLQ GAN SLL+G G MS +AKWA
Sbjct  294   ASAGILVYMALVDLLAADFMSPKLQSNGKLQLGANLSLLIGTGCMSFIAKWA  345



>ref|XP_004293836.1| PREDICTED: zinc transporter 1-like [Fragaria vesca subsp. vesca]
Length=355

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 192/295 (65%), Positives = 234/295 (79%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IP L PE   FFM+KAFAAGVILATGFIHVLPDAFE+LTS  LS+ PW DFPF
Sbjct  61    LPMLGKKIPTLRPENDIFFMIKAFAAGVILATGFIHVLPDAFESLTSPCLSQMPWGDFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AMV+AIGT+M+D+FATSY+      K   V    E      G   V  H    H H
Sbjct  121   TGFIAMVSAIGTMMIDTFATSYYRRSHFNKALPVKDDQEMNGVHEGHVHVHTHATHGHAH  180

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                 +++ D+ SS +L+R R+ISQVLELGI+VHSVIIG++LGAS++PKTIKPLVAALTFH
Sbjct  181   GSDAMALEDSASSFELVRRRIISQVLELGIVVHSVIIGVSLGASESPKTIKPLVAALTFH  240

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFKS+++A M LFFSLTTP+GIV+G+G+++ Y E+S   LI+EG+
Sbjct  241   QFFEGMGLGGCICQAKFKSKAIATMVLFFSLTTPIGIVVGMGVSSFYKENSSTALIVEGV  300

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYMALVDLLAADFM+PRM  N ++Q GAN SLLLG+G MS+LAKWA
Sbjct  301   FNSASAGILIYMALVDLLAADFMNPRMQGNLRIQLGANLSLLLGSGCMSLLAKWA  355



>gb|AAR08414.1| metal transport protein [Medicago truncatula]
Length=372

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 193/292 (66%), Positives = 225/292 (77%), Gaps = 1/292 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IPALSPE   FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L++HPW DFPF
Sbjct  82    LPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLNEHPWGDFPF  141

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM  A+GTLMVD++AT+YF     ++  A  E+                 H     
Sbjct  142   TGFVAMCTAMGTLMVDTYATAYFQNHYSKRAPAQVES-QTTPDVENEEHTHVHAHASHSH  200

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                    D SS+LLRHRVISQVLELGII HSVIIGI+LGAS++PKTI+PLVAALTFHQFF
Sbjct  201   AHGHISFDQSSELLRHRVISQVLELGIIGHSVIIGISLGASESPKTIRPLVAALTFHQFF  260

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLG CI QA FKS S+ IM LFF+LTTP+GI IG+GI+N YDE+SP   I EGIFN+
Sbjct  261   EGMGLGSCITQANFKSLSITIMGLFFALTTPVGIGIGLGISNVYDENSPTAFIFEGIFNA  320

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLLAADFM+PRM KN +LQ G+N SLLLGAG MS++AKWA
Sbjct  321   ASAGILIYMALVDLLAADFMNPRMQKNGRLQLGSNISLLLGAGCMSLIAKWA  372



>ref|XP_010036080.1| PREDICTED: zinc transporter 8-like [Eucalyptus grandis]
 gb|KCW47602.1| hypothetical protein EUGRSUZ_K01348 [Eucalyptus grandis]
Length=346

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 234/295 (79%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+VG+R+PAL PE S FF+VKAFAAGVIL+TGFIHVLPDAFENLTS  LS+ PW +FPF
Sbjct  52    LPIVGKRVPALHPERSIFFIVKAFAAGVILSTGFIHVLPDAFENLTSPCLSETPWGEFPF  111

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+AA+GTLMVD+ ATSY+      K      A D E G G        TH     
Sbjct  112   AGFVAMMAALGTLMVDTLATSYYRKLHANKAGPDKSAEDEEKGKGNQGHVHVHTHASQGH  171

Query  751   hvS--VTDTD-SSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
               +  +T +D SSS LLRHRV+SQVLELGI+VHSVIIGI+LGAS++P+TIKPLVAALTFH
Sbjct  172   SHAPMLTKSDGSSSDLLRHRVVSQVLELGIVVHSVIIGISLGASESPETIKPLVAALTFH  231

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QA+F++++ AIMALFFSLTTP+GI IGIGI+N YDE SP  LI+EGI
Sbjct  232   QFFEGMGLGGCITQAQFETRASAIMALFFSLTTPVGIAIGIGISNVYDESSPTALIVEGI  291

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSAS+GILIYMALVDLLA DFMSP++  + +L +G   +LLLGAG MS+LAKWA
Sbjct  292   FNSASSGILIYMALVDLLAPDFMSPKLQNSGRLLWGTFAALLLGAGCMSLLAKWA  346



>ref|XP_006429779.1| hypothetical protein CICLE_v10011940mg [Citrus clementina]
 gb|ESR43019.1| hypothetical protein CICLE_v10011940mg [Citrus clementina]
Length=388

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 235/295 (80%), Gaps = 4/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPV+G+ IPALSPE   FF++KAFAAGVIL+TGF+HVLPDAFENLTS  L +HPW DFPF
Sbjct  95    LPVLGKTIPALSPERKIFFLIKAFAAGVILSTGFVHVLPDAFENLTSPCLDEHPWADFPF  154

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG--RSGEKVTAGHEAGDAE-VGpgvvpvhthathgh  741
              GF AMVAAIGTLM+D+FATSY +   R      A     D E VG     VH H    H
Sbjct  155   TGFAAMVAAIGTLMIDAFATSYATSYYRKSHFGEAEDNVSDEEKVGEHAGHVHVHTHATH  214

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
              H H S+ +    S+LLRHRVIS VLELGI+VHSVIIGI+LG S++PKTIKPLVAALTFH
Sbjct  215   GHAHGSI-EYAGESELLRHRVISLVLELGILVHSVIIGISLGTSESPKTIKPLVAALTFH  273

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFKS+ VAI+ALFFSLTTP GI IGIGI++ YDE+ P  LI+EGI
Sbjct  274   QFFEGMGLGGCITQAKFKSRGVAILALFFSLTTPAGIAIGIGISSFYDENDPTALIVEGI  333

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+A+AGILIYM+LVDLLAADFM+P+M  N +LQFGA+ SLLLGAG MS+LAKWA
Sbjct  334   FNAAAAGILIYMSLVDLLAADFMNPKMQDNKRLQFGAHVSLLLGAGCMSLLAKWA  388



>ref|XP_002527722.1| zinc/iron transporter, putative [Ricinus communis]
 gb|EEF34635.1| zinc/iron transporter, putative [Ricinus communis]
Length=355

 Score =   358 bits (918),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 236/296 (80%), Gaps = 4/296 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ + IPALSPE + FFM+K+FAAGVIL+TGFIH+LPDAFE+LTS  L ++PW  FPF
Sbjct  60    LPLLSKFIPALSPEKNVFFMIKSFAAGVILSTGFIHILPDAFESLTSPCLDENPWGKFPF  119

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AMV+AIGTLMVD++ATSYF+    R  +    G E    + G     +H H    H
Sbjct  120   TGFIAMVSAIGTLMVDTYATSYFNKSNLRKAQSAVTGDEEKSVDNGGAHEHMHVHTHATH  179

Query  742   ahghvSVTDTDS-SSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
              H H  VT  DS  S LLRHRVISQVLELGI+VHSVIIGI+LGAS++PKTI+PLVAALTF
Sbjct  180   GHSHGRVTVQDSVPSDLLRHRVISQVLELGIVVHSVIIGISLGASESPKTIRPLVAALTF  239

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QA FK+++V  M LFF+LTTP GI IGIGI+N Y+E+SP  LI+EG
Sbjct  240   HQFFEGMGLGGCISQANFKTRAVTTMVLFFALTTPAGIAIGIGISNVYNENSPTALIVEG  299

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +FNSASAGILIYMALVDLLAADFM+P++  + KLQFG N SLLLGAG M++LAKWA
Sbjct  300   VFNSASAGILIYMALVDLLAADFMNPKVQASAKLQFGVNVSLLLGAGCMALLAKWA  355



>ref|XP_006481377.1| PREDICTED: zinc transporter 8-like [Citrus sinensis]
Length=358

 Score =   357 bits (916),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 234/295 (79%), Gaps = 4/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPV+G+ IPALSPE   FF++KAFAAGVIL+TGF+HVLPDAFENLTS  L +HPW DFPF
Sbjct  65    LPVLGKTIPALSPERKIFFLIKAFAAGVILSTGFVHVLPDAFENLTSPCLDEHPWGDFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG--RSGEKVTAGHEAGDAE-VGpgvvpvhthathgh  741
              GF AMVAAIGTLM+D+FATSY +   R      A     D E VG     VH H    H
Sbjct  125   TGFAAMVAAIGTLMIDAFATSYATSYYRKSHFGEAEDNVSDEEKVGEHAGHVHVHTHATH  184

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
              H H S+ +    S+LLRHRVIS VLELGI+VHSVIIGI+LG S++PKTIKPLVAALTFH
Sbjct  185   GHAHGSI-EYAGESELLRHRVISLVLELGILVHSVIIGISLGTSESPKTIKPLVAALTFH  243

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFKS+ VAI+A FFSLTTP GI IGIGI++ YDE+ P  LI+EGI
Sbjct  244   QFFEGMGLGGCITQAKFKSRGVAILAFFFSLTTPAGIAIGIGISSFYDENDPTALIVEGI  303

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+A+AGILIYM+LVDLLAADFM+P+M  N +LQFGA+ SLLLGAG MS+LAKWA
Sbjct  304   FNAAAAGILIYMSLVDLLAADFMNPKMQDNKRLQFGAHVSLLLGAGCMSLLAKWA  358



>ref|XP_002307858.2| hypothetical protein POPTR_0006s00840g, partial [Populus trichocarpa]
 gb|EEE91381.2| hypothetical protein POPTR_0006s00840g, partial [Populus trichocarpa]
Length=332

 Score =   356 bits (913),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 232/295 (79%), Gaps = 4/295 (1%)
 Frame = +1

Query  391   LPVVGR-RIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFP  567
             LP++G+  IPALSPE + FF++KAFAAGVIL+TGFIHVLPDAF++LTS  L ++PW +FP
Sbjct  39    LPILGKTSIPALSPEKNIFFIIKAFAAGVILSTGFIHVLPDAFDSLTSPCLGENPWGNFP  98

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             F GFVAMV+AIGTLMVD  AT+YF+ R         E+GD E            TH    
Sbjct  99    FTGFVAMVSAIGTLMVDCLATTYFT-RFHLIKAQSEESGDEEKAAVEAHEGHVHTHASHG  157

Query  748   ghvSVTDTDSS--SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                 + D+  S  SQL+RHRVI+QVLELGI+VHSVIIG++LGAS++PKTI+PLVAAL+FH
Sbjct  158   HSHGIVDSSGSGPSQLIRHRVITQVLELGIVVHSVIIGVSLGASESPKTIRPLVAALSFH  217

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFK++S  IMALFFSLTTP+GI IGIGITN Y+E SP  LI+EGI
Sbjct  218   QFFEGMGLGGCITQAKFKTKSTVIMALFFSLTTPVGIAIGIGITNVYNESSPNSLIVEGI  277

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYMALVDLLAADFM P++  N  LQFG N SLLLGAG MS++AKWA
Sbjct  278   FNAASAGILIYMALVDLLAADFMHPKVQSNGALQFGVNVSLLLGAGCMSLVAKWA  332



>ref|XP_010093125.1| Zinc transporter 5 [Morus notabilis]
 gb|EXB53577.1| Zinc transporter 5 [Morus notabilis]
Length=358

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 209/298 (70%), Positives = 239/298 (80%), Gaps = 10/298 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ I ALSPE + FFM+KAFAAGVILATGFIHVLPDAFENLTS  LS+ PW +FPF
Sbjct  65    LPMLGKTIHALSPERNVFFMIKAFAAGVILATGFIHVLPDAFENLTSPCLSETPW-EFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFS-----GRSGEKVTAGHEAGDAEVGpgvvpvhthath  735
              GFVAM++AI TLMVD+FATSYF      G+S    + G E  D E       VH H   
Sbjct  124   TGFVAMMSAILTLMVDAFATSYFQKSHFGGKSPAPASVGDEEKDGE---HSEHVHVHTHA  180

Query  736   ghahghvSVTDTDS-SSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAAL  912
              H H H  V D +S SS+LLRHRVISQVLELGI+VHSVIIGI+LGAS++PKTI PLVAAL
Sbjct  181   THGHSHGFVGDENSASSELLRHRVISQVLELGIVVHSVIIGISLGASESPKTITPLVAAL  240

Query  913   TFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLII  1092
             TFHQFFEGMGLGGCIAQAKFK+++V IMA+FFSLTTP+GI IGIGI+N Y E SP  LI+
Sbjct  241   TFHQFFEGMGLGGCIAQAKFKARAVTIMAIFFSLTTPVGIAIGIGISNVYKETSPTALIV  300

Query  1093  EGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             EGIFN+ASAGILIYMALVDLLAADFMS ++  N +LQ GAN SLLLGAG MS+LAKWA
Sbjct  301   EGIFNAASAGILIYMALVDLLAADFMSRKLQNNGRLQIGANVSLLLGAGCMSLLAKWA  358



>ref|XP_009610335.1| PREDICTED: zinc transporter 5 [Nicotiana tomentosiformis]
Length=341

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 198/292 (68%), Positives = 237/292 (81%), Gaps = 9/292 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+ IPALSPE + FF++KAFAAGVILATGFIHVLPDA+++LTS  L ++PW DFPF
Sbjct  59    IPVLGKAIPALSPEKNLFFIIKAFAAGVILATGFIHVLPDAYKSLTSPYLKENPWGDFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AMV+A+ TLMVD++ATSY+  +S +      ++GD E+         +        
Sbjct  119   SGFIAMVSAMATLMVDTYATSYYKNKSAKNGVVA-QSGDEEL--------VNVHSHGHVH  169

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
               +    DS S+LLR+RVISQVLE+GIIVHSVIIGIALGAS++PKTI+PLVAALTFHQFF
Sbjct  170   GSTSMIGDSDSELLRYRVISQVLEVGIIVHSVIIGIALGASESPKTIRPLVAALTFHQFF  229

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCIAQAKFK+++VAIM LFFSLTTP+GI IG+GITN YDE+SP  LI+EG+FNS
Sbjct  230   EGMGLGGCIAQAKFKTRAVAIMTLFFSLTTPIGIGIGLGITNSYDENSPTALIVEGVFNS  289

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVD LAADFM PRM  N KLQ GAN SLLLGAGLMS+LAKWA
Sbjct  290   ASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANISLLLGAGLMSLLAKWA  341



>gb|ACJ84426.1| unknown [Medicago truncatula]
 gb|KEH35200.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=358

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 197/296 (67%), Positives = 234/296 (79%), Gaps = 4/296 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPALSPE   FF++KAFAAGVILATGFIHVLPDAFENLTS +L KHPW DFPF
Sbjct  63    IPLLGKVIPALSPEKDIFFIIKAFAAGVILATGFIHVLPDAFENLTSPRLKKHPWGDFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHE---AGDAEVGpgvvpvhthathg-  738
              GFVAM  A+GTLMVD++AT+YF     +K  A  E   + D E                
Sbjct  123   TGFVAMCTAMGTLMVDTYATAYFQNHYSKKAPAQVENEVSPDVEKDHEGHMDVHTHASHG  182

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             HAH H+S   +  S++LLRHRVI+QVLELGIIVHSVIIGI+LGAS++PKTI+PLVAALTF
Sbjct  183   HAHPHMSSVSSGPSTELLRHRVITQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTF  242

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLG CI QA FKS S+ IM LFF+LTTP+GI IGIGI++ YDE+SP  LI+EG
Sbjct  243   HQFFEGMGLGSCITQANFKSLSITIMGLFFALTTPVGIAIGIGISSGYDENSPTALIVEG  302

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFN+AS+GILIYMALVDLLAADFM+PRM K+  L+ G N SLLLG+GLMS++AKWA
Sbjct  303   IFNAASSGILIYMALVDLLAADFMNPRMQKSGILRLGCNISLLLGSGLMSLIAKWA  358



>ref|XP_007213802.1| hypothetical protein PRUPE_ppa007253mg [Prunus persica]
 gb|EMJ15001.1| hypothetical protein PRUPE_ppa007253mg [Prunus persica]
Length=376

 Score =   356 bits (913),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 234/295 (79%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IP L PE   FFM+KAFAAGVILATGFIH+LP+AFE+LTS  LS+ PW +FPF
Sbjct  82    LPMLGKKIPTLRPENDIFFMIKAFAAGVILATGFIHILPEAFESLTSPCLSQTPWGNFPF  141

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AM++AIGT+M+D+FATSY+      K   V    E      G   V  H    H H
Sbjct  142   TGFIAMLSAIGTMMIDTFATSYYRRSHFTKALPVKEDEEMHGVHEGHVHVHTHATHGHAH  201

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
               G +   D+ SS +L+RHRVISQVLELGI+VHSVIIGI+LGAS +P+TIKPLVAALTFH
Sbjct  202   GSGAILPEDSASSFELIRHRVISQVLELGIVVHSVIIGISLGASQSPRTIKPLVAALTFH  261

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QAKFKS+++A M LFFSLTTP+GI +G+GI+N Y+E SP  LI+EG+
Sbjct  262   QFFEGMGLGGCISQAKFKSRAIATMVLFFSLTTPIGIGVGMGISNIYNESSPTALIVEGV  321

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYMALVDLLAADFM+PRM  N ++Q GAN SLLLG+G MS+LAKWA
Sbjct  322   FNSASAGILIYMALVDLLAADFMNPRMQGNLRIQLGANISLLLGSGCMSLLAKWA  376



>gb|AAR08413.1| metal transport protein [Medicago truncatula]
Length=359

 Score =   355 bits (910),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 218/279 (78%), Gaps = 4/279 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPALSPE   FF++KAFAAGVILATGFIHVLPDAFENLTS +L KHPW DFPF
Sbjct  63    IPLLGKVIPALSPEKDIFFIIKAFAAGVILATGFIHVLPDAFENLTSPRLKKHPWGDFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHE---AGDAEVGpgvvpvhthathg-  738
              GFVAM  A+GTLMVD++AT+YF     +K  A  E   + D E                
Sbjct  123   TGFVAMCTAMGTLMVDTYATAYFQNHYSKKAPAQVENEVSPDVEKDHEGHMDVHTHASHG  182

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             HAH H+S   +  S++LLRHRVI+QVLELGIIVHSVIIGI+LGAS++PKTI+PLVAALTF
Sbjct  183   HAHPHMSSVSSGPSTELLRHRVITQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTF  242

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLG CI QA FKS S+ IM LFF+LTTP+GI IGIGI++ YDE+SP  LI+EG
Sbjct  243   HQFFEGMGLGSCITQANFKSLSITIMGLFFALTTPVGIAIGIGISSGYDENSPTALIVEG  302

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             IFN+AS+GILIYMALVDLLAADFM+PRM KN  L+ G N
Sbjct  303   IFNAASSGILIYMALVDLLAADFMNPRMQKNGILRLGCN  341



>ref|XP_002307860.2| zinc transporter protein ZIP1 [Populus trichocarpa]
 gb|EEE91383.2| zinc transporter protein ZIP1 [Populus trichocarpa]
Length=354

 Score =   354 bits (909),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 190/294 (65%), Positives = 230/294 (78%), Gaps = 3/294 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IP LSPE + FF++KAFAAGVIL+TGFIHVLPDAF++LTS  L ++PW  FPF
Sbjct  62    LPILGKTIPVLSPEKNIFFIIKAFAAGVILSTGFIHVLPDAFDSLTSPCLGENPWGKFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAMV+AIGTLMVD  A+SY++     K     E+GD E            TH     
Sbjct  122   TGFVAMVSAIGTLMVDCLASSYYTRLHLNKAQP-EESGDEEKAAVEAHEGHVHTHATHGH  180

Query  751   hvSVTDTDSS--SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                + D+  S  SQL+RHRVI+QVLELGI+VHSVIIG++LGAS++P TI+PLVAAL+FHQ
Sbjct  181   SHGIVDSSGSGPSQLIRHRVITQVLELGIVVHSVIIGVSLGASESPNTIRPLVAALSFHQ  240

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI QAKFK++++ IMALFFSLTTP+GI IG+GI+N Y+E SP  LI+EGIF
Sbjct  241   FFEGMGLGGCITQAKFKTKTIVIMALFFSLTTPVGIAIGLGISNVYNESSPNALIVEGIF  300

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+ASAGILIYMALVDLLAADFM P++  N  LQFG N SLLLGAG MS+LAKWA
Sbjct  301   NAASAGILIYMALVDLLAADFMHPKVQSNGALQFGVNVSLLLGAGCMSLLAKWA  354



>gb|AFK49414.1| unknown [Medicago truncatula]
Length=358

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 195/296 (66%), Positives = 232/296 (78%), Gaps = 4/296 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPALSPE   FF++KAFAAGVILATGFIHVLPDAFENLTS +L KHPW DFPF
Sbjct  63    IPLLGKVIPALSPEKDIFFIIKAFAAGVILATGFIHVLPDAFENLTSPRLKKHPWGDFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHE---AGDAEVGpgvvpvhthathg-  738
              GFVAM  A+GTLMVD++AT+YF     +K  A  E   + D E                
Sbjct  123   TGFVAMCTAMGTLMVDTYATAYFQNHYSKKAPAQVENEVSPDVEKDHEGHMDVHTHASHG  182

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             HAH H+S   +  S++LLRHRVI+QVLELGIIVHSVIIGI+LGAS++PKTI+PLVAALTF
Sbjct  183   HAHPHMSSVSSGPSTELLRHRVITQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTF  242

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLG CI QA FKS S+ IM LFF+LTTP+GI IGIGI++ YDE+SP  LI+EG
Sbjct  243   HQFFEGMGLGSCITQANFKSLSITIMGLFFALTTPVGIAIGIGISSGYDENSPTALIVEG  302

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFN+AS+GILIYMALVDLLAADFM+PRM K+  L+ G N  LLLG+GLM ++AKWA
Sbjct  303   IFNAASSGILIYMALVDLLAADFMNPRMQKSGILRLGCNIFLLLGSGLMFLIAKWA  358



>ref|XP_011002389.1| PREDICTED: zinc transporter 8-like [Populus euphratica]
Length=354

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 191/294 (65%), Positives = 229/294 (78%), Gaps = 3/294 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IP LSPE + FF++KAFAAGVIL+TGFIHVLPDAF++LTS  LS++PW  FPF
Sbjct  62    LPILGKTIPVLSPEKNIFFIIKAFAAGVILSTGFIHVLPDAFDSLTSPCLSENPWGKFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFV M++AIGTLMVD  A+SYF+     K     E+ D E            TH     
Sbjct  122   TGFVTMMSAIGTLMVDCLASSYFTRLHLNKAQP-EESRDEEKAAVEAHEGHVHTHATHGH  180

Query  751   hvSVTDTDSS--SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                + D+  S  SQL+RHRVI+QVLELGI+VHSVIIG++LGAS++PKTI+PLVAAL+FHQ
Sbjct  181   SHGLVDSSGSGPSQLIRHRVITQVLELGIVVHSVIIGVSLGASESPKTIRPLVAALSFHQ  240

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI QAKFK++++ IMALFFSLTTP+GI IGIGITN Y+E SP  LI+EGIF
Sbjct  241   FFEGMGLGGCITQAKFKTKTIVIMALFFSLTTPVGIAIGIGITNVYNESSPNALIVEGIF  300

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+ASAGILIYMALVDLLAADFM P++  N  LQFG N SLLLG G MS+LAKWA
Sbjct  301   NAASAGILIYMALVDLLAADFMHPKVQANGALQFGVNVSLLLGVGCMSLLAKWA  354



>gb|KEH35211.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=366

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/273 (66%), Positives = 208/273 (76%), Gaps = 1/273 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IPALSPE   FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L++HPW DFPF
Sbjct  82    LPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLNEHPWGDFPF  141

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM  A+GTLMVD++AT+YF     ++  A  E+                 H     
Sbjct  142   TGFVAMCTAMGTLMVDTYATAYFQNHYSKRAPAQVESQTTP-DVENEEHTHVHAHASHSH  200

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                    D SS+LLRHRVISQVLELGIIVHSVIIGI+LGAS++PKTI+PLVAALTFHQFF
Sbjct  201   AHGHISFDQSSELLRHRVISQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTFHQFF  260

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLG CI QA FKS S+ IM LFF+LTTP+GI IG+GI+N YDE+SP  LI EGIFN+
Sbjct  261   EGMGLGSCITQANFKSLSITIMGLFFALTTPVGIGIGLGISNVYDENSPTALIFEGIFNA  320

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFG  1209
             ASAGILIYMALVDLLAADFM+PRM KN +   G
Sbjct  321   ASAGILIYMALVDLLAADFMNPRMQKNAQSLLG  353



>gb|KEH35212.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=343

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/273 (66%), Positives = 208/273 (76%), Gaps = 1/273 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IPALSPE   FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L++HPW DFPF
Sbjct  59    LPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLNEHPWGDFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM  A+GTLMVD++AT+YF     ++  A  E+                 H     
Sbjct  119   TGFVAMCTAMGTLMVDTYATAYFQNHYSKRAPAQVESQTTP-DVENEEHTHVHAHASHSH  177

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                    D SS+LLRHRVISQVLELGIIVHSVIIGI+LGAS++PKTI+PLVAALTFHQFF
Sbjct  178   AHGHISFDQSSELLRHRVISQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTFHQFF  237

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLG CI QA FKS S+ IM LFF+LTTP+GI IG+GI+N YDE+SP  LI EGIFN+
Sbjct  238   EGMGLGSCITQANFKSLSITIMGLFFALTTPVGIGIGLGISNVYDENSPTALIFEGIFNA  297

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFG  1209
             ASAGILIYMALVDLLAADFM+PRM KN +   G
Sbjct  298   ASAGILIYMALVDLLAADFMNPRMQKNAQSLLG  330



>ref|XP_008371921.1| PREDICTED: zinc transporter 1-like [Malus domestica]
Length=356

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 230/295 (78%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IPAL+PE   FFM+KAFAAGVILATGFIHVLPDAFE+LTS  LS+ PW +FPF
Sbjct  62    LPMLGKKIPALNPENDIFFMIKAFAAGVILATGFIHVLPDAFESLTSPCLSETPWGNFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AM++AIGT+M+D+ ATSY+      K   V    E      G      H      H
Sbjct  122   TGFIAMLSAIGTMMIDTLATSYYRRSHFTKPLPVNEDEEMNRVPEGHVHGHTHATHGRAH  181

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
               G ++  D+  S +L+RHRVISQVLELGI+VHSVIIGI+LGAS +PKTIKPLVAALTFH
Sbjct  182   GSGVIAAEDSIPSFELVRHRVISQVLELGILVHSVIIGISLGASQSPKTIKPLVAALTFH  241

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QA FKS+++A M LFFSLTTP+GI +G+GI+N Y++ SP  LI+EG+
Sbjct  242   QFFEGMGLGGCITQANFKSRAIATMVLFFSLTTPIGIGVGMGISNIYNDTSPTALIVEGV  301

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYMALVDLLAADFM+PRM  N ++Q GAN SLLLG G MS+LAKWA
Sbjct  302   FNSASAGILIYMALVDLLAADFMNPRMQSNLRIQLGANVSLLLGCGCMSLLAKWA  356



>ref|XP_010109875.1| Zinc transporter 1 [Morus notabilis]
 gb|EXC24818.1| Zinc transporter 1 [Morus notabilis]
Length=351

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 232/296 (78%), Gaps = 6/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IP L PE   FFM+KAFAAGVILATGFIH+LP+AFE+LTS  L ++PW DFPF
Sbjct  58    LPILGKKIPTLRPENDIFFMIKAFAAGVILATGFIHILPEAFESLTSPCLGRNPWGDFPF  117

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA----GHEAGDAEVGpgvvpvhthathg  738
              GFVAM++A+ T+M+D+FATS++      K        H  G A  G   V  H    H 
Sbjct  118   AGFVAMLSALATMMIDTFATSFYERAHFNKALPVKDDSHVQGAAHEGHVHVHTHATHGHA  177

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H      V++  SS +L+RHRVISQVLELGI+VHSVIIGI+LGAS +P TIKPLVAALTF
Sbjct  178   HGSAF--VSEDISSVELVRHRVISQVLELGIVVHSVIIGISLGASYSPTTIKPLVAALTF  235

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QAKFKS+S+  M LFFSLTTP+GI IG+GI++ Y+E++P  LI+EG
Sbjct  236   HQFFEGMGLGGCISQAKFKSKSIVTMVLFFSLTTPVGIGIGMGISSVYNENNPTALIVEG  295

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFNSASAGILIYMALVDLLAADFM+PRM  N +LQ GAN SLLLG+G MS+LAKWA
Sbjct  296   IFNSASAGILIYMALVDLLAADFMNPRMQSNLRLQLGANISLLLGSGSMSLLAKWA  351



>ref|XP_008383275.1| PREDICTED: zinc transporter 1-like [Malus domestica]
Length=358

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 214/337 (64%), Positives = 261/337 (77%), Gaps = 7/337 (2%)
 Frame = +1

Query  265   AAECKCggdeeddgeVHDkklalkyklaaiasilvasaigvsLPVVGRRIPALSPEGSFF  444
             +AEC+C  +  D    HDK   LK+KL AI+SIL+AS +GVSLP++G++IPAL+PE   F
Sbjct  26    SAECECNSETLD----HDKFKVLKFKLLAISSILIASFLGVSLPMLGKKIPALNPENDIF  81

Query  445   FMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFCGFVAMVAAIGTLMVDSF  624
             F++KAFAAGVILATGFIHVLPDAFE+L S  LS+ PW  FPF GF+AM++AIGT+M+D+F
Sbjct  82    FVIKAFAAGVILATGFIHVLPDAFESLRSPCLSETPWGSFPFTGFIAMLSAIGTMMIDTF  141

Query  625   ATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLR  795
             ATSY+      K   V    E      G   V  H    H H  G ++  D+ SS +++R
Sbjct  142   ATSYYRRSDFTKALPVKEDEEMNGLHEGHVHVHTHATHGHAHGSGAIAPEDSISSFEIVR  201

Query  796   HRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFK  975
             HRVISQVLELGI+VHSVIIGI+LGAS +PKTIKPLVAALTFHQFFEGMGLGGCI QA FK
Sbjct  202   HRVISQVLELGILVHSVIIGISLGASQSPKTIKPLVAALTFHQFFEGMGLGGCITQANFK  261

Query  976   SQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLL  1155
             S+++A M LFFS TTP+GI +G+GI+N Y+E SP  LI+EG+FNSASAGILIYMALVDLL
Sbjct  262   SRAIAAMVLFFSFTTPIGIGVGMGISNIYNETSPSALIVEGVFNSASAGILIYMALVDLL  321

Query  1156  AADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             AADFM+PRM  N ++Q GAN SLLLG+G MS+LAKWA
Sbjct  322   AADFMNPRMQSNLRIQVGANISLLLGSGCMSLLAKWA  358



>ref|XP_008225897.1| PREDICTED: zinc transporter 8-like [Prunus mume]
Length=356

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 212/337 (63%), Positives = 261/337 (77%), Gaps = 7/337 (2%)
 Frame = +1

Query  265   AAECKCggdeeddgeVHDkklalkyklaaiasilvasaigvsLPVVGRRIPALSPEGSFF  444
             +AEC C  + +     HDK   LK+KL AI+SIL+AS +GVSLP++G++IP L PE   F
Sbjct  24    SAECTCSKETQH----HDKVKVLKFKLVAISSILIASVLGVSLPMLGKKIPTLRPENDIF  79

Query  445   FMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFCGFVAMVAAIGTLMVDSF  624
             F++KAFAAGVILATGFIHVLP+AFE+LTS  LS+ PW +FPF GF+AM++AIGT+M+D+F
Sbjct  80    FLIKAFAAGVILATGFIHVLPEAFESLTSPCLSQTPWGNFPFSGFIAMLSAIGTMMIDTF  139

Query  625   ATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLR  795
             ATSY+      K   V    E      G   V  H    H H  G +   D+ SS +L+R
Sbjct  140   ATSYYRRSHFTKALPVKEDEEMHGVHEGHVHVHTHATHGHAHGSGAILPEDSASSLELIR  199

Query  796   HRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFK  975
             H+VISQVLELGI+VHSVIIGI+LGAS +P+TIKPLVAALTFHQFFEGMGLGGCI+QAKFK
Sbjct  200   HQVISQVLELGIVVHSVIIGISLGASQSPRTIKPLVAALTFHQFFEGMGLGGCISQAKFK  259

Query  976   SQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLL  1155
              +++A M LFFSLTTP+GI +G+GI+N Y+E SP  LI+EG+FNSASAGILIYMALVDLL
Sbjct  260   FRAIATMVLFFSLTTPIGIGVGMGISNIYNESSPTALIVEGVFNSASAGILIYMALVDLL  319

Query  1156  AADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             AADFM+PRM  N ++Q GAN SLLLG+G MS+LAKWA
Sbjct  320   AADFMNPRMQGNLRIQLGANISLLLGSGCMSLLAKWA  356



>gb|AFK48496.1| unknown [Lotus japonicus]
Length=338

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 228/306 (75%), Gaps = 39/306 (13%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+GR    L P+  FFFMVKAFAAGVIL+TGFIHVLPDAF+ LTS  L+ HPW DFPF
Sbjct  58    IPVLGRHFSILRPDNDFFFMVKAFAAGVILSTGFIHVLPDAFDKLTSPCLNDHPWGDFPF  117

Query  571   CGFVAMVAAIGTLMVDSFATSYF-----SGRSGEKV---------TAGHEAGDAEVGpgv  708
              GFVAMV+AIGTLM+DS AT+YF     S    EKV         + GH  G        
Sbjct  118   TGFVAMVSAIGTLMIDSTATAYFNKSHSSNEKEEKVVDLPVHTHASNGHAHGS-------  170

Query  709   vpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKT  888
                               T + +S+QLLRHR ISQVLELGI+VHSVIIGI+LGAS++P+T
Sbjct  171   ------------------TASSASTQLLRHRAISQVLELGIVVHSVIIGISLGASESPET  212

Query  889   IKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDE  1068
             I+PL+AALTFHQFFEGMGLGGCI+QAKF++++V +MALFFSLTTP+GI IG+GITN YDE
Sbjct  213   IRPLIAALTFHQFFEGMGLGGCISQAKFETKAVIVMALFFSLTTPVGIAIGMGITNAYDE  272

Query  1069  DSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglms  1248
             +S   LI+EGI N+ASAGILIYM+LVDLLAADFM+PR  ++ KLQ GAN  LLLGAG MS
Sbjct  273   NSQTALIVEGIMNAASAGILIYMSLVDLLAADFMNPRFQQSSKLQLGANLCLLLGAGCMS  332

Query  1249  mlaKWA  1266
             +LAKWA
Sbjct  333   LLAKWA  338



>ref|XP_009775150.1| PREDICTED: zinc transporter 5-like [Nicotiana sylvestris]
Length=342

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 235/295 (80%), Gaps = 14/295 (5%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+ IPALSPE + FF++KAFAAGVIL+TGFIHVLPDA+E+LTS  L ++PW DFPF
Sbjct  59    IPVLGKAIPALSPEKNLFFIIKAFAAGVILSTGFIHVLPDAYESLTSPCLKENPWGDFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRS---GEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AMV+A+ TLMVD++ATSY+  +S   G    +G E G   V        + +  G 
Sbjct  119   SGFIAMVSAMATLMVDTYATSYYKNKSVKNGVVAQSGDEEGVIHVHSHGHAHGSTSMIG-  177

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                       DS S+LLR+RVISQVLELGIIVHSVIIGIALGAS++PKTI+PLV ALTFH
Sbjct  178   ----------DSDSELLRYRVISQVLELGIIVHSVIIGIALGASESPKTIRPLVGALTFH  227

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCIAQAKFK+++V IM LFFSLTTP+GI IG+GITN YDE+SP  LI+EG+
Sbjct  228   QFFEGMGLGGCIAQAKFKNRAVVIMTLFFSLTTPIGIGIGLGITNSYDENSPTALIVEGV  287

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYMALVD LAADFM PRM  N KLQ GAN SLLLGAGLMS+LAKWA
Sbjct  288   FNSASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANISLLLGAGLMSLLAKWA  342



>ref|XP_004243649.1| PREDICTED: zinc transporter 5-like [Solanum lycopersicum]
Length=342

 Score =   350 bits (897),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 186/275 (68%), Positives = 219/275 (80%), Gaps = 11/275 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+ IPALSPE + FF++KAFAAGVIL+TGFIHVLPDA+ +LTS  L+KHPW DFPF
Sbjct  62    IPVLGKAIPALSPERNLFFIIKAFAAGVILSTGFIHVLPDAYGSLTSPCLAKHPWGDFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AMV+A+ TLMVD++A SY+S ++ E   A  ++GD E G      H   +      
Sbjct  122   SGFIAMVSALATLMVDTYANSYYSKKNLENGVAVAQSGD-EGGVVHPHSHGSGSMM----  176

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                    DS S+LLR+RVISQVLELGIIVHSVIIGIALGAS+TPK IKPLVAALTFHQFF
Sbjct  177   ------VDSKSELLRYRVISQVLELGIIVHSVIIGIALGASETPKNIKPLVAALTFHQFF  230

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCIAQAK KS+++AIM L FSLTTP+GI IG+GITN YDE+SP  LI+EG+FNS
Sbjct  231   EGLGLGGCIAQAKLKSRTIAIMTLLFSLTTPIGIGIGLGITNVYDENSPTALIVEGVFNS  290

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             ASAGILIYMALVD LAADFM PRM  N KLQ GAN
Sbjct  291   ASAGILIYMALVDFLAADFMHPRMQSNGKLQLGAN  325



>ref|XP_008799797.1| PREDICTED: zinc transporter 8-like [Phoenix dactylifera]
Length=347

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 197/292 (67%), Positives = 226/292 (77%), Gaps = 3/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ + IPALSPE   FF++KAFAAGVILATGFIH+LPDAFENLTS  LS  PW  FPF
Sbjct  59    LPILSKSIPALSPENDIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLSDDPWGKFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF AM+ A+GTLMVD+ ATSYFS RS   V      GDAE+   V     H    H H 
Sbjct  119   AGFGAMIGALGTLMVDTLATSYFS-RSARAVNDEANKGDAEMNHPVGDAVIHVHATHGHA  177

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
             H    D   S +L+RHRVISQVLELGI+VHSVIIGI+LGASD+P TI+PLVAAL+FHQFF
Sbjct  178   HGPAVD--GSDKLVRHRVISQVLELGIVVHSVIIGISLGASDSPSTIRPLVAALSFHQFF  235

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCIAQAKFK+ SVA M LFFSLTTP+GI IG GI++ Y+E+SP  LI+EGI NS
Sbjct  236   EGMGLGGCIAQAKFKTMSVATMILFFSLTTPVGIAIGFGISSVYNENSPTALIVEGILNS  295

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              +AGILIYMALVDLLA DFM+PR+    KLQF  N SLL+GAGLMS+LAKWA
Sbjct  296   VAAGILIYMALVDLLAEDFMNPRVQSKGKLQFAINVSLLIGAGLMSLLAKWA  347



>emb|CAN83129.1| hypothetical protein VITISV_029537 [Vitis vinifera]
Length=397

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 189/292 (65%), Positives = 225/292 (77%), Gaps = 6/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP +G++IPAL PE   FF VKAFAAGVILATGFIHVLPDAFE+LTS  L + PW  FPF
Sbjct  112   LPTLGKKIPALRPENDVFFAVKAFAAGVILATGFIHVLPDAFESLTSPCLGESPWGSFPF  171

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AIGT+M+D+FAT ++      K     E  D E+            HG    
Sbjct  172   SGFVAMLSAIGTMMMDAFATGFYQRLQRSKAQPVKE--DEEMQCENQDQVHGHPHGSGF-  228

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                V+    S +L RHRVI+QVLELGI+VHSVIIGI+LGAS++PKTIKPLVAAL+FHQFF
Sbjct  229   ---VSGELGSPELARHRVIAQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFHQFF  285

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI+QAKFKS++VA+M +FFSLTTP+GI +G+GI+N YDE+SPK L++EG+FNS
Sbjct  286   EGMGLGGCISQAKFKSKAVAVMVVFFSLTTPVGIAVGMGISNIYDENSPKALVVEGVFNS  345

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDL+AADFMSPRM  N KLQ  AN  LLLG   MS+LAKWA
Sbjct  346   ASAGILIYMALVDLVAADFMSPRMQTNFKLQIAANILLLLGTACMSLLAKWA  397



>ref|XP_010036084.1| PREDICTED: zinc transporter 1-like [Eucalyptus grandis]
Length=346

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 231/295 (78%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ +PAL PE + FF++KAFAAGVIL+TGFIHVLPDAFE+LTS  L K PW +FPF
Sbjct  52    LPILGKTVPALHPERNIFFIIKAFAAGVILSTGFIHVLPDAFESLTSPCLGKTPWGEFPF  111

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+AA+GTL+VDS ATSY+     +K    +   D E             H     
Sbjct  112   AGFVAMIAALGTLIVDSLATSYYKKSHIDKAMLDNYVEDEEKARENHGHVHVHAHASNGH  171

Query  751   hv--SVTDTD-SSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  +TD+D +SS LLRHRV+SQVLELGI+V SVIIGI+LGAS++PKTI+PLVAALTFH
Sbjct  172   SHGPKLTDSDVNSSDLLRHRVVSQVLELGIVVRSVIIGISLGASESPKTIRPLVAALTFH  231

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI  AKF++++ AIMA+FFSLTTP+G+ IG+G+T+ YDE+SPK L++EGI
Sbjct  232   QFFEGMGLGGCITLAKFETRASAIMAMFFSLTTPVGVAIGLGLTSVYDENSPKALVVEGI  291

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYMALVDLLAADFMSP++  N +L FG   +LLLGAG MS+LA+WA
Sbjct  292   FNAASAGILIYMALVDLLAADFMSPKLQNNGRLLFGTYVALLLGAGCMSLLARWA  346



>ref|XP_008357510.1| PREDICTED: zinc transporter 8-like, partial [Malus domestica]
Length=338

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 198/292 (68%), Positives = 235/292 (80%), Gaps = 4/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL P+ + FF++KAFAAGVILATGFIHVLPDAFE+LT   L ++PW  FPF
Sbjct  51    IPILGKTIPALHPDRNIFFIIKAFAAGVILATGFIHVLPDAFESLTDPALKENPWGKFPF  110

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+AAIGTLMVDS+ATSY+S RS  K    +   D E            TH     
Sbjct  111   TGFVAMMAAIGTLMVDSYATSYYS-RSHFK---NNINADEEKAQEHEGHVHVHTHATHGH  166

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                  DT  S++LLRHRVISQVLELGI+VHSVIIGI+LGAS++PKTIKPLVAAL+FHQFF
Sbjct  167   AHGAVDTSPSAELLRHRVISQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFHQFF  226

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QAKFK+++VAIM+LFFSLTTP+GI IGIGI+N YDE SP  LI+EG+FN+
Sbjct  227   EGMGLGGCITQAKFKNRAVAIMSLFFSLTTPVGIGIGIGISNVYDESSPTALIMEGVFNA  286

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYM+LVDLLAADFM+P+M +N +LQ GAN SLLLGAG MS+LAKWA
Sbjct  287   ASAGILIYMSLVDLLAADFMNPKMQRNGRLQAGANLSLLLGAGCMSLLAKWA  338



>ref|XP_008464645.1| PREDICTED: zinc transporter 5-like [Cucumis melo]
Length=365

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 215/337 (64%), Positives = 256/337 (76%), Gaps = 4/337 (1%)
 Frame = +1

Query  265   AAECKCggdeeddgeVHDkklalkyklaaiasilvasaigvsLPVVGRRIPALSPEGSFF  444
             AA+C+C  D E+DG   D  LALKYK+ AIA+IL+A  IGV +P++G+ IPALSPE   F
Sbjct  30    AADCQCPEDSEEDGGKRDDTLALKYKIVAIATILLAGIIGVVIPLLGKVIPALSPEKDIF  89

Query  445   FMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFCGFVAMVAAIGTLMVDSF  624
             F++KAFAAGVILATGFIHVLPDA+E LTS KL++HPW  FPF G VAMVAAIGTLM+D+ 
Sbjct  90    FVIKAFAAGVILATGFIHVLPDAYEKLTSSKLNEHPWGKFPFTGLVAMVAAIGTLMMDAG  149

Query  625   ATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahghvSVTDTD---SSSQLLR  795
             A+SY++ R           GD E+  G         H H     +    D   SS+++LR
Sbjct  150   ASSYYT-RIHLNKAQPELNGDDEMRGGGGHDGHVHVHTHGTHGHAHGSADVGGSSTEILR  208

Query  796   HRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFK  975
             HRVISQVLELGI+VHS+IIGI LG S+TPKTI+PLVAA+TFHQ FEGMGLGGCIAQAKFK
Sbjct  209   HRVISQVLELGIVVHSIIIGIGLGVSETPKTIRPLVAAITFHQLFEGMGLGGCIAQAKFK  268

Query  976   SQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLL  1155
             +++  +M LFF LTTPLGI IGI +T  YDEDSPK LI+EGI N+AS+GILIYMALVDLL
Sbjct  269   NRATILMGLFFCLTTPLGIAIGIAVTKGYDEDSPKALIVEGILNAASSGILIYMALVDLL  328

Query  1156  AADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             AADFM+PRM  N KLQ  AN SL+LGA LMS+LA WA
Sbjct  329   AADFMNPRMQSNGKLQLLANVSLILGAALMSLLAIWA  365



