BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c90547_g1_i1 len=951 path=[1:0-950]

Length=951
                                                                      Score     E

ref|XP_004228722.1|  PREDICTED: protein YLS3                            181   7e-52   
gb|EYU39237.1|  hypothetical protein MIMGU_mgv1a014178mg                180   1e-51   
emb|CBI16491.3|  unnamed protein product                                178   4e-51   
ref|XP_002283442.1|  PREDICTED: protein YLS3-like                       178   5e-51   Vitis vinifera
emb|CDP17362.1|  unnamed protein product                                178   9e-51   
ref|XP_006445830.1|  hypothetical protein CICLE_v10016842mg             173   6e-49   
ref|XP_007163836.1|  hypothetical protein PHAVU_001G268300g             172   1e-48   
ref|XP_007014734.1|  Bifunctional inhibitor/lipid-transfer protei...    169   1e-47   
ref|XP_006492750.1|  PREDICTED: uncharacterized protein LOC102613530    174   4e-47   
gb|KHN44488.1|  Putative GPI-anchored protein                           165   5e-46   
ref|XP_006354156.1|  PREDICTED: non-specific lipid-transfer prote...    165   8e-46   
gb|KDP44350.1|  hypothetical protein JCGZ_19217                         164   9e-46   
gb|KGN54079.1|  hypothetical protein Csa_4G280560                       164   1e-45   
ref|XP_010257571.1|  PREDICTED: protein YLS3                            164   1e-45   
ref|XP_007205970.1|  hypothetical protein PRUPE_ppa012060mg             163   5e-45   
ref|NP_001237564.1|  uncharacterized protein LOC100305590 precursor     162   8e-45   
ref|XP_002270671.1|  PREDICTED: protein YLS3                            161   1e-44   Vitis vinifera
ref|XP_008225280.1|  PREDICTED: protein YLS3-like                       160   3e-44   
ref|XP_009364110.1|  PREDICTED: protein YLS3-like                       160   4e-44   
ref|XP_010243423.1|  PREDICTED: protein YLS3-like                       161   8e-44   
ref|XP_008384404.1|  PREDICTED: protein YLS3-like                       159   9e-44   
ref|XP_011089694.1|  PREDICTED: protein YLS3-like                       159   9e-44   
gb|KHG12536.1|  hypothetical protein F383_03102                         158   3e-43   
ref|XP_009628973.1|  PREDICTED: protein YLS3-like                       158   4e-43   
ref|XP_009766807.1|  PREDICTED: protein YLS3-like                       157   6e-43   
ref|XP_010673513.1|  PREDICTED: protein YLS3                            157   1e-42   
gb|KHN47957.1|  Putative GPI-anchored protein                           157   1e-42   
ref|XP_010044958.1|  PREDICTED: protein YLS3-like                       156   3e-42   
emb|CBI16494.3|  unnamed protein product                                155   4e-42   
ref|XP_010101137.1|  hypothetical protein L484_016701                   155   4e-42   
ref|NP_001238362.1|  uncharacterized protein LOC100499687 precursor     155   5e-42   
ref|XP_002285691.1|  PREDICTED: protein YLS3-like                       155   5e-42   Vitis vinifera
emb|CAN59826.1|  hypothetical protein VITISV_016657                     163   7e-42   Vitis vinifera
ref|XP_008449799.1|  PREDICTED: protein YLS3                            153   2e-41   
ref|XP_007159392.1|  hypothetical protein PHAVU_002G234400g             153   2e-41   
ref|XP_003561314.1|  PREDICTED: protein YLS3-like isoform X2            153   2e-41   
ref|XP_010542451.1|  PREDICTED: protein YLS3-like isoform X2            153   2e-41   
ref|XP_010044960.1|  PREDICTED: protein YLS3-like                       153   3e-41   
ref|NP_001235687.1|  uncharacterized protein LOC100306483 precursor     152   4e-41   
ref|XP_002309285.2|  hypothetical protein POPTR_0006s21040g             152   5e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006579354.1|  PREDICTED: uncharacterized protein LOC100306...    152   5e-41   
ref|XP_011089118.1|  PREDICTED: protein YLS3-like                       152   6e-41   
ref|XP_003629697.1|  Non-specific lipid-transfer protein-like pro...    152   9e-41   
ref|XP_002530873.1|  lipid binding protein, putative                    150   1e-40   Ricinus communis
ref|XP_010101138.1|  putative GPI-anchored protein                      151   1e-40   
ref|XP_010542450.1|  PREDICTED: protein YLS3-like isoform X1            151   2e-40   
ref|XP_011009645.1|  PREDICTED: protein YLS3-like                       151   2e-40   
ref|XP_009375461.1|  PREDICTED: protein YLS3-like                       151   2e-40   
emb|CCH50970.1|  T4.9                                                   150   2e-40   
gb|KHG18912.1|  hypothetical protein F383_24909                         150   3e-40   
ref|XP_006369483.1|  hypothetical protein POPTR_0001s23850g             150   3e-40   
ref|XP_004955761.1|  PREDICTED: non-specific lipid-transfer prote...    150   4e-40   
ref|XP_010934252.1|  PREDICTED: protein YLS3                            150   4e-40   
ref|XP_008351727.1|  PREDICTED: protein YLS3-like                       150   5e-40   
ref|XP_011025176.1|  PREDICTED: protein YLS3                            149   6e-40   
ref|XP_006838654.1|  hypothetical protein AMTR_s00002p00240480          149   1e-39   
gb|ACU14650.1|  unknown                                                 149   1e-39   Glycine max [soybeans]
ref|XP_008451096.1|  PREDICTED: protein YLS3-like                       148   2e-39   
ref|XP_009770685.1|  PREDICTED: protein YLS3-like                       148   2e-39   
ref|XP_004504343.1|  PREDICTED: non-specific lipid-transfer prote...    148   3e-39   
ref|XP_008378010.1|  PREDICTED: protein YLS3-like                       148   3e-39   
gb|KFK38683.1|  hypothetical protein AALP_AA3G147000                    147   4e-39   
ref|XP_008231395.1|  PREDICTED: protein YLS3-like isoform X2            147   6e-39   
ref|XP_004504341.1|  PREDICTED: non-specific lipid-transfer prote...    147   7e-39   
ref|XP_004502215.1|  PREDICTED: non-specific lipid-transfer prote...    146   8e-39   
ref|XP_007219100.1|  hypothetical protein PRUPE_ppa015466mg             145   1e-38   
ref|XP_008802527.1|  PREDICTED: protein YLS3-like                       146   1e-38   
ref|XP_004229337.1|  PREDICTED: protein YLS3                            146   1e-38   
gb|AFK37798.1|  unknown                                                 146   1e-38   
ref|XP_011093401.1|  PREDICTED: protein YLS3-like                       146   1e-38   
ref|XP_004165809.1|  PREDICTED: uncharacterized GPI-anchored prot...    146   1e-38   
ref|XP_006359139.1|  PREDICTED: non-specific lipid-transfer prote...    146   1e-38   
emb|CDP07663.1|  unnamed protein product                                146   2e-38   
ref|XP_010534886.1|  PREDICTED: protein YLS3-like                       145   2e-38   
ref|XP_007052623.1|  Bifunctional inhibitor/lipid-transfer protei...    145   2e-38   
gb|KHG04910.1|  hypothetical protein F383_07676                         146   2e-38   
gb|EEC81687.1|  hypothetical protein OsI_25271                          145   3e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_006369482.1|  hypothetical protein POPTR_0001s23850g             144   3e-38   
ref|XP_004144111.1|  PREDICTED: uncharacterized GPI-anchored prot...    145   4e-38   
ref|XP_011010692.1|  PREDICTED: protein YLS3-like                       145   4e-38   
ref|XP_009409233.1|  PREDICTED: protein YLS3-like                       145   5e-38   
ref|XP_010917572.1|  PREDICTED: protein YLS3-like                       144   6e-38   
ref|XP_002512201.1|  lipid binding protein, putative                    142   6e-38   Ricinus communis
gb|KFK38682.1|  hypothetical protein AALP_AA3G147000                    144   6e-38   
ref|XP_010228246.1|  PREDICTED: protein YLS3-like isoform X1            144   7e-38   
ref|XP_008231394.1|  PREDICTED: protein YLS3-like isoform X1            144   8e-38   
ref|XP_002299127.1|  hypothetical protein POPTR_0001s04590g             144   9e-38   Populus trichocarpa [western balsam poplar]
ref|XP_009354800.1|  PREDICTED: protein YLS3-like                       142   1e-37   
ref|XP_002881958.1|  protease inhibitor/seed storage/lipid transf...    144   1e-37   
ref|XP_003601632.1|  Non-specific lipid-transfer protein-like pro...    143   1e-37   
gb|KDP20375.1|  hypothetical protein JCGZ_05258                         143   1e-37   
ref|XP_009628615.1|  PREDICTED: protein YLS3-like                       143   1e-37   
ref|XP_010934234.1|  PREDICTED: protein YLS3-like isoform X1            143   2e-37   
ref|XP_006386057.1|  hypothetical protein POPTR_0003s21390g             142   2e-37   
ref|XP_010544520.1|  PREDICTED: protein YLS3-like                       143   2e-37   
ref|XP_002304871.1|  hypothetical protein POPTR_0003s21390g             143   2e-37   Populus trichocarpa [western balsam poplar]
gb|EEE66751.1|  hypothetical protein OsJ_23458                          142   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011047088.1|  PREDICTED: protein YLS3 isoform X1                 142   3e-37   
ref|XP_010098644.1|  putative GPI-anchored protein                      142   3e-37   
ref|XP_009776706.1|  PREDICTED: protein YLS3-like                       141   5e-37   
gb|AFK48853.1|  unknown                                                 141   7e-37   
gb|KDO46035.1|  hypothetical protein CISIN_1g029183mg                   141   9e-37   
ref|XP_006295014.1|  hypothetical protein CARUB_v10024085mg             141   1e-36   
gb|KEH35234.1|  Lipid transfer protein                                  139   1e-36   
ref|NP_181959.1|  bifunctional inhibitor/lipid-transfer protein/s...    141   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482799.1|  PREDICTED: protein YLS3-like                       140   1e-36   
ref|NP_001240276.1|  uncharacterized protein LOC100792950 precursor     140   2e-36   
dbj|BAJ95766.1|  predicted protein                                      140   2e-36   
gb|AFK38594.1|  unknown                                                 140   3e-36   
gb|EEC74584.1|  hypothetical protein OsI_10163                          139   3e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_006397606.1|  hypothetical protein EUTSA_v10001634mg             140   3e-36   
ref|XP_011047089.1|  PREDICTED: protein YLS3 isoform X2                 138   4e-36   
gb|AFK48341.1|  unknown                                                 137   6e-36   
gb|AII99869.1|  protease inhibitor/seed storage/ltp family              139   7e-36   
ref|XP_010518028.1|  PREDICTED: protein YLS3-like                       139   7e-36   
gb|ACU15623.1|  unknown                                                 139   8e-36   Glycine max [soybeans]
ref|XP_010506351.1|  PREDICTED: protein YLS3-like                       139   1e-35   
gb|ABF94168.1|  Protease inhibitor/seed storage/LTP family protei...    138   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010508309.1|  PREDICTED: protein YLS3-like                       138   2e-35   
gb|EEE58386.1|  hypothetical protein OsJ_09548                          137   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009397688.1|  PREDICTED: protein YLS3-like                       138   2e-35   
ref|XP_009394719.1|  PREDICTED: protein YLS3-like                       138   2e-35   
ref|XP_011088858.1|  PREDICTED: protein YLS3-like                       137   3e-35   
ref|XP_003564265.1|  PREDICTED: protein YLS3-like                       137   3e-35   
ref|XP_006439006.1|  hypothetical protein CICLE_v10033694mg             137   3e-35   
ref|XP_004294978.1|  PREDICTED: uncharacterized protein LOC101298982    137   4e-35   
ref|XP_006392665.1|  hypothetical protein EUTSA_v10011802mg             137   5e-35   
emb|CDY64362.1|  BnaAnng19290D                                          137   5e-35   
gb|KFK37241.1|  hypothetical protein AALP_AA4G232200                    137   6e-35   
ref|XP_004158216.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    136   6e-35   
ref|NP_001059125.1|  Os07g0198300                                       136   8e-35   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG92716.1|  unnamed protein product                                136   9e-35   Oryza sativa Japonica Group [Japonica rice]
gb|KEH19312.1|  Lipid transfer protein                                  135   1e-34   
ref|XP_008803424.1|  PREDICTED: protein YLS3-like                       135   1e-34   
ref|XP_007133468.1|  hypothetical protein PHAVU_011G181000g             135   1e-34   
ref|XP_009106891.1|  PREDICTED: protein YLS3-like                       135   1e-34   
emb|CDY02452.1|  BnaA08g00590D                                          135   2e-34   
ref|XP_009592816.1|  PREDICTED: protein YLS3-like isoform X1            135   2e-34   
ref|XP_004135899.1|  PREDICTED: uncharacterized GPI-anchored prot...    135   2e-34   
ref|XP_004511135.1|  PREDICTED: uncharacterized GPI-anchored prot...    134   3e-34   
ref|XP_008775497.1|  PREDICTED: protein YLS3-like                       134   3e-34   
ref|XP_009592817.1|  PREDICTED: protein YLS3-like isoform X2            134   3e-34   
gb|ABB90545.1|  lipid transfer protein                                  134   4e-34   Triticum aestivum [Canadian hard winter wheat]
emb|CDY69589.1|  BnaC04g53090D                                          134   5e-34   
ref|XP_006658373.1|  PREDICTED: protein YLS3-like                       134   6e-34   
ref|XP_002459511.1|  hypothetical protein SORBIDRAFT_02g005900          134   6e-34   Sorghum bicolor [broomcorn]
gb|AAG51569.1|AC027034_15  unknown protein; 63629-62263                 133   7e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61728.1|  unknown                                                 132   8e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564682.2|  Bifunctional inhibitor/lipid-transfer protein/s...    134   9e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480053.1|  PREDICTED: protein YLS3-like                       133   1e-33   
gb|KHG28399.1|  hypothetical protein F383_02239                         132   1e-33   
ref|XP_009143014.1|  PREDICTED: protein YLS3-like                       133   1e-33   
ref|XP_002466262.1|  hypothetical protein SORBIDRAFT_01g004610          132   2e-33   Sorghum bicolor [broomcorn]
ref|XP_008461230.1|  PREDICTED: protein YLS3-like                       132   2e-33   
ref|NP_001185235.1|  Bifunctional inhibitor/lipid-transfer protei...    133   2e-33   
gb|AES71883.2|  Lipid transfer protein                                  132   2e-33   
ref|XP_002881957.1|  protease inhibitor/seed storage/lipid transf...    132   2e-33   
ref|XP_010462370.1|  PREDICTED: protein YLS3-like                       132   3e-33   
dbj|BAJ87912.1|  predicted protein                                      132   3e-33   
ref|XP_010069341.1|  PREDICTED: protein YLS3-like                       130   8e-33   