>ref|XP_004146060.1| PREDICTED: zinc transporter 1-like [Cucumis sativus]
Length=357

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 191/296 (65%), Positives = 229/296 (77%), Gaps = 4/296 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPALSPE   FF++KAFAAGVILATGFIHVLPDA+ NLTS KL++HPW  FPF
Sbjct  62    IPLLGKLIPALSPEKDIFFIIKAFAAGVILATGFIHVLPDAYGNLTSSKLNEHPWGKFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFS----GRSGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              G VAMVAAIGTLMVD+ A+SY++     ++  ++    E      G     VH H    
Sbjct  122   TGLVAMVAAIGTLMVDAGASSYYTRIHLNKAQPELNGDDEMRGGGCGAHDGHVHVHTHGT  181

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H H H S     SS+++LRHRVISQVLELGI+VHSVIIGI LG S++P+TI+PLVAA+TF
Sbjct  182   HGHAHGSADVGGSSTEILRHRVISQVLELGIVVHSVIIGIGLGVSESPETIRPLVAAITF  241

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQ FEGMGLGGCIAQAKFK+++  +M LFF LTTP+GI IGI +T  YDEDSPK LI+EG
Sbjct  242   HQLFEGMGLGGCIAQAKFKNRATILMGLFFCLTTPIGIAIGIAVTKTYDEDSPKALIVEG  301

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             I N+AS+GILIYMALVDLLAADFM+PRM  N KLQ  AN SL+LGA LMS+LA WA
Sbjct  302   ILNAASSGILIYMALVDLLAADFMNPRMQSNGKLQLLANVSLILGAALMSLLAIWA  357



>ref|XP_008378335.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 8-like [Malus 
domestica]
Length=351

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 198/292 (68%), Positives = 235/292 (80%), Gaps = 4/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL P+ + FF++KAFAAGVILATGFIHVLPDAFE+LT   L ++PW  FPF
Sbjct  64    IPILGKTIPALHPDRNIFFIIKAFAAGVILATGFIHVLPDAFESLTDPALKENPWGKFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+AAIGTLMVDS+ATSY+S RS  K    +   D E            TH     
Sbjct  124   TGFVAMMAAIGTLMVDSYATSYYS-RSHFK---NNINADEEKAQEHEGHVHVHTHATHGH  179

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                  DT  S++LLRHRVISQVLELGI+VHSVIIGI+LGAS++PKTIKPLVAAL+FHQFF
Sbjct  180   AHGAVDTSPSAELLRHRVISQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFHQFF  239

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QAKFK+++VAIM+LFFSLTTP+GI IGIGI+N YDE SP  LI+EG+FN+
Sbjct  240   EGMGLGGCITQAKFKNRAVAIMSLFFSLTTPVGIGIGIGISNVYDESSPTALIMEGVFNA  299

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYM+LVDLLAADFM+P+M +N +LQ GAN SLLLGAG MS+LAKWA
Sbjct  300   ASAGILIYMSLVDLLAADFMNPKMQRNGRLQAGANLSLLLGAGCMSLLAKWA  351



>ref|XP_007145986.1| hypothetical protein PHAVU_006G003300g [Phaseolus vulgaris]
 gb|ESW17980.1| hypothetical protein PHAVU_006G003300g [Phaseolus vulgaris]
Length=352

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 201/293 (69%), Positives = 234/293 (80%), Gaps = 3/293 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPALSPE   FF++KAFAAGVILATGFIHVLPDAFENLTS  L +HPW DFPF
Sbjct  62    IPLLGKVIPALSPEKDIFFIIKAFAAGVILATGFIHVLPDAFENLTSPCLKEHPWGDFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEV-Gpgvvpvhthathghah  747
              GFVAM  A+GTLMVD++AT+YF     +++ +  E GD E        VH H    H H
Sbjct  122   TGFVAMCTAMGTLMVDTYATAYFQKHHSKEIHS--ENGDVEKEAGHEGHVHLHTHATHGH  179

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
              H  V   D SSQLLRHRVISQVLELGIIVHSVIIGI+LGAS++P TI+PLVAALTFHQF
Sbjct  180   AHGPVHSDDHSSQLLRHRVISQVLELGIIVHSVIIGISLGASESPNTIRPLVAALTFHQF  239

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLG CI+QA FK  SV +M LFF+LTTP+GI IGIGITN YDE+SP  LI+EG+FN
Sbjct  240   FEGMGLGSCISQANFKRGSVIVMGLFFALTTPVGIGIGIGITNVYDENSPTALIVEGVFN  299

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +ASAGILIYMALVDLLA DFMSPRM ++ +L+ GAN  LLLGAGLMS++AKWA
Sbjct  300   AASAGILIYMALVDLLATDFMSPRMQQSGRLRLGANIFLLLGAGLMSLVAKWA  352



>ref|XP_007022739.1| Zinc transporter 1 precursor [Theobroma cacao]
 gb|EOY14264.1| Zinc transporter 1 precursor [Theobroma cacao]
Length=363

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 230/295 (78%), Gaps = 5/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++GRRIPAL PE   FFM+KAFAAGVILATGF+H+LPDAF+NLTS  L + PW +FPF
Sbjct  71    LPLLGRRIPALRPENDIFFMIKAFAAGVILATGFVHILPDAFKNLTSPCLKESPWGNFPF  130

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR---SGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAM++AIGTLM+D+FAT Y+  +     ++V A  E      G   V  H    H H
Sbjct  131   SGFVAMMSAIGTLMIDTFATGYYKRQHFNKNKQVNADEEKAAEHAGHVHVHTHATHGHAH  190

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  S ++    S+L+R R+ISQVLE+GI+VHSVIIGI+LGAS++P TI+PL+AAL+FH
Sbjct  191   GSA--SPSEEFGLSELIRQRIISQVLEVGIVVHSVIIGISLGASESPDTIRPLLAALSFH  248

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QA+FKS SVAIM  FFSLTTPLGI +GIGI+  Y+++SP  LI+ G+
Sbjct  249   QFFEGMGLGGCISQAQFKSLSVAIMGTFFSLTTPLGIAVGIGISCFYNDNSPTALIVGGV  308

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYM+LVDLLAADFM+PR+  N +LQ GAN SLLLGA  MS+LAKWA
Sbjct  309   FNSASAGILIYMSLVDLLAADFMNPRLQSNVRLQVGANVSLLLGAACMSVLAKWA  363



>ref|XP_007145957.1| hypothetical protein PHAVU_006G001000g [Phaseolus vulgaris]
 gb|ESW17951.1| hypothetical protein PHAVU_006G001000g [Phaseolus vulgaris]
Length=354

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 229/292 (78%), Gaps = 1/292 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPALSPE   FF++KAFAAGVILATGFIHVLPDAFENLTS  L +HPW DFPF
Sbjct  64    IPLLGKVIPALSPEKDIFFIIKAFAAGVILATGFIHVLPDAFENLTSPCLKEHPWGDFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM  A+GTLMVD++AT+YF     +++ + +   + E G                 
Sbjct  124   TGFVAMCTAMGTLMVDTYATAYFQKHHSQEIQSENRDVEKEAGHEGDVHLHTHATHGHAP  183

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                 +D D SSQLLRHRVISQVLELGI+VHSVIIGI+LGAS++P TI+PLVAALTFHQFF
Sbjct  184   GPVQSD-DHSSQLLRHRVISQVLELGIVVHSVIIGISLGASESPNTIRPLVAALTFHQFF  242

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLG CI+QA FK  SV +M LFF+LTTP+GI IGIGITN YDE+SP  LI+EG+FN+
Sbjct  243   EGMGLGSCISQANFKRVSVIVMGLFFALTTPVGIGIGIGITNVYDENSPTALIVEGVFNA  302

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYM+LVDLLA DFM+PRM ++ +L+ GAN SLLLGAG MS++AKWA
Sbjct  303   ASAGILIYMSLVDLLATDFMNPRMQQSGRLRLGANVSLLLGAGFMSLIAKWA  354



>emb|CDP16373.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 237/304 (78%), Gaps = 13/304 (4%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             PV+G++I ALSPE +FFF++KAFAAGVILATGFIHVLPDAFE+LTS  L + PW DFPF 
Sbjct  61    PVLGKKIRALSPENNFFFVIKAFAAGVILATGFIHVLPDAFESLTSPCLPESPWGDFPFT  120

Query  574   GFVAMVAAIGTLMVDSFATSYF----SGRSGEKVTAGH--------EAGDAEVGpgvvpv  717
             GFVAMVAAIGTLMVD  ATS++    SG +G  +  G         +  + E+      +
Sbjct  121   GFVAMVAAIGTLMVDVQATSHYNKKSSGNNGTVLALGEGDDHGENGKPSNGEIAKSSAGL  180

Query  718   hthathghahghvSVT-DTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIK  894
               H    H H H +++ + DS S  LR+RVI+QVLELGIIVHSVIIG+ALGASD+PKTI+
Sbjct  181   PLHTHATHGHAHGAISMEGDSISTQLRYRVITQVLELGIIVHSVIIGLALGASDSPKTIR  240

Query  895   PLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDS  1074
             PL+AAL+FHQ FEG+GLGGCI QAKFK+ ++A+MALFFSLTTP+GI IGIG+ N Y+E+S
Sbjct  241   PLLAALSFHQLFEGLGLGGCITQAKFKAPAIAVMALFFSLTTPVGIAIGIGVANVYNENS  300

Query  1075  PKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsml  1254
             PK LI++G+ N+ASAGILIYMALVDLLA DFM+P+M  N  LQ GAN SLLLGAG MS+L
Sbjct  301   PKALIVQGVLNAASAGILIYMALVDLLATDFMNPKMQNNGWLQIGANVSLLLGAGCMSLL  360

Query  1255  aKWA  1266
             AKWA
Sbjct  361   AKWA  364



>gb|KHG11077.1| Zinc transporter 5 -like protein [Gossypium arboreum]
Length=356

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 192/293 (66%), Positives = 233/293 (80%), Gaps = 2/293 (1%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+ I AL P+ + FF++KAFAAGVIL+TGFIHVLPDA E+LTS  L+++PW  FPF 
Sbjct  64    PLLGKVIEALRPDKNLFFLIKAFAAGVILSTGFIHVLPDATESLTSPCLNENPWGKFPFA  123

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             G +AM AAIGTLMVD FATS+++     K    HE  + +       +H H    H H H
Sbjct  124   GLLAMTAAIGTLMVDVFATSHYTKSHLHKTQQNHEGDEEKTEQTENHLHVHTHATHGHSH  183

Query  754   vSVT--DTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
              SV+  +   S+QLLRHRV+SQVLELGI+VHSVIIGI+LGAS++PKTIKPLVAALTFHQF
Sbjct  184   GSVSMLERADSAQLLRHRVVSQVLELGIVVHSVIIGISLGASESPKTIKPLVAALTFHQF  243

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCI+QAKFK +SVAIM+LFFSLTTP+GI IGI ITN YDE+SP  LI+EG+ N
Sbjct  244   FEGMGLGGCISQAKFKGRSVAIMSLFFSLTTPVGIAIGIAITNAYDENSPTALIVEGLLN  303

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +AS+GILIYMALVDLLAADFM+P++  N  LQ GA+ SLLLGAGLMS+LA WA
Sbjct  304   AASSGILIYMALVDLLAADFMNPKLQSNGILQVGASVSLLLGAGLMSLLAIWA  356



>ref|XP_004167569.1| PREDICTED: zinc transporter 1-like [Cucumis sativus]
 gb|KGN54984.1| ZIP transporter [Cucumis sativus]
Length=367

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 191/296 (65%), Positives = 229/296 (77%), Gaps = 4/296 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPALSPE   FF++KAFAAGVILATGFIHVLPDA+ NLTS KL++HPW  FPF
Sbjct  72    IPLLGKLIPALSPEKDIFFIIKAFAAGVILATGFIHVLPDAYGNLTSSKLNEHPWGKFPF  131

Query  571   CGFVAMVAAIGTLMVDSFATSYFS----GRSGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              G VAMVAAIGTLMVD+ A+SY++     ++  ++    E      G     VH H    
Sbjct  132   TGLVAMVAAIGTLMVDAGASSYYTRIHLNKAQPELNGDDEMRGGGCGAHDGHVHVHTHGT  191

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H H H S     SS+++LRHRVISQVLELGI+VHSVIIGI LG S++P+TI+PLVAA+TF
Sbjct  192   HGHAHGSADVGGSSTEILRHRVISQVLELGIVVHSVIIGIGLGVSESPETIRPLVAAITF  251

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQ FEGMGLGGCIAQAKFK+++  +M LFF LTTP+GI IGI +T  YDEDSPK LI+EG
Sbjct  252   HQLFEGMGLGGCIAQAKFKNRATILMGLFFCLTTPIGIAIGIAVTKTYDEDSPKALIVEG  311

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             I N+AS+GILIYMALVDLLAADFM+PRM  N KLQ  AN SL+LGA LMS+LA WA
Sbjct  312   ILNAASSGILIYMALVDLLAADFMNPRMQSNGKLQLLANVSLILGAALMSLLAIWA  367



>ref|XP_008226052.1| PREDICTED: zinc transporter 1-like [Prunus mume]
Length=347

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 230/295 (78%), Gaps = 5/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IP L PE   FFM+KAFAAGVILATGFIH+LPDAF+NLTS  L ++PW  FPF
Sbjct  55    LPLLGKKIPTLRPENDIFFMIKAFAAGVILATGFIHILPDAFDNLTSPCLKENPWGKFPF  114

Query  571   CGFVAMVAAIGTLMVDSFATSYF--SGRSGEKVTAGH-EAGDAEVGpgvvpvhthathgh  741
              GFVAM++AIGTLMVDS AT Y+  S     +VT    E GD   G     VH H     
Sbjct  115   TGFVAMLSAIGTLMVDSLATGYYQRSNIKSNQVTVHELETGDHVHGHAADHVHGHTHATQ  174

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
             +H H S  +   SS+L+RHRVISQVLELGI+VHSVIIGI+LGAS +P+TIKPL+ AL+FH
Sbjct  175   SHAHGS--EELMSSELIRHRVISQVLELGILVHSVIIGISLGASQSPETIKPLMVALSFH  232

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI+QAKFKS+S AIMA FFSLTTP+GI IGIGI+  Y+E SP  LI+EG 
Sbjct  233   QFFEGVGLGGCISQAKFKSRSAAIMAAFFSLTTPVGIAIGIGISTVYNESSPTALIVEGT  292

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+A+AGILIYMALVDLLAADFM+PR+  N K+Q GA  SLLLG G MS++AKWA
Sbjct  293   FNAAAAGILIYMALVDLLAADFMNPRLQSNLKIQLGAYISLLLGTGCMSVIAKWA  347



>ref|XP_009354003.1| PREDICTED: zinc transporter 1-like [Pyrus x bretschneideri]
Length=359

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 230/295 (78%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IPAL+ E   FF++KAFAAGVILATGFIHVLPDAFE+L S  LS+  W  FPF
Sbjct  65    LPILGKKIPALNTENDIFFLIKAFAAGVILATGFIHVLPDAFESLRSPCLSETLWDSFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AM++AIGT+M+D+FATSY+      K   V    E      G   V  H    H H
Sbjct  125   TGFIAMLSAIGTMMIDTFATSYYRRSHFTKALPVKEDEEMNGVHQGHVHVHAHATHGHSH  184

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
               G ++  D+ SS +++RHRVISQVLELGI+VHSVIIGI+LGAS +PKTIKPLVAALTFH
Sbjct  185   GSGAIAPEDSISSFEIVRHRVISQVLELGILVHSVIIGISLGASQSPKTIKPLVAALTFH  244

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QA FKS+++A M LFFSLTTP+GI +G+GI+N Y+E SP  LI+EG+
Sbjct  245   QFFEGMGLGGCITQANFKSRAIATMVLFFSLTTPIGIGVGMGISNIYNETSPIALIVEGV  304

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYMALV+LLAADFM+PRM  N ++Q GAN SLLLG+G MS LAKWA
Sbjct  305   FNSASAGILIYMALVNLLAADFMNPRMQSNLRIQLGANVSLLLGSGCMSFLAKWA  359



>gb|ADF43066.1| zinc transporter protein [Ammopiptanthus nanus]
Length=356

 Score =   344 bits (883),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 229/295 (78%), Gaps = 10/295 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+  PAL PE  FFF++KAFAAGVIL+TGFIHVLPDAF+ LTS +LS HPW D PF
Sbjct  69    IPMLGKTFPALRPEKDFFFIIKAFAAGVILSTGFIHVLPDAFDKLTSPRLSDHPWGDLPF  128

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAM++AIGTLMVDS AT+YF+    +  ++V A  E  +   G  +           
Sbjct  129   TGFVAMISAIGTLMVDSLATAYFNKSHFKDKDQVVADEEKVEQVHGDHLHLHTHATHGHA  188

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  S+  TD    LLRHRVISQVLE+GI+VHSVIIGI+LGAS++PKTI+PL+AALTFH
Sbjct  189   HG---SIPSTD----LLRHRVISQVLEIGIVVHSVIIGISLGASESPKTIRPLIAALTFH  241

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFK ++V IMALFFSLTTP+GI IG+ IT  YDE+SP  LI+EGI
Sbjct  242   QFFEGMGLGGCIYQAKFKIKAVIIMALFFSLTTPVGIAIGLAITGAYDENSPTALIVEGI  301

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              N+ASAGILIYM+LVDLLAADFM+ R+  + +LQFGA+ SLLLGAG MS+LAKWA
Sbjct  302   LNAASAGILIYMSLVDLLAADFMNSRIQGSGRLQFGASVSLLLGAGCMSLLAKWA  356



>emb|CBI27217.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   350 bits (898),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 189/292 (65%), Positives = 225/292 (77%), Gaps = 6/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP +G++IPAL PE   FF VKAFAAGVILATGFIHVLPDAFE+LTS  L + PW  FPF
Sbjct  237   LPTLGKKIPALRPENDVFFAVKAFAAGVILATGFIHVLPDAFESLTSPCLGESPWGSFPF  296

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AIGT+M+D+FAT ++      K     E  D E+            HG    
Sbjct  297   SGFVAMLSAIGTMMMDAFATGFYQRLQRSKAQPVKE--DEEMQCENQDQVHGHPHGSGF-  353

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                V+    S +L RHRVI+QVLELGI+VHSVIIGI+LGAS++PKTIKPLVAAL+FHQFF
Sbjct  354   ---VSGELGSPELARHRVIAQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFHQFF  410

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI+QAKFKS++VA+M +FFSLTTP+GI +G+GI+N YDE+SPK L++EG+FNS
Sbjct  411   EGMGLGGCISQAKFKSKAVAVMVVFFSLTTPVGIAVGMGISNIYDENSPKALVVEGVFNS  470

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDL+AADFMSPRM  N KLQ  AN  LLLG   MS+LAKWA
Sbjct  471   ASAGILIYMALVDLVAADFMSPRMQTNFKLQIAANILLLLGTACMSLLAKWA  522


 Score =   233 bits (593),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +1

Query  760   VTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFEGM  939
             V +  +SS L+RHRV+SQVLELGI+VHSVIIGI+LGAS++PKTIKPLVAAL+FHQFFEGM
Sbjct  40    VLERSNSSDLIRHRVVSQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFHQFFEGM  99

Query  940   GLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSASA  1119
             GLGGCI+QAK+K ++  IM LFFSLTTP GI +G+GI+  YDE+SP  LI++G+ NSASA
Sbjct  100   GLGGCISQAKYKIKATIIMVLFFSLTTPTGIAVGLGISKIYDENSPTALIVQGVLNSASA  159

Query  1120  GILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             GILIYMALVDLLA DFM+P+M  N +LQ GA  +LLLGA  MS+LAKW
Sbjct  160   GILIYMALVDLLATDFMNPKMQSNVRLQLGAYATLLLGAASMSVLAKW  207



>ref|XP_009340286.1| PREDICTED: zinc transporter 1-like [Pyrus x bretschneideri]
Length=359

 Score =   344 bits (883),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 231/295 (78%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IPAL+ E   FF++KAFAAGVILATGFIHVLPDAFE+L S  LS+  W  FPF
Sbjct  65    LPMLGKKIPALNTENDIFFLIKAFAAGVILATGFIHVLPDAFESLRSPCLSETLWDSFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AM++AIGT+M+D+FATSY+      K   V    E      G   V  H    H H
Sbjct  125   TGFIAMLSAIGTMMIDTFATSYYRRSHFTKALPVKEDEEMNGVHQGHVHVHAHATHGHAH  184

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
               G ++  D+ SS +++R+RVISQVLELGI+VHSVIIGI+LGAS +PKTIKPLVAALTFH
Sbjct  185   GSGAIAPEDSISSFEIVRNRVISQVLELGILVHSVIIGISLGASQSPKTIKPLVAALTFH  244

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QA FKS+++A M LFFSLTTP+GI +G+GI+N Y++ SP  LI+EG+
Sbjct  245   QFFEGMGLGGCITQANFKSRAIATMVLFFSLTTPIGIGVGMGISNIYNKTSPSALIVEGV  304

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYMALVDLLAADFM+PRM  N ++Q GAN SLLLG+G MS+LAKWA
Sbjct  305   FNSASAGILIYMALVDLLAADFMNPRMQSNLRIQLGANVSLLLGSGCMSLLAKWA  359



>ref|XP_010260702.1| PREDICTED: zinc transporter 8-like [Nelumbo nucifera]
Length=354

 Score =   344 bits (882),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 192/295 (65%), Positives = 226/295 (77%), Gaps = 10/295 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+ IPAL PE + FF++KAFAAGVILATGFIH+LPDAFE LTS  L    W  FPF
Sbjct  67    IPVLGKTIPALHPEKNIFFIIKAFAAGVILATGFIHILPDAFEQLTSPCLKGKAWEKFPF  126

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAM++AIGTLM+D+ ATSY++     K   +    E  D +V    V  H    H H
Sbjct  127   TGFVAMMSAIGTLMIDTTATSYYNRSHFNKSQLMNGDEERTDEQVSHVHVHTHATYGHAH  186

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                        +SS+LLRHRVISQVLELGI+VHSVIIGI++G S+ P TI+PLVAALTFH
Sbjct  187   G-------SDSTSSELLRHRVISQVLELGIVVHSVIIGISVGTSEDPSTIRPLVAALTFH  239

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFK+++ AIM LFFSLTTP+GI IG+GITN Y+E+SP  LI+EGI
Sbjct  240   QFFEGMGLGGCITQAKFKNRATAIMILFFSLTTPVGIAIGMGITNVYNENSPTALIVEGI  299

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             F+SA+AGILIYMALVDLLAADFM+PRM  N KLQ  AN SLLLGAG MS+LAKWA
Sbjct  300   FDSAAAGILIYMALVDLLAADFMNPRMQSNGKLQILANASLLLGAGCMSVLAKWA  354



>gb|AAX28838.1| zinc transporter protein ZIP2 [Fragaria x ananassa]
Length=353

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 196/293 (67%), Positives = 232/293 (79%), Gaps = 2/293 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IP+L PE   FF++KAFAAGVILATGFIHVLPDAFE LTS  L ++PW +FPF
Sbjct  62    IPIIGKTIPSLQPEKPIFFIIKAFAAGVILATGFIHVLPDAFERLTSPCLKENPWANFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+AAIGTLMVDS ATSYF+ RS  K    H  GD E            THG    
Sbjct  122   TGFVAMMAAIGTLMVDSIATSYFN-RSHFKKAQNHVNGDEEKVGEHEGHVHVHTHGTHGH  180

Query  751   hvSVTDTDSS-SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
                  DT+S+ SQLLRHRVIS+VLELGI+VHSVIIGI+LGAS++P T++PLVAALTFHQF
Sbjct  181   SHGSLDTNSAESQLLRHRVISKVLELGIVVHSVIIGISLGASESPATVRPLVAALTFHQF  240

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCIAQA+    +  IM LFFSLTTP+GI IGIGI++RY+E+SP  LI+EG+F+
Sbjct  241   FEGMGLGGCIAQARESQLTTIIMVLFFSLTTPVGIGIGIGISSRYEENSPTALILEGLFD  300

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +ASAGILIYMALVDLLAADFM+P+M KN KLQ GAN SLL GAG MS++AKWA
Sbjct  301   AASAGILIYMALVDLLAADFMNPKMQKNIKLQVGANVSLLFGAGCMSLIAKWA  353



>ref|XP_011085461.1| PREDICTED: zinc transporter 5-like [Sesamum indicum]
Length=344

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 226/292 (77%), Gaps = 11/292 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPV+GR + ALSPE + FF++KAFAAGVIL+TGFIHVLPDAFE+LTS  L + PW DFPF
Sbjct  64    LPVLGRTVAALSPERNLFFILKAFAAGVILSTGFIHVLPDAFESLTSPCLGEKPWEDFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAMVAAIGTLMVD++AT+++  ++ +K     E  +  V                  
Sbjct  124   AGFVAMVAAIGTLMVDTYATAHYQRQAEKKNCKKEEEEEGMV-----------PVHTHAT  172

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
             H +V+     ++LLRHRVISQVLELGIIVHSVIIGIALGASD+PKTI+PL+ ALTFHQ F
Sbjct  173   HGAVSLESGETELLRHRVISQVLELGIIVHSVIIGIALGASDSPKTIRPLIGALTFHQLF  232

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QAKF + ++ +MA+FFSLTTP GI +GIG++N Y E SP  LI+EG+FNS
Sbjct  233   EGIGLGGCITQAKFDAAAITLMAIFFSLTTPTGIAVGIGLSNIYSETSPTALIVEGVFNS  292

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLL+ADFMS +M  N KLQ GAN SLLLGAG MS+LAKWA
Sbjct  293   ASAGILIYMALVDLLSADFMSHKMQTNLKLQLGANASLLLGAGCMSLLAKWA  344



>gb|ABH01187.1| zinc transporter protein [Ammopiptanthus mongolicus]
Length=356

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 228/295 (77%), Gaps = 10/295 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+  PAL PE  FFF+VKAFAAGVIL+ GFIHVLPDAF+ LTS +LS HPW DFPF
Sbjct  69    IPMLGKTFPALRPEKDFFFIVKAFAAGVILSAGFIHVLPDAFDKLTSPRLSDHPWGDFPF  128

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAM++AIGTLMVDS AT+YF+    +  ++V A  E  +   G  +           
Sbjct  129   TGFVAMISAIGTLMVDSLATAYFNKSHFKDKDQVVADEEKVEQVHGDHLHLHTHATHGHA  188

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  S+  TD    LLRHRVISQVLE+GI+VHSVIIGI+LGAS++PKTI+PL+AALTFH
Sbjct  189   HG---SIPSTD----LLRHRVISQVLEIGIVVHSVIIGISLGASESPKTIRPLIAALTFH  241

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFK ++V IMALFFSLTTP+GI IG+ IT  YDE+SP  LI+EGI
Sbjct  242   QFFEGMGLGGCIYQAKFKIKAVIIMALFFSLTTPVGIAIGLAITGAYDENSPTALIVEGI  301

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
               +ASAGILIYM+LVDLLAADFM+ R+  + +LQFGA+ SLLLGAG MS+LAKWA
Sbjct  302   LKAASAGILIYMSLVDLLAADFMNSRIQGSGRLQFGASVSLLLGAGCMSLLAKWA  356



>ref|XP_007049130.1| Zinc transporter 5 precursor [Theobroma cacao]
 gb|EOX93287.1| Zinc transporter 5 precursor [Theobroma cacao]
Length=355

 Score =   342 bits (877),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 196/294 (67%), Positives = 231/294 (79%), Gaps = 5/294 (2%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+ I AL PE + FF +KAFAAGVIL+TGFIHVLPDA E+LTS  L ++PW  FPF 
Sbjct  64    PLLGKTINALRPEKNLFFTIKAFAAGVILSTGFIHVLPDATESLTSPCLDENPWGKFPFA  123

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAE-VGpgvvpvhthathghahg  750
             G VAM +AI TLMVD FATS+++     K    H  GD E  G     VH H    H H 
Sbjct  124   GLVAMTSAIATLMVDVFATSHYTKSHFNKTQ--HINGDEEKTGEHENHVHVHTHATHGHA  181

Query  751   hvSVTDTDSS--SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
             H SV+  D S  S+LLRHRV+SQVLELGI+VHS I+G +LGAS++PKTIKPLVAALTFHQ
Sbjct  182   HGSVSSVDRSGSSELLRHRVVSQVLELGIVVHSAIVGTSLGASESPKTIKPLVAALTFHQ  241

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI+QA+FKS++VAIMALFFSLTTP+GI IGIGI+N YDE SP  LI+EGIF
Sbjct  242   FFEGMGLGGCISQAQFKSRAVAIMALFFSLTTPVGIAIGIGISNIYDESSPTALIVEGIF  301

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+ASAGILIYMALVDLLAADFM+P++  N  LQ GA+ +LLLGAGLMS+LA WA
Sbjct  302   NAASAGILIYMALVDLLAADFMNPKLQNNGILQAGASVALLLGAGLMSLLAVWA  355



>ref|XP_009396993.1| PREDICTED: zinc transporter 8-like [Musa acuminata subsp. malaccensis]
Length=353

 Score =   342 bits (876),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 225/296 (76%), Gaps = 4/296 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL P+   FF++KAFAAGVILATGFIH+LPDAFENLTS  L   PW+DFPF
Sbjct  58    IPILGKWIPALRPDKDIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLPSSPWQDFPF  117

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKV---TAGHEAGDAEVGpgvvpvhthathgh  741
              GF AMVAA+GTLM+D+ AT YF+   G K+    +     D E     +          
Sbjct  118   AGFGAMVAAVGTLMIDTIATGYFNRLHGNKMRTTVSDETNADVEKTSDGLDHVHTHATHG  177

Query  742   ahghvSVTDT-DSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
                  ++ D+ D+S+QL+R+RVISQVLELGIIVHSVIIGI+LGAS+ P TI+PLVAAL+F
Sbjct  178   HAHGSTMMDSADASAQLIRNRVISQVLELGIIVHSVIIGISLGASEVPSTIRPLVAALSF  237

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI QAKFK++S+  M LFFSLTTP+GI IGIGI + YDE+SP  LI+EG
Sbjct  238   HQFFEGMGLGGCIVQAKFKAKSIVTMGLFFSLTTPVGIAIGIGIASVYDENSPTALIVEG  297

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
               NS ++GILIYMALVDLLAADFM+PR+    +LQF  N SLL+GAGLMS+LAKWA
Sbjct  298   CLNSVASGILIYMALVDLLAADFMNPRVQSKARLQFMINVSLLVGAGLMSLLAKWA  353



>gb|AFK42181.1| unknown [Medicago truncatula]
Length=358

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 188/296 (64%), Positives = 227/296 (77%), Gaps = 7/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ +RIP LSP+   FFM+KAFAAGVILATGFIH+LPDAFE+L S  L + PW DFP 
Sbjct  66    LPLLSKRIPILSPKNDIFFMIKAFAAGVILATGFIHILPDAFESLNSPCLKEKPWGDFPL  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRS---GEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              G VAM+++I TLMVDSFA+SY+  R     ++V A  E GD  VG   V       H H
Sbjct  126   AGLVAMLSSIATLMVDSFASSYYQKRHFNPSKQVPADEEKGDEHVGHVHVHTRATHGHAH  185

Query  742   ahghvSVTDTDS-SSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
                  S    DS S +L+R R+ISQVLELGI+VHSVIIGI+LG + +  TIKPL+ AL+F
Sbjct  186   GSATSS---QDSISPELIRQRIISQVLELGIVVHSVIIGISLGTAQSIDTIKPLLVALSF  242

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QAKF+S+S AIMA FFSLTTP+GI IG+G+++ Y ++SP  LI+EG
Sbjct  243   HQFFEGMGLGGCISQAKFESRSTAIMATFFSLTTPIGIAIGMGVSSVYKDNSPTSLIVEG  302

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +FNSASAGILIYMALVDLLAADFMSPRM  N K+Q GAN SLLLG+G MS+LAKWA
Sbjct  303   VFNSASAGILIYMALVDLLAADFMSPRMQNNFKIQIGANISLLLGSGCMSLLAKWA  358



>ref|XP_009397090.1| PREDICTED: zinc transporter 8-like [Musa acuminata subsp. malaccensis]
Length=349

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 227/295 (77%), Gaps = 6/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL P+   FF++KAFAAGVILATGFIH+LPDAFENLTS  L+  PW+DFPF
Sbjct  58    IPILGKWIPALRPDKDIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLASSPWQDFPF  117

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG--RSGEKVTAGHEA-GDAEVGpgvvpvhthathgh  741
              GF AMVAA+ TLM+D+ AT YF+   R   + TA  E   D E          H     
Sbjct  118   AGFGAMVAAVATLMIDTLATGYFNRLHRKNMRTTASDETTADVE---KTSDGSDHVHTHA  174

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
              HGH   +D D+S+QL+R+RVISQVLELGI+VHSVIIGI+LGAS+ P TI+PLVAAL+FH
Sbjct  175   THGHAHGSDGDASAQLIRNRVISQVLELGIVVHSVIIGISLGASEVPSTIRPLVAALSFH  234

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QAKFK++S+  M LFFSLTTP+GI IGIGI + YDE+SP  LI+EG 
Sbjct  235   QFFEGMGLGGCIVQAKFKAKSIVTMGLFFSLTTPVGIAIGIGIASVYDENSPTALIVEGC  294

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              NS ++GILIYMALVDLLAADFM+PR+    +LQF  N SLL+GAGLMS+LAKWA
Sbjct  295   LNSVASGILIYMALVDLLAADFMNPRVQSKARLQFMINVSLLVGAGLMSLLAKWA  349



>ref|XP_008378330.1| PREDICTED: zinc transporter 8-like [Malus domestica]
 ref|XP_008378331.1| PREDICTED: zinc transporter 8-like [Malus domestica]
Length=351

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/292 (66%), Positives = 230/292 (79%), Gaps = 4/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL P+ + FF++KAFAAGVILATGFIHVLPDAFENLT   L ++PW  FPF
Sbjct  64    IPILGKTIPALHPDRNIFFIIKAFAAGVILATGFIHVLPDAFENLTDPVLKENPWGKFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+AAIGTLMVDS+ATSY+S    E     +   D E            TH     
Sbjct  124   TGFVAMMAAIGTLMVDSYATSYYSNSHFEN----NINRDEEKAQEHGGHVHVHTHSTHGH  179

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                  DT  S++LLRHRVISQVLELGIIVHSVIIGI+LGAS++PKTIKPLVAAL+FHQFF
Sbjct  180   AHGAVDTSPSTELLRHRVISQVLELGIIVHSVIIGISLGASESPKTIKPLVAALSFHQFF  239

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QA F++++VAIM+LFFSLTTP+GI IGIGI+N YDE SP  LI+EG+FN+
Sbjct  240   EGMGLGGCITQAMFENRAVAIMSLFFSLTTPVGIGIGIGISNVYDESSPTALIVEGVFNA  299

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLLAADFM+ +M  + +LQ GAN SLL+GAG MS+LAKWA
Sbjct  300   ASAGILIYMALVDLLAADFMNQKMQSDGRLQAGANISLLVGAGCMSLLAKWA  351



>ref|XP_011014118.1| PREDICTED: zinc transporter 1-like [Populus euphratica]
Length=360

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/296 (64%), Positives = 229/296 (77%), Gaps = 6/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++I ALSPE   FFM+KAFAAGVILATGFIH+LPDAF++LTS  L+++PW DFPF
Sbjct  67    LPLLGKKIKALSPENDIFFMIKAFAAGVILATGFIHILPDAFDSLTSPCLAQNPWGDFPF  126

Query  571   CGFVAMVAAIGTLMVDSFATSYFS----GRSGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              GFVAM+ AIGTLMVD++AT ++      +S    T   E   A  G   V  H    H 
Sbjct  127   TGFVAMMTAIGTLMVDTYATGFYKRMHFNKSKPVNTTDEETAGAHEGHVHVHTHATHGHA  186

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H     S  +  + S+L+R R+ISQVLELGI+VHS+IIGI+LGAS++PKTIKPL+ AL+F
Sbjct  187   HGSA--SPEEDLALSELIRRRIISQVLELGIVVHSIIIGISLGASESPKTIKPLMVALSF  244

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI  A+FKS S+AIMA FFSLTTP+GI +GIGI++ Y+E+SP   +IEG
Sbjct  245   HQFFEGMGLGGCITLAQFKSTSMAIMATFFSLTTPVGIAVGIGISSIYNENSPTAQVIEG  304

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             I N+ASAGILIYMALVDLLAADFMSPRM  N ++Q GAN SLLLGAG MS LAKWA
Sbjct  305   ILNAASAGILIYMALVDLLAADFMSPRMQSNLRIQLGANVSLLLGAGCMSFLAKWA  360



>ref|XP_006422260.1| hypothetical protein CICLE_v10005248mg [Citrus clementina]
 gb|ESR35500.1| hypothetical protein CICLE_v10005248mg [Citrus clementina]
 gb|KDO61585.1| hypothetical protein CISIN_1g018182mg [Citrus sinensis]
Length=359

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 228/296 (77%), Gaps = 5/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+++PAL PE   FFM+KAFAAGVILATGF+H+LPDAF+NLTS  L ++PW DFPF
Sbjct  65    LPLLGKKVPALRPENDTFFMIKAFAAGVILATGFVHILPDAFDNLTSPCLVENPWGDFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AIGTLM+D+FAT Y+  R         +  D E+           TH     
Sbjct  125   SGFVAMMSAIGTLMIDTFATGYYK-RQHFNCKPNKQLVDEEMANEHAGHVHVHTHATHGH  183

Query  751   hvSVTDTDSS----SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
                 TD+       S+++R RVISQVLELGI+VHS+IIGI+LGAS++  TIKPL+AAL+F
Sbjct  184   AHGSTDSSYQELALSEIIRKRVISQVLELGIVVHSIIIGISLGASESLDTIKPLLAALSF  243

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QA++KS+S+AIMA FFSLTTP+GI IG+GI++ Y E+ P  LI++G
Sbjct  244   HQFFEGMGLGGCISQAEYKSRSMAIMAAFFSLTTPVGIAIGVGISSVYKENGPTALIVQG  303

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +FNSASAGILIYMALVDLLAADFM+P +  N +LQ GAN SLLLGAG MS+LAKWA
Sbjct  304   VFNSASAGILIYMALVDLLAADFMNPILQSNRRLQLGANISLLLGAGCMSVLAKWA  359



>ref|XP_002274548.2| PREDICTED: zinc transporter 5 [Vitis vinifera]
Length=660

 Score =   350 bits (898),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 189/292 (65%), Positives = 225/292 (77%), Gaps = 6/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP +G++IPAL PE   FF VKAFAAGVILATGFIHVLPDAFE+LTS  L + PW  FPF
Sbjct  375   LPTLGKKIPALRPENDVFFAVKAFAAGVILATGFIHVLPDAFESLTSPCLGESPWGSFPF  434

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AIGT+M+D+FAT ++      K     E  D E+            HG    
Sbjct  435   SGFVAMLSAIGTMMMDAFATGFYQRLQRSKAQPVKE--DEEMQCENQDQVHGHPHGSGF-  491

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                V+    S +L RHRVI+QVLELGI+VHSVIIGI+LGAS++PKTIKPLVAAL+FHQFF
Sbjct  492   ---VSGELGSPELARHRVIAQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFHQFF  548

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI+QAKFKS++VA+M +FFSLTTP+GI +G+GI+N YDE+SPK L++EG+FNS
Sbjct  549   EGMGLGGCISQAKFKSKAVAVMVVFFSLTTPVGIAVGMGISNIYDENSPKALVVEGVFNS  608

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDL+AADFMSPRM  N KLQ  AN  LLLG   MS+LAKWA
Sbjct  609   ASAGILIYMALVDLVAADFMSPRMQTNFKLQIAANILLLLGTACMSLLAKWA  660


 Score =   325 bits (832),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/277 (58%), Positives = 206/277 (74%), Gaps = 16/277 (6%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ + +P+L PE + +F++KAFAAGVILATGF+H+LPDA+++L S  LS++PW  FPF
Sbjct  65    LPLLLKNVPSLRPEKAIYFLIKAFAAGVILATGFLHILPDAYDSLKSPCLSENPWGGFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AM+AAI TLM+++FAT Y      R  + V    E+     G              
Sbjct  125   TGFIAMMAAILTLMMEAFATGYHRRSELRKAQPVNGDEESDGDHAGHVHGSAF-------  177

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                   V +  +SS L+RHRV+SQVLELGI+VHSVIIGI+LGAS++PKTIKPLVAAL+FH
Sbjct  178   ------VLERSNSSDLIRHRVVSQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFH  231

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QAK+K ++  IM LFFSLTTP GI +G+GI+  YDE+SP  LI++G+
Sbjct  232   QFFEGMGLGGCISQAKYKIKATIIMVLFFSLTTPTGIAVGLGISKIYDENSPTALIVQGV  291

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGA  1212
              NSASAGILIYMALVDLLA DFM+P+M  N +LQ GA
Sbjct  292   LNSASAGILIYMALVDLLATDFMNPKMQSNVRLQLGA  328



>ref|XP_007212798.1| hypothetical protein PRUPE_ppa020164mg [Prunus persica]
 gb|EMJ13997.1| hypothetical protein PRUPE_ppa020164mg [Prunus persica]
Length=331

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 192/294 (65%), Positives = 228/294 (78%), Gaps = 5/294 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IP L PE   FFM+KAFAAGVILAT FIH+LPDAF+NLTS  L ++PW  FPF
Sbjct  41    LPLLGKKIPTLRPENDIFFMIKAFAAGVILATAFIHILPDAFDNLTSPCLKENPWGKFPF  100

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHE--AGDAEVGpgvvpvhthathgha  744
              GFVAM++AIGTLMVDS AT Y+  RS  K    HE   GD   G     VH H     +
Sbjct  101   TGFVAMLSAIGTLMVDSLATGYYQ-RSNIKSNQVHELETGDRVHGHAADHVHGHTHATQS  159

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
             H H S  +   SS+L+R+RVISQVLELGI+VHSVIIGI+LGAS +P+TIKPL+ AL+FHQ
Sbjct  160   HAHGS--EELMSSELIRNRVISQVLELGILVHSVIIGISLGASQSPETIKPLMVALSFHQ  217

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEG+GLGGCI+QAKFKS+S AIMA FFSLTTP+GI IGIGI+  Y+E SP  LI+EG F
Sbjct  218   FFEGVGLGGCISQAKFKSRSAAIMAAFFSLTTPVGIAIGIGISTVYNESSPTALIVEGTF  277

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+A+AGILIYMALVDLLAADFM+PR+  N  +Q GA  SLLLG G MS+LAKWA
Sbjct  278   NAAAAGILIYMALVDLLAADFMNPRLQSNLGIQLGAYISLLLGTGCMSVLAKWA  331



>gb|AAR08412.1| metal transport protein [Medicago truncatula]
 gb|KEH38228.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=358

 Score =   339 bits (870),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 224/295 (76%), Gaps = 5/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ +RIP LSP+   FFM+KAFAAGVILATGFIH+LPDAFE+L S  L + PW DFP 
Sbjct  66    LPLLSKRIPILSPKNDIFFMIKAFAAGVILATGFIHILPDAFESLNSPCLKEKPWGDFPL  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR---SGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              G VAM+++I TLMVDSFA+SY+  R     ++V A  E GD E    V           
Sbjct  126   AGLVAMLSSIATLMVDSFASSYYQKRHFNPSKQVPADEEKGD-EHVGHVHVHTHATHGHA  184

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  S  D+  S +L+R R+ISQVLELGI+VHSVIIGI+LG + +  TIKPL+ AL+FH
Sbjct  185   HGSATSSQDS-ISPELIRQRIISQVLELGIVVHSVIIGISLGTAQSIDTIKPLLVALSFH  243

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QAKF+S+S AIMA FFSLTTP+GI IG+G+++ Y ++SP  LI+EG+
Sbjct  244   QFFEGMGLGGCISQAKFESRSTAIMATFFSLTTPIGIAIGMGVSSVYKDNSPTSLIVEGV  303

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYMALVDLLAADFMSPRM  N K+Q GAN SLLLG+G MS+LAKWA
Sbjct  304   FNSASAGILIYMALVDLLAADFMSPRMQNNFKIQIGANISLLLGSGCMSLLAKWA  358



>ref|XP_007149187.1| hypothetical protein PHAVU_005G048900g [Phaseolus vulgaris]
 gb|ESW21181.1| hypothetical protein PHAVU_005G048900g [Phaseolus vulgaris]
Length=359

 Score =   339 bits (870),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 229/295 (78%), Gaps = 5/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ RRIP L+P+   FFMVKAFAAGVILATGF+H+LPDA+E+LTS  L  +PW  FPF
Sbjct  67    LPLLSRRIPTLNPKNDIFFMVKAFAAGVILATGFVHILPDAYESLTSPCLKDNPWGKFPF  126

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRS---GEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAM+++IGTLMVDSFAT ++  +     ++V A  E GD   G   V  H    H H
Sbjct  127   TGFVAMMSSIGTLMVDSFATGFYHRQHFNPSKQVPADEEIGDEHAGHIHVHTHATHGHAH  186

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  S  +   +S+L+R R+ISQVLE+GI+VHSVIIGI+LG + +  TIKPL+ AL+FH
Sbjct  187   GSAVSS--EDAETSELIRQRIISQVLEIGIVVHSVIIGISLGTAGSIDTIKPLLVALSFH  244

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QA+F+S+S AIMA FFSLTTP+GI IG+G+++ Y E+SP  L +EG+
Sbjct  245   QFFEGMGLGGCISQAEFESKSTAIMATFFSLTTPIGIAIGMGVSSAYKENSPTALTVEGV  304