ref|XP_004306485.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   9e-33   
ref|XP_003558736.1|  PREDICTED: protein YLS3-like                       130   1e-32   
ref|XP_006305663.1|  hypothetical protein CARUB_v10010370mg             130   2e-32   
ref|NP_181958.1|  bifunctional inhibitor/lipid-transfer protein/s...    130   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501137.1|  PREDICTED: protein YLS3-like                       129   2e-32   
gb|KCW57668.1|  hypothetical protein EUGRSUZ_H00429                     127   2e-32   
ref|XP_007029080.1|  Bifunctional inhibitor/lipid-transfer protei...    130   2e-32   
ref|XP_010693844.1|  PREDICTED: protein YLS3 isoform X2                 129   3e-32   
ref|XP_006305662.1|  hypothetical protein CARUB_v10010370mg             129   4e-32   
gb|ACG31262.1|  lipid transfer protein                                  129   4e-32   Zea mays [maize]
ref|NP_001152188.1|  lipid binding protein precursor                    129   5e-32   Zea mays [maize]
gb|ACG45950.1|  lipid transfer protein                                  129   5e-32   Zea mays [maize]
gb|ACG37967.1|  lipid transfer protein                                  129   5e-32   Zea mays [maize]
gb|EMT07496.1|  Non-specific lipid-transfer protein-like protein        128   6e-32   
gb|ACR37836.1|  unknown                                                 128   6e-32   Zea mays [maize]
ref|XP_009418410.1|  PREDICTED: protein YLS3-like                       129   7e-32   
ref|XP_002468449.1|  hypothetical protein SORBIDRAFT_01g046080          128   7e-32   Sorghum bicolor [broomcorn]
ref|XP_010693842.1|  PREDICTED: protein YLS3 isoform X1                 127   8e-32   
ref|XP_002891826.1|  protease inhibitor/seed storage/lipid transf...    127   1e-31   
ref|XP_006397607.1|  hypothetical protein EUTSA_v10001638mg             127   2e-31   
ref|NP_001170312.1|  putative bifunctional inhibitor/LTP/seed sto...    127   2e-31   Zea mays [maize]
gb|EMT07497.1|  hypothetical protein F775_15194                         126   2e-31   
gb|EMT03137.1|  hypothetical protein F775_19441                         126   3e-31   
emb|CDP10170.1|  unnamed protein product                                125   4e-31   
ref|XP_003549079.1|  PREDICTED: protein YLS3-like isoform X1            126   4e-31   
ref|XP_007152277.1|  hypothetical protein PHAVU_004G115900g             126   5e-31   
ref|NP_001152231.1|  LOC100285869 precursor                             125   5e-31   Zea mays [maize]
gb|ABR16730.1|  unknown                                                 125   7e-31   Picea sitchensis
gb|AAS07215.1|  putative protease inhibitor                             125   7e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001266562.1|  lipid binding protein                              125   8e-31   
tpg|DAA52009.1|  TPA: putative bifunctional inhibitor/LTP/seed st...    125   1e-30   
ref|XP_004142249.1|  PREDICTED: non-specific lipid-transfer prote...    123   1e-30   
ref|XP_004981375.1|  PREDICTED: non-specific lipid-transfer prote...    125   1e-30   
gb|EPS62245.1|  non-specific lipid-transfer protein                     123   2e-30   
ref|XP_004985580.1|  PREDICTED: non-specific lipid-transfer prote...    124   2e-30   
ref|XP_011075093.1|  PREDICTED: protein YLS3-like                       124   2e-30   
emb|CDY54411.1|  BnaC06g41560D                                          124   2e-30   
gb|ABK22783.1|  unknown                                                 124   2e-30   Picea sitchensis
ref|XP_009147517.1|  PREDICTED: protein YLS3-like                       124   3e-30   
emb|CDY24046.1|  BnaA06g00440D                                          122   4e-30   
gb|KEH21671.1|  RALF                                                    123   5e-30   
ref|XP_007152276.1|  hypothetical protein PHAVU_004G115800g             123   8e-30   
ref|XP_003549048.1|  PREDICTED: protein YLS3-like                       122   1e-29   
ref|XP_003549102.1|  PREDICTED: protein YLS3-like isoform X1            122   2e-29   
ref|XP_004172159.1|  PREDICTED: non-specific lipid-transfer prote...    118   7e-29   
gb|EPS60733.1|  hypothetical protein M569_14069                         117   2e-28   
ref|XP_010554897.1|  PREDICTED: protein YLS3                            116   1e-27   
ref|XP_006492819.1|  PREDICTED: protein YLS3-like isoform X1            116   1e-27   
ref|XP_006369481.1|  hypothetical protein POPTR_0001s23850g             114   2e-27   
gb|KDO70843.1|  hypothetical protein CISIN_1g043293mg                   113   7e-27   
gb|EYU27162.1|  hypothetical protein MIMGU_mgv1a0260443mg               111   8e-27   
gb|EMT29098.1|  hypothetical protein F775_26764                         113   9e-27   
ref|XP_006492820.1|  PREDICTED: protein YLS3-like isoform X2            114   1e-26   
ref|XP_011086771.1|  PREDICTED: protein YLS3-like                       114   1e-26   
ref|XP_006651927.1|  PREDICTED: protein YLS3-like                       114   2e-26   
gb|KDO35899.1|  hypothetical protein CISIN_1g039949mg                   112   3e-26   
ref|XP_008242742.1|  PREDICTED: protein YLS3-like                       113   4e-26   
ref|XP_010088879.1|  hypothetical protein L484_020867                   112   5e-26   
ref|XP_007203697.1|  hypothetical protein PRUPE_ppa022009mg             113   5e-26   
ref|XP_010934241.1|  PREDICTED: protein YLS3-like isoform X2            111   5e-26   
gb|AAM63806.1|  unknown                                                 111   6e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191414.1|  protease inhibitor/(LTP) family protein               111   7e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138957.1|  PREDICTED: protein YLS3                            111   8e-26   
ref|XP_006476107.1|  PREDICTED: protein YLS3-like                       112   9e-26   
ref|XP_010516504.1|  PREDICTED: protein YLS3-like                       111   1e-25   
ref|NP_001132744.1|  putative bifunctional inhibitor/LTP/seed sto...    111   2e-25   Zea mays [maize]
gb|ACN27466.1|  unknown                                                 112   2e-25   Zea mays [maize]
gb|EYU31694.1|  hypothetical protein MIMGU_mgv1a0143491mg               108   2e-25   
ref|XP_010506349.1|  PREDICTED: protein YLS3-like                       110   2e-25   
ref|XP_006295054.1|  hypothetical protein CARUB_v10024122mg             110   3e-25   
emb|CDP03376.1|  unnamed protein product                                110   4e-25   
ref|XP_006451053.1|  hypothetical protein CICLE_v10010697mg             110   5e-25   
gb|KDP32327.1|  hypothetical protein JCGZ_13252                         110   5e-25   
ref|XP_002878226.1|  protease inhibitor/seed storage/lipid transf...    109   5e-25   
ref|XP_006292695.1|  hypothetical protein CARUB_v10018941mg             108   6e-25   
ref|XP_010518027.1|  PREDICTED: protein YLS3-like                       109   6e-25   
ref|XP_002515567.1|  lipid binding protein, putative                    108   1e-24   Ricinus communis
ref|XP_006402776.1|  hypothetical protein EUTSA_v10006273mg             108   1e-24   
ref|XP_010504811.1|  PREDICTED: protein YLS3-like                       107   2e-24   
ref|XP_002281585.1|  PREDICTED: protein YLS3                            108   2e-24   Vitis vinifera
ref|XP_010508310.1|  PREDICTED: protein YLS3-like                       107   2e-24   
ref|XP_007013274.1|  Bifunctional inhibitor/lipid-transfer protei...    108   3e-24   
ref|XP_008809013.1|  PREDICTED: protein YLS3-like                       107   4e-24   
ref|XP_004985579.1|  PREDICTED: non-specific lipid-transfer prote...    108   5e-24   
ref|XP_006402775.1|  hypothetical protein EUTSA_v10006273mg             106   5e-24   
ref|XP_010427760.1|  PREDICTED: protein YLS3-like                       106   8e-24   
emb|CDY00571.1|  BnaC04g23540D                                          104   1e-23   
ref|XP_009104149.1|  PREDICTED: protein YLS3-like                       105   1e-23   
emb|CBI28121.3|  unnamed protein product                                107   1e-23   
emb|CDX98302.1|  BnaC06g16630D                                          105   2e-23   
ref|XP_009374052.1|  PREDICTED: protein YLS3-like                       104   6e-23   
emb|CDX88991.1|  BnaA04g01950D                                          102   7e-23   
ref|XP_009602101.1|  PREDICTED: protein YLS3-like                       103   7e-23   
ref|XP_010541739.1|  PREDICTED: protein YLS3-like                       103   8e-23   
gb|AGZ80685.1|  lipid binding protein                                   101   1e-22   
gb|AGZ80668.1|  lipid binding protein                                   101   1e-22   
ref|XP_009781023.1|  PREDICTED: protein YLS3-like                       103   1e-22   
gb|AGZ80687.1|  lipid binding protein                                   100   1e-22   
gb|EYU25912.1|  hypothetical protein MIMGU_mgv1a017757mg                102   2e-22   
ref|XP_006854228.1|  hypothetical protein AMTR_s00048p00225010          100   2e-22   
ref|XP_006600039.1|  PREDICTED: protein YLS3-like                       101   3e-22   
ref|NP_001051617.2|  Os03g0804200                                       100   4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008337357.1|  PREDICTED: protein YLS3-like                       101   4e-22   
ref|XP_010915020.1|  PREDICTED: protein YLS3-like                       101   5e-22   
emb|CDX67750.1|  BnaA07g17900D                                        99.8    5e-22   
gb|AFG47010.1|  hypothetical protein 2_5794_01                        99.4    7e-22   
ref|XP_006365420.1|  PREDICTED: uncharacterized GPI-anchored prot...    101   2e-21   
ref|XP_004241629.2|  PREDICTED: protein YLS3-like                     99.8    2e-21   
ref|XP_006600045.1|  PREDICTED: protein YLS3-like                     97.8    3e-21   
ref|XP_006599593.1|  PREDICTED: protein YLS3-like isoform X2          98.2    3e-21   
ref|XP_006836022.1|  hypothetical protein AMTR_s00236p00023830        98.2    4e-21   
ref|XP_006856998.1|  hypothetical protein AMTR_s00964p00010390        96.7    4e-21   
ref|XP_006843664.1|  hypothetical protein AMTR_s00007p00185590        95.9    5e-21   
ref|XP_006599603.1|  PREDICTED: protein YLS3-like isoform X2          96.7    1e-20   
ref|XP_006599591.1|  PREDICTED: protein YLS3-like isoform X1          96.3    2e-20   
ref|XP_003549042.2|  PREDICTED: protein YLS3-like                     94.7    2e-20   
ref|XP_006600057.1|  PREDICTED: protein YLS3-like                     95.1    3e-20   
ref|XP_006600043.1|  PREDICTED: protein YLS3-like                     94.0    6e-20   
ref|XP_006836021.1|  hypothetical protein AMTR_s00236p00020140        92.4    6e-20   
ref|XP_003549086.2|  PREDICTED: protein YLS3-like                     94.4    7e-20   
gb|AGZ80671.1|  lipid binding protein                                 92.8    9e-20   
gb|AGZ80667.1|  lipid binding protein                                 92.0    2e-19   
ref|XP_006827906.1|  hypothetical protein AMTR_s00008p00146780        92.4    3e-19   
gb|AGZ80669.1|  lipid binding protein                                 91.7    3e-19   
gb|KHN24015.1|  hypothetical protein glysoja_025188                   89.4    1e-18   
ref|XP_006836019.1|  hypothetical protein AMTR_s00236p00018010        87.0    4e-17   
ref|XP_010497757.1|  PREDICTED: protein YLS3-like                     85.5    4e-17   
ref|XP_006429931.1|  hypothetical protein CICLE_v10013719mg           85.1    8e-17   
ref|XP_002514908.1|  lipid binding protein, putative                  85.5    2e-16   
ref|XP_007225920.1|  hypothetical protein PRUPE_ppa012022mg           84.7    3e-16   
ref|XP_008222168.1|  PREDICTED: non-specific lipid transfer prote...  84.7    3e-16   
ref|XP_006844404.1|  hypothetical protein AMTR_s00142p00106070        82.4    5e-16   
ref|XP_006599600.1|  PREDICTED: protein YLS3-like                     82.4    6e-16   
gb|KFK22172.1|  hypothetical protein AALP_AAs71527U000100             82.0    7e-16   
ref|XP_004135333.1|  PREDICTED: uncharacterized GPI-anchored prot...  83.2    1e-15   
gb|KDO81894.1|  hypothetical protein CISIN_1g029795mg                 83.2    1e-15   
ref|XP_008446028.1|  PREDICTED: non-specific lipid transfer prote...  82.0    3e-15   
ref|XP_009372275.1|  PREDICTED: non-specific lipid transfer prote...  81.6    4e-15   
gb|KDP26810.1|  hypothetical protein JCGZ_17968                       81.3    5e-15   
ref|XP_008389894.1|  PREDICTED: non-specific lipid transfer prote...  81.3    5e-15   
ref|XP_008340225.1|  PREDICTED: non-specific lipid transfer prote...  81.3    6e-15   
ref|XP_010068505.1|  PREDICTED: protein YLS3-like                     80.9    7e-15   
gb|EMS68280.1|  hypothetical protein TRIUR3_25393                     79.3    8e-15   
gb|KGN51666.1|  hypothetical protein Csa_5G589340                     80.5    1e-14   
ref|XP_010102693.1|  hypothetical protein L484_015489                 79.7    2e-14   
ref|XP_004159693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  79.3    3e-14   
ref|XP_002303794.2|  GPI-anchored protein precursor                   78.2    8e-14   
ref|XP_006848247.1|  hypothetical protein AMTR_s00013p00038620        77.8    8e-14   
ref|XP_008354971.1|  PREDICTED: protein YLS3-like                     75.1    1e-13   
ref|XP_010265164.1|  PREDICTED: protein YLS3 isoform X1               77.4    1e-13   
ref|XP_011020739.1|  PREDICTED: non-specific lipid transfer prote...  77.4    2e-13   
ref|XP_010540409.1|  PREDICTED: non-specific lipid transfer prote...  76.6    2e-13   
ref|XP_002277578.1|  PREDICTED: non-specific lipid transfer prote...  75.9    6e-13   
ref|XP_004247576.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    6e-13   
ref|XP_006838416.1|  hypothetical protein AMTR_s00002p00104040        75.1    7e-13   
ref|XP_009109768.1|  PREDICTED: non-specific lipid transfer prote...  75.5    7e-13   
ref|XP_010265166.1|  PREDICTED: protein YLS3 isoform X2               74.7    8e-13   
ref|XP_006305638.1|  hypothetical protein CARUB_v10010343mg           74.7    1e-12   
gb|AAM62634.1|  lipid transfer protein, putative                      74.3    1e-12   
ref|NP_174116.1|  glycosylphosphatidylinositol-anchored lipid pro...  74.3    2e-12   
ref|XP_002890752.1|  hypothetical protein ARALYDRAFT_890328           74.3    2e-12   
ref|XP_010499289.1|  PREDICTED: non-specific lipid transfer prote...  74.3    2e-12   
ref|XP_007163769.1|  hypothetical protein PHAVU_001G262400g           73.9    2e-12   
ref|XP_010549290.1|  PREDICTED: non-specific lipid transfer prote...  73.9    2e-12   
emb|CAN67019.1|  hypothetical protein VITISV_027707                   73.9    3e-12   
ref|XP_009758370.1|  PREDICTED: non-specific lipid transfer prote...  73.2    3e-12   
ref|NP_177530.1|  protease inhibitor/seed storage/lipid transfer ...  73.2    4e-12   