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYMALVDLLAADFM+PR+ KN KLQ GAN SLLLG+G MS+LAKWA
Sbjct  305   FNSASAGILIYMALVDLLAADFMNPRLQKNLKLQLGANISLLLGSGCMSLLAKWA  359



>ref|XP_010922622.1| PREDICTED: zinc transporter 8-like isoform X1 [Elaeis guineensis]
Length=349

 Score =   339 bits (869),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 221/292 (76%), Gaps = 2/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ + IPALSPE   FF++KAFAAGVILATGFIH+LPDAFENLTS  L+ +PW  FPF
Sbjct  60    LPILSKSIPALSPENDIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLNDNPWGKFPF  119

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF AM+ A+GTLMVD+ ATSYFS R+   V      GDAE+            H     
Sbjct  120   AGFGAMLGALGTLMVDTLATSYFS-RAARAVGNEDNKGDAEMNGSAGDHRVVHVHATHGH  178

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                    D S +L+R+RVISQVLELGI+VHSVIIGI+LGASD+P TI+PLVAAL+FHQFF
Sbjct  179   AHGPA-VDGSEKLVRNRVISQVLELGIVVHSVIIGISLGASDSPSTIRPLVAALSFHQFF  237

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCIAQAKFK +S+A M LFFSLTTP+GI IG GI+  Y+E+SP  LI+EG  NS
Sbjct  238   EGMGLGGCIAQAKFKIKSIATMILFFSLTTPVGIAIGFGISTVYNENSPTALIVEGCLNS  297

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              +AGILIYMALVDLLA DFM+PR+    KLQF  N SLL+GAGLMS+LAKWA
Sbjct  298   VAAGILIYMALVDLLAEDFMNPRVQSKGKLQFWINVSLLIGAGLMSLLAKWA  349



>ref|XP_004303952.1| PREDICTED: zinc transporter 1-like [Fragaria vesca subsp. vesca]
Length=353

 Score =   339 bits (870),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 195/293 (67%), Positives = 230/293 (78%), Gaps = 2/293 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IP+L PE   FF++KAFAAGVILATGFIHVLPDAFE LTS  L ++PW +FPF
Sbjct  62    IPIIGKTIPSLQPEKPIFFIIKAFAAGVILATGFIHVLPDAFERLTSPCLKENPWANFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+AAIGTLMVDS ATSYF+ RS  K    H  GD E            THG    
Sbjct  122   TGFVAMMAAIGTLMVDSIATSYFN-RSHFKKAQNHVNGDEEKVGEHEGHVHVHTHGTHGH  180

Query  751   hvSVTDTDSS-SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
                  DT+S+ SQLLRHRVIS+VLELGI+VHSVIIGI+LGAS++P T++PLVAALTFHQF
Sbjct  181   SHGSLDTNSAESQLLRHRVISKVLELGIVVHSVIIGISLGASESPATVRPLVAALTFHQF  240

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCIAQA+    +  IM LFFSLTTP+GI IGIGI++RY E+S   LI+EG+F+
Sbjct  241   FEGMGLGGCIAQARESRLTTIIMVLFFSLTTPVGIGIGIGISSRYKENSSTALILEGLFD  300

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +ASAGILIYMALVDLLAADFM+P+M KN KLQ GAN SLL GAG MS++AKWA
Sbjct  301   AASAGILIYMALVDLLAADFMNPKMQKNVKLQVGANVSLLFGAGCMSLIAKWA  353



>ref|XP_002315075.2| metal transport family protein [Populus trichocarpa]
 gb|EEF01246.2| metal transport family protein [Populus trichocarpa]
Length=361

 Score =   339 bits (870),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 187/296 (63%), Positives = 228/296 (77%), Gaps = 6/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++I ALSPE   FFM+KAFAAGVILATGFIH+LPDAF++LTS  L+++PW DFPF
Sbjct  68    LPLLGKKIKALSPENDIFFMIKAFAAGVILATGFIHILPDAFDSLTSPCLAQNPWGDFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSYFS----GRSGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              GFVAM+ AIGTLMVD+FAT ++      +S    T   E  +   G   V  H    H 
Sbjct  128   TGFVAMMTAIGTLMVDTFATGFYKRMHFNKSKPVNTTDEETAEEHEGHVHVHTHATHGHA  187

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H     S  +  + S+L+R R+ISQ LELGI+VHS+IIGI+LGAS +PKTIKPL+ AL+F
Sbjct  188   HGSA--SPEEDLALSELIRRRIISQALELGIVVHSIIIGISLGASGSPKTIKPLMVALSF  245

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI  A+FKS S+AIMA FFSLTTP+GI +GIGI++ Y+E+SP   ++EG
Sbjct  246   HQFFEGMGLGGCITLAQFKSTSMAIMATFFSLTTPVGIAVGIGISSIYNENSPTAQVVEG  305

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFN+ASAGILIYMALVDLLAADFMSPRM  N ++Q GAN SLLLGAG MS LAKWA
Sbjct  306   IFNAASAGILIYMALVDLLAADFMSPRMQSNLRIQLGANVSLLLGAGCMSFLAKWA  361



>ref|XP_010922623.1| PREDICTED: zinc transporter 8-like isoform X2 [Elaeis guineensis]
Length=349

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 188/292 (64%), Positives = 222/292 (76%), Gaps = 2/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ + IPALSPE   FF++KAFAAGVILATGFIH+LPDAFENLTS  L+ +PW  FPF
Sbjct  60    LPILSKSIPALSPENDIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLNDNPWGKFPF  119

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF AM+ A+GTLMVD+ ATSYFS R+   V      GDAE+            H     
Sbjct  120   AGFGAMLGALGTLMVDTLATSYFS-RAARAVGNEDNKGDAEMNGSAGDHRVVHVHATHGH  178

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                    D S +L+R+RVISQVLELGI+VHSVIIGI+LGASD+P TI+PLVAAL+FHQFF
Sbjct  179   AHGPA-VDGSEKLVRNRVISQVLELGIVVHSVIIGISLGASDSPSTIRPLVAALSFHQFF  237

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCIAQAKFK +S+A M LFFSLTTP+GI IG GI++ Y+E+SP  LI+EG  NS
Sbjct  238   EGMGLGGCIAQAKFKIKSMATMILFFSLTTPVGIAIGFGISSVYNENSPTALIVEGCLNS  297

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              +AGILIYMALVDLLA DFM+PR+    KLQF  N SLL+GAGLMS+LAKWA
Sbjct  298   VAAGILIYMALVDLLAEDFMNPRVQSKGKLQFWINISLLIGAGLMSLLAKWA  349



>ref|XP_002264603.2| PREDICTED: zinc transporter 1 [Vitis vinifera]
Length=360

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 230/295 (78%), Gaps = 5/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+++PAL+PE   FFM+KAFAAGVILATGFIH+LP+AFE LTS  L ++PW  FPF
Sbjct  68    IPLLGKKVPALNPENHIFFMIKAFAAGVILATGFIHILPEAFERLTSPCLGENPWGKFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR---SGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              G VAM++AIGTLMVD+FAT Y+  +     ++VTA  E G    G   V  H    H H
Sbjct  128   TGLVAMMSAIGTLMVDTFATGYYKRQHFSKPKQVTADEERGQEHAGHVHVHTHATHGHAH  187

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  S +D +S S L+R R++SQVLELGI+VHSVIIG++LGAS  P+TIKPL+AAL+FH
Sbjct  188   GSA--SPSDEESLSDLIRRRIVSQVLELGIVVHSVIIGVSLGASQRPETIKPLLAALSFH  245

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI+QAKF+  ++A+M LFFS+TTP+GIV+GIGI+  Y E+ P  LI+EG+
Sbjct  246   QFFEGLGLGGCISQAKFRFSTMAMMVLFFSVTTPVGIVLGIGISRIYHENGPTALIVEGV  305

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             F++ASAGILIYMALVDLLAADFM+PR+  + +LQ GAN SLLLG G MS LAKWA
Sbjct  306   FDAASAGILIYMALVDLLAADFMNPRLQNSLRLQLGANISLLLGTGCMSFLAKWA  360



>emb|CAN72264.1| hypothetical protein VITISV_008114 [Vitis vinifera]
Length=360

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 230/295 (78%), Gaps = 5/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+++PAL+PE   FFM+KAFAAGVILATGFIH+LP+AFE LTS  L ++PW  FPF
Sbjct  68    IPLLGKKVPALNPENHIFFMIKAFAAGVILATGFIHILPEAFERLTSPCLGENPWGKFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR---SGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              G VAM++AIGTLMVD+FAT Y+  +     ++VTA  E G    G   V  H    H H
Sbjct  128   TGLVAMMSAIGTLMVDTFATGYYKRQHFSKPKQVTADEERGQEHAGHVHVHTHATHGHAH  187

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  S +D +S S L+R R++SQVLELGI+VHSVIIG++LGAS  P+TIKPL+AAL+FH
Sbjct  188   GSA--SPSDEESLSDLIRRRIVSQVLELGIVVHSVIIGVSLGASQRPETIKPLLAALSFH  245

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI+QAKF+  ++A+M LFFS+TTP+GIV+GIGI+  Y E+ P  LI+EG+
Sbjct  246   QFFEGLGLGGCISQAKFRFSTMAMMVLFFSVTTPVGIVLGIGISRIYHENGPTALIVEGV  305

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             F++ASAGILIYMALVDLLAADFM+PR+  + +LQ GAN SLLLG G MS LAKWA
Sbjct  306   FDAASAGILIYMALVDLLAADFMNPRLQNSLRLQLGANISLLLGTGCMSFLAKWA  360



>emb|CAN72265.1| hypothetical protein VITISV_008115 [Vitis vinifera]
Length=360

 Score =   338 bits (866),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 230/295 (78%), Gaps = 5/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+++PAL+PE   FFM+KAFAAGVILATGFIH+LP+AFE LTS  L ++PW  FPF
Sbjct  68    IPLLGKKVPALNPENHIFFMIKAFAAGVILATGFIHILPEAFERLTSPCLGENPWGKFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR---SGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              G VAM++AIGTLMVD+FAT Y+  +     ++VTA  E G    G   V  H    H H
Sbjct  128   TGLVAMMSAIGTLMVDTFATGYYKRQHFSKPKQVTADEERGQEHAGHVHVHTHATHGHAH  187

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  S +D +S S L+R R++SQVLELGI+VHSVIIG++LGAS  P+TIKPL+AAL+FH
Sbjct  188   GSA--SPSDEESLSDLIRRRIVSQVLELGIVVHSVIIGVSLGASQRPETIKPLLAALSFH  245

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI+QAKF+  ++A+M LFFS+TTP+GIV+GIGI+  Y E+ P  LI+EG+
Sbjct  246   QFFEGLGLGGCISQAKFRFSTMAMMVLFFSVTTPVGIVLGIGISRIYHENGPTALIVEGV  305

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             F++ASAGILIYMALVDLLAADFM+PR+  + +LQ GAN SLLLG G MS LAKWA
Sbjct  306   FDAASAGILIYMALVDLLAADFMNPRLQXSLRLQLGANISLLLGTGCMSFLAKWA  360



>ref|XP_002312231.1| metal transport family protein [Populus trichocarpa]
 gb|EEE89598.1| metal transport family protein [Populus trichocarpa]
Length=360

 Score =   337 bits (864),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 234/295 (79%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++I A  PE   FFM+KAFAAGVILATGFIH+LPDAFE+LTS  L++  W  FPF
Sbjct  66    LPLLGKKIKAFRPENDVFFMIKAFAAGVILATGFIHILPDAFESLTSPCLNQDLWGHFPF  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAM++AIGTLMVDSFAT ++        ++V    E    +   G V VHTHATHGH
Sbjct  126   TGFVAMMSAIGTLMVDSFATGFYKRMHFNKNKQVDTTDEETAGQEHEGHVHVHTHATHGH  185

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
             AHG  S+ +  + S+++R RVISQVLELGI+VHS+IIGI+LGAS +P+TIKPL+AAL+FH
Sbjct  186   AHGSASLNEDLALSEMVRRRVISQVLELGIVVHSIIIGISLGASGSPETIKPLMAALSFH  245

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI QA+FKS S+AIMA  FSLTTPLGI IGIGI+N YDE SP  L +EGI
Sbjct  246   QFFEGLGLGGCITQAQFKSASMAIMATLFSLTTPLGIAIGIGISNIYDERSPTALTVEGI  305

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGILIYMALVDLLA+DFMSPRM  N ++Q GAN SLLLGAG M+ + KWA
Sbjct  306   FNAASAGILIYMALVDLLASDFMSPRMQGNLRIQLGANVSLLLGAGCMTFMVKWA  360



>gb|KDP23905.1| hypothetical protein JCGZ_27105 [Jatropha curcas]
Length=359

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 233/307 (76%), Gaps = 22/307 (7%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+ G++I +L+PE + FF++KAFAAGVILATGF+H+LPDAFENLTS  L + PW DFPF
Sbjct  60    LPIFGKKIQSLNPENNIFFLIKAFAAGVILATGFVHILPDAFENLTSPCLEEIPWGDFPF  119

Query  571   CGFVAMVAAIGTLMVDSFATSYF------------SGRSGEKVTAGHEAGDAEVGpgvvp  714
              GFVAMVAAI T+MVDSFATSY+            +G   E        G   V      
Sbjct  120   AGFVAMVAAILTMMVDSFATSYYKRLHFNDKALPVTGDIVEMQGGKQHEGHVHV------  173

Query  715   vhthathghahghvSVTDTDS---SSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPK  885
              HTHA+HGHAHG  +V   DS   S  L RHRV+SQVLELGI+VHSVIIGI+LGAS++  
Sbjct  174   -HTHASHGHAHGSSAVISDDSVLKSDGLFRHRVVSQVLELGILVHSVIIGISLGASESTD  232

Query  886   TIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYD  1065
             TIKPLVAALTFHQFFEGMGLGGCI+QAKFKS ++ +M LFFSLTTP+GI IGIGI++ Y 
Sbjct  233   TIKPLVAALTFHQFFEGMGLGGCISQAKFKSGTITMMVLFFSLTTPMGIAIGIGISHSYS  292

Query  1066  EDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglm  1245
             +++P  LI+EG+FNSASAGILIYMALVDLLA DFM+P+M  N +LQ GAN SLLLG G M
Sbjct  293   DNTPTALIVEGVFNSASAGILIYMALVDLLAEDFMNPKMQANFRLQIGANVSLLLGMGCM  352

Query  1246  smlaKWA  1266
             S LAKWA
Sbjct  353   SALAKWA  359



>gb|AID21515.1| ZIP transporter, partial [Manihot esculenta]
Length=333

 Score =   336 bits (861),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 180/276 (65%), Positives = 219/276 (79%), Gaps = 6/276 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IPAL+PE + FF++KAFAAGVIL+TGFIHVLPDAFE+LTS  L+++PW  FPF
Sbjct  61    LPILGKFIPALNPEKNIFFIIKAFAAGVILSTGFIHVLPDAFESLTSPCLNENPWGKFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGE-KVTAGHEAGDAEVGpgvvpvhthathghah  747
              GFVAMV+AIGTLMVD+FATSY++   G+ +  AG E    E G          +H    
Sbjct  121   TGFVAMVSAIGTLMVDAFATSYYTKSHGQVRNIAGDEEKTEEDGGFHTHATHDHSHCS--  178

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
                 + +  +S +LLRHRVISQVLELGI+VHSVIIGI+LGAS +PKT++P+  ALTFHQF
Sbjct  179   ---GLIENSASPELLRHRVISQVLELGIVVHSVIIGISLGASQSPKTMRPIEDALTFHQF  235

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCI QAKFK + +AIMALFFSLTTP+GI IGIGI+N Y+E+SP  LI+EGIFN
Sbjct  236   FEGMGLGGCICQAKFKGRVMAIMALFFSLTTPIGIGIGIGISNAYNENSPTALIVEGIFN  295

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             SASAGILIYMALVDLLAADFM+P++  N KLQ G N
Sbjct  296   SASAGILIYMALVDLLAADFMNPKVQVNGKLQIGVN  331



>emb|CDP03480.1| unnamed protein product [Coffea canephora]
Length=354

 Score =   336 bits (862),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 192/295 (65%), Positives = 229/295 (78%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPV G++IP+LSPE + FF++KAFAAGVILATGFIHVLPDAFE+LTS  L  +PW  FPF
Sbjct  60    LPVWGKKIPSLSPENNLFFVIKAFAAGVILATGFIHVLPDAFESLTSPCLPDNPWGKFPF  119

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK-VTAGHEAGD--AEVGpgvvpvhthathgh  741
              GFVAM+A+IGTLMVD +ATS++   +G K + A  E GD   E     V          
Sbjct  120   TGFVAMLASIGTLMVDVYATSHYKKMAGNKGIQAIAEEGDRNGESNLSGVLPLHTHATHG  179

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                     + D+ S  LR+RVISQVLELGIIVHSVIIGIA+GASD+PKTI+PL+AALTFH
Sbjct  180   HAHTSLSMEGDTLSTQLRYRVISQVLELGIIVHSVIIGIAMGASDSPKTIRPLLAALTFH  239

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI QAKF ++++ IMA+FFSLTTP GI IGIGI N Y+E+SPK LI++GI
Sbjct  240   QFFEGVGLGGCITQAKFNARAITIMAIFFSLTTPAGIAIGIGIANVYNENSPKALIVQGI  299

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             F+SASAGILIYMALVDLL+ADFM+P+M  N KL  GAN SLL GAG MS+LAKWA
Sbjct  300   FDSASAGILIYMALVDLLSADFMNPKMQNNGKLLMGANVSLLFGAGCMSLLAKWA  354



>ref|XP_006493801.1| PREDICTED: zinc transporter 1-like [Citrus sinensis]
Length=451

 Score =   339 bits (869),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 228/296 (77%), Gaps = 5/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+++PAL PE   FFM+KAFAAGVILATGF+H+LPDAF+NLTS  L ++PW DFPF
Sbjct  157   LPLLGKKVPALRPENDTFFMIKAFAAGVILATGFVHILPDAFDNLTSPCLVENPWGDFPF  216

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AIGTLM+D+FAT Y+  R         +  D E+           TH     
Sbjct  217   SGFVAMMSAIGTLMIDTFATGYYK-RQHFNCKPNKQLVDEEMANEHAGHVHVHTHATHGH  275

Query  751   hvSVTDTDSS----SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
                 TD+       S+++R RVISQVLELGI+VHS+IIGI+LGAS++  TIKPL+AAL+F
Sbjct  276   AHGSTDSSYQELALSEIIRKRVISQVLELGIVVHSIIIGISLGASESLDTIKPLLAALSF  335

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QA++KS+S+AIMA FFSLTTP+GI IG+GI++ Y E+ P  LI++G
Sbjct  336   HQFFEGMGLGGCISQAEYKSRSMAIMAAFFSLTTPVGIAIGVGISSVYKENGPTALIVQG  395

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +FNSASAGILIYMALVDLLAADFM+P +  N +LQ GAN SLLLGAG MS+LAKWA
Sbjct  396   VFNSASAGILIYMALVDLLAADFMNPILQSNRRLQLGANISLLLGAGCMSVLAKWA  451



>ref|XP_006422259.1| hypothetical protein CICLE_v10005306mg [Citrus clementina]
 ref|XP_006493777.1| PREDICTED: zinc transporter 1-like [Citrus sinensis]
 gb|ESR35499.1| hypothetical protein CICLE_v10005306mg [Citrus clementina]
 gb|KDO61586.1| hypothetical protein CISIN_1g018732mg [Citrus sinensis]
Length=351

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 228/295 (77%), Gaps = 5/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IPAL PE   FFMVKAFAAGVILATGF+H+LP+AF++LTS  L ++PW +FPF
Sbjct  59    LPLLGKKIPALRPENDVFFMVKAFAAGVILATGFVHILPEAFDSLTSPCLGENPWGNFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              G VAM++AIGTLM+DSFAT Y+  +  +K  +  +  D E+           TH     
Sbjct  119   TGLVAMMSAIGTLMIDSFATGYYKRQHFDK--SRPQLVDEEMADDHSGHVHVHTHATHGH  176

Query  751   hvSVTDTDSS---SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  D+       +L+R RV+SQVLE+GI+VHSVIIGI+LGAS+    IKPL+AAL+FH
Sbjct  177   AHGSADSPQELALPELIRKRVVSQVLEIGIVVHSVIIGISLGASEDLDIIKPLLAALSFH  236

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QAKFKS+S+AIMA FFSLTTP+GI IGIGI++ Y+E+SP  LI+EGI
Sbjct  237   QFFEGMGLGGCISQAKFKSRSMAIMATFFSLTTPVGIAIGIGISSVYEENSPTALIVEGI  296

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FNSASAGILIYMALVDLLAADFM+P +  N +LQ GAN SLLLGAG MS+LAKWA
Sbjct  297   FNSASAGILIYMALVDLLAADFMNPILQSNSRLQLGANASLLLGAGCMSVLAKWA  351



>ref|XP_011014627.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 1 [Populus euphratica]
Length=359

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 196/302 (65%), Positives = 235/302 (78%), Gaps = 18/302 (6%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++I A  PE   FFM+KAFAAGVILATGFIH+LPDAFE+LTS  L++  W  FPF
Sbjct  66    LPLLGKKIKAFRPENDVFFMIKAFAAGVILATGFIHILPDAFESLTSPCLNQDLWGHFPF  125

Query  571   CGFVAMVAAIGTLMVDSFATSYF----------SGRSGEKVTAGHEAGDAEVGpgvvpvh  720
              GFVAM++AIGTLMVDSFAT ++          +  + E+  A HE          V VH
Sbjct  126   TGFVAMMSAIGTLMVDSFATGFYKRMHFNKNKPADTTDEETAAEHEG--------HVHVH  177

Query  721   thathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPL  900
             THATHGHAHG  S+ +  + S+L+R RVISQVLELGI+VHS+IIGI+LGAS +P+TIKPL
Sbjct  178   THATHGHAHGSASLKEDLALSELVRRRVISQVLELGIVVHSIIIGISLGASGSPETIKPL  237

Query  901   VAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPK  1080
             +AAL+FHQFFEG+GLGGCI QA+FKS S+AIMA  FSLTTPLGI IGIGI+N YDE SP 
Sbjct  238   MAALSFHQFFEGLGLGGCITQAQFKSASMAIMATLFSLTTPLGIAIGIGISNIYDERSPT  297

Query  1081  VLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaK  1260
              L +EGIFN+ASAGILIYMALVDLLA+DFMSPRM  N ++Q GAN SLLLGAG M+ + K
Sbjct  298   ALTVEGIFNAASAGILIYMALVDLLASDFMSPRMQGNFRIQLGANVSLLLGAGCMTFMVK  357

Query  1261  WA  1266
             WA
Sbjct  358   WA  359



>ref|XP_002532140.1| zinc/iron transporter, putative [Ricinus communis]
 gb|EEF30239.1| zinc/iron transporter, putative [Ricinus communis]
Length=359

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 200/342 (58%), Positives = 252/342 (74%), Gaps = 16/342 (5%)
 Frame = +1

Query  265   AAECKCggdeeddgeVHDkklalkyklaaiasilvasaigvsLPVVGRRIPALSPEGSFF  444
             +A+C C  +E    +  D+   LKYKL A++SIL+ASA+GV+LP+ G++IP+L+PE + F
Sbjct  26    SADCTCDQEETAVTQSDDRTKTLKYKLVAVSSILIASALGVTLPIFGKKIPSLNPENNIF  85

Query  445   FMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFCGFVAMVAAIGTLMVDSF  624
             F++KAFAAGVILATGF+H+LPDAF++LTS  L K PW  FPF GFVAMV+AI T+MVD+F
Sbjct  86    FLIKAFAAGVILATGFVHILPDAFDSLTSPCLKKKPWGQFPFSGFVAMVSAIMTMMVDTF  145

Query  625   ATSYFSGR--------SGEKVTAGHEAGDAEVGpgvvpvhthathghahghvSVTDTDSS  780
             ATSYF           SG++   G   G   V       H H +            +   
Sbjct  146   ATSYFKRSHFNKALPLSGDEELQGKHEGHVHVHTHASHGHAHGSAAFL--------SHDD  197

Query  781   SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIA  960
             S + RHR++SQVLELGI+VHSVIIGI+LGAS +  TIKPLVAALTFHQFFEGMGLGGCI+
Sbjct  198   SGIFRHRIVSQVLELGIVVHSVIIGISLGASQSIDTIKPLVAALTFHQFFEGMGLGGCIS  257

Query  961   QAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMA  1140
             QAKFKS++VA M LFFSLTTP+GI +GIGI++ Y+ ++   LI+EG+FNSASAGILIYMA
Sbjct  258   QAKFKSRAVAAMVLFFSLTTPIGIAVGIGISHSYNGNAQTALIVEGVFNSASAGILIYMA  317

Query  1141  LVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             LVDLLA DFM+P++  N +LQ GAN SLLLG   MS+LAKWA
Sbjct  318   LVDLLAEDFMNPKLQSNLRLQLGANLSLLLGTACMSLLAKWA  359



>ref|XP_009400783.1| PREDICTED: zinc transporter 8-like [Musa acuminata subsp. malaccensis]
Length=345

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 185/294 (63%), Positives = 229/294 (78%), Gaps = 11/294 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G  I +L PE   FF++KAFAAGVILATGFIH+LPDAFE LTS  L+  PW+DFPF
Sbjct  61    VPVLGMWIQSLRPEKDIFFVIKAFAAGVILATGFIHILPDAFETLTSSCLAASPWQDFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKV--TAGHEAGDAEVGpgvvpvhthathgha  744
              GF AMV AIGTLMVD+ AT YFS  +G+++  T+  EA + +V          ATHGH 
Sbjct  121   AGFCAMVGAIGTLMVDTLATGYFSRLNGDRLRSTSLSEATNGDV---------EATHGHT  171

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
             HG   +   DSS+QL+RHRV+SQVLELGI+VHSVIIGI+LGAS++P TI+PLV AL+FHQ
Sbjct  172   HGAAVMQPEDSSAQLIRHRVVSQVLELGIVVHSVIIGISLGASESPSTIRPLVVALSFHQ  231

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI QA+F  +++  M LFFSLTTP+GI IG GI++ Y+E+SP  LI++G+ 
Sbjct  232   FFEGMGLGGCIVQARFDFKAMVTMGLFFSLTTPVGIAIGTGISSVYNENSPTALIVQGLL  291

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +S +AGILIYMALVDLLAADFM PR+   PKLQF  N SLL G+GLM++LAKWA
Sbjct  292   DSVAAGILIYMALVDLLAADFMHPRVQSKPKLQFALNVSLLAGSGLMALLAKWA  345



>ref|XP_003546826.1| PREDICTED: zinc transporter 1-like [Glycine max]
Length=359

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 228/296 (77%), Gaps = 6/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ +RIP L+P+   FFMVKAFAAGVILATGF+H+LP+A+E+LTS  L ++PW  FPF
Sbjct  66    LPLLSKRIPTLNPKNDIFFMVKAFAAGVILATGFVHILPEAYESLTSPCLKENPWGKFPF  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR----SGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              GFVAM+++IGTLMVDSFAT ++  +    S +      E GD   G   V  H    H 
Sbjct  126   TGFVAMLSSIGTLMVDSFATGFYHRQHFNPSKQVPADDEEMGDEHAGHIHVHTHATHGHA  185

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H     S  +   +S ++R R+ISQVLE+GI++HSVIIGI+LG + +  TIKPL+ AL+F
Sbjct  186   HGSAVSS--EGSITSDVIRQRIISQVLEIGIVIHSVIIGISLGTAGSIDTIKPLLVALSF  243

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QAKF+S+S+AIMA FFSLTTP+GI IG+G+++ Y E+SP  L +EG
Sbjct  244   HQFFEGMGLGGCISQAKFESKSMAIMATFFSLTTPIGIAIGMGVSSVYKENSPTALTVEG  303

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFNSASAGILIYMALVDLLAADFMSPR+ KN KLQ GAN SLLLGAG MS+LAKWA
Sbjct  304   IFNSASAGILIYMALVDLLAADFMSPRLQKNLKLQLGANISLLLGAGCMSLLAKWA  359



>ref|XP_007049047.1| Zinc transporter 5 precursor [Theobroma cacao]
 gb|EOX93204.1| Zinc transporter 5 precursor [Theobroma cacao]
Length=352

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/276 (64%), Positives = 216/276 (78%), Gaps = 6/276 (2%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+ I AL PE + FF++KAFAAGVIL+TGFIHVLPDA E+LTS  L+++PW  FPF 
Sbjct  64    PLLGKTIKALRPENNLFFIIKAFAAGVILSTGFIHVLPDATESLTSPCLNENPWGKFPFA  123

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             G VAM +AI TLMVD+FATS+++ +S    T   +    + G     VH H    H H H
Sbjct  124   GLVAMASAIATLMVDAFATSHYT-KSHSNETQQIDGDKEKTGEHESHVHAHTHATHGHAH  182

Query  754   vSVT--DTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
              SV+  D   SS+LLRHRV+SQ   LGI+VHSVIIGI+LGAS++PKTIKPLVAALTFHQF
Sbjct  183   GSVSLVDRSGSSELLRHRVVSQ---LGIVVHSVIIGISLGASESPKTIKPLVAALTFHQF  239

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCI+QAKFKS++VA+MALFFSLTTP+GI IGIG++N Y E  P  LI+EGIFN
Sbjct  240   FEGMGLGGCISQAKFKSRAVAVMALFFSLTTPVGIAIGIGVSNMYHESRPTALIVEGIFN  299

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             +ASAGILIYMALVDLLAADFM+P++  N  LQ GA+
Sbjct  300   AASAGILIYMALVDLLAADFMNPKLQNNGMLQVGAS  335



>ref|XP_009794548.1| PREDICTED: zinc transporter 8-like [Nicotiana sylvestris]
Length=354

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 224/297 (75%), Gaps = 5/297 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+  PAL PE + FF VKAFAAGVILATGF+H+LPDAFE+L+S  LS+ PW DFPF
Sbjct  58    IPILGKIFPALHPENNIFFFVKAFAAGVILATGFVHILPDAFESLSSPCLSEKPWGDFPF  117

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AMVAAIGT+MVD  A SYF     +  + V +  E     +      VH H    H
Sbjct  118   AGFIAMVAAIGTMMVDLVAMSYFRRSHLKKQKPVNSDEEKEGGGIINQNNHVHVHTHSTH  177

Query  742   ahghvSVTDTDSSSQL--LRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALT  915
              H H SV   +  S+L   R RVISQVLELGI+VHSVIIGI+LGAS++PKTIKPLVAALT
Sbjct  178   GHAHGSVVPLEEGSELDLSRRRVISQVLELGILVHSVIIGISLGASESPKTIKPLVAALT  237

Query  916   FHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIE  1095
             FHQ FEGMGLGGCI++A+FK +  AIMA+FFSLTTP+GI IG GI+  Y E SP  L++E
Sbjct  238   FHQLFEGMGLGGCISEARFKVRKTAIMAIFFSLTTPMGIAIGFGISTVYSETSPTALMVE  297

Query  1096  GIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             GIFNS +AGIL+YMALVDLLAADFMS RM  +PKLQ GAN  LLLGAG MS+LAKWA
Sbjct  298   GIFNSIAAGILVYMALVDLLAADFMSNRMQDSPKLQIGANVFLLLGAGCMSLLAKWA  354



>gb|KHN48870.1| Zinc transporter 1 [Glycine soja]
Length=335

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 228/296 (77%), Gaps = 6/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ +RIP L+P+   FFMVKAFAAGVILATGF+H+LP+A+E+LTS  L ++PW  FPF
Sbjct  42    LPLLSKRIPTLNPKNDIFFMVKAFAAGVILATGFVHILPEAYESLTSPCLKENPWGKFPF  101

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR----SGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              GFVAM+++IGTLMVDSFAT ++  +    S +      E GD   G   V  H    H 
Sbjct  102   TGFVAMLSSIGTLMVDSFATGFYHRQHFNPSKQVPADDEEMGDEHSGHIHVHTHATHGHA  161

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H     S  +   +S ++R R+ISQVLE+GI++HSVIIGI+LG + +  TIKPL+ AL+F
Sbjct  162   HGSAVSS--EGSITSDVIRQRIISQVLEIGIVIHSVIIGISLGTAGSIDTIKPLLVALSF  219

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QAKF+S+S+AIMA FFSLTTP+GI IG+G+++ Y E+SP  L +EG
Sbjct  220   HQFFEGMGLGGCISQAKFESKSMAIMATFFSLTTPIGIAIGMGVSSVYKENSPTALTVEG  279

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFNSASAGILIYMALVDLLAADFMSPR+ KN KLQ GAN SLLLGAG MS+LAKWA
Sbjct  280   IFNSASAGILIYMALVDLLAADFMSPRLQKNLKLQLGANISLLLGAGCMSLLAKWA  335



>ref|XP_006858211.1| hypothetical protein AMTR_s00062p00183460 [Amborella trichopoda]
 gb|ERN19678.1| hypothetical protein AMTR_s00062p00183460 [Amborella trichopoda]
Length=352

 Score =   332 bits (851),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 182/292 (62%), Positives = 219/292 (75%), Gaps = 1/292 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+VGR IPAL PE + FF++KAFAAGVILATG IHVLPDAF+ L +  L++ PW  FPF
Sbjct  62    LPIVGRSIPALQPERNAFFVIKAFAAGVILATGMIHVLPDAFDKLGNACLNEDPWGKFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AIGTL+VDS AT Y+     +K        DAE            THG    
Sbjct  122   AGFVAMLSAIGTLVVDSLATGYYQRIHFKKPPVASNGEDAERNEAHDGHVHVHTHGTHGH  181

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                  +  + ++ LRHRVISQVLELGIIVHSVIIGI+LGAS++P TI+PLVAAL+FHQFF
Sbjct  182   THGAVEL-AGAETLRHRVISQVLELGIIVHSVIIGISLGASESPSTIRPLVAALSFHQFF  240

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QAKFKS++ A MALFF++TTP GI +GIGI + Y+E+SP  LI+EG  N+
Sbjct  241   EGMGLGGCIVQAKFKSRATACMALFFAITTPAGIAVGIGIASVYNENSPTALIVEGCLNA  300

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYM+LVDLLAADFM+P+M  N KLQ  AN SLL GAG MS++AKWA
Sbjct  301   ASAGILIYMSLVDLLAADFMNPKMQSNGKLQIWANVSLLFGAGAMSLMAKWA  352



>gb|KCW88546.1| hypothetical protein EUGRSUZ_A00918 [Eucalyptus grandis]
Length=356

 Score =   332 bits (850),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 222/301 (74%), Gaps = 9/301 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ +PAL PE   FF+VKAFAAGVILATG IHVLPDAF++LTS  L ++PW  FPF
Sbjct  56    IPLLGKVVPALRPEKDVFFLVKAFAAGVILATGLIHVLPDAFDSLTSPCLDENPWGKFPF  115

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAMVAA+GTLMVD++ATSY++     K       GD E          HA H H H 
Sbjct  116   AGFVAMVAAVGTLMVDTYATSYYTRSHFSKARPAESEGDEESDAAATAGDDHAGHLHVHT  175

Query  751   hvSVTDTDSS---------SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLV  903
             H +      S         S+LLRHRV+SQVLELGI+VHSVIIGI+LG S + KT+KPL+
Sbjct  176   HATHGHAHGSAYQGHEPGTSELLRHRVVSQVLELGIVVHSVIIGISLGTSGSAKTVKPLM  235

Query  904   AALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKV  1083
             AALTFHQFFEGMGLGGCI QAKFK+++  IMALFFSLTTP GI IGIGI++ YDE S + 
Sbjct  236   AALTFHQFFEGMGLGGCITQAKFKARTTIIMALFFSLTTPAGIAIGIGISDTYDESSQRA  295

Query  1084  LIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             LIIEG+FN+ASAGIL+YMALVDLLAADFMS ++  N +LQ   N  LL GAG M+ LAKW
Sbjct  296   LIIEGVFNAASAGILVYMALVDLLAADFMSAKVQGNGRLQLLCNCFLLFGAGCMAFLAKW  355

Query  1264  A  1266
             A
Sbjct  356   A  356



>ref|XP_004502089.1| PREDICTED: zinc transporter 5-like [Cicer arietinum]
Length=353

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 193/292 (66%), Positives = 228/292 (78%), Gaps = 2/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPALSPE   FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L +HPW DFPF
Sbjct  64    IPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLKEHPWGDFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM  A+GTLMVD++AT+YF     +K        D E  P V       TH     
Sbjct  124   TGFVAMCTAMGTLMVDTYATAYFQKHHSKKTPTTQV--DCETNPEVDGHIDLHTHVSHGH  181

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                    D+SS+LLRHRVISQVLELGIIVHS+IIGI+LGAS++PKTI+PLVAALTFHQFF
Sbjct  182   AHGHVPFDNSSELLRHRVISQVLELGIIVHSIIIGISLGASESPKTIRPLVAALTFHQFF  241

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLG CI QA FKS S+ IM LFF+LTTP+GI IG+GI++ YDE+SP  LI+EGIFN+
Sbjct  242   EGMGLGSCITQANFKSVSITIMGLFFALTTPVGIGIGLGISSVYDENSPTALIVEGIFNA  301

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             AS+GILIYMALVDLLAADFM+PRM K+ +L  G N SLLLGAG MS++AKWA
Sbjct  302   ASSGILIYMALVDLLAADFMNPRMQKSGRLTLGCNVSLLLGAGCMSLIAKWA  353



>ref|XP_010044870.1| PREDICTED: zinc transporter 1-like [Eucalyptus grandis]
Length=366

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 222/301 (74%), Gaps = 9/301 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ +PAL PE   FF+VKAFAAGVILATG IHVLPDAF++LTS  L ++PW  FPF
Sbjct  66    IPLLGKVVPALRPEKDVFFLVKAFAAGVILATGLIHVLPDAFDSLTSPCLDENPWGKFPF  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAMVAA+GTLMVD++ATSY++     K       GD E          HA H H H 
Sbjct  126   AGFVAMVAAVGTLMVDTYATSYYTRSHFSKARPAESEGDEESDAAATAGDDHAGHLHVHT  185

Query  751   hvSVTDTDSS---------SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLV  903
             H +      S         S+LLRHRV+SQVLELGI+VHSVIIGI+LG S + KT+KPL+
Sbjct  186   HATHGHAHGSAYQGHEPGTSELLRHRVVSQVLELGIVVHSVIIGISLGTSGSAKTVKPLM  245

Query  904   AALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKV  1083
             AALTFHQFFEGMGLGGCI QAKFK+++  IMALFFSLTTP GI IGIGI++ YDE S + 
Sbjct  246   AALTFHQFFEGMGLGGCITQAKFKARTTIIMALFFSLTTPAGIAIGIGISDTYDESSQRA  305

Query  1084  LIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             LIIEG+FN+ASAGIL+YMALVDLLAADFMS ++  N +LQ   N  LL GAG M+ LAKW
Sbjct  306   LIIEGVFNAASAGILVYMALVDLLAADFMSAKVQGNGRLQLLCNCFLLFGAGCMAFLAKW  365

Query  1264  A  1266
             A
Sbjct  366   A  366



>ref|XP_006658416.1| PREDICTED: zinc transporter 8-like [Oryza brachyantha]
Length=307

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 213/295 (72%), Gaps = 8/295 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+GRR+PAL P+G  FF+VKAFAAGVILATGF+H+LPDAFE+L+SD L+  PW+ FPF
Sbjct  18    VPVLGRRVPALRPDGDVFFLVKAFAAGVILATGFVHILPDAFESLSSDCLAGGPWKRFPF  77

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GF AMV AIGTL+VD+ AT YF+    + G    A HE              TH     
Sbjct  78    AGFGAMVGAIGTLVVDTLATGYFTRAHFKKGTAAAAAHEGHVHVH-----THSTHGHAHG  132

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
             +   V+    D   Q LRHRVISQVLELGI+VHSVIIGI+LGAS +P TIKPLV AL+FH
Sbjct  133   SSALVAAVGEDDKEQTLRHRVISQVLELGIVVHSVIIGISLGASQSPDTIKPLVVALSFH  192

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             Q FEGMGLGGCI QAKFK++SV  M LFF LTTP GI +G GI++ YDE SP  L++EG+
Sbjct  193   QMFEGMGLGGCIVQAKFKARSVVTMVLFFCLTTPAGIAVGAGISSAYDESSPAALVVEGL  252

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              NS +AGIL+YMALVDLLA DF  PR+   P++Q   N ++L+GA LMSMLA WA
Sbjct  253   LNSVAAGILLYMALVDLLAEDFTDPRVQGRPRMQLAVNVAMLVGAALMSMLAGWA  307



>gb|AAX28837.1| zinc transporter protein ZIP1 [Fragaria x ananassa]
Length=353

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 227/291 (78%), Gaps = 0/291 (0%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+ IP+L PE   F ++KAFAAGVILATGFIHVLPDAFE LTS  L ++PW  FPF 
Sbjct  63    PILGKTIPSLQPEKPIFLIIKAFAAGVILATGFIHVLPDAFERLTSPCLEENPWGKFPFT  122

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             GFVAM+AAIGTLMVDS ATSYF+    +K        + +VG     VH H    H H H
Sbjct  123   GFVAMMAAIGTLMVDSIATSYFNWSHLKKAQNQVNGDEEKVGEHEGHVHVHTHGTHGHAH  182

Query  754   vSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFE  933
              S+    + SQLLRHRVIS+VLELGI+VHSVIIGI+LGAS++  T++PLVAALTFHQFFE
Sbjct  183   GSLDTNSAESQLLRHRVISKVLELGIVVHSVIIGISLGASESAATVRPLVAALTFHQFFE  242

Query  934   GMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSA  1113
             GMGLGGCIAQA+    +  IM LFFSLTTP+GI IGIGI++RY+E+S   LI+EG+F++A
Sbjct  243   GMGLGGCIAQARESRLTTIIMVLFFSLTTPVGIGIGIGISSRYEENSSTALILEGLFDAA  302

Query  1114  SAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             SAGILIYMALVDLLAADFM+P+M KN KLQ GAN SLL GAG MS++AKWA
Sbjct  303   SAGILIYMALVDLLAADFMNPKMQKNVKLQVGANASLLFGAGCMSLIAKWA  353



>ref|XP_002265102.1| PREDICTED: zinc transporter 8 [Vitis vinifera]
Length=345

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 192/292 (66%), Positives = 231/292 (79%), Gaps = 5/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G++IPAL PE + FF++KAFAAGVILATGFIHVLPDAFE+LTS  LS++PW +FPF
Sbjct  59    IPIIGKKIPALQPEKNVFFVIKAFAAGVILATGFIHVLPDAFESLTSPCLSENPWANFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AIGTLMVDS +TSY++ RS  K +      + +VG     V+ H    H   
Sbjct  119   TGFVAMLSAIGTLMVDSLSTSYYT-RSHLKNSLPVLGDEEKVGEHEGQVYVHTHATHG--  175

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                 +  +  S L+RHRVISQVLELGI+ HSVIIGI+LGAS++P+TIKPLVAALTFHQFF
Sbjct  176   --HTSADEVGSDLIRHRVISQVLELGIVAHSVIIGISLGASESPQTIKPLVAALTFHQFF  233

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLG CI QAKFKS++  IM LFFSLTTP+GI IGIGI+  YDE+S   LIIEGIFN+
Sbjct  234   EGMGLGSCIVQAKFKSRAATIMGLFFSLTTPVGIGIGIGISQVYDENSSTALIIEGIFNA  293

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLLAADFMSP+M  N  L+  AN SLLLGAG MS++AKWA
Sbjct  294   ASAGILIYMALVDLLAADFMSPKMQTNEMLKVMANISLLLGAGCMSLIAKWA  345



>gb|KHN21378.1| Zinc transporter 1 [Glycine soja]
Length=335

 Score =   329 bits (843),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 181/296 (61%), Positives = 226/296 (76%), Gaps = 6/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ +RIP L+P+   FFMVKAFAAGVILATGF+H+LP+A+E+LTS  L ++PW  FPF
Sbjct  42    LPLLSKRIPTLNPKNDIFFMVKAFAAGVILATGFVHILPEAYESLTSPCLKENPWGKFPF  101

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR----SGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              GFVAM+++IGTLMVDSFAT ++  +    S +      E GD   G   V  H    H 
Sbjct  102   TGFVAMLSSIGTLMVDSFATGFYHRQHFNPSKQVPADDEEMGDEHAGHMHVHTHATHGHA  161

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H        +   +S+++R R+ISQVLE+GI+VHSVIIGI+LG + +  TIKPL+ AL+F
Sbjct  162   HGSAVSP--EGSITSEVIRQRIISQVLEIGIVVHSVIIGISLGTAGSIDTIKPLLVALSF  219

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QAKF+S+S  IMA FFSLTTP+GI IG+G+++ Y E+SP  L +EG
Sbjct  220   HQFFEGMGLGGCISQAKFESKSTVIMATFFSLTTPIGIAIGMGVSSVYKENSPTALTVEG  279

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFNSASAGILIYMALVDLLAADFMSP++ KN KLQ GAN SLLLGAG MS+LAKWA
Sbjct  280   IFNSASAGILIYMALVDLLAADFMSPKLQKNLKLQLGANISLLLGAGCMSLLAKWA  335



>gb|AFN88220.1| zinc transporter protein [Phaseolus vulgaris]
Length=354

 Score =   329 bits (844),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 181/300 (60%), Positives = 214/300 (71%), Gaps = 28/300 (9%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ +  PAL PE  FFFMVKAFAAGVIL+TGFIHVLPDAFE LT   L  HPW DF F
Sbjct  75    LPLLSKIFPALHPEKDFFFMVKAFAAGVILSTGFIHVLPDAFEKLTPPSLCDHPWDDFSF  134

Query  571   CGFVAMVAAIGTLMVDSFATSYFS--------GRSGEKVTAGHEAGDAEVGpgvvpvhth  726
              GFVAM+AAIGTLMVDS AT+YF         G   E+    H A  +            
Sbjct  135   AGFVAMLAAIGTLMVDSLATAYFKKSTIRDMDGVVDEEDLHNHHATHSHA----------  184

Query  727   athghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVA  906
                         +    S+ LLRHRV+SQVLELGI+VHSVIIGI+LGAS+ PKTI+PL+A
Sbjct  185   ----------PASMASPSTDLLRHRVVSQVLELGIVVHSVIIGISLGASENPKTIRPLIA  234

Query  907   ALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVL  1086
             ALTFHQFFEGMGLGGCI+QA+ K ++V IMALFFSLTTP+GI IG+ I+  Y+EDSP+ L
Sbjct  235   ALTFHQFFEGMGLGGCISQARLKRRAVIIMALFFSLTTPVGIAIGMIISGGYEEDSPRAL  294

Query  1087  IIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             I+EGI N+ASAGILIYM+LVDLLA D M P++  +  LQ G N SLL+GA  MS+LAKWA
Sbjct  295   IVEGILNAASAGILIYMSLVDLLAPDLMHPKIQASTTLQIGVNASLLIGAAFMSLLAKWA  354



>emb|CAN67594.1| hypothetical protein VITISV_000700 [Vitis vinifera]
Length=345

 Score =   329 bits (843),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 231/292 (79%), Gaps = 5/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G++IPAL PE + FF++KAFAAGVILATGFIHVLPDAFE+LTS  LS++PW +FPF
Sbjct  59    IPIIGKKIPALQPEKNVFFVIKAFAAGVILATGFIHVLPDAFESLTSPCLSENPWANFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AIGTLMVDS +TSY++ RS  K +      + +VG     V+ H    H   
Sbjct  119   TGFVAMLSAIGTLMVDSLSTSYYT-RSHLKNSLPVLGDEEKVGEHEGQVYVHTHATHG--  175

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                 +  +  S L+RHRVISQVLELGI+ HSVIIGI+LGAS++P+TI+PLVAALTFHQFF
Sbjct  176   --HTSADEVGSDLIRHRVISQVLELGIVAHSVIIGISLGASESPQTIRPLVAALTFHQFF  233

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLG CI QAKFKS++  IM LFFSLTTP+GI IGIGI+  YDE+S   LIIEGIFN+
Sbjct  234   EGMGLGSCIVQAKFKSRAATIMGLFFSLTTPVGIGIGIGISQVYDENSSTALIIEGIFNA  293

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLLAADFMSP+M  N  L+  AN SLLLGAG MS++AKWA
Sbjct  294   ASAGILIYMALVDLLAADFMSPKMQTNEMLKVMANISLLLGAGCMSLIAKWA  345



>ref|XP_008447078.1| PREDICTED: zinc transporter 1 [Cucumis melo]
Length=354

 Score =   329 bits (843),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 222/295 (75%), Gaps = 4/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+VG++I  L PE   FFM+KAFAAGVIL+TGFIH+LPDAF++LTS  L ++PW DFPF
Sbjct  61    LPLVGKKIRCLRPENDIFFMIKAFAAGVILSTGFIHILPDAFQDLTSPCLGQNPWGDFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR---SGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AM A+I TLMVD+FATS++  R     ++V A  E G+   G   V  H    H H
Sbjct  121   AGFIAMAASIATLMVDTFATSFYQRRHFSKTKQVIADQETGNDHAGHVHVHTHATHGHAH  180

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  + T   S + L+R+R+ISQVLELGI+VHSVIIGI+LGAS +P TIKPL+ AL+FH
Sbjct  181   GSAP-TPTGELSLADLIRYRIISQVLELGIVVHSVIIGISLGASLSPATIKPLLVALSFH  239

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QA+F+ QS A MA FFSLT P+GI +GIGI+  Y ++S   LI+EG 
Sbjct  240   QFFEGMGLGGCISQAQFRWQSAAAMATFFSLTAPVGIAVGIGISGVYRDNSRTALIVEGS  299

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              NSASAGILIYMALVDLLAADFM+PRM  N  LQ GAN SLLLGA  MS+LAKWA
Sbjct  300   MNSASAGILIYMALVDLLAADFMNPRMQNNLGLQLGANISLLLGAACMSVLAKWA  354



>ref|XP_003531480.1| PREDICTED: zinc transporter 1-like [Glycine max]
Length=361

 Score =   329 bits (843),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 181/296 (61%), Positives = 226/296 (76%), Gaps = 6/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ +RIP L+P+   FFMVKAFAAGVILATGF+H+LP+A+E+LTS  L ++PW  FPF
Sbjct  68    LPLLSKRIPTLNPKNDIFFMVKAFAAGVILATGFVHILPEAYESLTSPCLKENPWGKFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR----SGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              GFVAM+++IGTLMVDSFAT ++  +    S +      E GD   G   V  H    H 
Sbjct  128   TGFVAMLSSIGTLMVDSFATGFYHRQHFNPSKQVPADDEEMGDEHAGHMHVHTHATHGHA  187

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H        +   +S+++R R+ISQVLE+GI+VHSVIIGI+LG + +  TIKPL+ AL+F
Sbjct  188   HGSAVSP--EGSITSEVIRQRIISQVLEIGIVVHSVIIGISLGTAGSIDTIKPLLVALSF  245

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QAKF+S+S  IMA FFSLTTP+GI IG+G+++ Y E+SP  L +EG
Sbjct  246   HQFFEGMGLGGCISQAKFESKSTVIMATFFSLTTPIGIAIGMGVSSVYKENSPTALTVEG  305

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFNSASAGILIYMALVDLLAADFMSP++ KN KLQ GAN SLLLGAG MS+LAKWA
Sbjct  306   IFNSASAGILIYMALVDLLAADFMSPKLQKNLKLQLGANISLLLGAGCMSLLAKWA  361



>ref|NP_001059239.1| Os07g0232800 [Oryza sativa Japonica Group]
 dbj|BAC21508.1| putative zinc transporter protein ZIP1 [Oryza sativa Japonica 
Group]
 dbj|BAD31696.1| putative zinc transporter protein ZIP1 [Oryza sativa Japonica 
Group]
 dbj|BAF21153.1| Os07g0232800 [Oryza sativa Japonica Group]
Length=357

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/293 (62%), Positives = 217/293 (74%), Gaps = 3/293 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL-SKHPWRDFP  567
             LP +GR +PAL P+G  FF+VKAFAAGVILATGFIH+LPDAF+NLT D L +  PW++FP
Sbjct  67    LPSLGRHVPALRPDGDVFFLVKAFAAGVILATGFIHILPDAFDNLTDDCLPAGGPWKEFP  126

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             F GF AMV AIGTL+VD+ AT YF+    +K  A   A + +V   V    TH     + 
Sbjct  127   FAGFGAMVGAIGTLVVDTLATGYFTRALSKKDAATAAAHEGQV--HVHTHATHGHAHGSS  184

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
               V+    D     LRHRVISQVLELGI+VHSVIIGI+LGAS  P+TIKPLV AL+FHQ 
Sbjct  185   ALVAAVGEDDKETTLRHRVISQVLELGIVVHSVIIGISLGASQNPETIKPLVVALSFHQM  244

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCI QAKFK +S+  M LFF LTTP+GI +G+GI++ Y+E SP  L++EGI N
Sbjct  245   FEGMGLGGCIVQAKFKVRSIVTMVLFFCLTTPVGIAVGVGISSVYNESSPTALVVEGILN  304

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             S +AGILIYMALVDLLA DFM+PR+    KLQ G N ++L GAGLMSMLAKWA
Sbjct  305   SVAAGILIYMALVDLLAEDFMNPRVQSKGKLQLGINLAMLAGAGLMSMLAKWA  357



>ref|XP_009379338.1| PREDICTED: zinc transporter 8-like [Pyrus x bretschneideri]
 ref|XP_009379339.1| PREDICTED: zinc transporter 8-like [Pyrus x bretschneideri]
Length=350

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 196/292 (67%), Positives = 232/292 (79%), Gaps = 5/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IP L P+ + FF++KAFAAGVILATGFIHVLPDAFE+LT   L ++PW  FPF
Sbjct  64    IPILGKTIPDLHPDRNIFFIIKAFAAGVILATGFIHVLPDAFESLTDPALKENPWGKFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+AAIGTLMVDS ATSY+S RS  K    +  GD E          H    H H 
Sbjct  124   TGFVAMMAAIGTLMVDSCATSYYS-RSHLK---NNIDGDEERAQEHEGHDVHTHTTHGHA  179

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
             H ++ DT  S++LLRHRVISQVLELGI+VHSVIIGI+LGAS++PKTIKPL+ AL+FHQFF
Sbjct  180   HGAI-DTSPSTELLRHRVISQVLELGIVVHSVIIGISLGASESPKTIKPLLVALSFHQFF  238

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QAKFK+++V IM+LFFSLTTP+GI IGIGI+  YD  S  VLI+EG+FN+
Sbjct  239   EGMGLGGCITQAKFKNRAVVIMSLFFSLTTPVGIGIGIGISKFYDGSSQTVLIMEGVFNA  298

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYM+LVDLLAADFM P+M  N KLQ GAN SLLLGAG MS+LAKWA
Sbjct  299   ASAGILIYMSLVDLLAADFMKPKMQSNGKLQAGANISLLLGAGCMSLLAKWA  350



>ref|XP_004139841.1| PREDICTED: zinc transporter 1-like [Cucumis sativus]
 gb|KGN44299.1| hypothetical protein Csa_7G239610 [Cucumis sativus]
Length=354

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 222/295 (75%), Gaps = 4/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+VG++I  L PE   FFM+KAFAAGVIL+TGFIH+LPDAF++LTS  L ++PW DFPF
Sbjct  61    LPLVGKKIRCLRPENDIFFMIKAFAAGVILSTGFIHILPDAFQDLTSPCLGQNPWGDFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR---SGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AM A+I TLMVD+FATS++  R     ++V A  E G+   G   V  H    H H
Sbjct  121   AGFIAMAASIATLMVDTFATSFYQRRHFSKTKQVIADQETGNDHAGHVHVHTHATHGHAH  180

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  + T   S + L+R+R+ISQVLELGI+VHSVIIGI+LGAS +P TIKPL+ AL+FH
Sbjct  181   GSAP-TPTGELSLADLIRYRIISQVLELGIVVHSVIIGISLGASVSPATIKPLLVALSFH  239

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QA+F+ +S A MA FFSLT P+GI +GIGI+  Y ++S   LI+EG 
Sbjct  240   QFFEGMGLGGCISQAQFRWRSAAAMATFFSLTAPVGIAVGIGISGAYRDNSRTALIVEGS  299

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              NSASAGILIYMALVDLLAADFM+PRM  N  LQ GAN SLLLGA  MS+LAKWA
Sbjct  300   MNSASAGILIYMALVDLLAADFMNPRMQNNLGLQLGANISLLLGAACMSVLAKWA  354



>ref|XP_004231600.1| PREDICTED: zinc transporter 8-like [Solanum lycopersicum]
Length=347

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 222/292 (76%), Gaps = 3/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPA  PE + FF++KAFAAGVIL TGF+H+LPDAFE+L+S  L + PW DFPF
Sbjct  59    IPILGKVIPAFRPENNVFFLIKAFAAGVILGTGFVHILPDAFESLSSPCLPEKPWGDFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AM+++IGT+MVD  ATS++   +  K    +   + EV    V  H+   H H   
Sbjct  119   AGFIAMISSIGTMMVDLLATSFYKNSNLTKQKPVNSDEEKEV---HVHTHSTHGHAHGSV  175

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
              ++ ++ +    L R RVISQVLELGI+VHSVIIG++LGAS++PKTIKPLVAALTFHQ F
Sbjct  176   MLTSSEGNDELDLSRRRVISQVLELGILVHSVIIGVSLGASESPKTIKPLVAALTFHQLF  235

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCIA+AKFK +  A+MA+FFSLTTP+GI IG GI+  Y E SP  L++EGIFNS
Sbjct  236   EGMGLGGCIAEAKFKIKKAALMAIFFSLTTPIGIAIGFGISTVYSETSPTALMVEGIFNS  295

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             A+AGILIYMALVDLLAADFMS RM  +PKL  GAN  LL GAG MS+LAKWA
Sbjct  296   AAAGILIYMALVDLLAADFMSSRMQDSPKLLMGANIFLLFGAGCMSLLAKWA  347



>ref|XP_008792254.1| PREDICTED: zinc transporter 8-like [Phoenix dactylifera]
Length=349

 Score =   327 bits (839),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 218/294 (74%), Gaps = 5/294 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  + IP+L PE   FF++KAFAAGVILATGFIH+LPDAF NLTS  L ++PW +FPF
Sbjct  59    LPIFSKSIPSLRPENDIFFVIKAFAAGVILATGFIHILPDAFANLTSPCLDENPWGNFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHE-AGDAEVGpgvvpvhthathghah  747
              GFVAM+ A+GTLMVD+ A  Y    + E+   G E  GD E+                 
Sbjct  119   AGFVAMLGALGTLMVDTLAMGYLKRSAREE---GDELKGDVEMSGPAGDHLHVHATHARA  175

Query  748   ghvSVTDTDSSSQ-LLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                +  + D  SQ L+RHRVISQVLELGI+VHS+IIGI+LGAS++P  IK L+ AL+FHQ
Sbjct  176   RGHAALEVDDGSQKLVRHRVISQVLELGIVVHSIIIGISLGASESPSIIKSLIVALSFHQ  235

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI QAKFK +S A M LFFSLTTP+GIVIG GI++ Y+E+SP  LI+EGI 
Sbjct  236   FFEGMGLGGCIVQAKFKVKSRATMILFFSLTTPVGIVIGFGISSVYNENSPTALIVEGIL  295

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             NSA+AGILIYM+LVDLLA DFM+PR+    KLQFG N SLL+GAGLMS+LAKWA
Sbjct  296   NSAAAGILIYMSLVDLLAEDFMNPRVQSKGKLQFGINVSLLIGAGLMSLLAKWA  349



>emb|CAN83128.1| hypothetical protein VITISV_029536 [Vitis vinifera]
 gb|AFG19376.1| zinc transporter protein [Vitis vinifera]
Length=348

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 219/294 (74%), Gaps = 16/294 (5%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ + +P+L PE + +F++KAFAAGVILATGF+H+LPDA+++L S  LS++PW  FPF
Sbjct  65    LPLLLKNVPSLRPEKAIYFLIKAFAAGVILATGFLHILPDAYDSLKSPCLSENPWGGFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AM+AAI TLM+++FAT Y      R  + V    E+     G              
Sbjct  125   TGFIAMMAAILTLMMEAFATGYHRRSELRKAQPVNGDEESDGDHAGHVHGSAF-------  177

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                   V +  +SS L+RHRV+SQVLELGI+VHSVIIGI+LGAS++PKTIKPLVAAL+FH
Sbjct  178   ------VLERSNSSDLIRHRVVSQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFH  231

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QAK+K ++  IM LFFSLTTP GI +G+GI+  YDE+SP  LI++G+
Sbjct  232   QFFEGMGLGGCISQAKYKIKATIIMVLFFSLTTPTGIAVGLGISKIYDENSPTALIVQGV  291

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
              NSASAGILIYMALVDLLA DFM+P+M  N +LQ GA  +LLLGA  MS+LAKW
Sbjct  292   LNSASAGILIYMALVDLLATDFMNPKMQSNVRLQLGAYATLLLGAASMSVLAKW  345



>gb|AAP92123.1| iron transporter Fe2 [Oryza sativa]
Length=357

 Score =   327 bits (838),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 180/293 (61%), Positives = 217/293 (74%), Gaps = 3/293 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL-SKHPWRDFP  567
             LP +GR +PAL P+G  FF+VKAFAAGVILATGFIH+LPDAF+NLT D L +  PW++FP
Sbjct  67    LPSLGRHVPALRPDGDVFFLVKAFAAGVILATGFIHILPDAFDNLTDDCLPAGGPWKEFP  126

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             F GF AMV AIGTL+VD+ AT YF+    +K  A   A + +V   V    TH     + 
Sbjct  127   FAGFGAMVGAIGTLVVDTLATGYFTRALSKKDAATAAAHEGQV--HVHTHATHGHAHGSS  184

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
               V+    D     LRHRVISQVLELGI+VHSVIIGI+LGAS  P+TIKPLV AL+FHQ 
Sbjct  185   ALVAAVGEDDKETTLRHRVISQVLELGIVVHSVIIGISLGASQNPETIKPLVVALSFHQM  244

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCI QAKFK +S+  M LFF LTTP+GI +G+GI++ Y+E SP  L++EGI N
Sbjct  245   FEGMGLGGCIVQAKFKVRSIVTMVLFFCLTTPVGIAVGVGISSVYNESSPTALVVEGILN  304

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             S +AGILIYMALVDLLA DFM+PR+    KLQ G N ++L GAGLMSMLA+WA
Sbjct  305   SVAAGILIYMALVDLLAEDFMNPRVQSKGKLQLGINLAMLAGAGLMSMLAQWA  357



>ref|XP_004306552.1| PREDICTED: zinc transporter 1-like [Fragaria vesca subsp. vesca]
Length=361

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 216/296 (73%), Gaps = 4/296 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IPAL PE + FF+VKAFAAGVILAT FIH+LPDAFE LTS  L ++PW  FPF
Sbjct  66    LPLLGKKIPALRPENNIFFIVKAFAAGVILATAFIHILPDAFETLTSPCLKENPWGKFPF  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFV M++AIGTLMVD+ AT Y+   S ++     +  ++ VG           H H   
Sbjct  126   TGFVCMMSAIGTLMVDAMATGYYKSSSLKRTQVTDDDEESRVGHDHGHAGHAHGHTHGAT  185

Query  751   hvSV----TDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
               +     ++   SS+L+RHRVISQVLELGI+VHSVIIGI LG S  P TIKPL+ AL+F
Sbjct  186   QQASNAHGSEELKSSELIRHRVISQVLELGILVHSVIIGITLGVSQNPDTIKPLLVALSF  245

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEG+GLGGCI+QA+FKS+S AIMA FFSLTTP+GI +G  I+  Y E SP  LI++G
Sbjct  246   HQFFEGIGLGGCISQAQFKSRSAAIMAAFFSLTTPIGIAVGTAISRVYSETSPTALIVQG  305

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
                SA+AGILIYMALVDLLAADFMSPRM  N ++Q G+  SLLLG G MS LAKWA
Sbjct  306   TLESAAAGILIYMALVDLLAADFMSPRMQGNRRIQLGSYISLLLGTGCMSFLAKWA  361



>gb|ACU24645.1| unknown [Glycine max]
Length=359

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 224/296 (76%), Gaps = 6/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ +RIP L+P+   FFMVKAFAAGVILATGF+H+LP+A+E+LTS  L ++PW  FPF
Sbjct  66    LPLLSKRIPTLNPKNDIFFMVKAFAAGVILATGFVHILPEAYESLTSPCLKENPWGKFPF  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR----SGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              GFVAM+++IGTLMVDSFAT ++  +    S +      E GD   G   V  H    H 
Sbjct  126   TGFVAMLSSIGTLMVDSFATGFYHRQHFNPSKQVPADDEEMGDEHAGHIHVHTHATHGHA  185

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H     S  +   +S ++R R+ISQVLE+GI++HSVIIGI+LG + +  TIKPL+ AL+F
Sbjct  186   HGSAVSS--EGSITSDVIRQRIISQVLEIGIVIHSVIIGISLGTAGSIDTIKPLLVALSF  243

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI QAKF+S+ +AIMA FFSLTTP+GI IG+G+++ Y E+SP  L +EG
Sbjct  244   HQFFEGMGLGGCIFQAKFESKFMAIMATFFSLTTPIGIAIGMGVSSVYKENSPTALTVEG  303

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFNSA AGILIYMALVDLLAADFMSPR+ KN KLQ GAN SL LGAG MS+LAKWA
Sbjct  304   IFNSAFAGILIYMALVDLLAADFMSPRLQKNLKLQLGANISLFLGAGCMSLLAKWA  359



>ref|XP_006363493.1| PREDICTED: zinc transporter 8-like [Solanum tuberosum]
Length=348

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 216/292 (74%), Gaps = 3/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPA  PE + F ++KAFAAGVILATGF+H+LPDAFE+L+S  L + PW DFPF
Sbjct  60    IPILGKIIPAFRPENNVFVLIKAFAAGVILATGFVHILPDAFESLSSPCLPEKPWGDFPF  119

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              G +AM++AIGT+MVD  ATS++   +  K    +   + EV       H HA       
Sbjct  120   AGLIAMISAIGTMMVDLLATSFYKKSNLTKQKPVNSDEEKEVHVHTHSTHGHAHGSVMLS  179

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                 TD      L R RVISQVLELGI+VHSVIIG++LGAS++PKTIKPLVAALTFHQ F
Sbjct  180   SSEGTD---ELDLSRRRVISQVLELGILVHSVIIGVSLGASESPKTIKPLVAALTFHQLF  236

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCIA+AKFK +  A+M++FFSLTTP+GI IG GI+  Y E SP  L++EGIFNS
Sbjct  237   EGMGLGGCIAEAKFKIKKAALMSIFFSLTTPIGIAIGFGISTVYSETSPTALMVEGIFNS  296

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             A+AGILIYMALVDLLAADFMS RM  +PKL  GAN  LL GAG MS+LAKWA
Sbjct  297   AAAGILIYMALVDLLAADFMSTRMQDSPKLLMGANIFLLFGAGCMSLLAKWA  348



>ref|XP_010931295.1| PREDICTED: zinc transporter 8-like [Elaeis guineensis]
Length=350

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 218/294 (74%), Gaps = 4/294 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+ G+ I +L PE   FF++KAFAAGVILATGFIH+LPDAFENLTS  L ++PW +FPF
Sbjct  59    LPIFGKSIQSLRPENDIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLDENPWGNFPF  118

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEV-Gpgvvpvhthathghah  747
              GF AM+ A+GTLMVD+ AT YF  +   +       GD E+ GPG              
Sbjct  119   AGFGAMLGALGTLMVDTLATGYF--KRAARAVGDELKGDVEMSGPGGDRGVHVHATHGHA  176

Query  748   ghvSVTDTDSSSQ-LLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                +  + D   Q L+RHRVISQVLELGI+VHSVIIGI+LGAS+TP TI+PL+ AL+FHQ
Sbjct  177   HGPAALEADEGPQKLVRHRVISQVLELGIVVHSVIIGISLGASETPATIRPLIVALSFHQ  236

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEG+GLGGCIAQAKFK + +A M LFFSLTTP+GI IG GI++ Y+EDSP  LI+EGI 
Sbjct  237   FFEGVGLGGCIAQAKFKVRPMATMILFFSLTTPVGIAIGFGISSVYNEDSPTALIVEGIL  296

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             NS +AGILIYM+LVDLLA DFM+PR+  N  LQF  N SLL+G GLMS+LAKWA
Sbjct  297   NSVAAGILIYMSLVDLLAEDFMNPRVQSNGTLQFEINVSLLIGVGLMSLLAKWA  350



>ref|XP_010275878.1| PREDICTED: zinc transporter 5-like [Nelumbo nucifera]
Length=357

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 219/295 (74%), Gaps = 10/295 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+  P L P+   FFM+KAFAAGVILATGFIH+LPDAFE LTS  L    W +FPF
Sbjct  70    IPVLGKSFPPLRPDNDIFFMIKAFAAGVILATGFIHILPDAFEKLTSPCLKGKVWENFPF  129

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAM++ I TLMVD+ ATSYF        + ++   E G    G   V  H    H  
Sbjct  130   TGFVAMMSGIITLMVDTIATSYFQRLHFNKSQPLSVDQETGGEHAGHLHVHTHATHGH--  187

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  S     SSS+LLRHR+ISQVLELGI+VHSVIIGI+LGAS++P TI+PLVAALTFH
Sbjct  188   -----SHGSDSSSSELLRHRIISQVLELGIVVHSVIIGISLGASESPSTIRPLVAALTFH  242

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI QA+FK ++V +M LFFSLTTP+GI +G+GITN YDE++   L +EG+
Sbjct  243   QFFEGIGLGGCITQARFKRRAVVVMTLFFSLTTPVGIAVGLGITNIYDENTSTALSVEGV  302

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              +SA+AGILIYMALVDLLAADFM+PRM  N +LQ GA  SLL+GAG MS+LAKWA
Sbjct  303   LDSAAAGILIYMALVDLLAADFMNPRMQSNGRLQIGAYISLLIGAGCMSVLAKWA  357



>ref|XP_009625957.1| PREDICTED: zinc transporter 8-like [Nicotiana tomentosiformis]
Length=353

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 185/296 (63%), Positives = 221/296 (75%), Gaps = 4/296 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+  PAL PE + FF VKAFAAGVILATGF+H+LPDAFE+L+S  L + PW DFPF
Sbjct  58    IPILGKIFPALHPENNIFFFVKAFAAGVILATGFVHILPDAFESLSSPCLPEKPWGDFPF  117

Query  571   CGFVAMVAAIGTLMVDSFATSYF--SGRSGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
              GF+AMVAAIGT+MVD  A SYF  S    +K     E  +  +      VH H    H 
Sbjct  118   AGFIAMVAAIGTMMVDLVAMSYFRRSHLKRQKPVNSDEEKEGGMINQNNHVHVHTHSTHG  177

Query  745   hghvSVTDTDSSSQL--LRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H H SV   +  S+L   R RVISQVLELGI+VHSVIIGI+LGAS++PKTIKPLVAALTF
Sbjct  178   HAHGSVVPLEEGSELDLSRRRVISQVLELGILVHSVIIGISLGASESPKTIKPLVAALTF  237

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQ FEG+GLGGCI++A+FK +  A+MA+FFSLTTP+GI IG GI+  Y E SP  L++EG
Sbjct  238   HQLFEGIGLGGCISEARFKLRKTAMMAIFFSLTTPMGIAIGFGISTVYSETSPTALMVEG  297

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFNS + GIL+YMALVDLLAADFMS RM  +PKLQ  AN  LLLGAG MS+LAKWA
Sbjct  298   IFNSIATGILVYMALVDLLAADFMSSRMQDSPKLQIEANVFLLLGAGCMSLLAKWA  353



>ref|XP_004961773.1| PREDICTED: zinc transporter 9-like [Setaria italica]
Length=354

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 199/271 (73%), Gaps = 0/271 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P +GRR PAL P+   F  VKAFAAGVILAT F+H+LPDAFE L S  L   PW+ FPF
Sbjct  63    IPSLGRRFPALRPDTDLFIAVKAFAAGVILATAFVHILPDAFEKLGSPCLVDGPWQKFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              G VAM+AAI TL+VD+ AT YF      K  A    GD E        H HA    +  
Sbjct  123   TGLVAMLAAIATLVVDTIATGYFQRAHSAKTAAAPVIGDVEASDHAHGGHGHAHGVVSVM  182

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
               +       +QL+RHRVI+QVLELGIIVHSVIIG+++GAS++P TI+PLVAALTFHQFF
Sbjct  183   ASTSNADGGGAQLIRHRVIAQVLELGIIVHSVIIGMSVGASESPSTIRPLVAALTFHQFF  242

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QAKF+ +S+  MALFFSLTTP+G+VIGIGI++ Y+E+SP+ LI+EG+ N+
Sbjct  243   EGIGLGGCIVQAKFRLKSMLTMALFFSLTTPVGVVIGIGISSTYNENSPRALIVEGVLNA  302

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQ  1203
             A+AGIL YMALVDLLA DFM+PR+  N +LQ
Sbjct  303   AAAGILNYMALVDLLAEDFMNPRVQNNGRLQ  333



>ref|XP_010051825.1| PREDICTED: zinc transporter 1-like [Eucalyptus grandis]
Length=373

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 177/300 (59%), Positives = 227/300 (76%), Gaps = 9/300 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+++P+L P+   FF+VK+FAAGVIL+T F+H+LPDAF +L S  L+  PW +FPF
Sbjct  75    LPILGKKLPSLHPDNPIFFLVKSFAAGVILSTAFVHILPDAFASLASPALADTPWHNFPF  134

Query  571   CGFVAMVAAIGTLMVDSFATSYFS----GRSGEKV----TAGHEAGDAEVGpgvvpvhth  726
              GF+AM+AAIGT+MVD+FATSYF     G++ ++V     A    GD E+      VH H
Sbjct  135   AGFIAMLAAIGTMMVDTFATSYFERSHFGKAADEVLQPPPAAAGKGDEEMDMHEGHVHVH  194

Query  727   athghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVA  906
                 H H H S  D+ SS QL RHR+ISQVLELG++VHSVIIG++LGAS++P+TIKPLVA
Sbjct  195   THATHGHAHGSAHDSRSS-QLTRHRIISQVLELGVVVHSVIIGVSLGASESPRTIKPLVA  253

Query  907   ALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVL  1086
             ALTFHQ FEG+GLGGCI+QAKFKS+ +  M  FF LTTP+GI +G+G+++ Y E  P  L
Sbjct  254   ALTFHQLFEGIGLGGCISQAKFKSRKIVAMMAFFCLTTPVGIGVGMGMSSIYGEGKPSAL  313

Query  1087  IIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             I+EG  NSASAGIL YMALVDL+AAD+M+P M +N KLQ GAN SLLLG+  MS+LA WA
Sbjct  314   IVEGSLNSASAGILTYMALVDLIAADYMNPIMLQNLKLQMGANLSLLLGSASMSLLATWA  373



>ref|XP_004488546.1| PREDICTED: zinc transporter 1-like [Cicer arietinum]
Length=369

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 177/298 (59%), Positives = 221/298 (74%), Gaps = 6/298 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ +R+P LSP    FFM+KAFAAGVIL+TGFIH+LP+AFE L S  L ++ W +FPF
Sbjct  72    LPLLSKRVPILSPNNDLFFMIKAFAAGVILSTGFIHILPEAFEKLNSPCLKENIWGNFPF  131

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR--SGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
              GFVAM+++I TLMVDSFA+ Y+  +  +   ++      D E+G      H H      
Sbjct  132   AGFVAMLSSIATLMVDSFASGYYHRQHFNNNNLSKQVPHDDVEIGGNEHVGHIHVHTHAT  191

Query  745   hghvSVTDTDS----SSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAAL  912
             HGH   +   S    SS+L+R R+ISQVLELGI+VHSVIIGI+LG + +  TIKPL+ AL
Sbjct  192   HGHAHGSTNSSHDSISSELIRQRIISQVLELGIVVHSVIIGISLGTAQSIDTIKPLLVAL  251

Query  913   TFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLII  1092
             +FHQFFEGMGLGGCI+QAKF+S+S  IMA FFSLTTP+GI IGI +++ Y E+ P  LI+
Sbjct  252   SFHQFFEGMGLGGCISQAKFESRSTTIMATFFSLTTPIGIAIGIAVSSVYKENDPTSLIV  311

Query  1093  EGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             EG+F SASAGILIYMALVDLLAADFMSPR+  N K+ F AN SLLLGAG MS+LAKWA
Sbjct  312   EGVFTSASAGILIYMALVDLLAADFMSPRLQNNLKMHFAANISLLLGAGCMSLLAKWA  369



>ref|XP_002461715.1| hypothetical protein SORBIDRAFT_02g006960 [Sorghum bicolor]
 gb|EER98236.1| hypothetical protein SORBIDRAFT_02g006960 [Sorghum bicolor]
Length=382

 Score =   320 bits (819),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 220/318 (69%), Gaps = 26/318 (8%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKH-PWRDFP  567
             LPV+GRR+PAL  +G  FF+VKAFAAGVILATGFIH+LPDAFE LTSD L K  PW+DFP
Sbjct  65    LPVLGRRVPALRADGDVFFLVKAFAAGVILATGFIHILPDAFEKLTSDCLPKSGPWQDFP  124

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAE---------------  693
             F GF AMV AIGTL+VD+ AT YF+    ++G         GD E               
Sbjct  125   FAGFGAMVGAIGTLVVDTVATGYFTRVHFKNGAAAAEAAAVGDEEKQQAAAAAAAPHGDD  184

Query  694   ------VGpgvvpvhthathghahghvSVTDTDSSSQ-LLRHRVISQVLELGIIVHSVII  852
                                HG +    +V  T+   +  LRHRVI+QVLELGI+VHSVII
Sbjct  185   DHDHDGHVHMHTHATHGHAHGSSALVAAVGGTEGDKEHALRHRVIAQVLELGIVVHSVII  244

Query  853   GIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGI  1032
             GI+LGAS+ P TIKPLV AL+FHQ FEGMGLGGCI QAKFK +S+  M LFF LTTP+GI
Sbjct  245   GISLGASEGPSTIKPLVVALSFHQMFEGMGLGGCIVQAKFKVRSIVTMVLFFCLTTPVGI  304

Query  1033  VIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGA  1212
             ++GIGI++ Y+EDSP  LI+EGI NS +AGIL+YMALVDLLA DFM+P++    KLQ   
Sbjct  305   LVGIGISSVYNEDSPTALIVEGILNSVAAGILVYMALVDLLAEDFMNPKVQSRGKLQLAI  364

Query  1213  NTslllgaglmsmlaKWA  1266
             N S+L+GAGLMSMLAKWA
Sbjct  365   NVSMLVGAGLMSMLAKWA  382



>emb|CDP16431.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   317 bits (812),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 177/292 (61%), Positives = 209/292 (72%), Gaps = 52/292 (18%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPV+G++IP+LSPE +FFF++KAFAAGVILATGFIHVLPDAFE+LTS  L ++PW  FPF
Sbjct  68    LPVLGKKIPSLSPENNFFFIIKAFAAGVILATGFIHVLPDAFESLTSPCLPQNPWGKFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM+AAIG LMV                                             
Sbjct  128   TGFVAMLAAIGALMV---------------------------------------------  142

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                    D+  QL   RV S VLELGIIVHSVIIGIALGASD PK I+PL+AALTFHQFF
Sbjct  143   -------DAIVQLHTFRVASIVLELGIIVHSVIIGIALGASDNPKIIRPLLAALTFHQFF  195

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCIAQAKFK+Q++ IMALFFSLTTP GI IGIGI+N Y+E+SP  LI++GIF++
Sbjct  196   EGIGLGGCIAQAKFKAQAITIMALFFSLTTPFGIAIGIGISNVYNENSPNALIVQGIFDA  255

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             AS+GIL+YMALVDLL+ADFM+P+M  N +L  GAN SLL GAG MS+LAKWA
Sbjct  256   ASSGILVYMALVDLLSADFMNPKMQSNARLLQGANISLLFGAGCMSLLAKWA  307



>ref|XP_003557360.1| PREDICTED: zinc transporter 8-like [Brachypodium distachyon]
Length=366

 Score =   319 bits (817),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 216/302 (72%), Gaps = 10/302 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL-SKHPWRDFP  567
             LPV+ RR+P L P+G  FF+VKAFAAGVILATGFIH+LPDAFENL S  L S  PW+DFP
Sbjct  65    LPVLARRVPGLRPDGDVFFLVKAFAAGVILATGFIHILPDAFENLGSPCLPSDGPWKDFP  124

Query  568   FCGFVAMVAAIGTLMVDSFATSYF----SGRSG-----EKVTAGHEAGDAEVGpgvvpvh  720
             F G  AMV AIGTL+VD+ AT YF    S + G     E+  A   AG+ +V       H
Sbjct  125   FAGLGAMVGAIGTLVVDTLATGYFTRAHSKKGGGAVVDEEKQAAAAAGEEDVHVHTHATH  184

Query  721   thathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPL  900
              HA    A         D     +R+RVISQVLELGI+VHSVIIGI+LGAS  P TIKPL
Sbjct  185   GHAHGSAALVAAVGGAEDDKMDTIRYRVISQVLELGIVVHSVIIGISLGASQEPDTIKPL  244

Query  901   VAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPK  1080
             V AL+FHQ FEGMGLGGCI QAKFK++S+  M LFF LTTP+GI +G+GI+  Y+E+SP 
Sbjct  245   VVALSFHQMFEGMGLGGCIVQAKFKARSIVTMILFFCLTTPVGIAVGVGISRVYNENSPT  304

Query  1081  VLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaK  1260
              L++EG  NS +AGIL+YMALVDLLA DFM+P++    KLQ G N S+LLGAGLMSMLAK
Sbjct  305   ALVVEGGLNSVAAGILVYMALVDLLAEDFMNPKVQSRGKLQLGINLSMLLGAGLMSMLAK  364

Query  1261  WA  1266
             WA
Sbjct  365   WA  366



>ref|XP_010941688.1| PREDICTED: zinc transporter 4 [Elaeis guineensis]
Length=362

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 178/301 (59%), Positives = 225/301 (75%), Gaps = 10/301 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++GR + AL PE   FF++KAFAAGVILATG IH+LP AFE+LTS  L + PW +FP 
Sbjct  63    LPILGRSVAALRPENDVFFVIKAFAAGVILATGLIHILPGAFESLTSPCLKEDPWHNFPV  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR--SGEKVTAGHEAGDAEV-------Gpgvvpvht  723
              GFVAM++AIGT+MVDSFATSY++    S  +    +E G+ +V       G   V  H 
Sbjct  123   AGFVAMLSAIGTMMVDSFATSYYTRSHFSKARPVEEYEGGNGDVETSADHDGHVHVHTHA  182

Query  724   hathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLV  903
                H H     S  D  S ++ +RHR+ISQVLELGI+VHS+IIGI+LGAS++P TI+PL+
Sbjct  183   THGHAHGSVPASPEDA-SLAERIRHRIISQVLELGIVVHSLIIGISLGASESPSTIRPLL  241

Query  904   AALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKV  1083
              AL+FHQFFEG+GLGGCI QA F++++  IMA+FFSLT P+GI +GI I++ Y E+SP  
Sbjct  242   GALSFHQFFEGIGLGGCIVQANFRAKATVIMAVFFSLTAPIGISLGIAISSSYKENSPIA  301

Query  1084  LIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             LI+EGIFNSASAGILIYMALVDLLAADF  P+M  N +LQ G + +LLLGAGLMS+LAKW
Sbjct  302   LIVEGIFNSASAGILIYMALVDLLAADFTHPKMQNNGRLQLGTHLALLLGAGLMSILAKW  361

Query  1264  A  1266
             A
Sbjct  362   A  362



>ref|XP_008799796.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 5-like [Phoenix 
dactylifera]
Length=354

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 222/295 (75%), Gaps = 7/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P+ G+ +P+LSPE   FF++KAFAAGVILAT FIH+LP++FE LTS  L++HPW++FPF
Sbjct  64    IPISGKWVPSLSPEKDVFFVIKAFAAGVILATAFIHILPESFERLTSPCLNEHPWQEFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAG---HEAGDAEVGpgvvpvhthathgh  741
              GF+AMV+AIGTLMVD+ AT YFS  S  K  +G      GDAE G   V       HG 
Sbjct  124   AGFIAMVSAIGTLMVDAVATGYFSRSSIWKPDSGVSDEGIGDAEQGAARVHAMHGHXHGP  183

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
             A     V D D   + LRHR+ISQVLELGI+VHSVIIGI LG S++P +I+PL+AAL FH
Sbjct  184   AAL---VVD-DGPDEALRHRIISQVLELGIVVHSVIIGITLGTSESPSSIRPLLAALCFH  239

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI QA F+ +S+  M LFF+LTTP+GI +GIGI++ YDE+SP  L +EG+
Sbjct  240   QFFEGIGLGGCIVQANFRVRSMVTMMLFFALTTPVGIAVGIGISSTYDENSPTALTVEGV  299

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              +SA+AGILIYM+LVDLLA DF +PR+  N +LQ   N SLL+GAGLMS+L KWA
Sbjct  300   LDSAAAGILIYMSLVDLLAEDFRNPRVQSNWRLQLVINVSLLVGAGLMSLLGKWA  354



>gb|EMT08252.1| Zinc transporter 1 [Aegilops tauschii]
Length=374

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 217/316 (69%), Gaps = 24/316 (8%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLS--KHPWRDF  564
             LPV+GRR+PAL PEG  FF+VKAFAAGVILATGFIH+LPDAFENL S  L     PW+DF
Sbjct  59    LPVLGRRVPALRPEGDVFFLVKAFAAGVILATGFIHILPDAFENLKSPCLQPCDGPWQDF  118

Query  565   PFCGFVAMVAAIGTLMVDSFATSYFSGRSGEK----------------------VTAGHE  678
             PF G  AMV AIGTL+VD+ AT YF+     K                        A H 
Sbjct  119   PFAGLGAMVGAIGTLVVDTVATGYFTRAHLNKDGANAAISSNAAGVDEEKQAAAEEARHH  178

Query  679   AGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGI  858
              G+               HG A    +V   D     +RHRVISQVLELGI+VHSVIIGI
Sbjct  179   DGEEHDVHVHTHATHGHAHGSAALVAAVGGADDEKDTIRHRVISQVLELGIVVHSVIIGI  238

Query  859   ALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVI  1038
             +LGAS  P+TIKPLVAAL+FHQ FEGMGLGGCI QAKFK++S+ IM LFF LTTP+GI+I
Sbjct  239   SLGASQNPETIKPLVAALSFHQMFEGMGLGGCIVQAKFKARSIVIMILFFCLTTPVGILI  298

Query  1039  GIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANT  1218
             G GI+  Y+E+SP  L++EG  NS +AGILIYMALVDLLAADFM+P++    KLQ G N 
Sbjct  299   GFGISRVYNENSPTALVVEGSLNSVAAGILIYMALVDLLAADFMNPKVQSRGKLQLGINV  358

Query  1219  slllgaglmsmlaKWA  1266
             S+L+GAGLMSMLAKWA
Sbjct  359   SMLVGAGLMSMLAKWA  374



>gb|EPS66222.1| zinc transporter protein, partial [Genlisea aurea]
Length=336

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 180/292 (62%), Positives = 211/292 (72%), Gaps = 12/292 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP +G R+PALSP+ +FFF+VK+FAAGVILATGFIHVLPDAF +LTS  L ++PW  FPF
Sbjct  57    LPTLGTRVPALSPDKNFFFVVKSFAAGVILATGFIHVLPDAFSDLTSPCLDQNPW-GFPF  115

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              G +AM AAI +LM+DS+AT+Y+  R+ +      EA  AEV    +             
Sbjct  116   AGLIAMTAAILSLMIDSYATAYYKRRNSDVKNNDVEAA-AEVAVSGLLHGHAHGGAVF--  172

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                     S  +LLRHRVISQVLELGIIVHSVIIGIALGAS  P TIKPL+AALTFHQ F
Sbjct  173   --------SEPELLRHRVISQVLELGIIVHSVIIGIALGASQDPLTIKPLIAALTFHQLF  224

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI+Q KFK+++VA MA FF+ TTP GI IGI IT  Y E SP  LI++G  NS
Sbjct  225   EGMGLGGCISQGKFKARTVATMAAFFATTTPGGIAIGIAITKAYRETSPTALIVQGTLNS  284

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLL  DFMS R+  N KL F AN +LL GAG M++LAKWA
Sbjct  285   ASAGILIYMALVDLLGVDFMSDRLQGNGKLMFVANLALLFGAGCMALLAKWA  336



>ref|XP_007041017.1| Zinc transporter 1 precursor [Theobroma cacao]
 gb|EOX96848.1| Zinc transporter 1 precursor [Theobroma cacao]
Length=612

 Score =   325 bits (834),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/293 (59%), Positives = 216/293 (74%), Gaps = 2/293 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IP   PE + FF++KAFA GVILATGF+H+LPDA+E+L+S  + + PW  FPF
Sbjct  319   LPILGKKIPTFQPENNVFFLIKAFAGGVILATGFVHILPDAYESLSSPCIGEKPWGVFPF  378

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKV--TAGHEAGDAEVGpgvvpvhthathgha  744
              GF+AMV+AI T+M+D+ ATS++      K     G E    E G  V            
Sbjct  379   TGFLAMVSAIVTMMIDTIATSFYKRSHFNKALPVNGDEEMLGEHGGHVHVHTHATHGHAH  438

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                    D+ SS  ++R R+ISQVLE+GI+VHSVIIGIALGAS T KTIKPLVAALTFHQ
Sbjct  439   GSAFVSEDSGSSGLIIRQRIISQVLEVGIVVHSVIIGIALGASQTAKTIKPLVAALTFHQ  498

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI+QAKFK++++ IM LFFS TTP+GI  G+G++  Y+E+S K L++EGIF
Sbjct  499   FFEGMGLGGCISQAKFKTRAIGIMLLFFSFTTPMGIAFGMGVSKIYNENSSKALVVEGIF  558

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             NS SAGILIYM+LVDLLAADFM+PRM  + KLQ G N SLLLGA  MS+LAKW
Sbjct  559   NSLSAGILIYMSLVDLLAADFMNPRMQSSIKLQLGCNLSLLLGAACMSLLAKW  611


 Score =   227 bits (578),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 152/212 (72%), Gaps = 6/212 (3%)
 Frame = +1

Query  583   AMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahghvS-  759
             AMVAAI TLM++SFAT Y   +  E   A    GD E        H H       GH   
Sbjct  60    AMVAAILTLMMESFATGYH--KRNELSKAQPVNGDEESEEHGGHSHGHGHGHGRGGHGHG  117

Query  760   ---VTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                V D   SS L+RHR++SQVLELGI+VHSVIIG++LGAS+ P+TIKPLVAA++FHQFF
Sbjct  118   SAFVLDRTKSSDLIRHRIVSQVLELGIVVHSVIIGLSLGASENPRTIKPLVAAISFHQFF  177

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI  AKFK ++VAIM LF SLT P+GI +GIG++N Y+E+SP  LI++G+ NS
Sbjct  178   EGMGLGGCILPAKFKHRAVAIMVLFISLTAPIGIAVGIGLSNAYNENSPTALIVQGLLNS  237