emb|CDY26162.1|  BnaA06g12550D                                        73.2    5e-12   
ref|XP_004247577.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    5e-12   
ref|XP_009149284.1|  PREDICTED: protein YLS3-like                     72.4    7e-12   
ref|XP_004310085.1|  PREDICTED: uncharacterized GPI-anchored prot...  72.4    7e-12   
ref|XP_009113721.1|  PREDICTED: non-specific lipid transfer prote...  72.4    9e-12   
ref|XP_010045643.1|  PREDICTED: protein YLS3                          72.4    9e-12   
ref|XP_009598307.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    9e-12   
emb|CDY60398.1|  BnaCnng36210D                                        72.4    9e-12   
emb|CBI15442.3|  unnamed protein product                              72.0    9e-12   
emb|CDY19210.1|  BnaC05g14110D                                        72.0    1e-11   
ref|XP_011002127.1|  PREDICTED: non-specific lipid transfer prote...  72.0    1e-11   
emb|CDY45869.1|  BnaC02g22510D                                        72.0    1e-11   
ref|XP_006484108.1|  PREDICTED: uncharacterized GPI-anchored prot...  71.6    1e-11   
ref|XP_010460563.1|  PREDICTED: non-specific lipid transfer prote...  72.0    1e-11   
ref|XP_010249032.1|  PREDICTED: non-specific lipid transfer prote...  72.0    1e-11   
emb|CDY27641.1|  BnaA09g27660D                                        72.0    1e-11   
ref|XP_011079977.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-11   
emb|CDY11759.1|  BnaC03g58190D                                        71.6    2e-11   
gb|KCW83850.1|  hypothetical protein EUGRSUZ_B00719                   72.4    2e-11   
ref|XP_009412766.1|  PREDICTED: non-specific lipid transfer prote...  71.2    2e-11   
gb|KFK41828.1|  hypothetical protein AALP_AA2G176700                  70.9    3e-11   
ref|XP_010545093.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    4e-11   
gb|KFK44671.1|  hypothetical protein AALP_AA1G288600                  70.1    6e-11   
ref|XP_006368883.1|  hypothetical protein POPTR_0001s13860g           70.1    6e-11   
emb|CDO98441.1|  unnamed protein product                              70.1    7e-11   
gb|EYU46558.1|  hypothetical protein MIMGU_mgv1a021050mg              68.6    8e-11   
ref|XP_009598308.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    8e-11   
ref|XP_009758371.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    8e-11   
emb|CDP13346.1|  unnamed protein product                              69.3    9e-11   
emb|CDX96495.1|  BnaA07g31060D                                        69.3    1e-10   
ref|XP_010094770.1|  hypothetical protein L484_019980                 69.3    1e-10   
ref|XP_009106045.1|  PREDICTED: protein YLS3                          69.3    1e-10   
ref|NP_001274812.1|  non-specific lipid-transfer protein-like pro...  68.9    1e-10   
ref|XP_006416606.1|  hypothetical protein EUTSA_v10009608mg           68.9    1e-10   
emb|CDX73025.1|  BnaC06g34730D                                        68.9    1e-10   
ref|XP_010478148.1|  PREDICTED: non-specific lipid transfer prote...  68.9    2e-10   
ref|XP_006360770.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-10   
ref|NP_001235727.1|  uncharacterized protein LOC100305718 precursor   68.9    2e-10   
ref|XP_008801676.1|  PREDICTED: non-specific lipid transfer prote...  68.2    2e-10   
gb|KFK37567.1|  hypothetical protein AALP_AA4G273500                  68.6    2e-10   
gb|AFK48078.1|  unknown                                               68.2    2e-10   
gb|KHG23710.1|  hypothetical protein F383_10500                       68.2    3e-10   
ref|XP_006374355.1|  hypothetical protein POPTR_0015s06360g           68.2    3e-10   
ref|XP_007044002.1|  Glycosylphosphatidylinositol-anchored lipid ...  68.6    4e-10   
gb|KDP21428.1|  hypothetical protein JCGZ_21899                       67.8    4e-10   
ref|NP_001235887.1|  uncharacterized protein LOC100499777 precursor   67.4    5e-10   
ref|XP_004239214.1|  PREDICTED: non-specific lipid transfer prote...  67.4    5e-10   
ref|XP_010416218.1|  PREDICTED: non-specific lipid transfer prote...  68.6    5e-10   
ref|XP_010416216.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    5e-10   
gb|KHN24060.1|  Putative GPI-anchored protein                         67.4    5e-10   
ref|XP_010250696.1|  PREDICTED: non-specific lipid transfer prote...  67.4    5e-10   
ref|XP_006301497.1|  hypothetical protein CARUB_v10021923mg           67.4    6e-10   
ref|XP_008240321.1|  PREDICTED: protein YLS3                          67.4    6e-10   
ref|XP_010038081.1|  PREDICTED: non-specific lipid transfer prote...  67.0    6e-10   
emb|CDY03956.1|  BnaC07g11810D                                        67.0    6e-10   
ref|XP_009611499.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    7e-10   
gb|KDP20109.1|  hypothetical protein JCGZ_05878                       67.0    7e-10   
ref|NP_001265899.1|  uncharacterized protein LOC101506326 precursor   67.0    7e-10   
ref|XP_010677982.1|  PREDICTED: protein YLS3                          67.0    7e-10   
gb|EYU33443.1|  hypothetical protein MIMGU_mgv1a014418mg              67.0    7e-10   
gb|KHN44444.1|  Putative GPI-anchored protein                         66.6    9e-10   
ref|XP_006489592.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    9e-10   
ref|XP_010480527.1|  PREDICTED: protein YLS3-like                     66.6    1e-09   
ref|XP_009764787.1|  PREDICTED: protein YLS3-like                     66.6    1e-09   
ref|XP_009611500.1|  PREDICTED: non-specific lipid transfer prote...  66.2    1e-09   
gb|KDO74530.1|  hypothetical protein CISIN_1g040530mg                 65.9    1e-09   
ref|XP_009348129.1|  PREDICTED: protein YLS3                          66.2    1e-09   
ref|XP_006419979.1|  hypothetical protein CICLE_v10006862mg           65.5    1e-09   
ref|XP_002888950.1|  hypothetical protein ARALYDRAFT_339589           66.2    2e-09   
ref|XP_008350274.1|  PREDICTED: protein YLS3-like isoform X2          63.9    2e-09   
ref|XP_010471473.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    2e-09   
ref|XP_002524756.1|  Nonspecific lipid-transfer protein precursor...  66.2    2e-09   
ref|XP_009118134.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    2e-09   
ref|XP_002971247.1|  hypothetical protein SELMODRAFT_411802           65.1    2e-09   
emb|CDP03652.1|  unnamed protein product                              65.5    2e-09   
gb|AAV97731.1|  lipid transfer protein                                65.5    2e-09   
ref|XP_009367611.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    2e-09   
gb|AAV97732.1|  lipid transfer protein                                65.5    2e-09   
ref|XP_009791428.1|  PREDICTED: non-specific lipid transfer prote...  65.1    2e-09   
ref|XP_003524896.2|  PREDICTED: uncharacterized GPI-anchored prot...  65.1    3e-09   
ref|XP_009367612.1|  PREDICTED: non-specific lipid-transfer prote...  65.5    3e-09   
ref|XP_010507806.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    3e-09   
gb|KHN34821.1|  Putative GPI-anchored protein                         64.7    3e-09   
ref|XP_008453387.1|  PREDICTED: protein YLS3                          65.1    4e-09   
emb|CDP03651.1|  unnamed protein product                              64.7    4e-09   
ref|XP_008374966.1|  PREDICTED: protein YLS3                          65.1    4e-09   
emb|CDY66095.1|  BnaA04g29630D                                        65.1    4e-09   
ref|XP_011082645.1|  PREDICTED: non-specific lipid-transfer prote...  64.7    4e-09   
ref|XP_006390494.1|  hypothetical protein EUTSA_v10019767mg           65.1    4e-09   
ref|XP_009618189.1|  PREDICTED: non-specific lipid transfer prote...  64.3    4e-09   
ref|NP_001150532.1|  lipid transfer protein precursor                 64.7    4e-09   
ref|XP_010926816.1|  PREDICTED: non-specific lipid transfer prote...  64.7    5e-09   
ref|XP_006415714.1|  hypothetical protein EUTSA_v10008820mg           64.7    5e-09   
ref|NP_001062343.1|  Os08g0532800                                     64.3    5e-09   
gb|EAZ07773.1|  hypothetical protein OsI_30026                        64.3    5e-09   
ref|XP_007208861.1|  hypothetical protein PRUPE_ppa025857mg           64.7    5e-09   
ref|XP_009621610.1|  PREDICTED: non-specific lipid transfer prote...  64.3    6e-09   
ref|XP_010497022.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    6e-09   
ref|XP_010507807.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    6e-09   
ref|XP_010507801.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    6e-09   
ref|XP_007036507.1|  Bifunctional inhibitor/lipid-transfer protei...  64.3    6e-09   
ref|XP_009616237.1|  PREDICTED: protein YLS3                          64.3    6e-09   
ref|XP_010265167.1|  PREDICTED: non-specific lipid transfer prote...  63.9    6e-09   
ref|XP_002885513.1|  predicted protein                                63.9    6e-09   
ref|XP_010507800.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    6e-09   
ref|XP_011014639.1|  PREDICTED: protein YLS3-like                     64.3    6e-09   
ref|XP_010497021.1|  PREDICTED: non-specific lipid-transfer prote...  64.3    6e-09   
dbj|BAD11656.1|  lipid transfer protein-like                          63.5    9e-09   
ref|XP_002444694.1|  hypothetical protein SORBIDRAFT_07g026120        63.5    1e-08   
ref|XP_002889436.1|  hypothetical protein ARALYDRAFT_311412           63.2    1e-08   
ref|XP_004138342.1|  PREDICTED: uncharacterized protein LOC101203136  63.9    1e-08   
gb|AAM64723.1|  unknown                                               63.5    1e-08   
gb|KHG16607.1|  hypothetical protein F383_20647                       63.5    1e-08   
ref|NP_566126.1|  protease inhibitor/seed storage/lipid transfer ...  63.5    1e-08   
gb|KCW49882.1|  hypothetical protein EUGRSUZ_K03347                   63.2    1e-08   
ref|XP_001781696.1|  predicted protein                                65.9    1e-08   
ref|XP_010038080.1|  PREDICTED: non-specific lipid transfer prote...  62.8    2e-08   
gb|AAM63095.1|  unknown                                               62.8    2e-08   
ref|XP_003601770.1|  Non-specific lipid-transfer protein              63.2    2e-08   
gb|AFK34697.1|  unknown                                               63.2    2e-08   
ref|XP_009388486.1|  PREDICTED: non-specific lipid transfer prote...  62.4    2e-08   
ref|XP_006352184.1|  PREDICTED: uncharacterized GPI-anchored prot...  63.2    2e-08   
ref|XP_010497034.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-08   
gb|AAN60349.1|  unknown                                               62.4    2e-08   
ref|XP_002961566.1|  hypothetical protein SELMODRAFT_403556           62.8    2e-08   
ref|XP_007050549.1|  Bifunctional inhibitor/lipid-transfer protei...  62.8    2e-08   
ref|XP_006398011.1|  hypothetical protein EUTSA_v10001654mg           62.8    2e-08   
emb|CDY27459.1|  BnaC04g51000D                                        65.1    2e-08   
ref|XP_007050548.1|  Bifunctional inhibitor/lipid-transfer protei...  62.8    2e-08   
ref|XP_009782722.1|  PREDICTED: non-specific lipid transfer prote...  62.8    2e-08   
ref|NP_566712.1|  protease inhibitor/seed storage/lipid transfer ...  62.4    2e-08   
emb|CDY06170.1|  BnaA09g50330D                                        62.4    2e-08   
ref|XP_008386478.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    2e-08   
ref|XP_011086802.1|  PREDICTED: non-specific lipid transfer prote...  63.2    2e-08   
ref|XP_002880347.1|  hypothetical protein ARALYDRAFT_322456           62.4    2e-08   
ref|XP_011091038.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    3e-08   
ref|XP_004134131.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    3e-08   
ref|XP_006583405.1|  PREDICTED: protein YLS3-like isoform X2          62.4    3e-08   
gb|AGT16035.1|  lipid transfer protein                                62.4    3e-08   
ref|XP_004164321.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-08   
emb|CDY38061.1|  BnaCnng09220D                                        65.1    3e-08   
ref|XP_008386477.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    3e-08   
ref|XP_007034805.1|  Non-specific lipid-transfer protein, putativ...  62.0    3e-08   
ref|XP_007034804.1|  Non-specific lipid-transfer protein, putativ...  62.0    3e-08   
ref|XP_009783799.1|  PREDICTED: non-specific lipid transfer prote...  62.0    3e-08   
ref|XP_010326386.1|  PREDICTED: protein YLS3                          62.0    3e-08   
ref|XP_010532560.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    3e-08   
ref|XP_008438652.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-08   
ref|XP_006827902.1|  hypothetical protein AMTR_s00008p00138040        60.1    4e-08   
ref|XP_007034802.1|  Non-specific lipid-transfer protein, putativ...  61.6    4e-08   
ref|XP_009783798.1|  PREDICTED: non-specific lipid transfer prote...  62.0    4e-08   
ref|XP_007034803.1|  Non-specific lipid-transfer protein isoform 2    61.2    4e-08   
ref|NP_001051536.1|  Os03g0794000                                     62.0    4e-08   
ref|XP_002963592.1|  hypothetical protein SELMODRAFT_69618            59.7    4e-08   
ref|XP_006583404.1|  PREDICTED: protein YLS3-like isoform X1          62.4    5e-08   
gb|KHN20721.1|  hypothetical protein glysoja_019038                   61.6    5e-08   
ref|XP_011072938.1|  PREDICTED: protein YLS3                          61.6    5e-08   
ref|XP_008368324.1|  PREDICTED: non-specific lipid transfer prote...  60.5    5e-08   
ref|XP_006295530.1|  hypothetical protein CARUB_v10024635mg           60.8    5e-08   
gb|KEH43852.1|  Lipid transfer protein                                61.2    5e-08   
ref|XP_010682757.1|  PREDICTED: non-specific lipid transfer prote...  61.6    5e-08   
gb|ACM78624.1|  protease inhibitor/seed storage/lipid transfer pr...  60.1    5e-08   
ref|XP_002870280.1|  predicted protein                                60.8    6e-08   
ref|XP_006418264.1|  hypothetical protein EUTSA_v10009479mg           60.8    8e-08   
ref|XP_007152775.1|  hypothetical protein PHAVU_004G158600g           61.2    8e-08   
ref|XP_002981493.1|  hypothetical protein SELMODRAFT_59638            58.9    8e-08   
ref|NP_973749.1|  bifunctional inhibitor/lipid-transfer protein/s...  60.5    1e-07   
emb|CCW28756.1|  putative lipid transfer/seed storage/trypsin-alp...  60.5    1e-07   
ref|XP_010435062.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-07   
emb|CCW28822.1|  putative lipid transfer/seed storage/trypsin-alp...  60.5    1e-07   
ref|XP_010259100.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    1e-07   
ref|XP_002978544.1|  hypothetical protein SELMODRAFT_443870           60.1    1e-07   
gb|KGN63812.1|  hypothetical protein Csa_1G022510                     60.8    1e-07   