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQF  1206
             ASAGILIYMALVDLLA  FMSP+M  N +LQ 
Sbjct  238   ASAGILIYMALVDLLADVFMSPQMLSNIRLQL  269



>ref|XP_006468557.1| PREDICTED: zinc transporter 8-like isoform X2 [Citrus sinensis]
 ref|XP_006468559.1| PREDICTED: zinc transporter 8-like isoform X2 [Citrus sinensis]
 gb|KDO77254.1| hypothetical protein CISIN_1g018051mg [Citrus sinensis]
Length=361

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 221/297 (74%), Gaps = 5/297 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P  G+ I    PE + FF++KAFAAGVILATGF+H+LPDA+E+LTS  LS  PW+DFPF
Sbjct  65    IPSFGKNISTFHPENNIFFIIKAFAAGVILATGFVHILPDAYESLTSPCLSPKPWQDFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAMV+AI T+MVD+FATS++      K   V    +   AE    V           
Sbjct  125   TGFVAMVSAILTMMVDAFATSFYQRLHFSKALPVNDDDKEMHAEHEGHVHVHTHATHGHA  184

Query  742   ahghvSVTDTDSS--SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALT  915
                  + +D   S  S L RHR++SQVLELGI+VHSVIIGI+LGAS + KTIKPLVAALT
Sbjct  185   HGSAFASSDASGSGTSDLFRHRIVSQVLELGIVVHSVIIGISLGASGSVKTIKPLVAALT  244

Query  916   FHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIE  1095
             FHQFFEGMGLGGCI+QAKFKS++VA M LFFSLTTP+GI IGIGI+  Y E+SP  L+IE
Sbjct  245   FHQFFEGMGLGGCISQAKFKSKAVAAMILFFSLTTPVGIGIGIGISKVYKENSPTALVIE  304

Query  1096  GIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             GIFNSASAGILIYMALVDLLA DFMSP++  N KLQ GAN SLLLG+G MS+LAKWA
Sbjct  305   GIFNSASAGILIYMALVDLLATDFMSPKLQTNFKLQLGANFSLLLGSGCMSLLAKWA  361



>ref|XP_010044860.1| PREDICTED: zinc transporter 5-like [Eucalyptus grandis]
 gb|KCW88544.1| hypothetical protein EUGRSUZ_A00916 [Eucalyptus grandis]
Length=364

 Score =   317 bits (812),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/277 (59%), Positives = 202/277 (73%), Gaps = 8/277 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++ R IPA+ P+   FF+VKAFAAGVILATG IHVLPDAF++LTS  L ++PW +FPF
Sbjct  65    IPLLARVIPAIGPDRDAFFVVKAFAAGVILATGLIHVLPDAFDSLTSPCLDQNPWGNFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAMVAAI TLMVD++ATSY++     K       GD E                   
Sbjct  125   AGFVAMVAAIATLMVDAYATSYYTRSHFSKARPAASKGDEETKAAAGSEDHAGHLHMHTH  184

Query  751   hvSVTDTDS--------SSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVA  906
                     S        +S+LLRHRVISQVLELGI+VHSVIIGI++G S + +T+K L+A
Sbjct  185   TTHGHAHGSAYQDQEPGTSELLRHRVISQVLELGIVVHSVIIGISVGTSGSLQTVKTLMA  244

Query  907   ALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVL  1086
             ALTFHQFFEGMGLGGCIAQAKFK+ S  IMA+FFSLTTPLGI IGIGI++ YD++SP+ L
Sbjct  245   ALTFHQFFEGMGLGGCIAQAKFKATSTVIMAIFFSLTTPLGIAIGIGISSSYDDNSPRAL  304

Query  1087  IIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPK  1197
             II+GIF++ASAGIL+YM+LVDLLAADFMS ++  N +
Sbjct  305   IIQGIFDAASAGILVYMSLVDLLAADFMSAKVQGNGR  341



>gb|EMT08251.1| Zinc transporter 1 [Aegilops tauschii]
Length=382

 Score =   317 bits (812),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 217/321 (68%), Gaps = 30/321 (9%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL-SKHPWRDFP  567
             LPV+GRR+PAL PEG  FF+VKAFAAGVILATGFIH+LPDAFENLTSD L S  PW+DFP
Sbjct  63    LPVLGRRVPALRPEGDVFFLVKAFAAGVILATGFIHILPDAFENLTSDCLPSDGPWKDFP  122

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA--------------------------  669
             F G  AMV AIGTL+VD+ AT YF+     K  A                          
Sbjct  123   FAGLGAMVGAIGTLVVDTVATGYFTRAHLNKDRAHGHGAISSSAAVVDEEKQAAAAAIEG  182

Query  670   --GHEAGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHS  843
                H+ G+ +V       H HA    A         D    + RHRVISQVLELGI+VHS
Sbjct  183   ARRHDGGEHDVHVHTHATHGHAHGSAALVAAVGGAEDEKDTI-RHRVISQVLELGIVVHS  241

Query  844   VIIGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTP  1023
             VIIGI+LGAS  P TIKPLV AL+FHQ FEGMGLGGCI QAKFK++S+  M LFF LTTP
Sbjct  242   VIIGISLGASQDPDTIKPLVVALSFHQMFEGMGLGGCIVQAKFKARSIVTMILFFCLTTP  301

Query  1024  LGIVIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQ  1203
             +GI +G GI+  Y+E+SP  L++EG  NS +AGIL+YMALVDLLA DFM+P++    KLQ
Sbjct  302   VGIAVGFGISRVYNENSPTALVVEGSLNSVAAGILVYMALVDLLAEDFMNPKVQSRGKLQ  361

Query  1204  FGANTslllgaglmsmlaKWA  1266
              G N S+L+GAGLMSMLAKWA
Sbjct  362   LGINVSMLVGAGLMSMLAKWA  382



>ref|XP_006448619.1| hypothetical protein CICLE_v10015713mg [Citrus clementina]
 gb|ESR61859.1| hypothetical protein CICLE_v10015713mg [Citrus clementina]
Length=361

 Score =   316 bits (810),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 220/297 (74%), Gaps = 5/297 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P  G+ I    PE + FF++KAFAAGVILATGF+H+LPDA+E+LTS  LS  PW+DFPF
Sbjct  65    IPSFGKNISTFHPENNIFFIIKAFAAGVILATGFVHILPDAYESLTSPCLSPKPWQDFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAMV+AI T+MVD+FATS++      K   V    +   AE    V           
Sbjct  125   TGFVAMVSAILTMMVDAFATSFYQRLHFSKALPVNDDDKEMHAEHEGHVHVHTHATHGHA  184

Query  742   ahghvSVTDTDSS--SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALT  915
                  + +D   S  S L RHR++SQVLELGI+VHSVIIGI+LGAS + KTIKPLVAALT
Sbjct  185   HGSAFASSDASGSGTSDLFRHRIVSQVLELGIVVHSVIIGISLGASGSVKTIKPLVAALT  244

Query  916   FHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIE  1095
             FHQFFEGMGLGGCI+QAKFKS+S+  M LFFSLTTP+GI IGIGI+  Y E+SP  L+IE
Sbjct  245   FHQFFEGMGLGGCISQAKFKSKSIVAMILFFSLTTPVGIGIGIGISKVYKENSPTALVIE  304

Query  1096  GIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             GIFNSASAGILIYMALVDLLA DFMSP++  N KLQ GAN SLLLG+G MS+LAKWA
Sbjct  305   GIFNSASAGILIYMALVDLLATDFMSPKLQTNFKLQLGANFSLLLGSGCMSLLAKWA  361



>ref|XP_009402753.1| PREDICTED: zinc transporter 8-like [Musa acuminata subsp. malaccensis]
Length=343

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/292 (60%), Positives = 217/292 (74%), Gaps = 6/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPAL P+   FF++K+FAAGVILAT F+H+LPD+F++LTS  L   PW +FPF
Sbjct  58    IPILGKWIPALDPDRDTFFVIKSFAAGVILATAFVHILPDSFDSLTSSCLHPDPWHNFPF  117

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF AM+AAIGTLM+D+ AT YFS        +     D E+     P   H  + H H 
Sbjct  118   AGFGAMIAAIGTLMIDTLATGYFS--RPHNAVSDETKTDIEI----RPDVVHEENIHVHT  171

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
             H       SS QL+RHRVISQVLELGI+VHSVIIGIALGAS+TP TIKPLV AL+FHQFF
Sbjct  172   HAHAHGHPSSPQLIRHRVISQVLELGIVVHSVIIGIALGASETPSTIKPLVVALSFHQFF  231

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGC+ QAK K ++   M LFFSLTTP+G+ +G G+++ YDE+SP  LI+EG+ NS
Sbjct  232   EGVGLGGCLVQAKLKPRTAVTMGLFFSLTTPVGVAVGAGLSSAYDENSPTALIVEGLLNS  291

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYM+LVDLLA DFM+PR+    +LQ G N SLL GAGLMS+LAKWA
Sbjct  292   ASAGILIYMSLVDLLAEDFMNPRVQSKGRLQVGMNISLLTGAGLMSLLAKWA  343



>ref|XP_010260697.1| PREDICTED: zinc transporter 8-like [Nelumbo nucifera]
Length=674

 Score =   326 bits (835),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 173/278 (62%), Positives = 203/278 (73%), Gaps = 9/278 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+GR IPAL P+ + FF++KAFAAGVILATGFIH+LPDAFE LTS  L    W +FPF
Sbjct  386   IPVLGRTIPALHPDRNVFFLIKAFAAGVILATGFIHILPDAFEQLTSPCLKGKVWENFPF  445

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAM++A+GT MV++ AT Y+      K        E     VG   V  H    H H
Sbjct  446   TGFVAMMSAMGTFMVETLATGYYKRLHFSKSLPTNVDEEMQGDHVGHLHVHTHATHGHSH  505

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
               G  +  D      LLRHRV SQVLELGI+VHSVIIGI+LGAS  P TIKPLVAAL+FH
Sbjct  506   GSGDSTAPD------LLRHRVTSQVLELGILVHSVIIGISLGASQEPSTIKPLVAALSFH  559

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI QA F++++V +M LFFSLTTP GI +GIGITN YDE+SP  LI+EGI
Sbjct  560   QFFEGMGLGGCITQANFRTRAVVVMTLFFSLTTPAGIAVGIGITNVYDENSPTALIVEGI  619

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             F+SA+AGILIYMALVDLLA+DFM+PRM  N KLQ  AN
Sbjct  620   FDSAAAGILIYMALVDLLASDFMNPRMQSNGKLQLWAN  657


 Score =   319 bits (817),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 165/275 (60%), Positives = 205/275 (75%), Gaps = 4/275 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +PV+G+ IPAL PE   FF++KAFAAGVILATGFIH+LP+AFE LTS  L    W++FPF
Sbjct  69    IPVLGKAIPALHPENDIFFIIKAFAAGVILATGFIHILPNAFEKLTSPCLKGKAWQNFPF  128

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AM++ IGTLMVD+  T Y+   +  K     +  + +V     PV     H HA  
Sbjct  129   TGFIAMMSGIGTLMVDTLVTGYYKRSNFSKA----QPLNGDVERAGEPVDHVHVHTHATH  184

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
               +     +SS LLRHR+ISQVLELGI+VHSVIIGI+LG S++  TIKPL+AAL+FHQFF
Sbjct  185   GHAHGSNSTSSDLLRHRIISQVLELGIVVHSVIIGISLGTSESSSTIKPLIAALSFHQFF  244

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QA+ KS +VAIMA+FFSLTTP+GI +GIGITN YD +S   L +EG+F+S
Sbjct  245   EGIGLGGCITQARIKSSAVAIMAVFFSLTTPVGIAVGIGITNVYDANSSTSLSVEGVFDS  304

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             AS+GILIYMALVDLLAADFM P+M  N +LQ  AN
Sbjct  305   ASSGILIYMALVDLLAADFMDPKMQSNGRLQIIAN  339



>gb|ABF55690.1| putative zinc transporter [Triticum aestivum]
Length=376

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 186/317 (59%), Positives = 219/317 (69%), Gaps = 25/317 (8%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL-SKHPWRDF-  564
             LPV+GRR+PAL PEG  FF+VKAFAAGVILATGFIH+LPDAF+NLTSD L S  PW+DF 
Sbjct  60    LPVLGRRVPALRPEGDVFFLVKAFAAGVILATGFIHILPDAFDNLTSDCLPSDGPWKDFQ  119

Query  565   -PFCGFVAMVAAIGTLMVDSFATSYFSGRSGEK----------------------VTAGH  675
              PF G  AMV AIGTL+VD+ AT YF+     K                        A H
Sbjct  120   FPFAGLGAMVGAIGTLVVDTVATGYFTRAHLNKDGANAAISSNAAGVDEEKQAAAEEARH  179

Query  676   EAGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIG  855
               G+               HG A    +V   D     +RHRVISQVLELGI+VHSVIIG
Sbjct  180   HDGEEHDVHVHTHATHGHAHGSAALVAAVGGADDEKDTIRHRVISQVLELGIVVHSVIIG  239

Query  856   IALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIV  1035
             I+LGAS  P+TIK LVAAL+FHQ FEGMGLGGCI QAKFK++S+ IM LFF LTTP+GI+
Sbjct  240   ISLGASQNPETIKSLVAALSFHQMFEGMGLGGCIVQAKFKARSIVIMILFFCLTTPVGIL  299

Query  1036  IGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             IG GI+  Y+++SP  L++EG  NS +AGILIYMALVDLLAADFM+P++    KLQ G N
Sbjct  300   IGFGISRVYNKNSPTALVVEGSLNSVAAGILIYMALVDLLAADFMNPKVQSRGKLQLGIN  359

Query  1216  TslllgaglmsmlaKWA  1266
              S+L+GAGLMSMLAKWA
Sbjct  360   VSMLVGAGLMSMLAKWA  376



>dbj|BAJ25747.1| zinc transporter [Oryza sativa Indica Group]
Length=387

 Score =   314 bits (805),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 216/319 (68%), Gaps = 27/319 (8%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL-SKHPWRDFP  567
             LP +GR +PAL P+G  FF+VKAFAAGVILATGFIH+LPDAF+NLT D L +  PW++FP
Sbjct  69    LPSLGRHVPALRPDGDVFFLVKAFAAGVILATGFIHILPDAFDNLTDDCLPAGGPWKEFP  128

Query  568   FCGFVAMVAAIGTLMVDSFATSYFS----------------GRSGEKVTAGHE-------  678
             F GF AMV AIGTL+VD+ AT YF+                 +S    T  H        
Sbjct  129   FAGFGAMVGAIGTLVVDTLATGYFTRAQSKKDAAAAVADEEKQSAAATTQQHNHHYVVGD  188

Query  679   ---AGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVI  849
                  + E    V    TH     +   V+    D     LRHRVISQVLELGI+VHSVI
Sbjct  189   GGGGEEHEGQVHVHTHATHGHAHGSSALVAAVGEDDKETTLRHRVISQVLELGIVVHSVI  248

Query  850   IGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLG  1029
             IGI+LGAS  P+TIKPLV AL+FHQ FEGMGLGGCI QAKFK +S+  M LFF LTTP+G
Sbjct  249   IGISLGASQNPETIKPLVVALSFHQMFEGMGLGGCIVQAKFKVRSIVTMVLFFCLTTPVG  308

Query  1030  IVIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFG  1209
             I +G+GI++ Y+E SP  L++EGI NS +AGILIYMALVDLLA DFM+PR+    KLQ G
Sbjct  309   IAVGVGISSVYNESSPTALVVEGILNSVAAGILIYMALVDLLAEDFMNPRVQSRGKLQLG  368

Query  1210  ANTslllgaglmsmlaKWA  1266
              N ++L GAGLMSMLAKWA
Sbjct  369   INLAMLAGAGLMSMLAKWA  387



>gb|EAZ03299.1| hypothetical protein OsI_25442 [Oryza sativa Indica Group]
 dbj|BAJ25748.1| zinc transporter [Oryza sativa Indica Group]
Length=387

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 216/319 (68%), Gaps = 27/319 (8%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL-SKHPWRDFP  567
             LP +GR +PAL P+G  FF+VKAFAAGVILATGFIH+LPDAF+NLT D L +  PW++FP
Sbjct  69    LPSLGRHVPALRPDGDVFFLVKAFAAGVILATGFIHILPDAFDNLTDDCLPAGGPWKEFP  128

Query  568   FCGFVAMVAAIGTLMVDSFATSYFS----------------GRSGEKVTAGHE-------  678
             F GF AMV AIGTL+VD+ AT YF+                 +S    T  H        
Sbjct  129   FAGFGAMVGAIGTLVVDTLATGYFTRAQSKKDAAAAVADEEKQSAAATTQQHNHHYVVGD  188

Query  679   ---AGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVI  849
                  + E    V    TH     +   V+    D     LRHRVISQVLELGI+VHSVI
Sbjct  189   GGGGEEHEGQVHVHTHATHGHAHGSSALVAAVGEDDKETTLRHRVISQVLELGIVVHSVI  248

Query  850   IGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLG  1029
             IGI+LGAS  P+TIKPLV AL+FHQ FEGMGLGGCI QAKFK +S+  M LFF LTTP+G
Sbjct  249   IGISLGASQNPETIKPLVVALSFHQMFEGMGLGGCIVQAKFKVRSIVTMVLFFCLTTPVG  308

Query  1030  IVIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFG  1209
             I +G+GI++ Y+E SP  L++EGI NS +AGILIYMALVDLLA DFM+PR+    KLQ G
Sbjct  309   IAVGVGISSVYNESSPTALVVEGILNSVAAGILIYMALVDLLAEDFMNPRVQSRGKLQLG  368

Query  1210  ANTslllgaglmsmlaKWA  1266
              N ++L GAGLMSMLAKWA
Sbjct  369   INLAMLAGAGLMSMLAKWA  387



>ref|XP_003542170.1| PREDICTED: zinc transporter 8-like isoform X1 [Glycine max]
Length=347

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 229/296 (77%), Gaps = 12/296 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ IPALSPE + FF++KAFAAGVILATGFIH+LPDAFENLTS  L+K+PW  FPF
Sbjct  60    IPLLGKVIPALSPEKNIFFIIKAFAAGVILATGFIHILPDAFENLTSPCLNKYPWDAFPF  119

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGH----EAGDAEVGpgvvpvhthathg  738
              GFVAM  A+GTLMV+++AT+YF      +V   +    E+GD  +       H H    
Sbjct  120   TGFVAMCTAMGTLMVETYATAYFKKHHHSQVQTTYVEKEESGDVHLHTHATHGHAHGHLP  179

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
                     +    SS LLRHRVISQVLELGIIVHS+IIGI++GAS++PKTI+PLVAALTF
Sbjct  180   --------SHDHQSSALLRHRVISQVLELGIIVHSIIIGISMGASESPKTIRPLVAALTF  231

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLG CI QA F+  S+ IM LFF+LTTP+GI IGIGITN YDE+SP  LI+EG
Sbjct  232   HQFFEGMGLGSCIIQANFQRLSITIMGLFFALTTPVGIGIGIGITNVYDENSPTALIVEG  291

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             IFN+ASAGILIYMALVDLLAADFM+PRM K+  L+ GAN SLLLGAG MS+LAKWA
Sbjct  292   IFNAASAGILIYMALVDLLAADFMNPRMQKSGSLRLGANLSLLLGAGCMSLLAKWA  347



>ref|XP_009393263.1| PREDICTED: zinc transporter 4-like [Musa acuminata subsp. malaccensis]
Length=354

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/295 (57%), Positives = 216/295 (73%), Gaps = 3/295 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++GR + AL PE   FF++KAFAAGVILATG IH+LP AF++LTS  L +HPW+DFP 
Sbjct  60    IPILGRAVSALRPENDMFFVIKAFAAGVILATGLIHILPAAFQSLTSPCLDEHPWQDFPV  119

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GFV M +A+GT+M+DSFATSY+      K   V    EAG    G         +    
Sbjct  120   TGFVVMSSALGTMMIDSFATSYYKRSHFSKARPVEEDDEAGQGSSGDHAHVDTHRSHGHA  179

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                  + T+  S S+ +R +VISQVLELGI+VHSVIIGI+LGAS +P TI+PLV AL+FH
Sbjct  180   HASAAAATEAASLSERIRQQVISQVLELGILVHSVIIGISLGASQSPSTIRPLVGALSFH  239

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI QA F+++S  +MA+FFSLT P+GI +G  I+  YDE S   LI+EG+
Sbjct  240   QFFEGIGLGGCIVQANFRAKSSLMMAVFFSLTAPIGIAVGTAISFVYDETSSTALIVEGV  299

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             FN+ASAGIL+YM+LVDLLAADF +PRM  N +LQ GA+ +LL+GAGLMS+LAKWA
Sbjct  300   FNAASAGILVYMSLVDLLAADFTNPRMQSNGRLQLGAHLALLVGAGLMSLLAKWA  354



>gb|EYU33801.1| hypothetical protein MIMGU_mgv1a008434mg [Erythranthe guttata]
Length=374

 Score =   313 bits (801),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 223/303 (74%), Gaps = 11/303 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++GRR+ AL PE   FFM+KAFAAGVILATGFIH+LPDAF  LTS  L++ PWR FPF
Sbjct  72    LPLLGRRVEALRPENDVFFMIKAFAAGVILATGFIHILPDAFRTLTSPCLAEDPWRRFPF  131

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpg-----------vvpv  717
              GF+AMVA+IGTLMVD+ AT+++     +     ++ GD E G             +   
Sbjct  132   AGFIAMVASIGTLMVDTLATAFYKNMHFDTAKQVNDVGDEEEGSIHPEDGHDARVDIHAH  191

Query  718   hthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKP  897
              TH     A   +    + S S ++R R+ISQVLELGI+VHSVIIGI+LGAS +  TIKP
Sbjct  192   ATHGHAHGASAALPSRKSGSVSDIVRQRIISQVLELGIVVHSVIIGISLGASQSSYTIKP  251

Query  898   LVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSP  1077
             L+ AL+FHQFFEGMGLGGCI+QA+FKS +  IM LFFSLTTP+GI +GIGI++ Y E+S 
Sbjct  252   LLVALSFHQFFEGMGLGGCISQARFKSVTTMIMTLFFSLTTPIGIGVGIGISSVYKENSS  311

Query  1078  KVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmla  1257
               LI+EG+ NSASAGILIYMALVDLLAADFM+PRM  N +LQ GA+TSLLLGAG MS LA
Sbjct  312   TGLIVEGVMNSASAGILIYMALVDLLAADFMNPRMEGNLRLQLGAHTSLLLGAGCMSFLA  371

Query  1258  KWA  1266
             KWA
Sbjct  372   KWA  374



>ref|XP_010922625.1| PREDICTED: zinc transporter 8-like [Elaeis guineensis]
Length=349

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 177/292 (61%), Positives = 215/292 (74%), Gaps = 2/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ + IPALS E   FF +KAFAA VILATGFIH+LPDAFENLTS  L+ +PW +FPF
Sbjct  60    LPILSKSIPALSLENDIFFAIKAFAAVVILATGFIHILPDAFENLTSLCLNDNPWGNFPF  119

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF AM+ A+GTLMVD+ ATSYF+ RS   V   +  GDA +G      H    H     
Sbjct  120   AGFGAMLGALGTLMVDTLATSYFT-RSARAVGDENNKGDAAMGGSAGDHHVVHVHATRGH  178

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                 T    S +L R+RVIS  LELGI+VHSVIIGI+LGASD+P TI PLVAAL+FHQFF
Sbjct  179   AHGPT-VYVSDKLERNRVISLELELGIVVHSVIIGISLGASDSPSTISPLVAALSFHQFF  237

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCIAQAKFK +S+A+M LFFSLTTP+G+ IG GI++ Y+++SP  LII+G  NS
Sbjct  238   EGMGLGGCIAQAKFKIKSMAMMILFFSLTTPVGMAIGFGISSVYNKNSPITLIIKGCLNS  297

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              + GILIYMALVDLL  +FM+P++    KLQF  N SLL+G  LMS+LAKWA
Sbjct  298   VAIGILIYMALVDLLVEEFMNPKVQSKGKLQFEINVSLLIGVYLMSLLAKWA  349



>ref|XP_004976446.1| PREDICTED: zinc transporter 9-like [Setaria italica]
Length=359

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 215/301 (71%), Gaps = 12/301 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P +GR+IPAL P+   FF VKAFAAGVILAT F+H+LPDAFE L S  L   PW+  PF
Sbjct  62    IPSLGRKIPALRPDTDLFFAVKAFAAGVILATAFVHILPDAFEKLGSPCLVDGPWQKLPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthath-----  735
              GFVAM+AAI TL+VD+ AT YF     +   A    GD E       VH HA       
Sbjct  122   AGFVAMLAAIATLVVDTIATGYFQRAHAKNAAA---VGDVETPGHHHHVHAHAHGDHGHN  178

Query  736   ----ghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLV  903
                        S ++TD  +QL+RHRVISQVLELGIIVHSVIIG++LGAS++P TI+PL+
Sbjct  179   HGMPALIASSSSTSNTDDHAQLIRHRVISQVLELGIIVHSVIIGMSLGASESPITIRPLL  238

Query  904   AALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKV  1083
              ALTFHQFFEG+GLGGCI QA+F+ +SV  MALFFSLTTP+G+ IGIGI++ Y+E+SP+ 
Sbjct  239   VALTFHQFFEGIGLGGCIVQARFRLRSVVTMALFFSLTTPVGVAIGIGISSAYNENSPRA  298

Query  1084  LIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             LI EG+  +A+AGIL YMALVDLLA DFM+PR+  + KLQ   N SLLLG  LMSMLA W
Sbjct  299   LITEGVLTAAAAGILNYMALVDLLAEDFMNPRVQNSGKLQVILNVSLLLGTALMSMLAIW  358

Query  1264  A  1266
             A
Sbjct  359   A  359



>ref|XP_011095751.1| PREDICTED: zinc transporter 1-like [Sesamum indicum]
Length=361

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 183/294 (62%), Positives = 216/294 (73%), Gaps = 4/294 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++GRR     PE   FFM+KAFAAGVILATGFIH+LPDAF  LTS  L ++PW  FPF
Sbjct  68    LPLLGRRFHVFRPENDIFFMIKAFAAGVILATGFIHILPDAFRTLTSPCLGENPWGKFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFV M+AAI TLMVD+ ATS++        ++V    EAGD E    V           
Sbjct  128   AGFVGMMAAIATLMVDTVATSFYKNMHFSKSKQVNVDEEAGDDEHAGHVHIHTHATHGHA  187

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                     +  S S L+R R+ISQVLELGI+VHSVIIGI+LGAS +  TIKPL+AAL+FH
Sbjct  188   HGAAAPSNEM-SLSDLVRQRIISQVLELGIVVHSVIIGISLGASVSVDTIKPLLAALSFH  246

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEGMGLGGCI+QA+FKS +  IM LFFSLTTP+GI +GIGI++ Y E+SPK LI+EGI
Sbjct  247   QFFEGMGLGGCISQAEFKSLTTTIMMLFFSLTTPIGIGVGIGISSVYKENSPKALIVEGI  306

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             FNSAS+GILIYMALVDLLAADFM+PRM  N +LQ GA+ SLLLGAG MS LAKW
Sbjct  307   FNSASSGILIYMALVDLLAADFMNPRMQSNVRLQLGAHISLLLGAGCMSFLAKW  360



>dbj|BAJ91221.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   312 bits (799),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 213/322 (66%), Gaps = 31/322 (10%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL--SKHPWRDF  564
             LPV+GRR+PAL PEG  FF+VKAFAAGVILATGFIH+LPDAFE LTS  L  S  PW DF
Sbjct  62    LPVLGRRVPALRPEGDVFFLVKAFAAGVILATGFIHILPDAFEKLTSPCLLPSDGPWHDF  121

Query  565   PFCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA-------------------------  669
             PF G  AMV AIGTL+VD+ AT YF+     K  A                         
Sbjct  122   PFAGLGAMVGAIGTLVVDTVATGYFTRAQLNKDGAHGHGAITSSAAVVDEEKQAAAAASE  181

Query  670   ---GHEAGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVH  840
                 HE G+ EV       H HA    A         D    + RHRVISQVLELGI+VH
Sbjct  182   EARRHEGGEQEVHVHTHATHGHAHGSAALVAAVGGAEDEKDTI-RHRVISQVLELGIVVH  240

Query  841   SVIIGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTT  1020
             SVIIGI+LGAS  P TIKPLV AL+FHQ FEGMGLGGCI QAKF+++S+  M LFF LTT
Sbjct  241   SVIIGISLGASQNPDTIKPLVVALSFHQMFEGMGLGGCIVQAKFRARSIVTMILFFCLTT  300

Query  1021  PLGIVIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKL  1200
             P+GI +G GI+  Y+E SP  L++EG  NS +AGILIYMALVDLLA DFM+P++    KL
Sbjct  301   PVGIAVGFGISRVYNEYSPTALVVEGSLNSVAAGILIYMALVDLLAEDFMNPKVQSRGKL  360

Query  1201  QFGANTslllgaglmsmlaKWA  1266
             Q G N S+L+GAGLMSMLAKWA
Sbjct  361   QLGINISMLVGAGLMSMLAKWA  382



>ref|XP_009384788.1| PREDICTED: zinc transporter 5-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   313 bits (802),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 216/296 (73%), Gaps = 5/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+  PAL PE   FF++K+FAAGVILATGF+H+LPDAF+ LTS  L   PW+ FPF
Sbjct  129   IPILGKWWPALHPEKDVFFVIKSFAAGVILATGFVHILPDAFDGLTSSCLDPSPWQKFPF  188

Query  571   CGFVAMVAAIGTLMVDSFATSYFS----GRSGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              GF AMVAAI TLM+D+ AT YFS     R+           D E  P  +  H      
Sbjct  189   AGFGAMVAAIATLMMDTVATGYFSRSHSARARTAAVTDETKADME-APHGMHGHNDVHVH  247

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
                 H  + +  S+ QL+RHRVISQVLELGI+VHSVIIGI+LGAS+TP TI+ L+AAL+F
Sbjct  248   SHANHGHIHEDPSAQQLIRHRVISQVLELGIVVHSVIIGISLGASETPSTIRSLLAALSF  307

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEG+GLGGCI QAK++ +S+  M LFFSLTTP+GI +G+G ++ YDE+SP  L++EG
Sbjct  308   HQFFEGVGLGGCIVQAKYQMKSMVTMGLFFSLTTPVGIAVGMGTSSVYDENSPTALVVEG  367

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             + +SASAGILIYMALVDLLA DF +PR+   PKLQ   N SLLLGA LMS+LAKW+
Sbjct  368   LLDSASAGILIYMALVDLLAQDFTNPRVQSKPKLQLAMNISLLLGAALMSILAKWS  423



>ref|XP_006468556.1| PREDICTED: zinc transporter 8-like isoform X1 [Citrus sinensis]
 ref|XP_006468558.1| PREDICTED: zinc transporter 8-like isoform X1 [Citrus sinensis]
Length=365

 Score =   311 bits (797),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 221/301 (73%), Gaps = 9/301 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P  G+ I    PE + FF++KAFAAGVILATGF+H+LPDA+E+LTS  LS  PW+DFPF
Sbjct  65    IPSFGKNISTFHPENNIFFIIKAFAAGVILATGFVHILPDAYESLTSPCLSPKPWQDFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAMV+AI T+MVD+FATS++      K   V    +   AE    V           
Sbjct  125   TGFVAMVSAILTMMVDAFATSFYQRLHFSKALPVNDDDKEMHAEHEGHVHVHTHATHGHA  184

Query  742   ahghvSVTDTDSS--SQLLRHRVISQV----LELGIIVHSVIIGIALGASDTPKTIKPLV  903
                  + +D   S  S L RHR++SQV    LELGI+VHSVIIGI+LGAS + KTIKPLV
Sbjct  185   HGSAFASSDASGSGTSDLFRHRIVSQVSIDVLELGIVVHSVIIGISLGASGSVKTIKPLV  244

Query  904   AALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKV  1083
             AALTFHQFFEGMGLGGCI+QAKFKS++VA M LFFSLTTP+GI IGIGI+  Y E+SP  
Sbjct  245   AALTFHQFFEGMGLGGCISQAKFKSKAVAAMILFFSLTTPVGIGIGIGISKVYKENSPTA  304

Query  1084  LIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             L+IEGIFNSASAGILIYMALVDLLA DFMSP++  N KLQ GAN SLLLG+G MS+LAKW
Sbjct  305   LVIEGIFNSASAGILIYMALVDLLATDFMSPKLQTNFKLQLGANFSLLLGSGCMSLLAKW  364

Query  1264  A  1266
             A
Sbjct  365   A  365



>gb|KDO77256.1| hypothetical protein CISIN_1g018362mg [Citrus sinensis]
Length=357

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/277 (57%), Positives = 201/277 (73%), Gaps = 8/277 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP + +++  LSP+   FF++KAFAAGVILATGFIH+LPDAFE+LTS  L ++PW  FPF
Sbjct  68    LPFLVKKVSYLSPDKDVFFLIKAFAAGVILATGFIHILPDAFESLTSPCLCENPWHKFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA--GHEAGDAEVGpgvvpvhthathgha  744
              GF+AM+++IGTLM++++AT Y       K     G E  D +     V           
Sbjct  128   AGFIAMMSSIGTLMMEAYATGYHKRTELRKAQPFDGDEESDHDHDQQGVHAGHVHGSSF-  186

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                  V +  +SS L+R+R+ISQ+LELGI++HSVIIGI+LGAS+   TIKPLVAAL+FHQ
Sbjct  187   -----VPEPTNSSDLIRNRIISQILELGIVIHSVIIGISLGASERASTIKPLVAALSFHQ  241

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEG GLGGCI+QAKF   +++IM LFFSLTTP GI +GIGI+  YD+ SP  LI++G+ 
Sbjct  242   FFEGTGLGGCISQAKFNYTAISIMVLFFSLTTPAGIAVGIGISKIYDQSSPTALIVQGLL  301

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             NSASAGIL YMALVDLLAADFM+P+M  N +LQ GAN
Sbjct  302   NSASAGILTYMALVDLLAADFMNPKMLSNIRLQIGAN  338



>ref|XP_009419521.1| PREDICTED: zinc transporter 3-like [Musa acuminata subsp. malaccensis]
Length=403

 Score =   312 bits (799),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 224/306 (73%), Gaps = 18/306 (6%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++GR   A+SPE   FF++KAFAAGVILATG IH+LPDAFE+LTS  L +  W+DFP 
Sbjct  102   IPILGRSFAAMSPESDVFFVIKAFAAGVILATGLIHILPDAFESLTSPCLGEQQWQDFPV  161

Query  571   CGFVAMVAAIGTLMVDSFATSYFS--------------GRSGEKVTAGHEAGDAEVGpgv  708
              GF+AM +A+ TLM+DSFATSY+                R G++ +A   AG   V    
Sbjct  162   AGFIAMSSAMVTLMIDSFATSYYERSHFSKARPVEEKDERKGDEESARDHAGHVHVHTHA  221

Query  709   vpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKT  888
                H H +   A      + +D     +RHRVISQVLELGI+VHSVIIGI+LGAS+T  T
Sbjct  222   THGHAHGSAAAAGSPEEASLSDK----IRHRVISQVLELGILVHSVIIGISLGASETSST  277

Query  889   IKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDE  1068
             I+PLVAAL+FHQFFEG+GLGGCI QAKF++++  IMA+FFSLT P+GI +GI I++ YDE
Sbjct  278   IRPLVAALSFHQFFEGIGLGGCIVQAKFRAKATVIMAVFFSLTAPIGISLGIAISSSYDE  337

Query  1069  DSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglms  1248
              S   LII+GIFN+ASAGILIYM+LVDLLAADF +PRM  N +LQFGA+ +LLLGAGLMS
Sbjct  338   TSSTALIIQGIFNAASAGILIYMSLVDLLAADFKNPRMQSNGRLQFGAHLALLLGAGLMS  397

Query  1249  mlaKWA  1266
             +LA+WA
Sbjct  398   LLARWA  403



>emb|CBI34138.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 180/292 (62%), Positives = 210/292 (72%), Gaps = 52/292 (18%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G++IPAL PE + FF++KAFAAGVILATGFIHVLPDAFE+LTS  LS++PW +FPF
Sbjct  101   IPIIGKKIPALQPEKNVFFVIKAFAAGVILATGFIHVLPDAFESLTSPCLSENPWANFPF  160

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AIGTLMV                                             
Sbjct  161   TGFVAMLSAIGTLMV---------------------------------------------  175

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                    D  S L+RHRVISQVLELGI+ HSVIIGI+LGAS++P+TIKPLVAALTFHQFF
Sbjct  176   -------DMGSDLIRHRVISQVLELGIVAHSVIIGISLGASESPQTIKPLVAALTFHQFF  228

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLG CI QAKFKS++  IM LFFSLTTP+GI IGIGI+  YDE+S   LIIEGIFN+
Sbjct  229   EGMGLGSCIVQAKFKSRAATIMGLFFSLTTPVGIGIGIGISQVYDENSSTALIIEGIFNA  288

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYMALVDLLAADFMSP+M  N  L+  AN SLLLGAG MS++AKWA
Sbjct  289   ASAGILIYMALVDLLAADFMSPKMQTNEMLKVMANISLLLGAGCMSLIAKWA  340



>ref|XP_007212363.1| hypothetical protein PRUPE_ppa014732mg [Prunus persica]
 gb|EMJ13562.1| hypothetical protein PRUPE_ppa014732mg [Prunus persica]
Length=353

 Score =   309 bits (791),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 215/293 (73%), Gaps = 10/293 (3%)
 Frame = +1

Query  391   LPVVGRRIPA-LSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFP  567
             LP + + I + L P+  F+ ++KAFAAGVILATGF+HVLPDA E+LTS  LSK+PW  FP
Sbjct  66    LPFLLKNISSILHPDKDFYLLIKAFAAGVILATGFVHVLPDAHESLTSPCLSKNPWGRFP  125

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             F GFVAMV+AIGTLM+++ AT Y   +  E   +    GD E   G              
Sbjct  126   FTGFVAMVSAIGTLMMEAIATGYH--KRSELKKSQPVDGDEESDHGAHHAGHVHGSAL--  181

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
                 V ++ +SS+L+RHR+ISQVLELGI+VHSVIIGI+LGA  +P TIKPLVAAL+FHQF
Sbjct  182   ----VLESSNSSELIRHRIISQVLELGIVVHSVIIGISLGACQSPHTIKPLVAALSFHQF  237

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCI QAKFK +++A M LFFSLTTP GI +GI I+N Y + SP  LI++G+  
Sbjct  238   FEGMGLGGCIYQAKFKHKTMATMVLFFSLTTPAGIAVGIAISNTYTKSSPTALIVQGLLL  297

Query  1108  SASAGILIYMALVDLLAADFM-SPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             SASAGILIYMALVDLLAADF+ + +M  NPKLQ GAN +LLLGA  MS++AKW
Sbjct  298   SASAGILIYMALVDLLAADFINNAKMLGNPKLQLGANFTLLLGACFMSLMAKW  350



>dbj|BAK07315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=375

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 215/316 (68%), Gaps = 25/316 (8%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL-SKHPWRDFP  567
             LPV+GRR+PAL P+G  FF+VKAFAAGVILATGFIH+LPDAFENLTSD L +  PW+DFP
Sbjct  61    LPVLGRRVPALRPDGDVFFLVKAFAAGVILATGFIHILPDAFENLTSDCLPAAGPWKDFP  120

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGp---------------  702
             F G  AMV AIGTL+VD+ AT YF+ R+       H +  A V                 
Sbjct  121   FAGLGAMVGAIGTLVVDTVATGYFT-RAHLNKDRAHGSSAAVVDEEKQAAAAAAATAASE  179

Query  703   --------gvvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGI  858
                               HG A    +V   +     +RHRVISQVLELGI+VHSVIIGI
Sbjct  180   EAHEGHVHLHTHATHGHAHGSAALVAAVGGAEDEKDTIRHRVISQVLELGIVVHSVIIGI  239

Query  859   ALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVI  1038
             +LGAS  P+TIKPLV AL+FHQ FEGMGLGGCI QAKFK++S+  M LFF LTTP+GI I
Sbjct  240   SLGASQDPETIKPLVVALSFHQMFEGMGLGGCIVQAKFKARSIVTMILFFCLTTPVGIAI  299

Query  1039  GIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANT  1218
             G GI+  Y E+SP  L++EG  NS +AGIL+YMALVDLLA DFM+P +    KLQ G N 
Sbjct  300   GFGISRVYHENSPTALVVEGSLNSVAAGILVYMALVDLLAEDFMNPMVQSRGKLQLGINV  359

Query  1219  slllgaglmsmlaKWA  1266
             S+L+GAGLMSMLAKWA
Sbjct  360   SMLVGAGLMSMLAKWA  375



>ref|XP_008812441.1| PREDICTED: zinc transporter 3-like [Phoenix dactylifera]
Length=417

 Score =   311 bits (796),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 167/300 (56%), Positives = 216/300 (72%), Gaps = 8/300 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++GR + AL PE   FF++KAFAAGVILATG IH+LP AFE+LTS  L + PW  FP 
Sbjct  118   IPILGRSVAALRPENDVFFVIKAFAAGVILATGLIHILPAAFESLTSPCLKEDPWHHFPV  177

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA--------GHEAGDAEVGpgvvpvhth  726
              GFVAM++AIGT++VDSFATSY+      K           G E   A++   V      
Sbjct  178   AGFVAMLSAIGTMVVDSFATSYYRRSHISKARPVEEDEGRNGDEEYSADLAEHVHVHTHA  237

Query  727   athghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVA  906
                          +  S ++ +RHR+ISQVLELGI+VHS+IIGI+LGAS+ P TI+PL+ 
Sbjct  238   THGHAHGSVPVSPEEASLAERIRHRIISQVLELGIVVHSLIIGISLGASERPSTIRPLLG  297

Query  907   ALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVL  1086
             AL+FHQFFEG+GLGGCI QA F++++  +MA+FFSLT P+GI +GI I++ Y+E+S   L
Sbjct  298   ALSFHQFFEGIGLGGCIVQANFRAKATVVMAVFFSLTAPIGISLGIAISSSYEENSSIAL  357

Query  1087  IIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             I+EGIFNSASAGILIYMALVDLLAADF +P+M  N +LQ G + +LLLGAGLMS++AKWA
Sbjct  358   IVEGIFNSASAGILIYMALVDLLAADFTNPKMQNNGRLQLGTHLALLLGAGLMSIIAKWA  417



>gb|EMT15077.1| Zinc transporter 1 [Aegilops tauschii]
Length=462

 Score =   311 bits (798),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 159/274 (58%), Positives = 204/274 (74%), Gaps = 10/274 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P +GR+ PALSP+   FF++KAFAAG ILAT F+H+LP+AFE L S  L   PW+ FPF
Sbjct  62    IPSLGRKFPALSPDKDLFFVIKAFAAGGILATAFVHILPEAFERLGSPCLVDGPWQKFPF  121

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA--GH-EAGDAEVGpgvvpvhthathgh  741
              GFVAM+AAI TL+VD+ AT YF     +  +A  G+ EA D+E                
Sbjct  122   AGFVAMLAAIATLIVDTIATGYFQRAHAKNTSAAVGYVEASDSE-------QAHGGHSHG  174

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                 ++ + +D  +QL+RHRVISQVLELGIIVHSVIIG++LGAS+   TIKPLV ALTFH
Sbjct  175   VSAVIASSFSDDGAQLIRHRVISQVLELGIIVHSVIIGMSLGASENASTIKPLVVALTFH  234

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI QA+F+ +SV +MALFFSLT P+G+VIGIGI++ YDE+SP+ LI+EG+
Sbjct  235   QFFEGIGLGGCIVQARFRLKSVLMMALFFSLTLPVGVVIGIGISSAYDENSPRALIVEGL  294

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQ  1203
              ++A+AGIL YMALVDLLA DFM+PR+  N +LQ
Sbjct  295   LSAAAAGILNYMALVDLLAEDFMNPRVQNNGRLQ  328



>ref|XP_006468555.1| PREDICTED: zinc transporter 5-like [Citrus sinensis]
Length=357

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 200/277 (72%), Gaps = 8/277 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP + +++  LSP+   FF++KAFAAGVILATGFIH+LPDAFE+LTS  L ++PW  FPF
Sbjct  68    LPFLVKKVSYLSPDKDVFFLIKAFAAGVILATGFIHILPDAFESLTSPCLCENPWHKFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA--GHEAGDAEVGpgvvpvhthathgha  744
              GF+AM+++IGTLM++++AT Y       K     G E  D +     V           
Sbjct  128   AGFIAMMSSIGTLMMEAYATGYHKRTELRKAQPFDGDEESDHDHDQQGVHAGHVHGSSF-  186

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                  V +  +SS L+R+R+ISQ+LELGI++HSVIIGI+LGAS+   TIKPLVAAL+FHQ
Sbjct  187   -----VPEPTNSSDLIRNRIISQILELGIVIHSVIIGISLGASERASTIKPLVAALSFHQ  241

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEG GLGGCI+QAKF   +++IM LFFSL TP GI +GIGI+  YD+ SP  LI++G+ 
Sbjct  242   FFEGTGLGGCISQAKFNYTAISIMVLFFSLITPAGIAVGIGISKIYDQSSPTALIVQGLL  301

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             NSASAGIL YMALVDLLAADFM+P+M  N +LQ GAN
Sbjct  302   NSASAGILTYMALVDLLAADFMNPKMLSNIRLQIGAN  338



>emb|CDP03484.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/293 (57%), Positives = 214/293 (73%), Gaps = 2/293 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+ G++IP+L+P+ +FFF++KAF AG+ILATGFIH+LPDAF++LTS  +  +PW +FPF
Sbjct  50    LPIWGKKIPSLNPKSNFFFIIKAFTAGIILATGFIHILPDAFDSLTSPCIPINPWGNFPF  109

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSG-EKVTAGHEAGDAEVGpgvvpvhthathghah  747
              GFVAMVAAI TLMVD +A SY+  + G E   A   AGD   G   +           H
Sbjct  110   TGFVAMVAAICTLMVDVYANSYYKKKYGNENFQATVGAGDRNNGESNLSGVLPLHTHAIH  169

Query  748   ghvSVT-DTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
             GH   + + D+ S  LR+RVISQVLE GII+H+  I IALGAS + KTI+PL+ A TF+ 
Sbjct  170   GHGHASMEGDTISTELRYRVISQVLEFGIIMHTRFIAIALGASGSLKTIRPLLVAFTFYL  229

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEG+GLGGCI Q KF  +++AIM++FFSLTTP+GI IGIGI N Y  +SP  +I+EGIF
Sbjct  230   FFEGIGLGGCITQGKFNVRAIAIMSVFFSLTTPVGIAIGIGIANVYKHNSPIAIIVEGIF  289

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             +SASAG+LIYMALVDLL+AD M+P+M  N KL  GAN S L GA  M +LAKW
Sbjct  290   DSASAGVLIYMALVDLLSADLMNPKMQSNSKLLLGANVSFLFGASCMCLLAKW  342



>dbj|BAJ90473.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   309 bits (791),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 212/322 (66%), Gaps = 31/322 (10%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL--SKHPWRDF  564
             LPV+GRR+PAL PEG  FF+VKAFAAGVILATGFIH+LPDAFE LTS  L  S  PW DF
Sbjct  62    LPVLGRRVPALRPEGDVFFLVKAFAAGVILATGFIHILPDAFEKLTSPCLLPSDGPWHDF  121

Query  565   PFCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA-------------------------  669
             PF G  AMV AIGTL+VD+ AT YF+     K  A                         
Sbjct  122   PFAGLGAMVGAIGTLVVDTVATGYFTRAQLNKDGAHGHGAITSSAAVVDEEKQAAAAASE  181

Query  670   ---GHEAGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVH  840
                 HE G+ EV       H HA    A         D    + RHRVISQVLELGI+VH
Sbjct  182   EARRHEGGEQEVHVHTHATHGHAHGSAALVAAVGGAEDEKDTI-RHRVISQVLELGIVVH  240

Query  841   SVIIGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTT  1020
             SVIIGI+LGAS  P TIKPLV AL+FHQ F GMGLGGCI QAKF+++S+  M LFF LTT
Sbjct  241   SVIIGISLGASQNPDTIKPLVVALSFHQMFGGMGLGGCIVQAKFRARSIVTMILFFCLTT  300

Query  1021  PLGIVIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKL  1200
             P+GI +G GI+  Y+E SP  L++EG  NS +AGILIYMALVDLLA DFM+P++    KL
Sbjct  301   PVGIAVGFGISRVYNEYSPTALVVEGSLNSVAAGILIYMALVDLLAEDFMNPKVQSRGKL  360

Query  1201  QFGANTslllgaglmsmlaKWA  1266
             Q G N S+L+GAGLMSMLAKWA
Sbjct  361   QLGINISMLVGAGLMSMLAKWA  382



>ref|XP_008225896.1| PREDICTED: zinc transporter 5-like [Prunus mume]
Length=353

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 214/293 (73%), Gaps = 10/293 (3%)
 Frame = +1

Query  391   LPVVGRRIPA-LSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFP  567
             LP + + I + L P+  F+ ++KAFAAGVILATGF+HVLPDA E+LTS  LSK+PW  FP
Sbjct  66    LPFLVKNISSILHPDKDFYLLIKAFAAGVILATGFVHVLPDAHESLTSPCLSKNPWGRFP  125

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             F GFVAMV+AIGTLM+++ AT Y   +  E   +    GD E   G              
Sbjct  126   FTGFVAMVSAIGTLMMEAIATGYH--KRSELRKSQPVDGDEESDHGAHHAGHVHGSAL--  181

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
                 V +  +SS+L+RHR+ISQVLELGI+VHSVIIGI+LGA  +P TIKPLVAAL+FHQF
Sbjct  182   ----VLEPSNSSELIRHRIISQVLELGIVVHSVIIGISLGACQSPHTIKPLVAALSFHQF  237

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCI QAKFK +++A M LFFSLTTP GI +GI I+N Y + SP  LI++G+  
Sbjct  238   FEGMGLGGCIYQAKFKHKTMATMVLFFSLTTPAGIAVGIAISNTYTKSSPTALIVQGLLL  297

Query  1108  SASAGILIYMALVDLLAADFM-SPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             SASAGILIYMALVDLLAADF+ + +M  NPKLQ GAN +LLLGA  MS++AKW
Sbjct  298   SASAGILIYMALVDLLAADFINNAKMLGNPKLQLGANFTLLLGACFMSLMAKW  350



>gb|ACN38063.1| zinc transporter protein [Sedum alfredii]
Length=368

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 165/274 (60%), Positives = 200/274 (73%), Gaps = 1/274 (0%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             PV   +IP LSPE + FFM+KAFAAGVIL+TGFIHVLP+AF+ L S  LS+ PW  FPF 
Sbjct  79    PVFSHKIPQLSPETNVFFMIKAFAAGVILSTGFIHVLPEAFKRLMSPCLSETPWDKFPFT  138

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             GFVAMVA + TLM+D+FAT +++ R     T     G  E   G      H    H H H
Sbjct  139   GFVAMVATMLTLMIDAFATPFYT-RKSNATTKLQVVGVDEEEQGSHMQQAHTHTAHGHSH  197

Query  754   vSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFE  933
              S      +S LLR RVISQVLELGI+VHSVIIG++LGAS+   TIKPL+AALTFHQFFE
Sbjct  198   GSADQGTGASDLLRQRVISQVLELGIVVHSVIIGVSLGASNDLATIKPLLAALTFHQFFE  257

Query  934   GMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSA  1113
             G+GLGGCIAQAKFK++++A M LFFSLT P+GI IGIG+++ Y E+S K LI+ G+F++A
Sbjct  258   GLGLGGCIAQAKFKARTIATMVLFFSLTAPIGIAIGIGVSSTYKENSSKELILPGLFDAA  317

Query  1114  SAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             SAGILIY ALVDLLAADFM  R+  N  LQ GA+
Sbjct  318   SAGILIYTALVDLLAADFMGQRLQSNGMLQIGAS  351



>ref|NP_001236499.1| zinc transporter protein ZIP1 precursor [Glycine max]
 gb|AAK37761.1| zinc transporter protein ZIP1 [Glycine max]
Length=354

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 190/294 (65%), Positives = 223/294 (76%), Gaps = 6/294 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ I ALSPE   FF++KAFAAGVIL+TGFIHVLPDAFENLTS  L +HPW +FPF
Sbjct  65    IPLLGKVISALSPEKDTFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLKEHPWGEFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAE--VGpgvvpvhthathgha  744
              GFVAM  A+GTLMVD++AT+YF      +     EA D E   G               
Sbjct  125   TGFVAMCTAMGTLMVDTYATAYFKKHHHSQ----DEATDVEKESGHEGHVHLHTHATHGH  180

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                   TD D SS+LLRHRVISQVLE+GIIVHS+IIGI+LGAS++PKTI+PL+AAL FHQ
Sbjct  181   AHGHVPTDDDQSSELLRHRVISQVLEVGIIVHSIIIGISLGASESPKTIRPLMAALIFHQ  240

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLG CI QA FK  S+ +M L F+LTTP+GI IGIGIT  YDE+SP  LI+EGIF
Sbjct  241   FFEGMGLGSCITQANFKKLSITLMGLVFALTTPMGIGIGIGITKVYDENSPTALIVEGIF  300

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+ASAGILIYMALVDLLAADFM+PRM K+  L+ GAN SLLLGAG MS+LAKWA
Sbjct  301   NAASAGILIYMALVDLLAADFMNPRMQKSGSLRLGANLSLLLGAGCMSLLAKWA  354



>ref|XP_010922621.1| PREDICTED: zinc transporter 8-like [Elaeis guineensis]
Length=350

 Score =   306 bits (783),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 164/292 (56%), Positives = 214/292 (73%), Gaps = 2/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++G+ +P+LS E   FF++KAFAAGVILAT FIH+LP++FE LTS  L +HPW++FPF
Sbjct  61    IPILGKWVPSLSAEKDTFFVIKAFAAGVILATAFIHILPESFERLTSPCLDEHPWQEFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AMV+AI TLMVD+ ATSYF GRS  +       GDAE G                 
Sbjct  121   AGFIAMVSAIATLMVDTVATSYF-GRSSIRKAERPGMGDAEQGGAPHVHVHAMHGHGHGP  179

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                V D     ++ RHRVISQVLELGI+VHSVIIG+ LG S++P +I+ L+ AL FHQFF
Sbjct  180   VALVVD-GGRDEISRHRVISQVLELGIVVHSVIIGVTLGTSESPSSIRSLLVALCFHQFF  238

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGC+ QA F+ +S+  M LFF+LTTPLGI +GIGI++ Y+E+SP  L +EG+ +S
Sbjct  239   EGIGLGGCVVQANFRVRSMVTMMLFFALTTPLGIAVGIGISSTYNENSPTALTVEGVLDS  298

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             A+AGIL+YM+LVDLLA DF +PR+  N +LQ   + SLL+GAGLMS+LAKWA
Sbjct  299   AAAGILVYMSLVDLLAEDFKNPRVQSNWRLQLVLSASLLVGAGLMSLLAKWA  350



>ref|XP_010693319.1| PREDICTED: zinc transporter 1-like [Beta vulgaris subsp. vulgaris]
Length=368

 Score =   306 bits (784),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 173/292 (59%), Positives = 210/292 (72%), Gaps = 17/292 (6%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+R+  L PE   FFMVKAFAAGVILATGFIH+LP AFE LTS  + + PW++FPF
Sbjct  60    LPMLGKRVSILRPENDIFFMVKAFAAGVILATGFIHILPGAFEGLTSPCIDETPWQNFPF  119

Query  571   CGFVAMVAAIGTLMVDSFATSYF----------SGRSGEKVTAGHEAGDAEVGpgvvpvh  720
               F+AMVA+IG+LMVDS AT ++          + + G       E  D   G   V  H
Sbjct  120   AAFIAMVASIGSLMVDSLATGHYRKVHFGGNNNNSKEGSNKVVDEERNDEHAGHVHVHTH  179

Query  721   thathghahghvS-VTDTD------SSSQLLRHRVISQVLELGIIVHSVIIGIALGASDT  879
                 H H HG  S VT++       S  +L+RHRV +QVLELGI+VHSVIIGI+LG S+ 
Sbjct  180   ATHGHAHGHGGGSFVTESGEFGEELSKLELIRHRVTAQVLELGIVVHSVIIGISLGTSER  239

Query  880   PKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNR  1059
               TIKPL+AAL FHQFFEGMGLGGCI QAKFKS+S+A MALFFSLTTP+GI IGI I   
Sbjct  240   LDTIKPLMAALCFHQFFEGMGLGGCITQAKFKSRSMATMALFFSLTTPIGIAIGIAIAGV  299

Query  1060  YDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             YDE SP+ LII+GIF +A+AGILIYMALVDLLAADFM+PRM  N ++QFG++
Sbjct  300   YDEKSPRSLIIQGIFEAAAAGILIYMALVDLLAADFMNPRMQANTRIQFGSH  351



>gb|AAC17441.1| root iron transporter protein [Pisum sativum]
Length=348

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 212/294 (72%), Gaps = 11/294 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+V R +PALSP+G+ F +VK FAAG+IL TGF+HVLPD+F+ L SD L + PW +FPF
Sbjct  64    LPLVSRSVPALSPDGNLFVIVKCFAAGIILGTGFMHVLPDSFDMLWSDCLQEKPWHEFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFS--GRSGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
              GF AM++A+ T+MVDS ATSY++  G+ G  + A  E GD E+          A H   
Sbjct  124   SGFAAMISAVVTMMVDSLATSYYTQKGKKGVIIPAEGEVGDQEM---------GAVHAGH  174

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
             H H  V      SQLLR+RVI+ VLELGI+VHS++IG+A+G+S+   +IK LVAAL FHQ
Sbjct  175   HHHYQVKTEGEESQLLRYRVIAMVLELGIVVHSIVIGLAMGSSNNTCSIKGLVAALCFHQ  234

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
              FEGMGLGGCI QA++K    AIM  FFS+TTPLGI IGI +++ Y E+SPK LI  G+ 
Sbjct  235   MFEGMGLGGCILQAEYKFVKKAIMVFFFSITTPLGIAIGIAMSSNYKENSPKALITVGLL  294

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N +SAG+LIYMALVDLLAADFMS RM  + KLQ  +  ++ LGAG MS++AKWA
Sbjct  295   NGSSAGLLIYMALVDLLAADFMSRRMQGSIKLQLKSYVAVFLGAGGMSLMAKWA  348



>ref|XP_009363363.1| PREDICTED: zinc transporter 8-like [Pyrus x bretschneideri]
Length=344

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 207/294 (70%), Gaps = 22/294 (7%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP V + IP   PE  F+ ++KAFAAGVILATGF+HVLPDA ++LTS  LS++PWR FPF
Sbjct  67    LPFVVKNIPFFHPEKDFYLLIKAFAAGVILATGFVHVLPDANDSLTSPCLSENPWRRFPF  126

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA--GHEAGDAEVGpgvvpvhthathgha  744
              GFVAMV+AIGTLM+++ AT Y       K     G E  D  V                
Sbjct  127   TGFVAMVSAIGTLMMEAIATGYQKRSELRKPQPVDGDEENDHAVHFHG------------  174

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                       +SS+L+RHR+ISQVLELGI+VHSVIIGI+LGA  +  TIKPLVAAL+FHQ
Sbjct  175   -------SASNSSELIRHRIISQVLELGILVHSVIIGISLGACQSQHTIKPLVAALSFHQ  227

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI QAKF  +++AIM +FFSLTTP GI +GI I+  Y+E S   LI++G+ 
Sbjct  228   FFEGMGLGGCIYQAKFNHKTMAIMVVFFSLTTPTGIAVGIAISKTYNESSSTALIVQGLL  287

Query  1105  NSASAGILIYMALVDLLAADFM-SPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
              SASAGILIYMALVDLLAADF+ + +M  NPKLQ GA+ +LLLG   MS++AKW
Sbjct  288   LSASAGILIYMALVDLLAADFINNTKMLSNPKLQLGASFTLLLGVCFMSLMAKW  341



>gb|ACN93833.1| metal ion transporter ZIP5 [Hordeum vulgare]
Length=350

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/295 (56%), Positives = 207/295 (70%), Gaps = 10/295 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P +GR+ PALSPE   FF +KAFAAGVILAT F+H+LP+AFE L S  L   PW+ FPF
Sbjct  63    IPTLGRKFPALSPEKDLFFAIKAFAAGVILATAFVHILPEAFERLGSPCLVDGPWQKFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA---GHEAGDAEVGpgvvpvhthathgh  741
              G V M+ AI TL+VD+ AT YF     +  +A     +  D+E                
Sbjct  123   AGLVTMLGAIATLVVDTIATGYFQREHAKNSSAAIGNLDPADSE-------QAHGGHSHG  175

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                 ++ +  D  ++L+RHRVISQVLELGIIVHSVIIG++LGAS+   TI+PLV ALTFH
Sbjct  176   VSAIIASSSCDDGAKLIRHRVISQVLELGIIVHSVIIGMSLGASENAGTIRPLVVALTFH  235

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI QA+F+ +S  +M  FFSLT P+G+VIGIGI + YDE+SP+ LI EG+
Sbjct  236   QFFEGIGLGGCIVQARFRHKSFLMMTFFFSLTLPIGVVIGIGIASTYDENSPRALIAEGL  295

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              ++A+AGILIYMALVDLLA DFM+PR+  N +LQ   N SLL+G  LMSMLA WA
Sbjct  296   LSAAAAGILIYMALVDLLAEDFMNPRVQNNGRLQVIINISLLVGIALMSMLAVWA  350



>gb|EYU27582.1| hypothetical protein MIMGU_mgv1a008839mg [Erythranthe guttata]
Length=360

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 218/296 (74%), Gaps = 4/296 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++GRR   L PE   FFM+KAFAAGVILATGF+H+LPDA+  LTS  LSK PWR+FPF
Sbjct  65    IPLLGRRFQFLRPENDAFFMIKAFAAGVILATGFVHILPDAYRTLTSPCLSKSPWREFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF AMVAAIGTL VD+ AT+++      K    + A D E        H H      HG
Sbjct  125   TGFFAMVAAIGTLAVDTVATAFYKNMHFSKSKPLNYAVDEEDQQPPHDGHVHVHTHATHG  184

Query  751   hvSVTDTDSS----SQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H       S     S L+R R+ISQVLELGI+VHSVIIGI+LGAS +  T+KPL+AAL+F
Sbjct  185   HAHGAVVPSHEINLSDLVRQRIISQVLELGIVVHSVIIGISLGASQSVDTVKPLMAALSF  244

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEGMGLGGCI+QAKFKS +  +M +FFSLTTP+GI +GIGI++ Y E+SP  LI+EG
Sbjct  245   HQFFEGMGLGGCISQAKFKSLTTTVMMIFFSLTTPIGIGVGIGISSVYKENSPIALIVEG  304

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             I NSAS+GILIYM+LVDLLAADF +PRM  N +LQ GA+ SLLLGAG MS++AKWA
Sbjct  305   ILNSASSGILIYMSLVDLLAADFTNPRMQSNVRLQLGAHVSLLLGAGCMSLMAKWA  360



>ref|XP_002445166.1| hypothetical protein SORBIDRAFT_07g005140 [Sorghum bicolor]
 gb|EES14661.1| hypothetical protein SORBIDRAFT_07g005140 [Sorghum bicolor]
Length=363

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 212/301 (70%), Gaps = 9/301 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P +GRR PAL P+   FF VKAFAAGVILAT F+H+LPDAFE L S  L   PW+ FPF
Sbjct  63    IPSLGRRFPALRPDTDLFFAVKAFAAGVILATAFVHILPDAFEKLGSPCLVDGPWQKFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhtha-------  729
              G +AM+AAI TL+VD+ AT YF      K  A    GD E   G               
Sbjct  123   TGLIAMLAAIATLVVDTIATGYFQRAQAAKTAAVVVVGDVETSGGHAHGGHGHGHGHGHT  182

Query  730   --thghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLV  903
                        + ++ D S+QL+RHRVISQVLELGIIVHSVIIG+++GAS++P TI+PLV
Sbjct  183   HGMSSVVAAAATTSNGDDSTQLIRHRVISQVLELGIIVHSVIIGMSVGASESPSTIRPLV  242

Query  904   AALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKV  1083
             AALTFHQFFEG+GLGGCI QAKF+ + V +M LFFS TTP+GIVIGIGI++ YDE+SP  
Sbjct  243   AALTFHQFFEGLGLGGCIVQAKFRLKQVLMMTLFFSFTTPIGIVIGIGISSAYDENSPNA  302

Query  1084  LIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             LIIEG+ ++A+AGIL YMALVDLLA DFM+PR+  N +LQ   N SLL+G  LMSMLA W
Sbjct  303   LIIEGVLDAAAAGILNYMALVDLLAQDFMNPRVQNNGRLQVIINISLLVGTALMSMLAVW  362

Query  1264  A  1266
             A
Sbjct  363   A  363



>ref|XP_011035492.1| PREDICTED: zinc transporter 1-like [Populus euphratica]
Length=353

 Score =   301 bits (770),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 165/277 (60%), Positives = 197/277 (71%), Gaps = 10/277 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP   + +  L P+   FF++KAFAAGVIL TGFIH+LPDAFE+LTS  L +HPW  FPF
Sbjct  64    LPFFVKNLSYLHPDREAFFLIKAFAAGVILGTGFIHILPDAFESLTSPCLGQHPWEKFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSY---FSGRSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GFVAM++AIGTLM++SFAT Y      R  + V+  HE    +           A   H
Sbjct  124   AGFVAMLSAIGTLMMESFATGYHKRLELRKPQPVSGDHEENSDQ-------DDNGAGGVH  176

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
               G   V    +SS L RHR++SQVLELGI+VHSVIIG++LGAS + KTIKPLVAAL+FH
Sbjct  177   IRGPAFVLKRINSSDLNRHRIVSQVLELGILVHSVIIGLSLGASKSSKTIKPLVAALSFH  236

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI+QAKFK Q+  IM LFFSLTTP GI IGI I+  Y+E SP  LII+GI
Sbjct  237   QFFEGVGLGGCISQAKFKLQAKVIMILFFSLTTPTGIAIGIWISTSYNEASPMALIIQGI  296

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGA  1212
              NSASAGILIYMALVDLLAADF++  M  +  LQ GA
Sbjct  297   LNSASAGILIYMALVDLLAADFINSNMLYSFWLQLGA  333



>ref|XP_003568257.1| PREDICTED: zinc transporter 9-like [Brachypodium distachyon]
Length=369

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 212/302 (70%), Gaps = 10/302 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKH-PWRDFP  567
             +P +GRR PAL P+ + FF VKAFAAGVILAT F+H+LP+AF+ L S  L  H PWR FP
Sbjct  68    IPSLGRRFPALGPDTNLFFAVKAFAAGVILATAFVHILPEAFDRLGSPCLEGHGPWRKFP  127

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpv---------h  720
             F G VAM+AAI TL+VD+ AT YF    G K  A    GD   G G              
Sbjct  128   FAGLVAMLAAIATLVVDTVATGYFQRAHGAKKLAPAVDGDDVEGSGSAADHRSHVHGHGA  187

Query  721   thathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPL  900
             + A    +    +       ++L+RHR+ISQVLELGI+VHSVIIG++LGAS    TI+PL
Sbjct  188   SSAAVIASSSSAASHSHVDGAELIRHRIISQVLELGIVVHSVIIGMSLGASQNADTIRPL  247

Query  901   VAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPK  1080
             V ALTFHQFFEG+GLGGCI QAKF+ +SV  MALFFSLTTP+G+VIGIGI++ Y+E SP+
Sbjct  248   VIALTFHQFFEGIGLGGCIVQAKFRLRSVLAMALFFSLTTPVGVVIGIGISSGYNETSPR  307

Query  1081  VLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaK  1260
              L+++G+ ++A+AGIL YMALVDLLA DFM+PR+  N +LQ   N SLLLG  LMSMLA 
Sbjct  308   ALVVQGLLSAAAAGILNYMALVDLLAEDFMNPRVQNNGRLQVVVNISLLLGTALMSMLAI  367

Query  1261  WA  1266
             WA
Sbjct  368   WA  369



>gb|KCW47601.1| hypothetical protein EUGRSUZ_K01345 [Eucalyptus grandis]
Length=293

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 186/253 (74%), Gaps = 3/253 (1%)
 Frame = +1

Query  457   AFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFCGFVAMVAAIGTLMVDSFATSY  636
             AFAAGVIL T F+ VLPDAFE+LTS  LS+ PW DFPF GFVAMVAA+GTLMVD+ ATSY
Sbjct  21    AFAAGVILCTAFMDVLPDAFESLTSPCLSETPWGDFPFTGFVAMVAALGTLMVDTLATSY  80

Query  637   FSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLRHRVISQV  816
             +     +K       G  E             H       +   T+S S LL+HRVIS  
Sbjct  81    YKKSHIDKARPDKNVGGEEKARENQGHVHLHAHASHGHSHTSMLTESDSDLLQHRVIS--  138

Query  817   LELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIM  996
              ELGI+VHSVIIGI+ GAS++PKTI+PLVAALT HQFFEGMGLGGCIA AKF++++ AIM
Sbjct  139   -ELGIVVHSVIIGISSGASESPKTIRPLVAALTLHQFFEGMGLGGCIALAKFETRATAIM  197

Query  997   ALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSP  1176
             ALFFSLTTP+GI IG+G+++ YDE S K LI+EGIFN+ASAGILIYMALV LLAADFMSP
Sbjct  198   ALFFSLTTPVGIAIGLGVSSVYDESSLKALIVEGIFNAASAGILIYMALVGLLAADFMSP  257

Query  1177  RMHKNPKLQFGAN  1215
             ++  N +L F  N
Sbjct  258   KLQNNGRLLFWTN  270



>gb|EMS45894.1| Zinc transporter 5 [Triticum urartu]
Length=312

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 203/293 (69%), Gaps = 42/293 (14%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL-SKHPWRDFP  567
             LPV+GR +PAL P+G  FF+VKAFAAGVILATGFIH+LPDAFENLTSD L +  PW+DFP
Sbjct  61    LPVLGRHVPALRPDGDVFFLVKAFAAGVILATGFIHILPDAFENLTSDCLPAAGPWKDFP  120

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             F G  AMV AIGTL+VD+ AT YF        T  H   D   G                
Sbjct  121   FAGLGAMVGAIGTLVVDTLATGYF--------TRAHLNKDRAHG----------------  156

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
                      SS+ +        VLELGI+VHSVIIGI+LGAS  P+TIKPLV AL+FHQ 
Sbjct  157   ---------SSAAV--------VLELGIVVHSVIIGISLGASQDPETIKPLVVALSFHQM  199

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCI QAKFK++S+  M LFF LTTP+GI +G GI+  Y+E+SP  L++EG  N
Sbjct  200   FEGMGLGGCIVQAKFKARSIVTMILFFCLTTPVGIAVGFGISRVYNENSPTALVVEGSLN  259

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             S +AGIL+YMALVDLLA DFM+P++    KLQ G N S+L+GAGLMSMLAKWA
Sbjct  260   SVAAGILVYMALVDLLAEDFMNPKVQSRGKLQLGINVSMLVGAGLMSMLAKWA  312



>ref|XP_008371976.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 1-like [Malus 
domestica]
Length=355

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 211/294 (72%), Gaps = 6/294 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             L  +G++IP L P    FF++KAFAAGVI A GF+H+LPDAF+NLTS  + + PW  FP+
Sbjct  66    LNWLGKKIPTLMPXNDIFFLIKAFAAGVIJAIGFVHILPDAFDNLTSPCIKEXPWGKFPY  125

Query  571   CGFVAMVAAIGTLMVDSFATSYF--SGRSGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
              GFV M++A GTLMVDS AT Y+  S     +VT  HE    E G      H H      
Sbjct  126   XGFVTMLSATGTLMVDSLATGYYQRSKVKSNQVTI-HEL---ESGDDDHAGHVHGXTHST  181

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
              GH   ++   SS+L+R RVI  VLELGI+VHSVIIG +LGAS + +TIKPL+ AL+FHQ
Sbjct  182   QGHAHGSEELKSSELIRQRVIXXVLELGILVHSVIIGXSLGASPSXETIKPLMVALSFHQ  241

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI++A+FKS+S AIMA FFSLTTP+GI +G+GI+  Y+ +SP  LI EG  
Sbjct  242   FFEGMGLGGCISKAQFKSRSAAIMATFFSLTTPVGIAVGVGISTVYNXNSPTALIXEGTS  301

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+A+ GILIYMALVDLLAADFM+PRM  N K+Q GA +SLLLG G MS+L  WA
Sbjct  302   NAAAGGILIYMALVDLLAADFMNPRMQGNLKIQLGAYSSLLLGTGCMSLLXXWA  355



>gb|EMS55273.1| Zinc transporter 8 [Triticum urartu]
Length=459

 Score =   302 bits (774),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 203/331 (61%), Gaps = 56/331 (17%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKL-SKHPWRDFP  567
             LPV+GRR+PAL PEG  FF+VKAFAAGVILATGFIH+LPDAFENLTSD L S  PW+DFP
Sbjct  61    LPVLGRRVPALRPEGDVFFLVKAFAAGVILATGFIHILPDAFENLTSDCLPSDGPWKDFP  120

Query  568   FCGFVAMVAAIGTLMVDSFATSYFS-------GRSGEKVTAG------------------  672
             F G  AMV AIGTL+VD+ AT YF+       G  G    +                   
Sbjct  121   FAGLGAMVGAIGTLVVDTVATGYFTRAHLNKDGAHGHGAVSSSAAVVDEEKQAAAAASEE  180

Query  673   ---HEAGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHS  843
                HE G+ EV       H HA    A         D    + RHRVISQVLELGI+VHS
Sbjct  181   ARRHEGGEHEVHVHTHATHGHAHGSAALVAAVGGAEDEKDTI-RHRVISQVLELGIVVHS  239

Query  844   VIIGIALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQ--------------------  963
             VIIGI+LGAS  P+TIKPLV AL+FHQ FEGMGLGGCI Q                    
Sbjct  240   VIIGISLGASQDPETIKPLVVALSFHQMFEGMGLGGCIVQKNKTIEVFPCMYEHFKGWLY  299

Query  964   ------AKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSASAGI  1125
                   AKFK++S+  M LFF LTTP+GI +G GI+  Y+E+SP  L++EG  NS +AGI
Sbjct  300   MPNWNFAKFKARSIVTMILFFCLTTPVGIAVGYGISRVYNENSPTALVVEGGLNSVAAGI  359

Query  1126  LIYMALVDLLAADFMSPRMHKNPKLQFGANT  1218
             L+YMALVDLLA DFM+P++    KLQ G N 
Sbjct  360   LVYMALVDLLAEDFMNPKVQSRGKLQLGINV  390



>gb|KHG04713.1| Zinc transporter 1 -like protein [Gossypium arboreum]
Length=353

 Score =   298 bits (764),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 198/265 (75%), Gaps = 3/265 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ ++IP   P+ + FF++KAFA GVILAT F+H+LPDA+++LTS  LS+ PW  FPF
Sbjct  65    LPIMVKKIPTFGPQNNIFFLIKAFAGGVILATAFVHILPDAYQSLTSPCLSEKPWGVFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AMV+AI T+M+D+FATS++     +K  A    GD E+           TH     
Sbjct  125   TGFLAMVSAILTMMMDTFATSFYKSSHFDK--ALQVNGDEEMLGEHEGHVHVHTHPTHGH  182

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                 T++ S   ++  R+ISQVLE+GI+VHSVIIG+ALGAS + KTIKPLVAAL FHQFF
Sbjct  183   AHGSTES-SHHLMITQRIISQVLEVGIVVHSVIIGVALGASQSAKTIKPLVAALIFHQFF  241

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI+QAKFKS+++A+M + FSLTTP+GI +G+GI+  Y+E+SPK L++EGIFNS
Sbjct  242   EGMGLGGCISQAKFKSRAIAMMLVIFSLTTPMGIALGMGISKIYNENSPKALVVEGIFNS  301

Query  1111  ASAGILIYMALVDLLAADFMSPRMH  1185
              SAGILIYM+LVDLL  DFM+P M 
Sbjct  302   LSAGILIYMSLVDLLGVDFMNPLMQ  326



>ref|XP_009363337.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 1-like, partial 
[Pyrus x bretschneideri]
Length=335

 Score =   297 bits (760),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 172/298 (58%), Positives = 214/298 (72%), Gaps = 13/298 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IP L+PE   FF+ K FAAGVILA GF+H+LPDAF+NLTS  + ++PW  FPF
Sbjct  45    LPLLGKKIPTLTPEKDIFFLNKVFAAGVILAIGFVHILPDAFDNLTSPCIKENPWGKFPF  104

Query  571   CGFVAMVAAIGTLMVDSFATSYF--SGRSGEKVTAGHE---AGDAEVGpgvvpvhthath  735
              GFV M++A GTLMVDS A  Y+  S     +VT  HE   + D   G      H+   H
Sbjct  105   TGFVTMLSATGTLMVDSLAPGYYQRSNVKSNQVTI-HELESSDDDHAGHVHGHTHSTQGH  163

Query  736   ghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALT  915
              H       ++   S +L+RHRV SQVLELGI+VHSVIIGI+LGAS +P+TIKPL+ AL+
Sbjct  164   AHG------SEELKSPELIRHRVFSQVLELGILVHSVIIGISLGASPSPETIKPLIVALS  217

Query  916   FHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIE  1095
             FHQFFEGMGLGGCI+ AKFKS+S  +MA FFSLTTP GI +G+ I+  Y+ +S   LI+ 
Sbjct  218   FHQFFEGMGLGGCISMAKFKSRSAMVMATFFSLTTPAGIAVGVRISTVYNVNSRTALIVX  277

Query  1096  GIFNSASAGILIYMALVDLLAADFMSPR-MHKNPKLQFGANTslllgaglmsmlaKWA  1266
                N+AS GILIYMALVDLLAADFM+PR M  N K+Q GA +SLLLG G MS+LAKWA
Sbjct  278   RTLNAASGGILIYMALVDLLAADFMNPRIMQGNLKIQLGAYSSLLLGTGCMSLLAKWA  335



>ref|XP_010691362.1| PREDICTED: zinc transporter 1-like [Beta vulgaris subsp. vulgaris]
Length=356

 Score =   298 bits (762),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 211/296 (71%), Gaps = 5/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+ IPAL PE + FF+VK+FAAGVIL+TGFIH+LPDAFE+LT+  L K PW  FPF
Sbjct  62    LPILGKNIPALHPESNLFFLVKSFAAGVILSTGFIHILPDAFEDLTNPCL-KDPWGSFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFS----GRSGEKVTAGHEAGDAEVGpgvvpvhthathg  738
              G  AMV A+G+LM+D+FAT Y+      +     +   E      G   +  H    H 
Sbjct  121   TGLFAMVGALGSLMIDAFATGYYRRAHYAKPASSASVDEERSAEHAGHVHLHSHGTHGHA  180

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H  G  +  +      L+R+++ SQVLE+GI+VHSVIIG++LG S +  TIKPL+AAL F
Sbjct  181   HGPGPGATPEGLKELDLIRYKITSQVLEMGILVHSVIIGLSLGTSQSLDTIKPLMAALCF  240

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQFFEG+GLGGCI QA FKS S   MALFFSLTTP+G+ +GIGI+N YD+ SP  LI++G
Sbjct  241   HQFFEGVGLGGCIVQAAFKSASTLCMALFFSLTTPVGVAVGIGISNSYDDSSPTALIVQG  300

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             + N+ + GILIYMALVDLLA DFMSP++  N +L FGAN +LLLGAG M++LA WA
Sbjct  301   LLNAIAGGILIYMALVDLLAQDFMSPKVQTNTRLFFGANITLLLGAGCMAVLAIWA  356



>ref|XP_002879377.1| hypothetical protein ARALYDRAFT_320968 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55636.1| hypothetical protein ARALYDRAFT_320968 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/292 (58%), Positives = 203/292 (70%), Gaps = 25/292 (9%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+  P+L PE SFFF+ KAFAAGVILATGF+HVLP+A+E L S  L+   W +FPF 
Sbjct  80    PLLGKVFPSLRPETSFFFVTKAFAAGVILATGFMHVLPEAYEMLNSPCLTSEAW-EFPFT  138

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             GF+AM+AAI TL VD+FATS F         A     D E G                  
Sbjct  139   GFIAMIAAILTLSVDTFATSSFYK---SHCNASKRVSDGESGE-----------------  178

Query  754   vSVTDTDSSS-QLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                T  DS   Q+LR R+I+QVLELGIIVHSV+IGI+LGAS +P   K L  AL FHQ F
Sbjct  179   ---TSVDSEKVQVLRTRIIAQVLELGIIVHSVVIGISLGASQSPDAAKALFTALMFHQCF  235

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCIAQ KFK  SV IM+ FF++TTP+GIV+G+GI N YDE SP  LI++G+ N+
Sbjct  236   EGLGLGGCIAQGKFKCLSVTIMSTFFAITTPIGIVVGMGIANSYDESSPTALIVQGVLNA  295

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYM+LVDLLAADFM P+M  N  LQ  A+ +LLLGA LMS+LAKWA
Sbjct  296   ASAGILIYMSLVDLLAADFMHPKMQSNTGLQIMAHIALLLGAALMSLLAKWA  347



>ref|XP_007213568.1| hypothetical protein PRUPE_ppa015743mg, partial [Prunus persica]
 gb|EMJ14767.1| hypothetical protein PRUPE_ppa015743mg, partial [Prunus persica]
Length=265

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 204/294 (69%), Gaps = 45/294 (15%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IP L PE   FFM+KAFAAGVILATGFIH+LPDAF+NLTS  L ++PW +FP 
Sbjct  15    LPLLGKKIPTLRPENDIFFMIKAFAAGVILATGFIHILPDAFDNLTSPCLKENPWGNFPS  74

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKV--TAGHEAGDAEVGpgvvpvhthathgha  744
              G                   +  GR+ + V  T GH    +E                 
Sbjct  75    LG------------------DHVHGRAADHVHATQGHHGHGSE-----------------  99

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                        S +L+RHRVISQVLELGI+VHSVI+GI+LGAS +P+TIKPL+ AL+FHQ
Sbjct  100   --------ELRSPELIRHRVISQVLELGILVHSVIVGISLGASQSPETIKPLMVALSFHQ  151

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FF+GMGLGGCI+QAKFKS+S AIMA  FSLTTP+GI IGIGI+  Y+ + P  LI+E IF
Sbjct  152   FFQGMGLGGCISQAKFKSRSAAIMATIFSLTTPVGIAIGIGISTGYNGNCPTALIVEWIF  211

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+A+AGILIYMALVDLLAADFM+PRM  N ++Q GA  SLLLG+G MS+LAKWA
Sbjct  212   NAAAAGILIYMALVDLLAADFMNPRMQSNMRIQSGAYISLLLGSGCMSLLAKWA  265



>ref|XP_010557015.1| PREDICTED: zinc transporter 5-like [Tarenaya hassleriana]
Length=357

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 171/295 (58%), Positives = 220/295 (75%), Gaps = 5/295 (2%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G   P+L PE +FFF+ +AFAAGVIL+TGF+HVLP+AF+ LTS  LS+HPW +FPF 
Sbjct  64    PLLGNVFPSLRPETTFFFVTRAFAAGVILSTGFLHVLPEAFKMLTSPCLSEHPW-EFPFT  122

Query  574   GFVAMVAAIGTLMVDSFATSYF--SGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             GF+AM+AAI TL VD+FATSYF  S    +++ +  E  +     G+       +HG   
Sbjct  123   GFIAMMAAILTLSVDAFATSYFQKSHFKNQRIGSEGEGKEGGGELGLHVHAHAHSHGGLT  182

Query  748   ghvSVTDT--DSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                S   +  +S +QLLR+RVI+QVLELGIIVHSV+IGI+LGAS  P T K L AAL FH
Sbjct  183   AAESGGGSAGESMTQLLRNRVIAQVLELGIIVHSVVIGISLGASQDPDTAKTLFAALMFH  242

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             Q FEG+GLGGCI Q KFK  ++ IMA+FFS+TTP+GI +G+GI++ YDE SP  LI++G+
Sbjct  243   QCFEGLGLGGCITQGKFKWMTITIMAMFFSVTTPIGIAVGMGISSSYDESSPTALIVQGV  302

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              N+AS+GILIYM+LVDLLAADFM P+M  N  LQ  A+ SLLLGAG+MS+LAKWA
Sbjct  303   LNAASSGILIYMSLVDLLAADFMHPKMQSNSGLQIMAHISLLLGAGVMSLLAKWA  357



>gb|ACN93834.1| metal ion transporter ZIP8 [Hordeum vulgare]
Length=359

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 175/298 (59%), Positives = 211/298 (71%), Gaps = 10/298 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P +GRR PALSP+   FF VKAFAAGVILAT F+H+LP+AFE L S  L   PW+ FPF
Sbjct  66    IPSLGRRFPALSPDRDLFFGVKAFAAGVILATSFVHILPEAFERLGSPCLVDGPWQKFPF  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGH------EAGDAEVGpgvvpvhthat  732
              G VAM+AAI TL+VD+ AT YF   +  K  A        EA  A  G         A 
Sbjct  126   AGLVAMLAAIATLVVDTIATGYFQRAAHAKKAAAVVGADDVEATPAHHGLVGHSHGVSAV  185

Query  733   hghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAAL  912
                +    +    D  +QL+R RVISQVLELGIIVHSVIIG++LGAS +  TI+PLV AL
Sbjct  186   VASS----AAAADDGGAQLIRQRVISQVLELGIIVHSVIIGMSLGASQSASTIRPLVVAL  241

Query  913   TFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLII  1092
             TFHQFFEG+GLGGCI QAKF+ +SV +MALFFSLTTP+G+VIGIGI++ Y+E+SP  LI 
Sbjct  242   TFHQFFEGIGLGGCIVQAKFRLKSVLLMALFFSLTTPVGVVIGIGISSVYNENSPNTLIT  301

Query  1093  EGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +GI ++A+AGIL YMALVDLLA DFM+PR+  N +LQ   N SLLLG  LMSMLA WA
Sbjct  302   QGILSAAAAGILNYMALVDLLAEDFMNPRVQSNGRLQVIVNLSLLLGTALMSMLAVWA  359



>emb|CDP18202.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/294 (54%), Positives = 214/294 (73%), Gaps = 16/294 (5%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++ + + AL PE    F++KAFAAGVILATGFIH+LPDAF +LTS  L ++PW  FPF
Sbjct  61    IPLLLKNVRALQPETGLHFLIKAFAAGVILATGFIHILPDAFASLTSPCLPENPWGGFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AM+AAI TLM+++ AT Y      +K   + A  EA   + G    P         
Sbjct  121   AGFIAMMAAIVTLMMEALATGYHRRAEMQKPQPLDADEEANPTDAGHVHGPAI-------  173

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                   + +  +SS L+R+R++SQVLELGI+ HS +IG+++GA+  PK IK L+AAL+FH
Sbjct  174   ------LLERSNSSSLIRNRIVSQVLELGIVFHSTVIGVSMGATQNPKIIKSLIAALSFH  227

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI+QAKFK++++  M LFFSLTTP GI IGI I+ RY+E SP  L+++G+
Sbjct  228   QFFEGIGLGGCISQAKFKARTITTMVLFFSLTTPAGIAIGILISKRYNEYSPTALVVQGV  287

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
              +SAS+GILIYMALVDLLAADFM+P++  + ++QFGAN SLLLGA  MS++AKW
Sbjct  288   LDSASSGILIYMALVDLLAADFMNPKLQTDFRVQFGANFSLLLGACCMSLMAKW  341



>ref|XP_011096784.1| PREDICTED: fe(2+) transport protein 2 [Sesamum indicum]
Length=354

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/292 (54%), Positives = 212/292 (73%), Gaps = 7/292 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R +PAL P+   F +VKAFA+GVILATG++HVLPD+F+ L SD L ++PW+ FPF
Sbjct  70    LPMFSRAVPALQPDKDLFVLVKAFASGVILATGYMHVLPDSFDCLRSDCLPENPWKKFPF  129

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
               FVAM++A+ TLM+DS+A SY+  R  +        G+A V   +   H H  +     
Sbjct  130   TTFVAMLSAVFTLMLDSYAMSYYRKRDLDSEVKRTSDGNAIVDGKLESQHCHGFNV----  185

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                V   D++SQLLR+RV++QVLELGI+VHSV+IG+++GASD P TI+PLVAAL FHQ F
Sbjct  186   ---VKADDNASQLLRYRVVAQVLELGIVVHSVVIGLSMGASDNPCTIRPLVAALCFHQLF  242

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QA++  +  A+MA FFS TTP GI +GIG++N Y ++SP  LI+ G+ N+
Sbjct  243   EGMGLGGCILQAEYGVRMKAVMAFFFSATTPFGIALGIGLSNVYSDNSPTALIVVGLLNA  302

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              SAG+L YMALVDLLAADFM P++  + +LQ    T++LLGAG M+++AKWA
Sbjct  303   CSAGLLNYMALVDLLAADFMGPKLQNSMRLQTWGYTAVLLGAGGMALMAKWA  354



>ref|XP_010242082.1| PREDICTED: fe(2+) transport protein 1-like [Nelumbo nucifera]
Length=369

 Score =   296 bits (758),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 165/300 (55%), Positives = 212/300 (71%), Gaps = 11/300 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ R +PAL P+ + F +VKAFA+G+ILATGF+HVLPD+F+ L S  L ++PW  FPF
Sbjct  73    LPLLSRSVPALQPDRNLFVIVKAFASGIILATGFMHVLPDSFDMLRSPCLPENPWHKFPF  132

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGH--------EAGDAEVGpgvvpvhth  726
              GFVAM++A+G LMVDS  TS +S RS   V            +  D E+G  +      
Sbjct  133   SGFVAMLSAVGALMVDSITTSIYSRRSSMDVKPAEIEVADDEEDNRDREMGVVISSGVHF  192

Query  727   athghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVA  906
               H HA      T T   SQLLR+RVI+ VLELGIIVHSV+IG++LGASD   TIKPLVA
Sbjct  193   HGHCHAPID---TTTSGDSQLLRYRVIAMVLELGIIVHSVVIGLSLGASDNTCTIKPLVA  249

Query  907   ALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVL  1086
             AL FHQ FEGMGLGGCI QA++K    A+MA FFS+TTP GIV+GI ++  Y E+SP  L
Sbjct  250   ALCFHQMFEGMGLGGCIFQAEYKFLKKALMAFFFSVTTPFGIVLGIALSATYKENSPSSL  309

Query  1087  IIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             + EG+ ++ASAG+LIYMALVDLL+ADFM P++ +N KLQ  +  ++LLG G MS++AKWA
Sbjct  310   MTEGLLDAASAGLLIYMALVDLLSADFMGPKLQRNIKLQMKSYLAVLLGCGGMSLMAKWA  369



>ref|XP_006363198.1| PREDICTED: zinc transporter 5-like [Solanum tuberosum]
Length=354