>ref|XP_004228722.1| PREDICTED: protein YLS3 [Solanum lycopersicum]
Length=193

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 123/166 (74%), Gaps = 7/166 (4%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            +S++L KD+ ECA +L  LA CL YVSGEAK+PT DCC+GLK VLDKS+ CLC+LVKD N
Sbjct  23   SSANLDKDREECANQLVGLATCLPYVSGEAKSPTPDCCTGLKEVLDKSKICLCILVKDRN  82

Query  481  DPSLDIKINATLALGLPDRCSTP---ANISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
            DPSL +KINATLAL LP  C  P   +N+S CPELL+LAPNSPDAKVFQD+A SAKGS +
Sbjct  83   DPSLGLKINATLALSLPTLCHAPPNMSNVSMCPELLHLAPNSPDAKVFQDFAKSAKGS-S  141

Query  652  TSPAAPVKGSPSG---GATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
             +P+APV G+ SG    ++++D    G KR+ +  V + MG  + +
Sbjct  142  AAPSAPVSGNSSGKPANSSTNDKNDGGHKRRWMGFVEMTMGFLVIL  187



>gb|EYU39237.1| hypothetical protein MIMGU_mgv1a014178mg [Erythranthe guttata]
Length=198

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 118/168 (70%), Gaps = 8/168 (5%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A+ D+ KDK +CA  L  LA CL YVSGEAKAP  DCC+GLK +L KS +C+CLLVKD N
Sbjct  21   ATCDVDKDKEKCANDLVGLATCLPYVSGEAKAPPVDCCTGLKQILQKSPQCICLLVKDRN  80

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP+L ++INATLALGLP +C  PANIS CP LL+L PNSPDAKVF+D+ NSA  SN TS 
Sbjct  81   DPTLGLQINATLALGLPSQCHAPANISACPALLHLPPNSPDAKVFEDFVNSANKSNATST  140

Query  661  A-APVKGSPSGGATSSDVKS-------DGCKRKRLVEVNVAMGLFLYV  780
            + APV GSPSGG  ++ V +       DG  + + + + + +GL   +
Sbjct  141  SIAPVPGSPSGGMPTTTVTTAANQKSGDGGNKNKFLNIEMILGLIFTI  188



>emb|CBI16491.3| unnamed protein product [Vitis vinifera]
Length=171

 Score =   178 bits (451),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            AS+D AKD+ ECA++L  LA CL YV GE K+PT DCC+GLK VL K+RKCLC+L+KD N
Sbjct  6    ASADFAKDREECADQLVGLATCLPYVGGEGKSPTLDCCTGLKQVLQKARKCLCILIKDRN  65

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP+L +KINATLA+GLP  C  PANIS CP LL L   SPDAK+F++Y NS   S +TS 
Sbjct  66   DPNLGLKINATLAMGLPSACHAPANISACPALLQLPAGSPDAKIFEEYGNSTAASKSTSV  125

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
            A+    S SG  +S+++KSDG  R+R V V +  GL   +
Sbjct  126  ASAKANSSSG--SSAEMKSDG-GRRRWVGVELVFGLLFLI  162



>ref|XP_002283442.1| PREDICTED: protein YLS3-like [Vitis vinifera]
Length=188

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            AS+D AKD+ ECA++L  LA CL YV GE K+PT DCC+GLK VL K+RKCLC+L+KD N
Sbjct  23   ASADFAKDREECADQLVGLATCLPYVGGEGKSPTLDCCTGLKQVLQKARKCLCILIKDRN  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP+L +KINATLA+GLP  C  PANIS CP LL L   SPDAK+F++Y NS   S +TS 
Sbjct  83   DPNLGLKINATLAMGLPSACHAPANISACPALLQLPAGSPDAKIFEEYGNSTAASKSTSV  142

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
            A+    S SG  +S+++KSDG  R+R V V +  GL   +
Sbjct  143  ASAKANSSSG--SSAEMKSDG-GRRRWVGVELVFGLLFLI  179



>emb|CDP17362.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   178 bits (451),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 124/181 (69%), Gaps = 2/181 (1%)
 Frame = +1

Query  238  TMDPKIMAClfllqllvlfGPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCS  417
            T  P+ + C+ +L L+      ++DL KD+ +CA +L  L  CL YV G+AK+PT DCCS
Sbjct  4    TYVPRSVPCMLVLLLMFFSTFCNADLNKDREKCANQLVGLEGCLPYVGGDAKSPTIDCCS  63

Query  418  GLKGVLDKSRKCLCLLVKDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNS  597
            GLKGVL  SR+CLC+LVKD NDP+L +KINATLAL LPD+C  PAN+SECP LL+LAPNS
Sbjct  64   GLKGVLQHSRECLCILVKDRNDPNLGLKINATLALSLPDKCHAPANVSECPALLHLAPNS  123

Query  598  PDAKVFQDYANSAKGSNTTSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLY  777
            PDAKVF+D+A +  GS T         S   G+T + +KSDG K  R + + + +GL + 
Sbjct  124  PDAKVFEDFAKNGNGSATAEAGG--SSSTDKGSTGAAIKSDGGKGIRRLRIEMVLGLLII  181

Query  778  V  780
            V
Sbjct  182  V  182



>ref|XP_006445830.1| hypothetical protein CICLE_v10016842mg [Citrus clementina]
 gb|ESR59070.1| hypothetical protein CICLE_v10016842mg [Citrus clementina]
 gb|KDO63000.1| hypothetical protein CISIN_1g029705mg [Citrus sinensis]
Length=189

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G ASS++ +DKAECA+K+ ALA CL YV G+AK PT DCC GLK +LDKS+KCLCLL+KD
Sbjct  21   GLASSNIDQDKAECADKVVALATCLPYVGGDAKTPTVDCCGGLKQLLDKSKKCLCLLIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DPSL +KIN+TLA  LP  C +PAN+SEC  LL+L PNSPDAKVFQ ++N  +G   T
Sbjct  81   KDDPSLGLKINSTLAANLPTACHSPANVSECINLLHLPPNSPDAKVFQGFSNLTQGHGGT  140

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLF  771
             PA  V  +   G+ S+D KSDG K  RL+ + +A+  F
Sbjct  141  -PATAVGSNSKNGSPSADQKSDGGKASRLLGLEMAVWGF  178



>ref|XP_007163836.1| hypothetical protein PHAVU_001G268300g [Phaseolus vulgaris]
 gb|ESW35830.1| hypothetical protein PHAVU_001G268300g [Phaseolus vulgaris]
Length=203

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A+SDL KD+ ECA+KL  LA C+ YV GEAK PT DCCSGLK VLDKS+KC+C+L+KD
Sbjct  39   GFANSDLGKDREECADKLVGLASCVPYVGGEAKTPTIDCCSGLKVVLDKSKKCICILIKD  98

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP+L IKINATLA+ LP  C  PANIS C +LL+LAPNSPDAKVF+ + NSAK +N++
Sbjct  99   RDDPNLGIKINATLAIQLPSACHAPANISHCVDLLHLAPNSPDAKVFEGFQNSAK-TNSS  157

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRL  741
            +P +   G    G+ SS  +  G   KR 
Sbjct  158  TPVSSAAGGAEKGSNSSGQEKSGVSTKRW  186



>ref|XP_007014734.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY32353.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=187

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G ASSD+ +DK ECA +L  LA CL YV G++K PT DCCSGLK VLDKSRKCLC+L+KD
Sbjct  20   GFASSDVNQDKTECANQLVGLASCLPYVGGQSKTPTIDCCSGLKQVLDKSRKCLCVLIKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DPSL +KINATLA  LP  C  P N++EC  LL+LAPNS +AK F+ Y    +G   T
Sbjct  80   RDDPSLGLKINATLAATLPSTCHAPVNMTECISLLHLAPNSQEAKAFEGYEKLTEGHANT  139

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
             PAA   G+ +  A+++  KSDG K KR V V +A G+ L++
Sbjct  140  -PAA--NGNSTSSASTAAEKSDGGKGKRWVGVEMAFGVSLWI  178



>ref|XP_006492750.1| PREDICTED: uncharacterized protein LOC102613530 [Citrus sinensis]
Length=393

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G ASS++ +DKAECA+K+ ALA CL YV G+AK PT DCC GLK +LDKS+KCLCLL+KD
Sbjct  21   GLASSNIDQDKAECADKVVALATCLPYVGGDAKTPTVDCCGGLKQLLDKSKKCLCLLIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DPSL +KIN+TLA  LP  C +PAN+SEC  LL+L PNSPDAKVFQ ++N  +G   T
Sbjct  81   KDDPSLGLKINSTLAANLPTACHSPANVSECINLLHLPPNSPDAKVFQGFSNLTQGHGGT  140

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLF  771
             PA  V  +   G+ S+D KSDG K  RL+ + +A+  F
Sbjct  141  -PATAVGSNSKNGSPSADQKSDGGKASRLLGLEMAVWGF  178



>gb|KHN44488.1| Putative GPI-anchored protein [Glycine soja]
Length=182

 Score =   165 bits (418),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 110/141 (78%), Gaps = 1/141 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A SDL+KD+ ECA+KL  LA C+ YV GEAK PT DCC+GLK VLD+S+KCLC+L+KD
Sbjct  18   GFAKSDLSKDREECADKLIDLASCVPYVGGEAKTPTIDCCTGLKAVLDRSKKCLCILIKD  77

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP+L IKINATLA+ LP  C +PANI++C +LL+LAPNSPDAKVF+ +  SAK +N++
Sbjct  78   RDDPNLGIKINATLAIQLPSACHSPANITQCVDLLHLAPNSPDAKVFEGFQKSAK-TNSS  136

Query  655  SPAAPVKGSPSGGATSSDVKS  717
            +P +   G+  G ++S+  KS
Sbjct  137  TPVSVSSGAEKGSSSSAQEKS  157



>ref|XP_006354156.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Solanum tuberosum]
Length=190

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 119/165 (72%), Gaps = 10/165 (6%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            S+ L KD+ ECA +L  LA CL +VS EAKAPT DCC+GLK VLDKS+ CLC+LVKD ND
Sbjct  24   SASLDKDREECANQLVGLATCLPFVSSEAKAPTPDCCTGLKEVLDKSKICLCILVKDRND  83

Query  484  PSLDIKINATLALGLPDRCSTP---ANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
            PSL +KINATLAL LP  C  P   AN+S C +LL+LAPNSPDAKVFQD+   AKGS + 
Sbjct  84   PSLGLKINATLALSLPTLCHAPPNIANVSMCTDLLHLAPNSPDAKVFQDF---AKGS-SA  139

Query  655  SPAAPVKGSPSG--GATSSDVKSDGCKRKRLV-EVNVAMGLFLYV  780
            +P+APV G+ SG    +S++ K+DG  R+R +  + + MG  + +
Sbjct  140  APSAPVSGNSSGKPANSSTNDKNDGGHRRRCMGFIEMTMGFLVIL  184



>gb|KDP44350.1| hypothetical protein JCGZ_19217 [Jatropha curcas]
Length=181

 Score =   164 bits (416),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A SD+A+++AECA +L  LAPCL YV G AKAPT DCC+GLK VL+KS+KCLC+L+KD
Sbjct  16   GIARSDIAQERAECANQLVGLAPCLPYVGGTAKAPTLDCCTGLKQVLEKSKKCLCILIKD  75

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DPSL +KINATLA  LP  C  PANI++C +LL+LAP+SP+AKVF  +AN    S+++
Sbjct  76   RDDPSLGLKINATLAATLPSACHAPANITQCIDLLHLAPSSPEAKVFAGFANIT--SSSS  133

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLY  777
            +P A    + SG +     + +  KR   V V +  G  L+
Sbjct  134  APVASGNSTKSGSSAEDKSRGEIAKRSTYVGVEIICGFLLW  174



>gb|KGN54079.1| hypothetical protein Csa_4G280560 [Cucumis sativus]
Length=185

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 119/167 (71%), Gaps = 10/167 (6%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SS++ +D+AECA+++  LA CL YV GEAKAPT DCCSGLK VLDKSRKCLC+L+KD
Sbjct  19   GFVSSNIDQDRAECADQVVGLATCLPYVGGEAKAPTPDCCSGLKLVLDKSRKCLCVLIKD  78

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DPSL +K+N +LALGLP  C  PANI +C  LL+L+PNSP+AK F    NS K +NT+
Sbjct  79   RDDPSLGLKVNLSLALGLPSACHAPANIKDCVGLLHLSPNSPEAKDFLGSPNS-KETNTS  137

Query  655  SP--AAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGL----FLY  777
            +P  A PV GS S    +S+VK+DG KR + + V + +      FL+
Sbjct  138  TPAHATPVSGSSS---QNSEVKNDGTKRNQWLGVEMFIWFITSSFLF  181



>ref|XP_010257571.1| PREDICTED: protein YLS3 [Nelumbo nucifera]
Length=192

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 111/161 (69%), Gaps = 1/161 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G    D+A+D++ECA +L  L+ CL YV GEAKAPT DCC+GLK +LDKS+KCLC+LVKD
Sbjct  23   GSVRPDVAQDRSECANQLIGLSTCLPYVGGEAKAPTLDCCTGLKQILDKSKKCLCILVKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             NDP L +KINATLAL LP  C  PAN+S+CP LL+LAPNSP+A+VF+ +A  A GS   
Sbjct  83   RNDPDLGLKINATLALSLPTTCHAPANVSDCPALLHLAPNSPEAQVFEQFAKGA-GSTVA  141