 Score =   295 bits (756),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 165/293 (56%), Positives = 210/293 (72%), Gaps = 9/293 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPE--GSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDF  564
             LP++ +   +L      S  F++KAFAAGVILATGFIH+LPDAFE+LTS  LS++ W  F
Sbjct  66    LPILLKNFKSLQKNDYSSLQFLIKAFAAGVILATGFIHILPDAFESLTSPCLSENLWGSF  125

Query  565   PFCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
             PF GFVAM++AI TLM++SFAT Y       K    +   D E G G      H      
Sbjct  126   PFAGFVAMMSAIFTLMMESFATGYHRRAELRKAQPVNIGDDDEQGQGQDEHIAHGPQI--  183

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                  + +   SS L+RHR+ISQVLELGI+VHSVIIGI+LG ++ PKTIKPL+ AL+FHQ
Sbjct  184   -----LLERSDSSSLMRHRLISQVLELGILVHSVIIGISLGTTENPKTIKPLIIALSFHQ  238

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
             FFEGMGLGGCI+QAK+K++++ IM LFF++TTP GI IG+ I+  Y+E S   LI++G+ 
Sbjct  239   FFEGMGLGGCISQAKYKARTIIIMVLFFTVTTPSGIAIGMMISKGYNEQSSTALIVQGVL  298

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             NSASAGILIYMALVDLLA DFM P+++ + KLQ  AN SL+LGA  MS+LAKW
Sbjct  299   NSASAGILIYMALVDLLATDFMDPKLYTSFKLQISANVSLVLGAACMSLLAKW  351



>gb|AAY29147.1| Zrt- and Irt-related protein 3 [Arabidopsis halleri subsp. gemmifera]
Length=320

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/277 (57%), Positives = 191/277 (69%), Gaps = 29/277 (10%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+  P+L PE SFFF+ KAFAAGVILATGF+HVLP+A+E LTS  L+   W +FPF 
Sbjct  59    PLLGKFFPSLGPETSFFFVTKAFAAGVILATGFMHVLPEAYEMLTSPCLTSEAW-EFPFT  117

Query  574   GFVAMVAAIGTLMVDSFATS--YFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             GF+AM+ AI TL VDSFATS  Y S R   K  +  E+G+                    
Sbjct  118   GFIAMITAILTLSVDSFATSFLYKSHRKASKRVSDGESGE--------------------  157

Query  748   ghvSVTDTDSSS-QLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                  T  DS   Q+LR RVI+QVLELGIIVHSV+IGI+LGAS +P   K L  AL FHQ
Sbjct  158   -----TSVDSEKVQILRTRVIAQVLELGIIVHSVVIGISLGASQSPDAAKALFIALMFHQ  212

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
              FEG GLGGCIAQ KFK  SV IM+ FF++TTP+GIV+G+GITN YD  SP  LI++G+ 
Sbjct  213   CFEGFGLGGCIAQGKFKCLSVTIMSTFFAITTPIGIVVGMGITNSYDASSPTALIVQGVL  272

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGAN  1215
             N+ASAGILIYM+LVD LAADFM P+M  N +LQ  A+
Sbjct  273   NAASAGILIYMSLVDFLAADFMHPKMQSNIRLQIMAH  309



>ref|XP_010676218.1| PREDICTED: zinc transporter 1-like [Beta vulgaris subsp. vulgaris]
Length=363

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 209/303 (69%), Gaps = 15/303 (5%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+VG+ +P L PE   FF++K+FAAGVIL+TGF+H+LPDAFENL+   LS  PW  FPF
Sbjct  65    LPIVGKNLPILHPESKLFFLIKSFAAGVILSTGFVHILPDAFENLSDPSLSDTPWGKFPF  124

Query  571   CGFVAMVAAIGTLMVDSFAT-----SYFSGRSGEKV------TAGHEAGDAEVGpgvvpv  717
              G  AM+ A+G+LM+D+ AT     ++F   S   +      T G  A    +       
Sbjct  125   TGLAAMLGALGSLMIDAVATGHYRRAHFGQHSASSIGAVDDETRGDHASHVHLHTHATHG  184

Query  718   hthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKP  897
             H H           ++D D     +R++V SQVLELGI+VHS+IIGI+LG S +  TIKP
Sbjct  185   HAHGPGPMDANLDGLSDFDR----IRYKVTSQVLELGIVVHSIIIGISLGTSQSLDTIKP  240

Query  898   LVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSP  1077
             L+ AL FHQFFEG+GLGGCIAQA F+S S   MALFFSLTTP+G+ IGIGITN YD+ SP
Sbjct  241   LIVALCFHQFFEGIGLGGCIAQAAFRSGSTMCMALFFSLTTPVGVAIGIGITNVYDDSSP  300

Query  1078  KVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmla  1257
               L+++G+ NS +AGILIYMALVDLLA DFM+P++  N +L  GAN +LLLGAG+M++LA
Sbjct  301   TALVVQGLLNSVAAGILIYMALVDLLAQDFMNPKVQTNTRLFVGANVTLLLGAGVMALLA  360

Query  1258  KWA  1266
              WA
Sbjct  361   IWA  363



>gb|KDP31427.1| hypothetical protein JCGZ_11803 [Jatropha curcas]
Length=344

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 163/296 (55%), Positives = 207/296 (70%), Gaps = 16/296 (5%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R +PALSP+ S F +VKAFA+GVILATG++HVLPD+F  LTS+ L ++PWR FPF
Sbjct  61    LPLFSRAVPALSPDKSLFSIVKAFASGVILATGYMHVLPDSFNCLTSECLPENPWRKFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRS----GEKVTAGHEAGDAEVGpgvvpvhthathg  738
               FVAM++A+ TLMVDSFA SY+        GE V    + G  E G  V          
Sbjct  121   TTFVAMLSALITLMVDSFALSYYKKHELRSEGEGVRDDVQEGGNEDGETVNVKVEE----  176

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
                     +     S LLRHRV++QVLELGI+VHSV+IG+++GASD P TI+PL+AAL F
Sbjct  177   --------SPGGIDSPLLRHRVVAQVLELGIVVHSVVIGLSMGASDNPCTIRPLIAALCF  228

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQ FEGMGLGGCI QA++  +  A M  FFS TTP GI +GIG++N Y E+SP  LI+ G
Sbjct  229   HQLFEGMGLGGCILQAEYGMKMKATMVFFFSSTTPFGIALGIGLSNVYSENSPTALIVVG  288

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             I N++SAG+L YMALVDLLAADFM  ++ +N KLQ  A  ++LLGAG MS++AKWA
Sbjct  289   ILNASSAGLLNYMALVDLLAADFMGHKLQQNVKLQMLAYIAVLLGAGGMSLMAKWA  344



>ref|XP_006418042.1| hypothetical protein EUTSA_v10008057mg [Eutrema salsugineum]
 gb|ESQ36395.1| hypothetical protein EUTSA_v10008057mg [Eutrema salsugineum]
Length=352

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 167/292 (57%), Positives = 202/292 (69%), Gaps = 4/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
              P++G   P+L PE +FFF+ KAFAAGVILATGF+HVLP+ +E LTS  L    W +FPF
Sbjct  65    FPLLGNFFPSLRPETNFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKGKAW-EFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GF+AMVAAI TL VDSFATSYF  RS  K +     GD E   G               
Sbjct  124   TGFIAMVAAILTLSVDSFATSYFQ-RSHFKTSK--RIGDGEEQSGGGGDELGLHVHAHGH  180

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                +   +S  QL R RV++QVLE+GIIVHSV+IGI+LGAS  P T K L AAL FHQ F
Sbjct  181   THGIVAVESEVQLHRTRVVAQVLEVGIIVHSVVIGISLGASQNPDTAKALFAALMFHQCF  240

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCIAQ  F   S+ IM++FFS+TTP+GI +G+GI   YDE SP  LI++G+ N+
Sbjct  241   EGLGLGGCIAQGNFNCMSITIMSIFFSITTPIGIAVGMGIATSYDESSPTALIVQGVLNA  300

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ASAGILIYM+LVD LAADFM P+M  N  LQ  A+ SLL GAG+MS+LAKWA
Sbjct  301   ASAGILIYMSLVDFLAADFMHPKMQSNTSLQIMAHISLLAGAGIMSLLAKWA  352



>ref|XP_004232649.1| PREDICTED: zinc transporter 3-like [Solanum lycopersicum]
Length=352

 Score =   293 bits (750),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 210/296 (71%), Gaps = 19/296 (6%)
 Frame = +1

Query  391   LPVVGRRIPALSPE--GSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDF  564
             LP++ +   +L         FM+KAFAAGVILATGFIH+LPDAFE+LTS  LS+  W  F
Sbjct  68    LPILLKNFKSLQKNDYSPLQFMIKAFAAGVILATGFIHILPDAFESLTSPCLSEDLWGSF  127

Query  565   PFCGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthath  735
             PF GFVAM++AI TLM++SFA+ Y      R  + V  G E G  E              
Sbjct  128   PFAGFVAMMSAIFTLMMESFASGYHRRAELRKAQPVNIGDEQGQDE--------------  173

Query  736   ghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALT  915
                HG   + +   SS L+RHR+ISQVLELGI+VHSVIIGI+LG ++ PKTIKPL+ AL+
Sbjct  174   HIDHGPQILLERSDSSSLMRHRLISQVLELGILVHSVIIGISLGTTENPKTIKPLIIALS  233

Query  916   FHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIE  1095
             FHQFFEGMGLGGCI+QAK+K +++ IM LFF++TTP GI IG+ I+  Y+E S   LI++
Sbjct  234   FHQFFEGMGLGGCISQAKYKVRTIIIMVLFFTVTTPSGIAIGMMISKGYNEQSSTALIVQ  293

Query  1096  GIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             G+ NSASAGILIYMALVDLLA DFM+P+++ + KLQ  AN SL+LGA  MS+LAKW
Sbjct  294   GVLNSASAGILIYMALVDLLATDFMNPKLYTSFKLQIVANVSLILGACCMSLLAKW  349



>ref|XP_003607852.1| Zinc transporter [Medicago truncatula]
 gb|AES90049.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=350

 Score =   293 bits (750),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 203/294 (69%), Gaps = 9/294 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R IPALSPEG  F +VK FAAG+IL TGF+HVLPD++E L SD L + PW +FPF
Sbjct  64    LPLATRSIPALSPEGDLFIIVKCFAAGIILGTGFMHVLPDSYEMLWSDCLDEKPWHEFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFS--GRSGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
              G VAM +A+ T+MVDS ATSY+S  G+SG  +   H   D E+G      H        
Sbjct  124   SGLVAMFSAVVTMMVDSIATSYYSKKGKSGVVIPESHGGDDQEIGHSHGGHHHIHNGFK-  182

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                   T+     QLLR+RV+  VLELGI+VHSV+IG+ +GAS+   +IK L+AA+ FHQ
Sbjct  183   ------TEESDEPQLLRYRVVVMVLELGIVVHSVVIGLGMGASNNTCSIKGLIAAMCFHQ  236

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
              FEGMGLGGCI QAK+K    A++  FFS+TTPLGI IG+ ++  Y E+SP  LI  G+ 
Sbjct  237   MFEGMGLGGCILQAKYKFLKNAMLVFFFSITTPLGIAIGLAMSTSYKENSPVALITVGLL  296

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N++SAG+LIYMALVDLLAADFMS RM  + KLQ  +  ++ LGAG MS++AKWA
Sbjct  297   NASSAGLLIYMALVDLLAADFMSKRMQSSIKLQLKSYVAVFLGAGGMSLMAKWA  350



>ref|XP_008243768.1| PREDICTED: fe(2+) transport protein 1-like [Prunus mume]
Length=361

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 200/277 (72%), Gaps = 9/277 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R +PAL P+   F +VKAFA+GVILATG++HVLPD+FE LTS  L + PW+ FPF
Sbjct  69    LPLFSRSVPALQPDKDLFSIVKAFASGVILATGYMHVLPDSFECLTSVCLPEKPWKKFPF  128

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
               FVAM++A+ TLMVDSF+ S++     +   A   +GD E    V P   H  HGH HG
Sbjct  129   TTFVAMLSAVLTLMVDSFSMSHYR----KAFAAATRSGDEENAKNVTPQLEHVGHGHGHG  184

Query  751   hvSVTDTD-----SSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALT  915
             HV  T  +       +QLLR+RV++QVLELGI+VHSV+IG+++GASD P TI+PL+AAL 
Sbjct  185   HVQDTKNEGGLNGKDTQLLRYRVVAQVLELGIVVHSVVIGLSMGASDNPCTIRPLIAALC  244

Query  916   FHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIE  1095
             FHQ FEGMGLGGCI QA++  +  +IM  FFS+TTP GI +GIG++N Y EDSP  LI+ 
Sbjct  245   FHQLFEGMGLGGCILQAEYGLKIKSIMVFFFSVTTPFGIALGIGLSNVYSEDSPTALIVV  304

Query  1096  GIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQF  1206
             G+ N+ASAG+L YMALVDLLAADFM P++   PKLQ 
Sbjct  305   GLLNAASAGLLNYMALVDLLAADFMGPKLQAKPKLQM  341



>ref|XP_009802160.1| PREDICTED: probable zinc transporter 10 [Nicotiana sylvestris]
 dbj|BAF48330.1| iron transporter protein IRT1 [Nicotiana tabacum]
Length=355

 Score =   293 bits (750),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 164/292 (56%), Positives = 214/292 (73%), Gaps = 0/292 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+V R IPALSPE S F +VKAFAAG+ILATGF+HVLPD+F+ L+S  L ++PW  FPF
Sbjct  64    LPLVTRSIPALSPERSLFVIVKAFAAGIILATGFMHVLPDSFDMLSSSCLKENPWHKFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AI TL +DS ATS +S ++   V    ++ D +   G V    H    H HG
Sbjct  124   TGFVAMLSAIFTLAIDSMATSLYSKKNKAGVIPESQSQDGDQEMGAVNAGNHVHSHHHHG  183

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
               S  D    ++LLR+RVI+ VLELGIIVHS++IG++LGAS+   TIK LVAAL FHQ F
Sbjct  184   SFSTKDGVDGAKLLRYRVIAMVLELGIIVHSIVIGLSLGASNNTCTIKGLVAALCFHQMF  243

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QA++K    AIMA FF++TTP GI +GI +++ Y+E+SP+ LI  G+ N+
Sbjct  244   EGMGLGGCILQAEYKFLKKAIMAFFFAITTPFGIALGIALSSTYEENSPRALITVGLLNA  303

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +SAG+LIYMALVDLLAADFM  ++  + KLQ  +  ++LLGAG MS++AKWA
Sbjct  304   SSAGLLIYMALVDLLAADFMGDKLQGSIKLQIKSYMAVLLGAGGMSLMAKWA  355



>gb|AFK47100.1| unknown [Medicago truncatula]
Length=350

 Score =   292 bits (748),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 203/294 (69%), Gaps = 9/294 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R IPALSPEG  F +VK FAAG+IL TGF+HVLPD++E L SD L + PW +FPF
Sbjct  64    LPLATRSIPALSPEGDLFIIVKCFAAGIILGTGFMHVLPDSYEMLWSDCLDEKPWHEFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFS--GRSGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
              G VAM +A+ T+MVDS ATSY+S  G+SG  +   H   D E+G      H        
Sbjct  124   SGLVAMFSAMVTMMVDSIATSYYSKKGKSGVVIPESHGGDDQEIGHSHGGHHHIHNGFK-  182

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                   T+     QLLR+RV+  VLELGI+VHSV+IG+ +GAS+   +IK L+AA+ FHQ
Sbjct  183   ------TEESDEPQLLRYRVVVMVLELGIVVHSVVIGLGMGASNNTCSIKGLIAAMCFHQ  236

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
              FEGMGLGGCI QAK+K    A++  FFS+TTPLGI IG+ ++  Y E+SP  LI  G+ 
Sbjct  237   MFEGMGLGGCILQAKYKFLKNAMLVFFFSITTPLGIAIGLAMSTSYKENSPVALITVGLL  296

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N++SAG+LIYMALVDLLAADFMS RM  + KLQ  +  ++ LGAG MS++AKWA
Sbjct  297   NASSAGLLIYMALVDLLAADFMSKRMQSSIKLQLKSYVAVFLGAGGMSLMAKWA  350



>ref|XP_009412061.1| PREDICTED: zinc transporter 3-like [Musa acuminata subsp. malaccensis]
Length=400

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 191/269 (71%), Gaps = 0/269 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             +P++GR + AL PE   FF++KAFAAGVILATG IH+LP AF++LTS  L++HPW   P 
Sbjct  109   IPILGRSVSALQPEHDMFFVIKAFAAGVILATGLIHILPAAFQSLTSPCLAEHPWHTLPV  168

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFV M +A+ T+M+DSFATSY+      K     E  +      V      +       
Sbjct  169   TGFVVMSSAMWTMMIDSFATSYYKRSHFSKARPVEEDEEHGQEGHVHVHTHPSHGHAHGS  228

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
               +  +  S S+ +RH+VISQVLELGI+VHSVI+GI+LGAS  P TI+PLV AL+FHQFF
Sbjct  229   TAAAAEEASVSERIRHQVISQVLELGILVHSVIVGISLGASQRPSTIRPLVGALSFHQFF  288

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QA F+++S  +MA+FFSLT P+GI +GI I++ YD+ S   LI+EG+FN+
Sbjct  289   EGIGLGGCIVQAGFRAKSTVVMAVFFSLTAPVGIALGIAISSVYDDASSTALIVEGVFNA  348

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPK  1197
             ASAGIL+YMALVDLLAADF +PRM  N +
Sbjct  349   ASAGILVYMALVDLLAADFTNPRMQSNGR  377



>ref|XP_010522316.1| PREDICTED: zinc transporter 5 [Tarenaya hassleriana]
Length=337

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 168/293 (57%), Positives = 208/293 (71%), Gaps = 20/293 (7%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G   P L PE SFFF+ +AFAAGVIL+TGF+HVLP+AF  L S  LS HPW+ FPF 
Sbjct  63    PLLGSVFPPLRPETSFFFVTRAFAAGVILSTGFLHVLPEAFGKLRSPCLSDHPWK-FPFT  121

Query  574   GFVAMVAAIGTLMVDSFATSYF--SGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             GF+AMVAAI TL +DSFATSYF  S    +K++ G E G                  H H
Sbjct  122   GFIAMVAAILTLSIDSFATSYFQRSHSKNQKISDGEELG-----------------IHGH  164

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
              H  +T  +S +QLLR RVI+QVLELGIIVHSV+IGIALGAS  P  ++ L  AL FHQ 
Sbjct  165   SHGGLTAVESKTQLLRSRVIAQVLELGIIVHSVVIGIALGASQDPDNVRALFTALMFHQC  224

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEG+GLGGCI Q KF   ++ IM LFFS+TTP+GI +G+ I++RYDE S   LI++G+ N
Sbjct  225   FEGLGLGGCITQGKFNCMTITIMTLFFSVTTPVGIGVGMEISSRYDESSSTALIVQGVLN  284

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +AS+GILIYM+LVDLLA DFM P++  N  LQ  A+ SLLLG+GLMS+LA WA
Sbjct  285   AASSGILIYMSLVDLLAPDFMHPKLQSNSGLQIMAHISLLLGSGLMSLLAYWA  337



>emb|CDP17625.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 216/298 (72%), Gaps = 13/298 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+V R +PALSP+ S F +VK+FAAG+ILATGF+HVLPD+F+ L+S  L ++PW  FPF
Sbjct  63    LPLVTRSVPALSPDKSLFVIVKSFAAGIILATGFMHVLPDSFDMLSSSCLKENPWHKFPF  122

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSG------EKVTAGHEAGDAEVGpgvvpvhthat  732
              GFVAM++AI TLMVDS ATS +S ++       E   A    GD E+  G +  H H +
Sbjct  123   SGFVAMLSAILTLMVDSLATSLYSKQNKGGIVIPEGGAAAAAQGDQEMAVGNLHGHHHGS  182

Query  733   hghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAAL  912
                     S+ D    +QLLR+RVI+ VLELGIIVHS++IGI+LGAS+   +IK LVAAL
Sbjct  183   I-------SMKDGVGGAQLLRYRVIAMVLELGIIVHSIVIGISLGASNNTCSIKGLVAAL  235

Query  913   TFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLII  1092
              FHQ FEGMGLGGCI QA++K    A+MA FFS+TTP GI +GIG+ + Y E+SP+ LI 
Sbjct  236   CFHQMFEGMGLGGCILQAEYKLLKKAVMAFFFSVTTPFGIALGIGLASTYKENSPRALIT  295

Query  1093  EGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              G+ N++SAG+LIYMALVDLLA+DFM P++  + KLQ  +  ++LLGAG MS++AKWA
Sbjct  296   VGLLNASSAGLLIYMALVDLLASDFMGPKLQGSVKLQIKSYMAVLLGAGGMSLMAKWA  353



>ref|XP_007225019.1| hypothetical protein PRUPE_ppa020099mg [Prunus persica]
 gb|EMJ26218.1| hypothetical protein PRUPE_ppa020099mg [Prunus persica]
Length=361

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 200/277 (72%), Gaps = 9/277 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R +PAL P+   F +VKA A+GVILATG++HVLPD+FE LTS  L + PW+ FPF
Sbjct  69    LPLFSRSVPALQPDKDLFSIVKALASGVILATGYMHVLPDSFECLTSVCLPEKPWKKFPF  128

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
               FVAM++A+ TLMVDSF+ S++     +   AG  +GD E    V P   H  HGH HG
Sbjct  129   TTFVAMLSAVLTLMVDSFSMSHYR----KAFAAGTRSGDEENDKNVTPQLEHVGHGHGHG  184

Query  751   hvSVTDTD-----SSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALT  915
             HV  T  +       SQLLR+RV++QVLELGI+VHSV+IG+++GASD P TI+PL+AAL 
Sbjct  185   HVQDTKIEGGLNGKDSQLLRYRVVAQVLELGIVVHSVVIGLSMGASDNPCTIRPLIAALC  244

Query  916   FHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIE  1095
             FHQ FEGMGLGGCI QA++  +  ++M  FFS+TTP GI +GIG++N Y EDSP  LI+ 
Sbjct  245   FHQLFEGMGLGGCILQAEYGLKIKSVMVFFFSVTTPFGIALGIGLSNVYSEDSPTALIVV  304

Query  1096  GIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQF  1206
             G+ N+ASAG+L YMALVDLLAADFM P++   PKLQ 
Sbjct  305   GLLNAASAGLLNYMALVDLLAADFMGPKLQAKPKLQM  341



>ref|XP_009141213.1| PREDICTED: zinc transporter 3-like [Brassica rapa]
Length=342

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 169/291 (58%), Positives = 205/291 (70%), Gaps = 23/291 (8%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+  P+L PE  FFF+ KAFAAGVIL+TGF+HVLP+A+E L S  L+   W DFPF 
Sbjct  75    PLLGKVFPSLRPETPFFFVTKAFAAGVILSTGFMHVLPEAYEMLNSPCLTSEAW-DFPFT  133

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             GF+AMVAAI TL VD+FATS F+        A     D E G                  
Sbjct  134   GFIAMVAAILTLSVDTFATSSFNK---SHCNASKTIPDGESGEL----------------  174

Query  754   vSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFE  933
               V D+ +  Q+LR RVI+QVLELGIIVHSV+IGI+LGAS +P+  K L  AL FHQ FE
Sbjct  175   --VVDS-AKVQMLRTRVIAQVLELGIIVHSVVIGISLGASQSPEAAKALFIALMFHQCFE  231

Query  934   GMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSA  1113
             G+GLGGCIAQ KFK  SV IM+ FF++TTPLGIV+G+ I N YDE SP  LI++G+ N+A
Sbjct  232   GLGLGGCIAQGKFKCLSVTIMSTFFAITTPLGIVVGMEIANTYDESSPTALIVQGVLNAA  291

Query  1114  SAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             SAGILIYM+LVDLLAADFM P+M  N  LQ  A+ +LLLGAGLMS+LAKWA
Sbjct  292   SAGILIYMSLVDLLAADFMHPKMQSNTGLQIMAHIALLLGAGLMSILAKWA  342



>ref|XP_006654534.1| PREDICTED: zinc transporter 5-like [Oryza brachyantha]
Length=350

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/292 (56%), Positives = 205/292 (70%), Gaps = 2/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP +G R PA+ PE   F  VKAFA GVILATG +H+LP AF+ L S  L   PW+ FPF
Sbjct  61    LPSLGNRFPAIQPETDVFLTVKAFAGGVILATGLVHILPAAFDALNSPCLVGGPWKKFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              G  AMV+AIGTL+VD+ AT YF  R+  K  A   A +              +H H   
Sbjct  121   AGMFAMVSAIGTLIVDTVATGYFH-RTDAKRKAAAIADEPTGNDLEATDEHSHSHAHGMS  179

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
              +SV   D    L+RHRVISQVLELG++VHS+IIG++LGAS+ P T++PLV ALTFHQFF
Sbjct  180   VMSVAAADEE-DLVRHRVISQVLELGVVVHSLIIGMSLGASNFPSTVRPLVPALTFHQFF  238

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QAKFK +SV  MALFFSLTTP+GI IGI I++ YD ++P+ L+++GI  S
Sbjct  239   EGIGLGGCIVQAKFKVRSVVTMALFFSLTTPVGIAIGIAISSVYDANNPRALVVQGILES  298

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             A+AGIL+YMALVD+LA DFM  ++    +LQ   N +LLLGAGLMS++A WA
Sbjct  299   AAAGILVYMALVDILAEDFMKTKVQSRARLQLAMNLALLLGAGLMSLIAIWA  350



>ref|NP_001055818.1| Os05g0472700 [Oryza sativa Japonica Group]
 sp|Q6L8G0.1|ZIP5_ORYSJ RecName: Full=Zinc transporter 5; AltName: Full=ZRT/IRT-like 
protein 5; Short=OsZIP5; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAP33800.1| putative zinc transporter OsZIP2 [Oryza sativa Japonica Group]
 dbj|BAD18965.1| zinc transporter [Oryza sativa Japonica Group]
 gb|AAT94022.1| putative zinc transporter OsZIP2 [Oryza sativa Japonica Group]
 gb|AAU44233.1| putative zinc transporter [Oryza sativa Japonica Group]
 dbj|BAF17732.1| Os05g0472700 [Oryza sativa Japonica Group]
 gb|EAY98395.1| hypothetical protein OsI_20308 [Oryza sativa Indica Group]
 dbj|BAG92180.1| unnamed protein product [Oryza sativa Japonica Group]
Length=353

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/295 (56%), Positives = 205/295 (69%), Gaps = 9/295 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP +G R PA+ PE   F  VKAFA GVILATG +H+LP AFE L+S  L   PW+ FPF
Sbjct  65    LPSLGGRFPAIQPETDVFLSVKAFAGGVILATGLVHILPAAFEALSSPCLVGGPWKRFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK---VTAGHEAGDAEVGpgvvpvhthathgh  741
              G VAMV+AIGTL+VD+ AT YF     ++     A   A D E        H H     
Sbjct  125   AGMVAMVSAIGTLIVDTVATGYFHRTDAKRKAAAVADEPADDLEASDEHSHGHAHGMSVM  184

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
             +       D      L+RHRVISQVLELG++VHS+IIG++LGASD P T++PLV ALTFH
Sbjct  185   SVAPAGEED------LVRHRVISQVLELGVVVHSLIIGMSLGASDFPSTVRPLVPALTFH  238

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             QFFEG+GLGGCI QAKF+ +SV  MALFFSLTTP GIV+GIGI++ YD +SP  L+++G+
Sbjct  239   QFFEGIGLGGCIVQAKFRVRSVVTMALFFSLTTPAGIVVGIGISSVYDANSPTALVVQGL  298

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
               +A+AGIL+YMALVD+LA DFM  ++ +  +LQ   N +LLLGAGLMSM+A WA
Sbjct  299   LEAAAAGILVYMALVDILAEDFMKTKVQRRGRLQLAMNVALLLGAGLMSMIAIWA  353



>ref|NP_180786.1| zinc transporter 3 [Arabidopsis thaliana]
 sp|Q9SLG3.1|ZIP3_ARATH RecName: Full=Zinc transporter 3; AltName: Full=ZRT/IRT-like 
protein 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC69954.1| putative Fe(II) transporter [Arabidopsis thaliana]
 gb|AEC08660.1| zinc transporter 3 [Arabidopsis thaliana]
Length=339

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 167/291 (57%), Positives = 203/291 (70%), Gaps = 23/291 (8%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+  P+L PE  FFF+ KAFAAGVILATGF+HVLP+A+E L S  L+   W +FPF 
Sbjct  72    PLLGKVFPSLRPETCFFFVTKAFAAGVILATGFMHVLPEAYEMLNSPCLTSEAW-EFPFT  130

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             GF+AM+AAI TL VD+FATS F         A     D E G                  
Sbjct  131   GFIAMIAAILTLSVDTFATSSFYK---SHCKASKRVSDGETGE-----------------  170

Query  754   vSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFE  933
              S  D++   Q+LR RVI+QVLELGIIVHSV+IGI+LGAS +P   K L  AL FHQ FE
Sbjct  171   -SSVDSEKV-QILRTRVIAQVLELGIIVHSVVIGISLGASQSPDAAKALFIALMFHQCFE  228

Query  934   GMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSA  1113
             G+GLGGCIAQ KFK  SV IM+ FF++TTP+GIV+G+GI N YDE SP  LI++G+ N+A
Sbjct  229   GLGLGGCIAQGKFKCLSVTIMSTFFAITTPIGIVVGMGIANSYDESSPTALIVQGVLNAA  288

Query  1114  SAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             SAGILIYM+LVDLLAADF  P+M  N  LQ  A+ +LLLGAGLMS+LAKWA
Sbjct  289   SAGILIYMSLVDLLAADFTHPKMQSNTGLQIMAHIALLLGAGLMSLLAKWA  339



>ref|XP_004293827.1| PREDICTED: zinc transporter 8-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=343

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 195/276 (71%), Gaps = 20/276 (7%)
 Frame = +1

Query  397   VVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFCG  576
             +V   IP L P+  F+ ++KAFAAGVILAT F+HVLPDA E+LTS  LS+ PW  FPF G
Sbjct  65    LVKVNIPFLHPDNDFYLLIKAFAAGVILATSFVHVLPDAQESLTSPCLSQKPWGKFPFTG  124

Query  577   FVAMVAAIGTLMVDSFATSY--FSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
             FVAMV+AIGTLM+++ AT Y   S  S  +   G E  +   G  +              
Sbjct  125   FVAMVSAIGTLMMEALATGYNKRSALSKPQPIDGDEETNQVHGSAL--------------  170

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                V +  +SS  +R+R+ISQVLELGIIVHSVIIG++LGA     TIKPLVAAL+FHQFF
Sbjct  171   ---VLEPSNSSDTIRNRIISQVLELGIIVHSVIIGVSLGACQKLHTIKPLVAALSFHQFF  227

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EG+GLGGCI QAKF  +++A+M  FFSLT+P GI +GI I+N Y+E+SP  L++EG+  S
Sbjct  228   EGIGLGGCIYQAKFSHKTMAVMVGFFSLTSPCGIGVGIAISNSYNENSPTSLVVEGLLLS  287

Query  1111  ASAGILIYMALVDLLAADFM-SPRMHKNPKLQFGAN  1215
             ASAGILIYMALVDLLAADF+ + +M  NPKLQ GAN
Sbjct  288   ASAGILIYMALVDLLAADFINNAKMLTNPKLQLGAN  323



>ref|XP_010544345.1| PREDICTED: zinc transporter 1 [Tarenaya hassleriana]
Length=344

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 195/268 (73%), Gaps = 12/268 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G++IPAL PE   FFMVKAFAAGVIL TGF+H+LPDAF++L            FPF
Sbjct  63    LPLIGKKIPALRPEKDVFFMVKAFAAGVILCTGFVHILPDAFQSLEDSP--------FPF  114

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AIGTLM+D+FAT Y+  R   K        D E    V              
Sbjct  115   AGFVAMLSAIGTLMIDTFATGYYERRHFSKQV---NTEDEEHAGHVHVHTHATHGHSHGS  171

Query  751   hvSVTDTD-SSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
               S  D +  ++ LLR R++SQVLE+GI+VHSVIIGI+LGAS + +TIKPL+AAL+FHQF
Sbjct  172   ASSPPDGELPATVLLRRRIVSQVLEVGIVVHSVIIGISLGASQSVETIKPLMAALSFHQF  231

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEG+GLGGCI+QA+F+++S AIMA FFS+T P+GI +GIGIT  Y+E+S + L +EG+FN
Sbjct  232   FEGLGLGGCISQAQFETRSKAIMATFFSMTAPVGIGVGIGITRSYEEESKEALWVEGVFN  291

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKN  1191
             +ASAGILIYM+LVDLLAADFM+P++  N
Sbjct  292   AASAGILIYMSLVDLLAADFMNPKLQTN  319



>ref|XP_009772860.1| PREDICTED: probable zinc transporter 10 [Nicotiana sylvestris]
Length=360

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 165/296 (56%), Positives = 215/296 (73%), Gaps = 5/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+V R IPALSPE S F +VKAFAAG+ILATGF+HVLPD+F+ L+S  L ++PW  FPF
Sbjct  66    LPLVTRSIPALSPERSLFVIVKAFAAGIILATGFMHVLPDSFDMLSSSCLKENPWHKFPF  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKV----TAGHEAGDAEVGpgvvpvhthathg  738
              GFVAM++AI TL +DS ATS +S ++   V     A  + GD E+G      + H+ H 
Sbjct  126   TGFVAMLSAIFTLAIDSMATSLYSKKNKAGVIPESQAQGQGGDQEMGEVNAGNNVHSHHH  185

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H          D + +LLR+RVI+ VLELGIIVHS++IGI+LGAS+   TIK LVAAL F
Sbjct  186   HGSFSTKDGVIDGT-KLLRYRVIAMVLELGIIVHSIVIGISLGASNNTCTIKGLVAALCF  244

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQ FEGMGLGGCI QA++K    AIMA FF++TTP GI +GI +++ Y+E+SP+ LI  G
Sbjct  245   HQMFEGMGLGGCILQAEYKFLKKAIMAFFFAVTTPFGIALGIALSSTYEENSPRALITVG  304

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             + N++SAG+LIYMALVDLLAADFM  ++  + KLQ  +  ++LLGAG MS++AKWA
Sbjct  305   LLNASSAGLLIYMALVDLLAADFMGDKLQGSIKLQIKSYMAVLLGAGGMSLMAKWA  360



>ref|XP_010475216.1| PREDICTED: zinc transporter 5-like [Camelina sativa]
Length=359

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 213/296 (72%), Gaps = 5/296 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
              P++GR  P+L PE +F F+ KAFAAGVILATGF+HVLP+ +E LTS  L    W +FPF
Sbjct  65    FPLLGRFFPSLRPETTFSFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKGEAW-EFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAG-DAEVGpgvvpvhthathg  738
              GF+AMVAAI TL VDSFAT+YF     ++ +K+  G E   D   G G         HG
Sbjct  124   TGFIAMVAAILTLSVDSFATAYFHRLHFKTSKKIGDGEEQRVDGGGGGGEDLGLHVHAHG  183

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
             H HG V V   DS  QL R RV++QVLE+GIIVHSV+IGI+LGAS +P T K L AAL F
Sbjct  184   HTHGIVGVESGDSEVQLHRTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMF  243

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQ FEG+GLGGCIAQ  F   S+ IM++FFS+TTP+GI +G+ I+N Y+E SP  LI++G
Sbjct  244   HQCFEGLGLGGCIAQGNFNCMSITIMSIFFSVTTPVGIAVGMAISNSYNESSPTALIVQG  303

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             + N+ASAGILIYM+LVD LAADFM P+M  N  LQ  A+ SLL+GAG+MS+LAKWA
Sbjct  304   VLNAASAGILIYMSLVDFLAADFMHPKMQSNTGLQIMAHISLLVGAGIMSLLAKWA  359



>ref|XP_010242080.1| PREDICTED: fe(2+) transport protein 1-like [Nelumbo nucifera]
Length=369

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 163/299 (55%), Positives = 213/299 (71%), Gaps = 10/299 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++ R +PAL P+ + F +VKAFAAG+ILATGF+HVLPD+F+ L S  L ++PW  FPF
Sbjct  74    LPLLSRSVPALQPDRNLFVIVKAFAAGIILATGFMHVLPDSFDMLRSPCLRENPWHKFPF  133

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKV-------TAGHEAGDAEVGpgvvpvhtha  729
              GF+AM++A+  LMVDS +TS +S RS   V        A  ++ D E+G  +       
Sbjct  134   SGFLAMLSAVVALMVDSISTSIYSHRSNVDVKPTEIEAAADGDSRDREMGVVISSGIHFH  193

Query  730   thghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAA  909
              H HA      T T   SQLLR+RVI+ VLELGIIVHSV+IG++LGASD   TIKPLVAA
Sbjct  194   GHCHAPMD---TTTSGDSQLLRYRVIAMVLELGIIVHSVVIGLSLGASDNTCTIKPLVAA  250

Query  910   LTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLI  1089
             L FHQ FEGMGLGGCI QA++K    A+MA FFS+TTP GIV+G+ ++  Y+E+S   LI
Sbjct  251   LCFHQMFEGMGLGGCILQAEYKFLKKALMAFFFSVTTPFGIVLGMALSRTYEENSSSSLI  310

Query  1090  IEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
               G+ N++SAG+LIYMALVDLL+ADFM PR+ ++ KLQ  +  ++LLG G MS++AKWA
Sbjct  311   TIGLLNASSAGLLIYMALVDLLSADFMGPRLQRSIKLQIKSYIAVLLGCGGMSLMAKWA  369



>ref|XP_003566152.1| PREDICTED: zinc transporter 5-like [Brachypodium distachyon]
Length=360

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 204/301 (68%), Gaps = 13/301 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKH-PWRDFP  567
             +P +GRR PAL PE   F  VKAFA GVILATG +H+LP AFE L S  L  H PWR FP
Sbjct  64    IPSLGRRFPALRPETDLFLAVKAFAGGVILATGLVHILPTAFEALGSPCLVGHGPWRRFP  123

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTA--------GHEAGDAEVGpgvvpvht  723
             F G VAM+AAIGTL+VD+ AT YF   + ++  A        G  AGD E        H 
Sbjct  124   FAGMVAMLAAIGTLIVDTVATGYFRRTNAKRAAAVTDEPALGGGRAGDLEATSSSDGHHA  183

Query  724   hathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLV  903
             HA              D   +L+RHRVISQVLELG++VHS+IIG++LGASD P T++PLV
Sbjct  184   HAHGMSVLA----APPDGEDELVRHRVISQVLELGVVVHSLIIGMSLGASDFPSTVRPLV  239

Query  904   AALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKV  1083
              ALTFHQ FEG+GLGGCI QAKF+ +SV  M L FSLTTP+GI +GI I++ YDE SPK 
Sbjct  240   PALTFHQLFEGIGLGGCIVQAKFRLKSVLAMGLLFSLTTPVGIGVGIAISSVYDETSPKA  299

Query  1084  LIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKW  1263
             L+++G+  +A+AGIL+YMALVD+LA DF    +    +LQ   N SLLLGAGLMS+LA W
Sbjct  300   LVVQGLLEAAAAGILVYMALVDILAEDFTKASVQSRARLQLALNVSLLLGAGLMSLLAVW  359

Query  1264  A  1266
             A
Sbjct  360   A  360



>emb|CDY48278.1| BnaA05g10760D [Brassica napus]
Length=342

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 209/294 (71%), Gaps = 29/294 (10%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+ IP+L PE SFFF+ KAFAAGVIL+TGF+HVLP+A+  L S  L+   W +FPF 
Sbjct  75    PLLGKVIPSLRPETSFFFVTKAFAAGVILSTGFMHVLPEAYVMLNSPCLTSEAW-EFPFT  133

Query  574   GFVAMVAAIGTLMVDSFATS--YFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             GF+AMVAAI TL VD+FATS  Y S     K     E+G+  V                 
Sbjct  134   GFIAMVAAILTLSVDTFATSSFYKSHCKASKTIIDGESGEPSV-----------------  176

Query  748   ghvSVTDTDSSS-QLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                     DS+  Q+LR R+I+QVLELGIIVHSV+IGI+LGAS +P+  K L  AL FHQ
Sbjct  177   --------DSAKVQILRTRIIAQVLELGIIVHSVVIGISLGASQSPEAAKALFIALMFHQ  228

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
              FEG+GLGGCIAQ KFK  SV IM+ FF++TTP+GIV+G+GI++ YDE SP  LI++G+ 
Sbjct  229   CFEGLGLGGCIAQGKFKCLSVTIMSTFFAVTTPIGIVVGMGISDTYDESSPTALIVQGVL  288

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+ASAGILIYM+LVDLLAADFM P+M  N  LQ  A+ SLLLGAGLMS+LAKWA
Sbjct  289   NAASAGILIYMSLVDLLAADFMHPKMQSNTGLQIMAHISLLLGAGLMSLLAKWA  342



>ref|XP_002282425.1| PREDICTED: fe(2+) transport protein 1 [Vitis vinifera]
 emb|CBI20301.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 194/273 (71%), Gaps = 8/273 (3%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++ + +P L P+G  F ++KAFA+GVILATG++HVLPD+ E+LTS  L + PW  FPF 
Sbjct  72    PILLQGMPLLKPDGKLFVLIKAFASGVILATGYVHVLPDSIESLTSPCLPQAPWSKFPFS  131

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
              F+AMVAA+ TLM+DSFA SY+          G    + E G  +     H+        
Sbjct  132   TFIAMVAAVLTLMMDSFAMSYYKKH-------GMSGAECEYGDHIENDQGHSHGHGHGVG  184

Query  754   vSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFE  933
             V   D D SS+LLR+++I+QVLELGI+VHSV+IG+++GAS+   TI+PL+AAL FHQFFE
Sbjct  185   VKKLD-DESSKLLRYQIIAQVLELGIVVHSVVIGLSMGASENASTIRPLIAALCFHQFFE  243

Query  934   GMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSA  1113
             GMGLGGCI QA++K+++ AIM  FFS+TTPLGI +GIG++  Y +DSP  LI+ G+ N+ 
Sbjct  244   GMGLGGCILQAEYKARTKAIMVFFFSVTTPLGIALGIGLSKVYSDDSPTALIVVGVLNAT  303

Query  1114  SAGILIYMALVDLLAADFMSPRMHKNPKLQFGA  1212
             SAG+L YMALVDLL ADFM P++  N KLQ  A
Sbjct  304   SAGLLNYMALVDLLGADFMGPKLQSNMKLQMWA  336



>ref|XP_007045694.1| Zinc transporter 7 precursor, putative [Theobroma cacao]
 gb|EOY01526.1| Zinc transporter 7 precursor, putative [Theobroma cacao]
Length=352

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 205/291 (70%), Gaps = 5/291 (2%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P+  R +P+L PE   F +VKAFA+GVILATG++HVLPDAF +L S  L ++PWR FPF 
Sbjct  67    PLFSRLLPSLRPERDLFIVVKAFASGVILATGYMHVLPDAFNDLMSKCLPENPWRKFPFT  126

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
              F AM+AA+ TLMVDSFA S +  R  +   A     DA  G G+   +           
Sbjct  127   TFAAMLAALVTLMVDSFAMSTYKKRCAKASVA-----DAGNGAGLENGNVQIEIFGQGQG  181

Query  754   vSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFE  933
              +V   D +SQLLR RVI+QVLELGIIVHSV+IG+A+GAS+   TI+ L+AAL FHQ FE
Sbjct  182   HAVEKNDKASQLLRCRVIAQVLELGIIVHSVVIGLAMGASENHCTIRSLIAALCFHQMFE  241

Query  934   GMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSA  1113
             GMGLGGCI QA+++ +  A MA FFS TTP GIV+GIG+++ Y E SP  LI+ G+ N++
Sbjct  242   GMGLGGCILQAEYELKMKATMAFFFSATTPFGIVLGIGLSSVYSETSPTELIVVGLLNAS  301

Query  1114  SAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             SAG+L YMALVDLLAADFM PR+  N KLQ  +  ++LLGAG MS++AKWA
Sbjct  302   SAGLLNYMALVDLLAADFMGPRLQTNMKLQVWSYMAVLLGAGFMSLMAKWA  352



>emb|CAI77926.2| hypothetical protein [Noccaea caerulescens]
Length=352

 Score =   290 bits (742),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 205/298 (69%), Gaps = 13/298 (4%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
              P+ G+  P+L PE +FFF+ KAFAAGVILATGF+HVLP+ +E LTS  L    W +FPF
Sbjct  62    FPLSGKYFPSLKPETNFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLEGGAW-EFPF  120

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHE---AGDAEVGpgvvpvhthat  732
              GF+AMVAAI TL VDSFATSYF     +  +K+  G E    G  E+G  V        
Sbjct  121   TGFIAMVAAILTLSVDSFATSYFYRLHFKPSKKIGDGEERSGGGGDELGLHVHAHGHAHG  180

Query  733   hghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAAL  912
                      V    S  Q  R RV++QVLE+GIIVHSV+IGI+LGAS +P T K L AAL
Sbjct  181   IV------GVDSGGSEVQTHRSRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAAL  234

Query  913   TFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLII  1092
              FHQ FEG+GLGGCIAQ  F   S+ IM++ FS+TTP+GI +G+GI N YDE SP  LI+
Sbjct  235   MFHQCFEGLGLGGCIAQGNFNCTSITIMSILFSVTTPIGIAVGMGIANSYDESSPTALIM  294

Query  1093  EGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +G+ NSASAGILIYM+LVD LAADFM P+M  N  LQ  A+ SLL+GAG+MS+LAKWA
Sbjct  295   QGVLNSASAGILIYMSLVDFLAADFMHPKMQSNTGLQIMAHISLLVGAGIMSLLAKWA  352