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLY  777
            S       S +   +S+   SDG + KR + V +  G+F +
Sbjct  142  SAGGNSSSSSTATGSSAKEASDGGRGKRWMAVEMVGGVFFF  182



>ref|XP_007205970.1| hypothetical protein PRUPE_ppa012060mg [Prunus persica]
 gb|EMJ07169.1| hypothetical protein PRUPE_ppa012060mg [Prunus persica]
Length=185

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 113/163 (69%), Gaps = 8/163 (5%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            SS++ +D+AECAE+L  LAPCL YV G+AKAPT DCC+G+K V  KS+KCLC+L+KD ND
Sbjct  25   SSNIDQDRAECAEQLVGLAPCLPYVGGDAKAPTLDCCTGIKEVEQKSKKCLCVLIKDRND  84

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA  663
            P+L +KINATLAL LP  C  P NIS C +LLNL  NSPDAK+F++YAN    S+T   A
Sbjct  85   PNLGLKINATLALQLPTSCHVPVNISRCVDLLNLPSNSPDAKMFREYANKTAASSTVPIA  144

Query  664  APVKGSPSGGATSSDVKSDGCK-RKRLVEVNVAMG----LFLY  777
            +   G+ +   T +  KSDG    KR++ V + +G    ++ Y
Sbjct  145  S---GNSTSNGTVAQAKSDGVSLEKRVLGVEMLLGSLALMWFY  184



>ref|NP_001237564.1| uncharacterized protein LOC100305590 precursor [Glycine max]
 gb|ACU13345.1| unknown [Glycine max]
Length=182

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 109/141 (77%), Gaps = 1/141 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A SDL+KD+  CA+KL  LA C+ YV GEAK PT DCC+GLK VLD+S+KCLC+L+KD
Sbjct  18   GFAKSDLSKDREGCADKLIDLASCVPYVGGEAKTPTIDCCTGLKAVLDRSKKCLCILIKD  77

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP+L IKINATLA+ LP  C +PANI++C +LL+LAPNSPDAKVF+ +  SAK +N++
Sbjct  78   RDDPNLGIKINATLAIQLPSACHSPANITQCVDLLHLAPNSPDAKVFEGFQKSAK-TNSS  136

Query  655  SPAAPVKGSPSGGATSSDVKS  717
            +P +   G+  G ++S+  KS
Sbjct  137  TPVSVSSGAEKGSSSSAQEKS  157



>ref|XP_002270671.1| PREDICTED: protein YLS3 [Vitis vinifera]
 emb|CBI32156.3| unnamed protein product [Vitis vinifera]
Length=188

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 113/157 (72%), Gaps = 3/157 (2%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
             +SD AKDK EC E+L  +A CL YV G+AKAPT DCCSGLK VL K++KCLC+++KD N
Sbjct  20   VTSDSAKDKQECTEQLVGMATCLPYVGGDAKAPTPDCCSGLKQVLQKNKKCLCVIIKDRN  79

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L + +NATLALGLP  C  PAN+S+CP LL+LAPNSPDA+VF  +ANS+ G+ +++P
Sbjct  80   DPDLGLNLNATLALGLPSVCHAPANVSQCPALLHLAPNSPDAQVFYQFANSSNGTASSTP  139

Query  661  AAPVKGSPSGGATSSDVKSDG--CKRKRLVEVNVAMG  765
            +  VK + S  A S  V + G  C  K+ + +  A+G
Sbjct  140  ST-VKSNSSASANSKGVSAQGGCCNGKKWLNLEFAVG  175



>ref|XP_008225280.1| PREDICTED: protein YLS3-like [Prunus mume]
Length=185

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 112/163 (69%), Gaps = 8/163 (5%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            SS++ +D+AECA++L  LAPCL YV G+AKAPT DCC+G+K V  KS+KCLC+L+KD +D
Sbjct  25   SSNIDQDRAECADQLVGLAPCLPYVGGDAKAPTLDCCTGIKEVEQKSKKCLCVLIKDHDD  84

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA  663
            P+L +KINATLAL LP  C  P NIS C +LLNL  NSPDAK+F++YAN    S+T   A
Sbjct  85   PNLGLKINATLALQLPTSCHVPVNISRCVDLLNLPSNSPDAKMFREYANKTAASSTVPIA  144

Query  664  APVKGSPSGGATSSDVKSDGCK-RKRLVEVNVAMG----LFLY  777
            +   G+ +   T +  KSDG    KRL+ V +  G    ++ Y
Sbjct  145  S---GNSTSNGTVAQTKSDGVSLEKRLLGVEMLFGSLALMWFY  184



>ref|XP_009364110.1| PREDICTED: protein YLS3-like [Pyrus x bretschneideri]
Length=193

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 114/166 (69%), Gaps = 6/166 (4%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  S ++ +D+AEC ++L  LAPC+ YV G+AK PT DCCSG+K V+ KS+KCLC+L+KD
Sbjct  23   GFGSCNIDQDRAECTDQLVGLAPCIPYVGGDAKTPTLDCCSGIKEVVQKSKKCLCILIKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKG-SNT  651
             +DP L +KIN+TLAL LP  C  P NIS C +LLNL  NSPDAK+F+D+ N  +  SN+
Sbjct  83   RDDPKLGLKINSTLALNLPSSCHVPVNISTCIDLLNLPSNSPDAKMFRDFENQTEARSNS  142

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCK-RKRLVEVNVAMG--LFLYV  780
            T+P + V  + SG  T +  KSDG +  KRL+ + +  G  L  Y+
Sbjct  143  TAPLSSVNSTSSG--TVAQAKSDGGRLEKRLMGIEMLFGTLLVFYI  186



>ref|XP_010243423.1| PREDICTED: protein YLS3-like [Nelumbo nucifera]
Length=247

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 111/164 (68%), Gaps = 8/164 (5%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G   SD+A+DK EC  +L  L+ CL YV G+AKAPT DCCSGLK V+DKS+KCLC+LVKD
Sbjct  22   GSVRSDIAQDKNECENQLIGLSTCLPYVGGQAKAPTLDCCSGLKEVVDKSKKCLCILVKD  81

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             NDP L IK+N TLAL LP  C T AN+S+CP LL+LAPNSPDA+VF+ +    KG N+T
Sbjct  82   RNDPDLGIKVNVTLALSLPTACHTSANVSDCPALLHLAPNSPDAQVFEQF---GKGVNST  138

Query  655  SPAAPVKG---SPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLY  777
               +  KG   S +G    +   S+G K KR + V +  G+ ++
Sbjct  139  --VSDDKGNSLSSTGTEAGAKQTSNGGKGKRRMVVEIVSGISIW  180



>ref|XP_008384404.1| PREDICTED: protein YLS3-like [Malus domestica]
 ref|XP_008384405.1| PREDICTED: protein YLS3-like [Malus domestica]
 ref|XP_008366146.1| PREDICTED: protein YLS3-like [Malus domestica]
Length=193

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 111/162 (69%), Gaps = 4/162 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  S ++ +D+AEC ++L  LAPCL YV G+AK PT DCCSG+K V+ KS+KCLC+L+KD
Sbjct  23   GFGSCNIDQDRAECTDQLVGLAPCLPYVGGDAKTPTLDCCSGIKEVVQKSKKCLCILLKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKG-SNT  651
             +DP L +KIN+TLAL LP  C  P NIS C +LLNL  NS DAK+F+D+ N+ +  SNT
Sbjct  83   RDDPKLGLKINSTLALNLPSSCHVPVNISTCIDLLNLPSNSSDAKMFRDFENNTEARSNT  142

Query  652  TSPAAPVKGSPSGGATSSDVKSD-GCKRKRLVEVNVAMGLFL  774
            T+P + V  + SG  T +  KSD G    RL+ + +  G FL
Sbjct  143  TAPTSSVNSTSSG--TVAQAKSDGGSLENRLMGIEMLFGTFL  182



>ref|XP_011089694.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=193

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 109/162 (67%), Gaps = 4/162 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  S D+ KDK +C  +L  LA CL YVSGE+K P  DCC+G K VL KS++CLCLLVKD
Sbjct  21   GLTSCDVEKDKEKCTNQLIGLATCLPYVSGESKFPPMDCCTGFKEVLQKSKECLCLLVKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPAN--ISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
             NDPSL  KINATLAL LP +C+ P N  I++CP +L+L PNSPDAKVF+D+ANS K SN
Sbjct  81   RNDPSLGFKINATLALSLPSKCNAPVNQSITDCPAVLHLPPNSPDAKVFEDFANSGKKSN  140

Query  649  TTSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFL  774
             T+P  P   + S     ++ KSDG K K  + V +   L L
Sbjct  141  ATAP--PAAENSSTEMPPANPKSDGGKSKSRLGVEMVSWLSL  180



>gb|KHG12536.1| hypothetical protein F383_03102 [Gossypium arboreum]
Length=186

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 111/162 (69%), Gaps = 9/162 (6%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            ASSD+ +DKAEC ++L  LAPCL YV G+AKAPT DCC GLK VL KS+KCLC+L+KD +
Sbjct  23   ASSDVNQDKAECTDQLVGLAPCLPYVGGQAKAPTMDCCGGLKQVLVKSKKCLCVLIKDRD  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DPSL + INA+LA  LP  C    NI+EC  LL+LAPNS +AK+FQ Y    +  +T+ P
Sbjct  83   DPSLGLNINASLAATLPHTCHDTVNITECISLLHLAPNSQEAKLFQGYQKLTEKHSTSPP  142

Query  661  AAPVKGSPSGGATSSDV-KSD-GCKRKRLVEVNVAMGLFLYV  780
            A       SG +TSS   KSD G  +KR+  V +A+G  L+V
Sbjct  143  A-------SGNSTSSAAEKSDGGMGKKRVGVVEIAVGFSLWV  177



>ref|XP_009628973.1| PREDICTED: protein YLS3-like [Nicotiana tomentosiformis]
Length=193

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 118/164 (72%), Gaps = 4/164 (2%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            + +++ KDK ECA +L  LA CL YVSG+AKAPT DCC+GLK VLDKS+KCLC+LVKD N
Sbjct  24   SRANIDKDKEECANQLVGLATCLPYVSGDAKAPTPDCCTGLKEVLDKSKKCLCVLVKDRN  83

Query  481  DPSLDIKINATLALGLPDRCSTP---ANISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
            DPSL +KINATLAL LP  C  P   AN+S CPELL+L PNSPDAKVF+D+A SAK S++
Sbjct  84   DPSLGLKINATLALSLPTLCHAPANSANVSMCPELLHLPPNSPDAKVFEDFAKSAKASSS  143

Query  652  TSPAAPVKGSPSGGATSSDVKSDGC-KRKRLVEVNVAMGLFLYV  780
             S A     S    AT+++ K+DG  +RK +  V + MG  + +
Sbjct  144  ASSAPVSGSSNGKAATTANEKNDGGDRRKWMGIVEMTMGFLVIM  187



>ref|XP_009766807.1| PREDICTED: protein YLS3-like [Nicotiana sylvestris]
Length=190

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 122/165 (74%), Gaps = 6/165 (4%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            + +D+ KDK ECA +L  LA CL YVSG AKAPT DCC+GLK VLDKS+KCLC+LVKD +
Sbjct  25   SRADIDKDKKECANQLVGLATCLPYVSGGAKAPTPDCCTGLKEVLDKSKKCLCVLVKDRD  84

Query  481  DPSLDIKINATLALGLPDRCSTP---ANISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
            DPSL +KINATLAL LP  C  P   AN+S CPELL+L PNSPDAKVF+D+A SAK S++
Sbjct  85   DPSLGLKINATLALSLPTLCHAPVNAANVSMCPELLHLPPNSPDAKVFEDFAKSAKASSS  144

Query  652  TSPAAPVKGSPSG-GATSSDVKSDGC-KRKRLVEVNVAMGLFLYV  780
               +APV GS +G  AT+++ K+DG  +RK +  V + MG  + +
Sbjct  145  AP-SAPVSGSSNGKAATTANEKNDGGDRRKWMGIVEMTMGFLVIM  188



>ref|XP_010673513.1| PREDICTED: protein YLS3 [Beta vulgaris subsp. vulgaris]
Length=189

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 108/159 (68%), Gaps = 3/159 (2%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            S D+ KDK ECA +L  LA CL YV G+AKAPTQDCC+GLK V+  S+KC+C+L+KD +D
Sbjct  23   SCDINKDKEECANQLVGLATCLPYVGGQAKAPTQDCCTGLKQVIKASKKCVCILIKDRDD  82

Query  484  PSLDIKINATLALGLPDRCSTPA--NISECPELLNLAPNSPDAKVFQDYANSAKGSNTTS  657
            PSL +KINATL L LP  C  PA  N+ +CP LL+L PNSPDAK+F D A  A   N+++
Sbjct  83   PSLGLKINATLGLTLPQACHLPASDNVDQCPALLHLPPNSPDAKMFTDLAKRAAAVNSSA  142

Query  658  PAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFL  774
            P +    + +GGA++ + KSD    KR +   +  G+ L
Sbjct  143  PTSSANSTSAGGASAKE-KSDSTTGKRQLLAQMLCGILL  180



>gb|KHN47957.1| Putative GPI-anchored protein [Glycine soja]
Length=193

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 106/156 (68%), Gaps = 1/156 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A+SD+ +DKAEC +KL  LA CL YV GEAK PT DCCSG+K V+DKS++CLC+L+KD
Sbjct  21   GFATSDINQDKAECTDKLLGLAGCLSYVGGEAKVPTMDCCSGIKEVIDKSKRCLCILIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DPSL +KIN TLAL LPD C TP NI++C +LL+LAP S +AKVF+ +  +     + 
Sbjct  81   RDDPSLGLKINVTLALNLPDVCETPTNITQCVDLLHLAPKSQEAKVFEGFEKALTNKTSP  140

Query  655  SPAAPVKGSPS-GGATSSDVKSDGCKRKRLVEVNVA  759
            SP      + + G +TS++  S G   KR +   V 
Sbjct  141  SPVLSANNTTAKGTSTSANNNSGGGWGKRWLVAEVV  176



>ref|XP_010044958.1| PREDICTED: protein YLS3-like [Eucalyptus grandis]
 gb|KCW87092.1| hypothetical protein EUGRSUZ_B03623 [Eucalyptus grandis]
Length=202

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 111/163 (68%), Gaps = 2/163 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G   SD+ +D+AECA++L  LA CL YV G+AK+PT DCC+GLKGVL KS+KCLC+L+KD
Sbjct  29   GSGRSDMDQDRAECADQLVGLASCLPYVGGDAKSPTIDCCTGLKGVLQKSKKCLCILIKD  88

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP+L +KINATLALGLP  C  PANIS C +LL+L  NS DAK+F+  ANS   S+ T
Sbjct  89   RDDPNLGLKINATLALGLPTACHAPANISACVDLLHLPANSTDAKLFRGAANSTTVSSAT  148

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKR--KRLVEVNVAMGLFLY  777
            +  A    S S G  S++ KS G  R  KR   + +  G+ + 
Sbjct  149  ATPAASANSTSTGGGSAEAKSHGGDRTTKRWWALEIVCGVLMM  191



>emb|CBI16494.3| unnamed protein product [Vitis vinifera]
Length=174

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            AS+D AKD+ ECA++L  LA CL YV GE KAPT DCC+GLK VL KS+KCLC+L+KD +
Sbjct  7    ASADFAKDRQECADQLVGLATCLPYVQGEGKAPTLDCCTGLKQVLQKSKKCLCVLIKDRD  66

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP+L  KIN TLAL LP  C+TPAN+SECP LL L P SPDAK+F++  NS   + +T P
Sbjct  67   DPNLGFKINTTLALSLPTACNTPANMSECPALLQLPPGSPDAKIFEESGNSTVTTKST-P  125

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
             A  K + +   +SS+++S G +R+R V V +  GL   +
Sbjct  126  VASAKANSTSSGSSSEMRSGGWRRRRWVGVELVFGLLFLI  165



>ref|XP_010101137.1| hypothetical protein L484_016701 [Morus notabilis]
 gb|EXB87355.1| hypothetical protein L484_016701 [Morus notabilis]
Length=185

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 106/141 (75%), Gaps = 9/141 (6%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDP  486
            ++L +D+AECA+KL  LA CL YV G+AK PT DCCSGLK V+DKS+KCLC+L+KD +DP
Sbjct  23   ANLEQDRAECADKLVGLATCLPYVGGDAKTPTMDCCSGLKEVVDKSKKCLCVLIKDRDDP  82

Query  487  SLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
            +L +KIN+TLA+ LP+ C  P NIS+C +LL+LAPNS DAKVF+  AN+  G  TT+P  
Sbjct  83   NLGVKINSTLAMQLPNACHIPTNISKCVDLLHLAPNSSDAKVFEGLANN-NGKTTTAPI-  140

Query  667  PVKGSPSGGATSS--DVKSDG  723
                 PSG ++S+  D KSDG
Sbjct  141  -----PSGNSSSTIADTKSDG  156



>ref|NP_001238362.1| uncharacterized protein LOC100499687 precursor [Glycine max]
 gb|ACU13241.1| unknown [Glycine max]
Length=193

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 106/156 (68%), Gaps = 1/156 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A+SD+ +DKAEC +KL  LA CL YV GEAK PT DCCSG+K V++KS++CLC+L+KD
Sbjct  21   GFATSDINQDKAECTDKLLGLAGCLSYVGGEAKVPTMDCCSGIKEVINKSKRCLCILIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DPSL +KIN TLAL LPD C TP NI++C +LL+LAP S +AKVF+ +  +     + 
Sbjct  81   RDDPSLGLKINVTLALNLPDVCETPTNITQCVDLLHLAPKSQEAKVFEGFEKALTNKTSP  140

Query  655  SPAAPVKGSPS-GGATSSDVKSDGCKRKRLVEVNVA  759
            SP      + + G +TS++  S G   KR +   V 
Sbjct  141  SPVLSANNTTAKGTSTSANNNSGGGWGKRWLVAEVV  176



>ref|XP_002285691.1| PREDICTED: protein YLS3-like [Vitis vinifera]
Length=190

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            AS+D AKD+ ECA++L  LA CL YV GE KAPT DCC+GLK VL KS+KCLC+L+KD +
Sbjct  23   ASADFAKDRQECADQLVGLATCLPYVQGEGKAPTLDCCTGLKQVLQKSKKCLCVLIKDRD  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP+L  KIN TLAL LP  C+TPAN+SECP LL L P SPDAK+F++  NS   + +T P
Sbjct  83   DPNLGFKINTTLALSLPTACNTPANMSECPALLQLPPGSPDAKIFEESGNSTVTTKST-P  141

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
             A  K + +   +SS+++S G +R+R V V +  GL   +
Sbjct  142  VASAKANSTSSGSSSEMRSGGWRRRRWVGVELVFGLLFLI  181



>emb|CAN59826.1| hypothetical protein VITISV_016657 [Vitis vinifera]
Length=595

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
             +SD AKDK EC E+L  +A CL YV G+AKAPT DCCSGLK VL K++KCLC+++KD N
Sbjct  20   VTSDSAKDKQECTEQLVGMATCLPYVGGDAKAPTPDCCSGLKQVLQKNKKCLCVIIKDRN  79

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L + +NATLALGLP  C  PAN+S+CP LL+LAPNSPDA+VF  +ANS+ G+ +++P
Sbjct  80   DPDLGLNLNATLALGLPSVCHAPANVSQCPALLHLAPNSPDAQVFYQFANSSNGTASSTP  139

Query  661  A  663
            +
Sbjct  140  S  140



>ref|XP_008449799.1| PREDICTED: protein YLS3 [Cucumis melo]
Length=186

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 123/184 (67%), Gaps = 19/184 (10%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SS++ +D+AECA+++  LA CL YV GEAKAPT DCCSGLK VLDKSRKCLC+L+KD
Sbjct  19   GFVSSNIDQDRAECADQVVGLATCLPYVGGEAKAPTPDCCSGLKLVLDKSRKCLCVLIKD  78

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DPSL +K+N TLALGLP  C  PA+I +C  LL+L+PNSP+AK F   +NS K +NT+
Sbjct  79   RDDPSLGLKVNLTLALGLPSACHAPADIKDCIGLLHLSPNSPEAKDFLGSSNS-KETNTS  137

Query  655  S--PAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYVfilifnl*fq*f*VFL  828
            S   A PV G+ S    +++VK+ G KR      N  +G+ + +  +  +        FL
Sbjct  138  SSAHATPVSGNSS---QNTEVKNGGTKRN-----NQWLGVEILICFITSS--------FL  181

Query  829  YFCI  840
            + CI
Sbjct  182  FTCI  185



>ref|XP_007159392.1| hypothetical protein PHAVU_002G234400g [Phaseolus vulgaris]
 gb|ESW31386.1| hypothetical protein PHAVU_002G234400g [Phaseolus vulgaris]
Length=187

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A+SD+ +DK+EC  K+  LA CL Y SGEA  PT DCC GLK V+DKS++CLC+L+KD
Sbjct  18   GFATSDINQDKSECMNKIIGLAGCLTYASGEAAVPTMDCCFGLKEVIDKSKRCLCILIKD  77

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             NDPSL +K+N TLAL LP+ C TP NI+EC +LL+L PNS DAKVF+ +  S   +N T
Sbjct  78   RNDPSLGLKVNVTLALKLPEVCKTPTNITECVDLLHLPPNSADAKVFEGFEKSL--TNQT  135

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLF  771
            SP +    +  G   + D K +G   K+ +   V  G+ 
Sbjct  136  SPPSTPAATAKGENINDDNKKNGGWAKKGLVTEVVCGIL  174



>ref|XP_003561314.1| PREDICTED: protein YLS3-like isoform X2 [Brachypodium distachyon]
Length=196

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 97/132 (73%), Gaps = 2/132 (2%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D A D+AEC++KL ALA CL +V G+A APT DCC+GLK VL  SRKCLC+LVKD +DP 
Sbjct  25   DFAADRAECSDKLVALATCLTFVQGQAPAPTPDCCAGLKTVLQSSRKCLCVLVKDRDDPG  84

Query  490  LDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYA--NSAKGSNTTSPA  663
            L +KIN T ALGLP  CS  ANIS+CP LLNL PNS DA+VF+D+A   +A+GS  + P+
Sbjct  85   LGLKINVTRALGLPAACSAAANISDCPRLLNLPPNSKDAQVFEDFAKQQAAQGSPGSGPS  144

Query  664  APVKGSPSGGAT  699
            AP  G+    AT
Sbjct  145  APSTGAQKSAAT  156



>ref|XP_010542451.1| PREDICTED: protein YLS3-like isoform X2 [Tarenaya hassleriana]
Length=191

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 112/163 (69%), Gaps = 3/163 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDLA+D+AEC+E+L  LA CL YV GEAKAPT+DCC+G K V+DKSRKC+C+L+KD
Sbjct  20   GSGNSDLAQDRAECSEQLVGLATCLPYVGGEAKAPTRDCCAGFKDVVDKSRKCICILIKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             NDP L +KINATLA+ LP  C   + NIS C  LL+L PNSP+AK F+        +N+
Sbjct  80   RNDPQLGLKINATLAVLLPTLCHQSSPNISACTSLLHLPPNSPEAKEFESLGKIEGNANS  139

Query  652  TSPAAPVKGS-PSGGATSSDVKSDGCKRKRLVEV-NVAMGLFL  774
            TS +   KG+  + GA ++  KS+G KR+  + V  +   LFL
Sbjct  140  TSSSPKPKGAREAQGAEAASEKSNGDKRESWLAVFTLIHALFL  182



>ref|XP_010044960.1| PREDICTED: protein YLS3-like [Eucalyptus grandis]
 gb|KCW87093.1| hypothetical protein EUGRSUZ_B03624 [Eucalyptus grandis]
Length=196