>ref|XP_006362613.1| PREDICTED: fe(2+) transport protein 1-like [Solanum tuberosum]
Length=350

 Score =   290 bits (742),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 197/271 (73%), Gaps = 6/271 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+V R IPALSPE S F +VKAFA+G+ILATGF+HVLPD+F+ L+S  L +HPW  FPF
Sbjct  65    LPLVTRSIPALSPERSLFVIVKAFASGIILATGFMHVLPDSFDMLSSSCLKEHPWHKFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++A+ T+ +DS ATS +S +    VT  +  GD E+      VH+H  HG    
Sbjct  125   TGFVAMLSALVTMAIDSIATSLYSKKHNGGVT--NPEGDQEMAVAGNHVHSHHHHGSL--  180

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
               S  D     +LLR+RVI+ VLELGIIVHS++IGI+LGAS+   TIK LVAAL FHQ F
Sbjct  181   --STKDGLDGKKLLRYRVIAMVLELGIIVHSIVIGISLGASNNTCTIKGLVAALCFHQMF  238

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QA++K    AIMA FF++TTP GI +GI ++  Y+E+SP+ LI  G+ N+
Sbjct  239   EGMGLGGCILQAEYKFMKRAIMAFFFAVTTPFGIALGIALSTTYEENSPRALITVGLLNA  298

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQ  1203
             +SAG+LIYMALVDLLAADFM  ++  + KLQ
Sbjct  299   SSAGLLIYMALVDLLAADFMGDKLQGSVKLQ  329



>ref|XP_006295925.1| hypothetical protein CARUB_v10025062mg [Capsella rubella]
 gb|EOA28823.1| hypothetical protein CARUB_v10025062mg [Capsella rubella]
Length=340

 Score =   290 bits (741),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 205/294 (70%), Gaps = 29/294 (10%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+  P+L PE SFFF+ KAFAAGVILATGF+HVLP+A+  L S  L+   W +FPF 
Sbjct  73    PLLGKVFPSLRPETSFFFLTKAFAAGVILATGFMHVLPEAYTMLNSPCLTSEAW-EFPFT  131

Query  574   GFVAMVAAIGTLMVDSFATS--YFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             GF+AM++AI TL VD+FATS  Y S     K     E+G+  V                 
Sbjct  132   GFIAMISAILTLSVDTFATSSFYKSHCKASKTIIDGESGEPSV-----------------  174

Query  748   ghvSVTDTDSSS-QLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                     DS   Q+LR R+I+QVLELGIIVHSV+IGI+LGAS +P   K L  AL FHQ
Sbjct  175   --------DSVKVQVLRTRIIAQVLELGIIVHSVVIGISLGASQSPDAAKALFIALMFHQ  226

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
              FEG+GLGGCIAQ KFK  SV IM+ FF++TTP+GIV+G+GI N YDE SP  LI++G+ 
Sbjct  227   CFEGLGLGGCIAQGKFKCLSVTIMSTFFAITTPIGIVVGMGIANSYDESSPTALIVQGVL  286

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+ASAGILIYM+LVDLLAADFM P+M  N  LQ  A+ +LLLGAGLMS+LAKWA
Sbjct  287   NAASAGILIYMSLVDLLAADFMHPKMQSNTGLQIMAHIALLLGAGLMSLLAKWA  340



>gb|AAC24199.1| putative zinc transporter [Arabidopsis thaliana]
Length=339

 Score =   290 bits (741),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 167/291 (57%), Positives = 202/291 (69%), Gaps = 23/291 (8%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+  P+L PE  FFF+ KAFAAGVILATGF+HVLP+A+E L S  L    W +FPF 
Sbjct  72    PLLGKVFPSLRPETCFFFVTKAFAAGVILATGFMHVLPEAYEMLNSPCLISEAW-EFPFT  130

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             GF+AM+AAI TL VD+FATS F         A     D E G                  
Sbjct  131   GFIAMIAAILTLSVDTFATSSFYK---SHCKASKRVSDGETGE-----------------  170

Query  754   vSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFE  933
              S  D++   Q+LR RVI+QVLELGIIVHSV+IGI+LGAS +P   K L  AL FHQ FE
Sbjct  171   -SSVDSEKV-QILRTRVIAQVLELGIIVHSVVIGISLGASQSPDAAKALFIALMFHQCFE  228

Query  934   GMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSA  1113
             G+GLGGCIAQ KFK  SV IM+ FF++TTP+GIV+G+GI N YDE SP  LI++G+ N+A
Sbjct  229   GLGLGGCIAQGKFKCLSVTIMSTFFAITTPIGIVVGMGIANSYDESSPTALIVQGVLNAA  288

Query  1114  SAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             SAGILIYM+LVDLLAADF  P+M  N  LQ  A+ +LLLGAGLMS+LAKWA
Sbjct  289   SAGILIYMSLVDLLAADFTHPKMQSNTGLQIMAHIALLLGAGLMSLLAKWA  339



>ref|XP_002514554.1| zinc/iron transporter, putative [Ricinus communis]
 gb|EEF47660.1| zinc/iron transporter, putative [Ricinus communis]
Length=351

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 210/303 (69%), Gaps = 30/303 (10%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R +PAL P+   F +VKAFA+GVILATG++HVLPD+F+ L S+ L ++PWR FPF
Sbjct  68    LPLFSRAVPALMPDRDLFAIVKAFASGVILATGYMHVLPDSFDCLRSECLPENPWRKFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEK----------VTAGHEAGDAEVGpgvvpvh  720
               FVAM++A+ TLMVDSFA SY+     +           +    E G+  V        
Sbjct  128   TTFVAMLSALFTLMVDSFAMSYYKKWGIDNGATGGGHHHHIKGAEELGNLAV--------  179

Query  721   thathghahghvSVTDTDSSSQ-LLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKP  897
                           TD  ++S+ LLRHRV++QVLELGI+VHSV+IG+++GASD P TI+P
Sbjct  180   -----------EDNTDGKANSEVLLRHRVVAQVLELGIVVHSVVIGLSMGASDNPCTIRP  228

Query  898   LVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSP  1077
             L+AAL FHQ FEGMGLGGCI QA++  +  A+M  FFS TTPLGI +GIG++N Y ++SP
Sbjct  229   LIAALCFHQLFEGMGLGGCILQAEYGMKIKAMMVFFFSATTPLGIALGIGLSNVYSDNSP  288

Query  1078  KVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmla  1257
               LI+ G+ N++SAG+L YMALVDLLAADFM P++ +N KLQ  A  S+LLGAG MS++A
Sbjct  289   TALIVVGLLNASSAGLLNYMALVDLLAADFMGPKLQQNLKLQILAYVSVLLGAGGMSLMA  348

Query  1258  KWA  1266
             KWA
Sbjct  349   KWA  351



>ref|XP_006410360.1| hypothetical protein EUTSA_v10016884mg [Eutrema salsugineum]
 gb|ESQ51813.1| hypothetical protein EUTSA_v10016884mg [Eutrema salsugineum]
Length=342

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 168/291 (58%), Positives = 207/291 (71%), Gaps = 23/291 (8%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+  P+L PE SFFF+ KAFAAGVIL+TGF+HVLP+A+  L S  L+   W DFPF 
Sbjct  75    PLLGKVFPSLRPETSFFFVTKAFAAGVILSTGFMHVLPEAYVMLNSPCLTSEAW-DFPFT  133

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             GF+AM+AAI TL VD+FATS FS +S  K  A     D E G                  
Sbjct  134   GFIAMLAAILTLSVDTFATSSFS-KSRSK--ASKTITDGESGEIS---------------  175

Query  754   vSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFE  933
                 D+D   Q+LR RVI+QVLELGI+VHSV+IGI+LGAS +P+  K L  AL FHQ FE
Sbjct  176   ---ADSDKV-QILRTRVIAQVLELGILVHSVVIGISLGASQSPEAAKALFIALMFHQCFE  231

Query  934   GMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSA  1113
             G+GLGGCIAQ KFK  SV +M+ FF++TTP+GIV+G+ I N YDE SP  LI++G+ N+A
Sbjct  232   GLGLGGCIAQGKFKCLSVTVMSTFFAITTPIGIVVGMVIANSYDESSPTALIVQGVLNAA  291

Query  1114  SAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             SAGILIYM+LVDLLAADFM P+M  N  LQ  A+ +LLLGAGLMS+LAKWA
Sbjct  292   SAGILIYMSLVDLLAADFMHPKMQSNTGLQIMAHVALLLGAGLMSVLAKWA  342



>ref|XP_010557016.1| PREDICTED: zinc transporter 3-like [Tarenaya hassleriana]
Length=359

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 214/316 (68%), Gaps = 47/316 (15%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G   P+L PE  FFF+ +AFAAGVIL+TGF+HVLP+AFE LTS  LS+HPW +FPF 
Sbjct  66    PLLGNVFPSLRPETPFFFVTRAFAAGVILSTGFLHVLPEAFEMLTSPCLSEHPW-EFPFT  124

Query  574   GFVAMVAAIGTLMVDSFATSYF--SGRSGEKVTA-----------------------GHE  678
             GF+AM+AAI TL VD+FATSY   S    +++++                       GH 
Sbjct  125   GFIAMMAAIFTLSVDAFATSYIQKSHFKNQRISSEGEGKEGGGELGLHVHARAHSQDGHT  184

Query  679   AGDAEVGpgvvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGI  858
             A ++ VG                     +  +S +QLLR RVI+QVLELGIIVHSV+IGI
Sbjct  185   AAESGVG---------------------SAVESKTQLLRSRVIAQVLELGIIVHSVVIGI  223

Query  859   ALGASDTPKTIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVI  1038
             +LGAS  P T K L AAL FHQ FEG+GLGGCI Q KFK  +   MA+ FS+TTP+GI +
Sbjct  224   SLGASQDPDTAKTLFAALMFHQCFEGLGLGGCITQGKFKWMAAMTMAMIFSVTTPIGIAV  283

Query  1039  GIGITNRYDEDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANT  1218
             G+GI++ YDE SP  LI++G+ N+AS+GILIYM+LVDLLAADFM P++  N  LQ  A+ 
Sbjct  284   GMGISSSYDESSPTALIVQGVLNAASSGILIYMSLVDLLAADFMHPKVQSNSGLQIMAHI  343

Query  1219  slllgaglmsmlaKWA  1266
             SLLLGAG+MS+LAKWA
Sbjct  344   SLLLGAGIMSLLAKWA  359



>ref|XP_002884924.1| hypothetical protein ARALYDRAFT_897485 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61183.1| hypothetical protein ARALYDRAFT_897485 [Arabidopsis lyrata subsp. 
lyrata]
Length=355

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 167/304 (55%), Positives = 212/304 (70%), Gaps = 28/304 (9%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP++G+RIPAL PE   FFMVKAFAAGVIL TGF+H+LPDAFE L+S  L       FPF
Sbjct  68    LPLIGKRIPALQPENDIFFMVKAFAAGVILCTGFVHILPDAFERLSSPCLQDTTAGKFPF  127

Query  571   CGFVAMVAAIGTLMVDSFATSY-----FSGRSGEK-----VTAGHEAGDAEVGpgvvpvh  720
              GFVAM++A+GTLM+D+FAT Y     F+  SG K     V     AG   V        
Sbjct  128   AGFVAMLSAMGTLMIDTFATGYYKRQHFNSNSGSKQVNVVVDEEEHAGHVHV--------  179

Query  721   thathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPL  900
                     H H S   T  S++L+R R++SQVLE+GI+VHSVIIGI+LGAS +  TIKPL
Sbjct  180   --------HTHASHGHTHGSTELIRKRIVSQVLEIGIVVHSVIIGISLGASQSIDTIKPL  231

Query  901   VAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITN--RYDEDS  1074
             +AAL+FHQFFEG+GLGGCI+ A+ KS+S  IMA FFS+T PLGI IG+G+++   Y ++S
Sbjct  232   MAALSFHQFFEGLGLGGCISMAEMKSKSTVIMATFFSVTAPLGIGIGLGMSSGFGYRKES  291

Query  1075  PKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsml  1254
              + +++EG+ N+ASAGILIYM+LVDLLA DFM+PR+  N  L   A  SL+LGA  MS+L
Sbjct  292   KEAIMVEGMLNAASAGILIYMSLVDLLAPDFMNPRLQSNLWLHLAAYLSLVLGAASMSLL  351

Query  1255  aKWA  1266
             A WA
Sbjct  352   AIWA  355



>ref|XP_002322355.2| root iron transporter family protein [Populus trichocarpa]
 gb|EEF06482.2| root iron transporter family protein [Populus trichocarpa]
Length=337

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 165/296 (56%), Positives = 209/296 (71%), Gaps = 12/296 (4%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P+  R IPAL P+ S F +VKAFAAG+ILATGF+HVLPD+F+ L+S  L ++PW  FPF 
Sbjct  49    PLFTRSIPALHPDRSLFVIVKAFAAGIILATGFMHVLPDSFDMLSSSCLPENPWHKFPFT  108

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSG-----EKVTAGHEAGDAEVGpgvvpvhthathg  738
             GF+AM++AI TLMVDS ATS +S +S      E +T G E  D E+   V   H H  H 
Sbjct  109   GFLAMLSAIVTLMVDSLATSVYSKKSNVGVNPESITHGAEQ-DREMASNVGHFHGHGHHY  167

Query  739   hahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTF  918
                        D + QLLR+RV++ VLELGIIVHSV+IG++LGAS    TIK LVAAL F
Sbjct  168   EDKL------ADGAKQLLRYRVVAMVLELGIIVHSVVIGLSLGASSNTCTIKGLVAALCF  221

Query  919   HQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEG  1098
             HQ FEGMGLGGCI QA++K    A+MA FF++TTP GI IGI ++  Y E+SP  LI  G
Sbjct  222   HQMFEGMGLGGCILQAEYKPLKKAVMAFFFAVTTPFGIAIGIALSKMYKENSPNALITVG  281

Query  1099  IFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             + N++SAG+LIYMALVDLLAADFM P++  + KLQ  +  ++LLGAG MS++AKWA
Sbjct  282   LLNASSAGLLIYMALVDLLAADFMGPKLQGSIKLQVKSYMAVLLGAGGMSLMAKWA  337



>ref|NP_172022.1| zinc transporter 5 [Arabidopsis thaliana]
 sp|O23039.1|ZIP5_ARATH RecName: Full=Zinc transporter 5; AltName: Full=ZRT/IRT-like 
protein 5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL38432.1|AF369909_1 putative metal transporter ZIP5 [Arabidopsis thaliana]
 gb|AAB71447.1| Similar to Arabidopsis Fe(II) transport protein (gb|U27590) [Arabidopsis 
thaliana]
 gb|AAT46031.1| At1g05300 [Arabidopsis thaliana]
 dbj|BAD44388.1| putative zinc transporter [Arabidopsis thaliana]
 gb|AEE27820.1| Fe(II) transporter isolog family protein ZIP5 [Arabidopsis thaliana]
Length=360

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 169/297 (57%), Positives = 214/297 (72%), Gaps = 7/297 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
              P++G+  P+L PE +FFF+ KAFAAGVILATGF+HVLP+ +E LTS  L    W +FPF
Sbjct  66    FPLLGKFFPSLKPETTFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKGEAW-EFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AMVAAI TL VDSFATSYF     ++ +++  G E  DA  G G         H H
Sbjct  125   TGFIAMVAAILTLSVDSFATSYFHKAHFKTSKRIGDGEEQ-DAGGGGGGGDELGLHVHAH  183

Query  742   ahg--hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALT  915
              H    V V   +S  QL R RV++QVLE+GIIVHSV+IGI+LGAS +P T K L AAL 
Sbjct  184   GHTHGIVGVESGESQVQLHRTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALM  243

Query  916   FHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIE  1095
             FHQ FEG+GLGGCIAQ  F   S+ IM++FFS+TTP+GI +G+ I++ YD+ SP  LI++
Sbjct  244   FHQCFEGLGLGGCIAQGNFNCMSITIMSIFFSVTTPVGIAVGMAISSSYDDSSPTALIVQ  303

Query  1096  GIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             G+ N+ASAGILIYM+LVD LAADFM P+M  N +LQ  A+ SLL+GAG+MS+LAKWA
Sbjct  304   GVLNAASAGILIYMSLVDFLAADFMHPKMQSNTRLQIMAHISLLVGAGVMSLLAKWA  360



>ref|XP_009143963.1| PREDICTED: zinc transporter 3 [Brassica rapa]
Length=342

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 208/294 (71%), Gaps = 29/294 (10%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+  P+L PE SFFF+ KAFAAGVIL+TGF+HVLP+A+  L S  L+   W +FPF 
Sbjct  75    PLLGKVFPSLRPETSFFFVTKAFAAGVILSTGFMHVLPEAYVMLNSPCLTSEAW-EFPFT  133

Query  574   GFVAMVAAIGTLMVDSFATS--YFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
             GF+AMVAAI TL VD+FATS  Y S     K     E+G+  V                 
Sbjct  134   GFIAMVAAILTLSVDTFATSSFYKSHCKASKTIIDGESGEPSV-----------------  176

Query  748   ghvSVTDTDSSS-QLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQ  924
                     DS+  Q+LR R+I+QVLELGIIVHSV+IGI+LGAS +P+  K L  AL FHQ
Sbjct  177   --------DSAKVQILRTRIIAQVLELGIIVHSVVIGISLGASQSPEAAKALFIALMFHQ  228

Query  925   FFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIF  1104
              FEG+GLGGCIAQ KFK  SV IM+ FF++TTP+GIV+G+GI++ YDE SP  LI++G+ 
Sbjct  229   CFEGLGLGGCIAQGKFKCLSVTIMSTFFAVTTPIGIVVGMGISDTYDESSPTALIVQGVL  288

Query  1105  NSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             N+ASAGILIYM+LVDLLAADFM P+M  N  LQ  A+ SLLLGAGLMS+LAKWA
Sbjct  289   NAASAGILIYMSLVDLLAADFMHPKMQSNTGLQIMAHISLLLGAGLMSLLAKWA  342



>ref|XP_011040375.1| PREDICTED: fe(2+) transport protein 1-like [Populus euphratica]
Length=358

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 202/291 (69%), Gaps = 0/291 (0%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P+  R IPAL P+ S F +VKAFAAG+ILATGF+HVLPD+F+ L+S  L ++PW  FPF 
Sbjct  68    PLFTRSIPALHPDRSLFVIVKAFAAGIILATGFMHVLPDSFDMLSSSCLPENPWHKFPFT  127

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             GFVAM++AI TLMVDS ATS +S +S   V        AE    +   H H        H
Sbjct  128   GFVAMLSAIVTLMVDSLATSVYSKKSTVGVNPESNTHGAEPDQEMAVGHFHGHGNGHGHH  187

Query  754   vSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFE  933
                   D   QLLR+RV++ VLELGIIVHSV+IG++LGAS    TIK LVAAL FHQ FE
Sbjct  188   YEAKLADGEKQLLRYRVVAMVLELGIIVHSVVIGLSLGASSNTCTIKGLVAALCFHQMFE  247

Query  934   GMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSA  1113
             GMGLGGCI QA++K    A+MA FF++TTP GI +GI ++  Y E SP  LI  G+ N++
Sbjct  248   GMGLGGCILQAEYKPFKKAVMAFFFAVTTPFGIALGIALSKMYKESSPNALITVGLLNAS  307

Query  1114  SAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             SAG+LIYMALVDLLAADFM P++  + KLQ  +  ++LLGAG MS++AKWA
Sbjct  308   SAGLLIYMALVDLLAADFMGPKLQGSIKLQLKSYMAVLLGAGGMSLMAKWA  358



>ref|XP_009772024.1| PREDICTED: zinc transporter 1-like [Nicotiana sylvestris]
Length=370

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 216/298 (72%), Gaps = 6/298 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLS-KHPWRDFP  567
             LP++ R+I AL PE   FFM+KAFAAGVILATGFIH+LPDAF+ LTS  L   +PW  FP
Sbjct  73    LPLLARKIEALRPENDIFFMIKAFAAGVILATGFIHILPDAFQTLTSPCLQGMNPWGKFP  132

Query  568   FCGFVAMVAAIGTLMVDSFATSYFSGR----SGEKVTAGHEAGDAEVGpgvvpvhthath  735
             F GF AMVA+IG LM+D+FATS +  R    + +   A  EA   ++            H
Sbjct  133   FTGFFAMVASIGCLMIDTFATSIYQKRHFHIAKQVNIADEEAARDDIQHSHSHTSHVHGH  192

Query  736   ghahghvSVTDTD-SSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAAL  912
              H   +   +D +   S+ +R+R+ISQVLELGI+VHS+IIG++LGAS   + IKPL+ AL
Sbjct  193   AHGATYSIGSDQELILSENIRNRIISQVLELGILVHSIIIGVSLGASQNTQMIKPLLVAL  252

Query  913   TFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLII  1092
             +FHQFFEGMGLGGCI+QAKFKS S AIMA+ FSLTTP GI IGIGI+  Y+  S   LI+
Sbjct  253   SFHQFFEGMGLGGCISQAKFKSVSTAIMAVLFSLTTPAGIGIGIGISRVYNAHSSISLIV  312

Query  1093  EGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             EGI NSAS+GILIYMALVD+LA+DFM+P+M  N +L  GA+ SLLLGAG MS++AKWA
Sbjct  313   EGILNSASSGILIYMALVDILASDFMNPKMQNNVRLLCGAHISLLLGAGCMSVMAKWA  370



>ref|XP_008225789.1| PREDICTED: fe(2+) transport protein 1-like [Prunus mume]
Length=358

 Score =   288 bits (736),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 167/293 (57%), Positives = 210/293 (72%), Gaps = 1/293 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+V R IPAL P+ + F +VK FAAG+ILATGF+HVLPD+F+ L+S+ L ++PW  FPF
Sbjct  66    LPLVTRSIPALHPDRNLFVIVKCFAAGIILATGFMHVLPDSFDMLSSNCLKENPWHKFPF  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGH-EAGDAEVGpgvvpvhthathghah  747
              GFVAM++AI TLMVDS ATS +S R    V   +      EV   +  V     H HAH
Sbjct  126   SGFVAMLSAIVTLMVDSMATSIYSKRCRTGVIPDNGTVAAVEVDQEMAAVGAGHGHFHAH  185

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
              H  V   +  SQL R+RV++ VLELGIIVHSV+IG++LGAS+   TIK LVAAL FHQ 
Sbjct  186   SHDIVKGGNEDSQLPRYRVVAMVLELGIIVHSVVIGLSLGASNNTCTIKGLVAALCFHQM  245

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCI QA++K    AIM  FFS TTP GI IG+ +T  Y E+SP+ LI  G+ N
Sbjct  246   FEGMGLGGCILQAEYKFMKKAIMVFFFSTTTPFGIAIGMALTKSYKENSPRSLITVGLLN  305

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ++SAG+LIYMALVDLLAADFM P++ ++ KLQ  +  ++LLGAG MS+LAKWA
Sbjct  306   ASSAGLLIYMALVDLLAADFMGPKLQRSIKLQIKSYMAVLLGAGGMSVLAKWA  358



>ref|XP_007214341.1| hypothetical protein PRUPE_ppa027114mg [Prunus persica]
 gb|EMJ15540.1| hypothetical protein PRUPE_ppa027114mg [Prunus persica]
Length=358

 Score =   288 bits (736),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 167/293 (57%), Positives = 210/293 (72%), Gaps = 1/293 (0%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+V R IPAL P+ + F +VK FAAG+ILATGF+HVLPD+F+ L+S+ L ++PW  FPF
Sbjct  66    LPLVTRSIPALHPDRNLFVIVKCFAAGIILATGFMHVLPDSFDMLSSNCLKENPWHKFPF  125

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGH-EAGDAEVGpgvvpvhthathghah  747
              GFVAM++AI TLMVDS ATS +S R    V   +      EV   +  V     H HAH
Sbjct  126   SGFVAMLSAIVTLMVDSMATSIYSKRCRTGVIPDNGTVAAVEVDQEMAAVGAGHGHFHAH  185

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
              H  V   +  SQL R+RV++ VLELGIIVHSV+IG++LGAS+   TIK LVAAL FHQ 
Sbjct  186   SHDIVKGGNEDSQLPRYRVVAMVLELGIIVHSVVIGLSLGASNNTCTIKGLVAALCFHQM  245

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEGMGLGGCI QA++K    AIM  FFS TTP GI IG+ +T  Y E+SP+ LI  G+ N
Sbjct  246   FEGMGLGGCILQAEYKFMKKAIMVFFFSTTTPFGIAIGMALTKSYKENSPRSLITVGLLN  305

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             ++SAG+LIYMALVDLLAADFM P++ ++ KLQ  +  ++LLGAG MS+LAKWA
Sbjct  306   ASSAGLLIYMALVDLLAADFMGPKLQRSIKLQIKSYMAVLLGAGGMSVLAKWA  358



>gb|AAR08416.1| metal transport protein [Medicago truncatula]
Length=360

 Score =   288 bits (736),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 159/295 (54%), Positives = 203/295 (69%), Gaps = 10/295 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R IPALSPEG  F +VK FAAG+IL TGF+HVLPD++E L SD L + PW +FPF
Sbjct  73    LPLATRSIPALSPEGDLFIIVKCFAAGIILGTGFMHVLPDSYEMLWSDCLDEKPWHEFPF  132

Query  571   CGFVAMVAAIGTLMVDSFATSYFS--GRSGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
              G VAM +A+ T+MVDS ATSY+S  G+SG  +   H   D E+G      H        
Sbjct  133   SGLVAMFSAVVTMMVDSIATSYYSKKGKSGVVIPESHGGDDQEIGHSHGGHHHIHNGFK-  191

Query  745   hghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLV-AALTFH  921
                   T+     QLLR+RV+  VLELGI+VHSV+IG+ +GAS+   +IK ++ AAL FH
Sbjct  192   ------TEESDEPQLLRYRVVVMVLELGIVVHSVVIGLGMGASNNTCSIKGILSAALCFH  245

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             Q FEGMGLGGCI QAK+K    A++  FFS+TTPLGI IG+ ++  Y E+SP  LI  G+
Sbjct  246   QMFEGMGLGGCILQAKYKFLKNAMLVFFFSITTPLGIAIGLAMSTSYKENSPVALITVGL  305

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              N++SAG+LIYMALVDLLAADFMS RM  + KLQ  +  ++ LGAG MS++AKWA
Sbjct  306   LNASSAGLLIYMALVDLLAADFMSKRMQSSIKLQLKSYVAVFLGAGGMSLMAKWA  360



>ref|XP_010469621.1| PREDICTED: zinc transporter 3 [Camelina sativa]
Length=339

 Score =   287 bits (734),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 163/295 (55%), Positives = 206/295 (70%), Gaps = 31/295 (11%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++G+  P L PE  FFF+ KAFAAGVILATGF+HVLP+A+  L S  L+   W +FPF 
Sbjct  72    PLLGKVFPPLRPETPFFFVTKAFAAGVILATGFMHVLPEAYTMLNSPCLTSEAW-EFPFT  130

Query  574   GFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgha  744
             GF+AMVAAI TL VD+FATS F     ++ +K+  G   G +                  
Sbjct  131   GFIAMVAAILTLSVDTFATSSFYKSHCKASKKINDGESGGPS------------------  172

Query  745   hghvSVTDTDSSS-QLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                      DS+  Q+LR R+I+QVLELGI+VHSV+IGI+LGAS +P+  K L  AL FH
Sbjct  173   --------VDSAQVQVLRTRIIAQVLELGILVHSVVIGISLGASQSPEAAKALFIALMFH  224

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             Q FEG+GLGGCIAQ KFK  SV +M+ FF++TTP+GIV+G+GI N YDE SP  LI++G+
Sbjct  225   QCFEGLGLGGCIAQGKFKCLSVTLMSTFFAITTPIGIVVGMGIANSYDESSPTALIVQGV  284

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              N+ASAGILIYM+LVDLLAADFM P+M  N  LQ  A+ +LL+GAGLMS+LAKWA
Sbjct  285   LNAASAGILIYMSLVDLLAADFMHPKMQSNTGLQIMAHIALLIGAGLMSLLAKWA  339



>ref|XP_011085164.1| PREDICTED: probable zinc transporter 10 [Sesamum indicum]
Length=348

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 159/291 (55%), Positives = 207/291 (71%), Gaps = 4/291 (1%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++ R IPALSP+ + F +VKAFAAG+ILATGF+HVLPD+F+ L+S  L  +PW  FPF 
Sbjct  62    PLLTRSIPALSPDRNLFVIVKAFAAGIILATGFMHVLPDSFDMLSSSCLKDNPWHKFPFT  121

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahgh  753
             GFVAM++AI TLM+DS ATS +S +    +      GD E+       H+H    H    
Sbjct  122   GFVAMLSAIITLMIDSMATSLYSKKHKAALVLPESGGDQEMAVVEAAAHSHFHGHHHGSK  181

Query  754   vSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFFE  933
             + V      SQLLR+RVI+ VLELGIIVHSV+IG++LGAS+   +IK LVAAL FHQ FE
Sbjct  182   LEV----EGSQLLRYRVIAMVLELGIIVHSVVIGLSLGASNNTCSIKGLVAALCFHQMFE  237

Query  934   GMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNSA  1113
             GMGLGGCI QA++K    A MA FFS+TTP GI +G+ + + Y E+SP+ LI  G+ N++
Sbjct  238   GMGLGGCILQAEYKFLKKAAMAFFFSVTTPFGIALGLALASSYKENSPRALITVGLLNAS  297

Query  1114  SAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             SAG+LIYMALVDLLAADFM  ++  + KLQ  +  ++LLGAG MS++AKWA
Sbjct  298   SAGLLIYMALVDLLAADFMGQKLQGSVKLQIKSYVAVLLGAGGMSLMAKWA  348



>ref|NP_001234248.1| iron-regulated transporter 1 precursor [Solanum lycopersicum]
 gb|AAD30548.1|AF136579_1 iron-regulated transporter 1 [Solanum lycopersicum]
 gb|AAF97509.1|AF246266_1 iron-regulated transporter 1 [Solanum lycopersicum]
Length=350

 Score =   287 bits (735),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 195/271 (72%), Gaps = 6/271 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+V R IPALSPE + F +VKAFAAG+ILATGF+HVLPD+F+ L+S  L +HPW  FPF
Sbjct  65    LPLVTRSIPALSPERNLFVIVKAFAAGIILATGFMHVLPDSFDMLSSSCLKEHPWHKFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AI T+ +DS ATS +S +    V   +  GD E+      VH+H  HG    
Sbjct  125   TGFVAMLSAIVTMAIDSIATSLYSKKHNGGVV--NPEGDQEMAVAGNHVHSHHHHGSL--  180

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
               S  D     +LLR+RVI+ VLELGIIVHS++IG++LGAS    TIK LVAAL FHQ F
Sbjct  181   --STKDGLDGKKLLRYRVIAMVLELGIIVHSIVIGLSLGASSNTCTIKGLVAALCFHQMF  238

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QA++K    AIMA FF++TTP GI +GI ++  Y+E+SP+ LI  G+ N+
Sbjct  239   EGMGLGGCILQAEYKFMKKAIMAFFFAVTTPFGIALGIALSTTYEENSPRALITVGLLNA  298

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQ  1203
             +SAG+LIYMALVDLLAADFM  ++  + KLQ
Sbjct  299   SSAGLLIYMALVDLLAADFMGDKLQGSVKLQ  329



>ref|XP_010538635.1| PREDICTED: probable zinc transporter 12 [Tarenaya hassleriana]
Length=357

 Score =   287 bits (735),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 164/293 (56%), Positives = 212/293 (72%), Gaps = 3/293 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LPV+GR+   L PE +FFF+++AFAAGVILATGFIH+LPDA ENLTS  L + PW DFP 
Sbjct  67    LPVLGRKFSFLRPESNFFFLIRAFAAGVILATGFIHILPDAGENLTSPCLGEAPWGDFPM  126

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGR-SGEKVTAGHEAGDAEVGpgvvpvhthathghah  747
              G +AM +AI T++++SFA  YF    SGEK +    AG  +    +     H  H H H
Sbjct  127   SGLIAMASAIVTMLIESFAAGYFQRLLSGEKNSLPVVAGGGK--QVLGTGGGHEGHVHVH  184

Query  748   ghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQF  927
              H S  +     +L+RH++++QVLELGI+VHSVIIG++LGAS    TIKPL+ ALTFHQ 
Sbjct  185   LHGSTFNESGEIKLIRHKIVTQVLELGIVVHSVIIGLSLGASQDLDTIKPLLVALTFHQL  244

Query  928   FEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFN  1107
             FEG+GLGGCI+QAKFK  ++A M LFF+LTTP+GI IGIG+   Y+E+SP  L++ GI N
Sbjct  245   FEGLGLGGCISQAKFKVGTIATMVLFFALTTPVGIGIGIGVAETYNENSPTALMVSGILN  304

Query  1108  SASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             SA+AGILIYMALVDLLAA+F  P++  + ++Q   + SLLLGA  MS+LA WA
Sbjct  305   SAAAGILIYMALVDLLAAEFNDPKVQGSFRMQISCSLSLLLGAAAMSLLAIWA  357



>ref|XP_002315981.2| zinc transporter 7 precursor family protein [Populus trichocarpa]
 gb|EEF02152.2| zinc transporter 7 precursor family protein [Populus trichocarpa]
Length=359

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/307 (52%), Positives = 208/307 (68%), Gaps = 29/307 (9%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R IPAL P+   F ++KAFA+GVILATG++HVLPD+F +L SD L  +PW+ FPF
Sbjct  67    LPLFSRAIPALMPDRDLFVVIKAFASGVILATGYMHVLPDSFNDLMSDCLPINPWKKFPF  126

Query  571   CGFVAMVAAIGTLMVDSFATSYFS---------GRSGEKVTAGH------EAGDAEVGpg  705
               FVAM++A+ TLM+DSFA SY+          G  GEKV  G       E G A VG  
Sbjct  127   TTFVAMLSALLTLMIDSFAMSYYKKHGFDRKGGGVDGEKVNNGERGLGNVENGSAHVGHC  186

Query  706   vvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPK  885
                                   D  S LLR+RV++QVLE+GI+VHSV+IG+++GAS+ P 
Sbjct  187   HGFNGGA--------------NDKDSMLLRNRVVAQVLEIGIVVHSVVIGLSMGASNNPC  232

Query  886   TIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYD  1065
             TI+PL+AAL FHQ FEGMGLGGCI QA++  +  AI+  FFS TTP GIV+GIG++N Y 
Sbjct  233   TIRPLIAALCFHQLFEGMGLGGCILQAEYGMKIKAILVFFFSTTTPFGIVLGIGLSNVYS  292

Query  1066  EDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglm  1245
             E SP  LI+ G+ N++SAG+L YMALVDLLAADFM P++  + +LQ  +  ++LLGAG M
Sbjct  293   ESSPTALIVVGLLNASSAGLLNYMALVDLLAADFMGPKLQDSMRLQAWSFIAVLLGAGGM  352

Query  1246  smlaKWA  1266
             S++AKWA
Sbjct  353   SLMAKWA  359



>gb|AFK33510.1| unknown [Lotus japonicus]
Length=356

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/295 (54%), Positives = 210/295 (71%), Gaps = 8/295 (3%)
 Frame = +1

Query  394   PVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPFC  573
             P++ R IPA SPE + F +VK FAAG+IL TGF+HVLPD+F+ L SD L + PW +FPF 
Sbjct  66    PLLTRSIPAFSPESNLFIIVKCFAAGIILGTGFVHVLPDSFDMLWSDCLQEKPWHEFPFS  125

Query  574   GFVAMVAAIGTLMVDSFATSYFSGRSGEKVT-AGHEAG--DAEVGpgvvpvhthathgha  744
             GFVAM +A+ T+M+DS ATS+++ R+   V    H  G  D E+G  V   H+H  H   
Sbjct  126   GFVAMFSALVTMMIDSLATSFYTRRNKSGVIPENHVEGGEDREMGAVVNVGHSHGHHHFH  185

Query  745   hghvSVTDTD-SSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
                   T TD + SQL+R+RV++ VLELGI+VHSV+IG+++GAS+   TIK LVAA+ FH
Sbjct  186   QE----TKTDRTDSQLMRYRVVATVLELGIVVHSVVIGLSMGASNNTCTIKGLVAAMCFH  241

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             Q FEGMGLGGCI QA++     AI   FFS+TTP GI +G+ ++  Y E+SP  LII G+
Sbjct  242   QMFEGMGLGGCILQAEYNFAKKAIFVFFFSVTTPFGIALGMAMSTSYKENSPSALIIVGL  301

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              N++SAG+L+YMALVDLLAADFMSPR+  + KLQ  +  ++ LGAG MS++AKWA
Sbjct  302   LNASSAGLLVYMALVDLLAADFMSPRLQGSIKLQLKSYIAVFLGAGAMSLMAKWA  356



>ref|XP_011009052.1| PREDICTED: fe(2+) transport protein 1-like [Populus euphratica]
Length=359

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 208/307 (68%), Gaps = 29/307 (9%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R IPAL P+   F +VKAFA+GVILATG++HVLPD+F +L SD L  +PW+ FPF
Sbjct  67    LPLFSRTIPALMPDRDLFVVVKAFASGVILATGYMHVLPDSFNDLMSDCLPINPWKKFPF  126

Query  571   CGFVAMVAAIGTLMVDSFATSYFS---------GRSGEKVTAGH------EAGDAEVGpg  705
               FVAM++AI TLM+DSFA SY+          G  GEKV  G       E G A VG  
Sbjct  127   TTFVAMLSAILTLMIDSFAMSYYKKHGFDKKGGGVDGEKVNNGERGLGNVENGGAHVGHC  186

Query  706   vvpvhthathghahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPK  885
                                   D  S LLR+RV++QVLE+GI+VHSV+IG+++GAS+ P 
Sbjct  187   GGFNGGA--------------NDKDSMLLRNRVVAQVLEIGIVVHSVVIGLSMGASNNPC  232

Query  886   TIKPLVAALTFHQFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYD  1065
             TI+PL+AAL FHQ FEGMGLGGCI QA++  +  AI+  FFS TTP GIV+GIG++N Y 
Sbjct  233   TIRPLIAALCFHQLFEGMGLGGCILQAEYGMKIKAILVFFFSTTTPFGIVLGIGLSNVYS  292

Query  1066  EDSPKVLIIEGIFNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglm  1245
             + SP  LI+ G+ N++SAG+L YMALVDLLAADFM P++  + +LQ  +  ++LLGAG M
Sbjct  293   DSSPTALIVVGLLNASSAGLLNYMALVDLLAADFMGPKLQDSMRLQAWSFIAVLLGAGGM  352

Query  1246  smlaKWA  1266
             S++AKWA
Sbjct  353   SLMAKWA  359



>ref|XP_010484879.1| PREDICTED: zinc transporter 5 [Camelina sativa]
Length=355

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 168/295 (57%), Positives = 212/295 (72%), Gaps = 7/295 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
              P++G+  P+L PE + FF+ KAFAAGVILATGF+HVLP+ +E LTS  L    W +FPF
Sbjct  65    FPLLGKFFPSLRPETTLFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKGEAW-EFPF  123

Query  571   CGFVAMVAAIGTLMVDSFATSYFSG---RSGEKVTAGHEAGDAEVGpgvvpvhthathgh  741
              GF+AMVAAI TL VDSFATSYF     ++ +++  G E      G G         HGH
Sbjct  124   TGFIAMVAAILTLSVDSFATSYFHRLHFKTSKRIGDGEEQ---RGGGGDDLGLHVHAHGH  180

Query  742   ahghvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFH  921
              HG V V   DS  QL R RV++QVLE+GIIVHSV+IGI+LGAS +P T K L AAL FH
Sbjct  181   THGIVGVESGDSEVQLHRTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFH  240

Query  922   QFFEGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGI  1101
             Q FEG+GLGGCIAQ  F   S+ +M++FFS+TTP+GI +G+ I + Y+E SP  LI++G+
Sbjct  241   QCFEGLGLGGCIAQGNFNCMSITVMSIFFSVTTPVGIAVGMAILSSYNESSPTALIVQGV  300

Query  1102  FNSASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              N+ASAGILIYM+LVD LAADFM P+M  N +LQ  A+ SLL+GAG+MS+LAKWA
Sbjct  301   LNAASAGILIYMSLVDFLAADFMHPKMQSNTRLQIMAHISLLVGAGIMSLLAKWA  355



>ref|XP_009622108.1| PREDICTED: fe(2+) transport protein 1-like [Nicotiana tomentosiformis]
Length=358

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 196/271 (72%), Gaps = 5/271 (2%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+V R +PAL P+ + F +VKAFA+GVILATG++HV+PD+F+ LTSD L  +PW+ FPF
Sbjct  72    LPLVSRTVPALQPDKNLFLLVKAFASGVILATGYMHVMPDSFDCLTSDCLPDNPWKKFPF  131

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
               FVAM++AI TL VDS+A SYF      K+ +G   G   V  G +       + H HG
Sbjct  132   TTFVAMLSAILTLSVDSYAMSYFKKY---KLESGVGNGRDFVHNGKMESQIIDNNSHIHG  188

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                V D   ++QLLR+RV++QVLELGI+VHSV+IG+++GASD P TI+PLVAA+ FHQ F
Sbjct  189   EAKVDD--KAAQLLRYRVVAQVLELGIVVHSVVIGLSMGASDNPCTIRPLVAAICFHQLF  246

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QA++  +  +IM  FFSLTTP GI +GIG++  Y E+SP  LI+ G+ N+
Sbjct  247   EGMGLGGCILQAEYGMKLKSIMVFFFSLTTPFGIALGIGLSKVYSENSPTALIVVGLLNA  306

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQ  1203
              SAG+L YMALVDLLAADFM  ++  + KLQ
Sbjct  307   CSAGLLNYMALVDLLAADFMGTKLQNSMKLQ  337



>ref|XP_008439828.1| PREDICTED: fe(2+) transport protein 1-like [Cucumis melo]
Length=347

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 157/292 (54%), Positives = 202/292 (69%), Gaps = 9/292 (3%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R +P L PEG  F +VKAFA+GVILATG++HVLPD+F  LTS  L ++PWR FPF
Sbjct  65    LPLFSRAMPVLQPEGKTFAIVKAFASGVILATGYMHVLPDSFNFLTSPCLPENPWRKFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
               F+AM++AI TLM+DSF  S+++ +S +   +  E    E                  G
Sbjct  125   PTFIAMLSAIMTLMLDSFTLSHYNKQSVQDQLSEEEEIKNE---------NRKEMSENLG  175

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                 T     SQLLRHRVI+Q+LE GI+VHSV+IG++LGAS+ P TI+PL+AAL FHQ F
Sbjct  176   KEEGTGKKLDSQLLRHRVIAQLLEAGILVHSVVIGLSLGASENPCTIRPLIAALCFHQLF  235

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QA+++ +  AIM  FFS+TTP GI +GIG++N Y E+SP  LI+ GI N+
Sbjct  236   EGMGLGGCILQAEYRIKMKAIMVFFFSVTTPFGIGLGIGLSNVYSENSPTALIVVGILNA  295

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
              SAG+L YMALVDLLA DFM P++  N KL   A  ++LLG G MS+LAKWA
Sbjct  296   LSAGLLNYMALVDLLAHDFMGPKLQANLKLHIWAYVAVLLGVGGMSLLAKWA  347



>ref|XP_006448755.1| hypothetical protein CICLE_v10015769mg [Citrus clementina]
 gb|ESR61995.1| hypothetical protein CICLE_v10015769mg [Citrus clementina]
Length=353

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/292 (54%), Positives = 205/292 (70%), Gaps = 3/292 (1%)
 Frame = +1

Query  391   LPVVGRRIPALSPEGSFFFMVKAFAAGVILATGFIHVLPDAFENLTSDKLSKHPWRDFPF  570
             LP+  R IPAL P+ + F +VKAFAAG+ILATGF+HVLPD+F+ LTS  L  +PW  FPF
Sbjct  65    LPLFTRWIPALHPDRNLFVVVKAFAAGIILATGFMHVLPDSFDMLTSSCLKDNPWHKFPF  124

Query  571   CGFVAMVAAIGTLMVDSFATSYFSGRSGEKVTAGHEAGDAEVGpgvvpvhthathghahg  750
              GFVAM++AI TLMVDS ATS +S +    V    EAG+ +     V    H        
Sbjct  125   SGFVAMLSAIATLMVDSLATSIYSKKCNSGVIP--EAGERD-QERAVASFGHVHGHAHGL  181

Query  751   hvSVTDTDSSSQLLRHRVISQVLELGIIVHSVIIGIALGASDTPKTIKPLVAALTFHQFF  930
                  D DSS QLLR+RVI+ VLELGI+VHS++IG+++GA++   TIK L+AAL FHQ F
Sbjct  182   SPDPKDADSSQQLLRYRVIAMVLELGIVVHSIVIGLSVGATNNTCTIKGLIAALCFHQMF  241

Query  931   EGMGLGGCIAQAKFKSQSVAIMALFFSLTTPLGIVIGIGITNRYDEDSPKVLIIEGIFNS  1110
             EGMGLGGCI QA++K     +M  FFS+TTP GI +GI ++  Y E+SP  LI  G+ N+
Sbjct  242   EGMGLGGCILQAEYKLMKRLVMVFFFSVTTPFGIALGIALSKTYKENSPSSLITVGLLNA  301

Query  1111  ASAGILIYMALVDLLAADFMSPRMHKNPKLQFGANTslllgaglmsmlaKWA  1266
             +SAG+LIYMALVDLL+ADFM P++  N KLQ  +  ++LLGAG MS++AKWA
Sbjct  302   SSAGLLIYMALVDLLSADFMGPKLQGNIKLQVKSYVAVLLGAGGMSLMAKWA  353



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4064136415066