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = +1

Query  316  AKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLD  495
            A+D+AECA++L  LA CL YV GEA+APT +CCSGLK VL KS KCLC+LV+D NDPSL 
Sbjct  27   AQDRAECADQLVGLATCLPYVGGEARAPTLECCSGLKQVLQKSLKCLCILVRDRNDPSLG  86

Query  496  IKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTS-PAAPV  672
            +KIN TLAL LP  C +P NIS+C +LL+LAPNS DA+VF  +  S +  N+T  P A  
Sbjct  87   LKINTTLALSLPTSCHSPVNISQCIDLLHLAPNSTDAEVFDRFEKSLEKRNSTKLPDAEG  146

Query  673  KGSPSGGATSSDVKSDGCKRKR  738
              + S   +S  +KS+  +R R
Sbjct  147  NSTDSTAGSSGQIKSNRSERSR  168



>ref|NP_001235687.1| uncharacterized protein LOC100306483 precursor [Glycine max]
 gb|ACU14687.1| unknown [Glycine max]
Length=192

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 103/137 (75%), Gaps = 6/137 (4%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A+SD+ +DKAEC +KL  LA CL YV GEAK P  DCCSG++ V+DKS++CLC+L+KD
Sbjct  21   GFATSDINQDKAECTDKLLGLAGCLPYVGGEAKVPAMDCCSGIREVIDKSKRCLCILIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP+L +KIN TLAL LPD C TP NI++C +LL+LAPNS +AKVF+ + N+   +N T
Sbjct  81   RDDPNLGLKINVTLALSLPDACQTPTNITQCVDLLHLAPNSTEAKVFEGFKNAL--TNKT  138

Query  655  SPAAPVKGSPSGGATSS  705
            SP++     P+  AT++
Sbjct  139  SPSS----VPANNATAN  151



>ref|XP_002309285.2| hypothetical protein POPTR_0006s21040g [Populus trichocarpa]
 gb|EEE92808.2| hypothetical protein POPTR_0006s21040g [Populus trichocarpa]
Length=183

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 101/151 (67%), Gaps = 3/151 (2%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDP  486
            SDLA DK EC E+L +L+ CL +V G+ K PT  CCSGL+  + K+ KCLC+LVKD N+P
Sbjct  16   SDLAADKRECNEQLASLSACLPFVGGDTKVPTPTCCSGLRQEISKTEKCLCILVKDRNEP  75

Query  487  SLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
             L  KINATLAL LP  C  PAN+S CPE+L+LAPNS DA+VF+D+A S K SN    A 
Sbjct  76   DLGFKINATLALSLPSICHAPANVSACPEMLHLAPNSTDAQVFEDFAASNK-SNAVVAAF  134

Query  667  PVKGSPSGGATSSDVKSDGCKRKRLVEVNVA  759
             +   P  G  +S   S+  K ++ +EV++ 
Sbjct  135  VLTNFPITGVQTSS--SNTMKERKWLEVSMV  163



>ref|XP_006579354.1| PREDICTED: uncharacterized protein LOC100306483 isoform X1 [Glycine 
max]
Length=193

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A+SD+ +DKAEC +KL  LA CL YV GEAK P  DCCSG++ V+DKS++CLC+L+KD
Sbjct  21   GFATSDINQDKAECTDKLLGLAGCLPYVGGEAKVPAMDCCSGIREVIDKSKRCLCILIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP+L +KIN TLAL LPD C TP NI++C +LL+LAPNS +AKVF+ + N+   +N T
Sbjct  81   RDDPNLGLKINVTLALSLPDACQTPTNITQCVDLLHLAPNSTEAKVFEGFKNAL--TNKT  138

Query  655  SPAA  666
            SP++
Sbjct  139  SPSS  142



>ref|XP_011089118.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=196

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 110/158 (70%), Gaps = 3/158 (2%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A+ D+ KDK +C ++L  LA CL YVSGE+K P  DCC+GLK VL KS +C+CLLVKD N
Sbjct  32   ATCDVDKDKLKCGDELVGLATCLPYVSGESKTPPIDCCAGLKQVLHKSPECICLLVKDRN  91

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DPSL +KINATLAL LP +C  PAN+S CP LL+L PNSPDAKVF+D+AN     N T+ 
Sbjct  92   DPSLGLKINATLALTLPSQCHAPANVSHCPALLHLPPNSPDAKVFEDFANQG---NATTT  148

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFL  774
            +AP   S      S+  +SDG K+  +  V+V+ G+ L
Sbjct  149  SAPAAASGDSSTRSAGERSDGGKKLGMEMVSVSAGVLL  186



>ref|XP_003629697.1| Non-specific lipid-transfer protein-like protein [Medicago truncatula]
 gb|AET04173.1| protease inhibitor/seed storage/LTP family protein [Medicago 
truncatula]
 gb|AFK34908.1| unknown [Medicago truncatula]
Length=194

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 112/165 (68%), Gaps = 4/165 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SD+ +DKAEC  KL  LA CL +V+ +AK+PT DCC+G+K V+DKS++CLC+L+KD
Sbjct  23   GLVTSDINQDKAECTNKLLTLAGCLPFVTNQAKSPTIDCCTGVKEVVDKSKRCLCILIKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP+L + IN TLAL LP+ C++P NI++C ++L+L P S +AKVF+D+  S +  NT+
Sbjct  83   HDDPNLGLTINVTLALKLPNDCNSPTNITQCIDILHLKPKSHEAKVFEDFQKSLE-KNTS  141

Query  655  SPAAPVKGSPSGGATSSDVKSD---GCKRKRLVEVNVAMGLFLYV  780
            +   P  G+   G ++S +  D   G   KR + V V  G+  +V
Sbjct  142  TTVPPASGTTRNGTSTSTIAQDKNGGGWGKRWLLVEVLCGILPFV  186



>ref|XP_002530873.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF31513.1| lipid binding protein, putative [Ricinus communis]
Length=145

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSD A+D+AECA +L  LA CL YV G AK PT DCC+GLK VLDKSRKCLC+L+KD
Sbjct  17   GCGSSDFAQDRAECANQLVGLATCLPYVGGTAKTPTLDCCTGLKSVLDKSRKCLCVLIKD  76

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             ++P L IK NATLA  LP  C  P N++EC +LL+L P+SPDAKVF  +AN   G+ TT
Sbjct  77   RDNPDLGIKFNATLAAFLPAACHAPVNVTECIDLLHLPPSSPDAKVFAGFANVTGGNGTT  136

Query  655  SPAA  666
            +  A
Sbjct  137  TAVA  140



>ref|XP_010101138.1| putative GPI-anchored protein [Morus notabilis]
 gb|EXB87356.1| putative GPI-anchored protein [Morus notabilis]
Length=182

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 104/154 (68%), Gaps = 4/154 (3%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SS L +DKAEC EKL  LA CL +V G+A +PT DCC GLK V++KS KCLC+LVKD
Sbjct  23   GFGSSTLEQDKAECGEKLVGLATCLNFVGGQASSPTSDCCRGLKTVVEKSTKCLCVLVKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANS-AKGSNT  651
             +DP LDIK N T AL LP  C  P N++ C +LL LAPNS DAKVF+D+A S   G++T
Sbjct  83   RDDPELDIKFNVTRALQLPSTCHVPLNLTACVDLLGLAPNSTDAKVFEDFAKSLGNGTST  142

Query  652  T-SPAAPVKG-SPSGGATSSDVKSDG-CKRKRLV  744
            + SPAA   G S S G T++  + DG   R R V
Sbjct  143  SASPAARTDGNSTSHGNTAAKGERDGIIIRARFV  176



>ref|XP_010542450.1| PREDICTED: protein YLS3-like isoform X1 [Tarenaya hassleriana]
Length=194

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 113/166 (68%), Gaps = 6/166 (4%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDLA+D+AEC+E+L  LA CL YV GEAKAPT+DCC+G K V+DKSRKC+C+L+KD
Sbjct  20   GSGNSDLAQDRAECSEQLVGLATCLPYVGGEAKAPTRDCCAGFKDVVDKSRKCICILIKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             NDP L +KINATLA+ LP  C   + NIS C  LL+L PNSP+AK F+        +N+
Sbjct  80   RNDPQLGLKINATLAVLLPTLCHQSSPNISACTSLLHLPPNSPEAKEFESLGKIEGNANS  139

Query  652  TSPA---APVKGS-PSGGATSSDVKSDGCKRKRLVEV-NVAMGLFL  774
            TS +     VKG+  + GA ++  KS+G KR+  + V  +   LFL
Sbjct  140  TSSSPKPKDVKGAREAQGAEAASEKSNGDKRESWLAVFTLIHALFL  185



>ref|XP_011009645.1| PREDICTED: protein YLS3-like [Populus euphratica]
 ref|XP_011009646.1| PREDICTED: protein YLS3-like [Populus euphratica]
Length=195

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 96/141 (68%), Gaps = 0/141 (0%)
 Frame = +1

Query  319  KDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDI  498
            KD  ECAE+L  LA CL YV G+AKAPT DCC+GLK VL  ++KCLC+++KD NDP L +
Sbjct  31   KDTEECAEQLVGLATCLPYVGGDAKAPTPDCCNGLKQVLKDNKKCLCVIIKDRNDPDLGL  90

Query  499  KINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAAPVKG  678
            KINATLAL LP  C  PAN+S+CP LLNL PNSPDA++F   ANS+  + ++   +P  G
Sbjct  91   KINATLALSLPSVCHAPANVSQCPALLNLPPNSPDAQIFYQLANSSNHTASSPALSPSPG  150

Query  679  SPSGGATSSDVKSDGCKRKRL  741
                   S+  +S GC   ++
Sbjct  151  GAQPQGRSAQQESHGCHSGKI  171



>ref|XP_009375461.1| PREDICTED: protein YLS3-like [Pyrus x bretschneideri]
Length=193

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 107/164 (65%), Gaps = 2/164 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  S ++ +DKAECA++L  LAPCL YV G+AK+PT DCCSG+K V+ KS+KCLC+L+KD
Sbjct  23   GFGSCNIDQDKAECADQLVGLAPCLPYVGGDAKSPTIDCCSGIKVVVQKSKKCLCVLIKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP L +KINATLAL LP  C  P NIS C +LLNL  NSPDAK+F+DY N  +  ++T
Sbjct  83   RDDPKLGLKINATLALNLPSSCHVPINISRCVDLLNLPSNSPDAKMFRDYENKTETRSST  142

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMG--LFLYV  780
            +       S S G  + +    G   K L+ + +  G  L  Y+
Sbjct  143  TAPISSGNSTSSGTVAQEKSDGGSLGKSLIGIEMLFGSLLLFYI  186



>emb|CCH50970.1| T4.9 [Malus x robusta]
Length=193

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 107/164 (65%), Gaps = 2/164 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  S ++ +DKAECA++L  LAPCL YV G+AK+PT DCCSG+K V+ KS+KCLC+L+KD
Sbjct  23   GFGSCNIDQDKAECADQLVGLAPCLPYVGGDAKSPTIDCCSGIKVVVQKSKKCLCVLIKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP L +KINATLAL LP  C  P NIS C +LLNL  NSPDAK+F+DY N  +  ++T
Sbjct  83   RDDPKLGLKINATLALNLPSSCHVPINISRCVDLLNLPSNSPDAKMFRDYENKTEARSST  142

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMG--LFLYV  780
            +       S S G  + +    G   K L+ + +  G  L  Y+
Sbjct  143  TAPISSGNSTSSGTVAQEKSDGGSLGKSLMGIEMLFGSLLLFYI  186



>gb|KHG18912.1| hypothetical protein F383_24909 [Gossypium arboreum]
Length=182

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 102/160 (64%), Gaps = 8/160 (5%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A +D+ +DK EC+ +L  LAPCL YV G+AK PT DCCSGLK VLDKSRKCLC+L+KD +
Sbjct  22   AKADINQDKTECSNELVGLAPCLPYVGGDAKTPTIDCCSGLKQVLDKSRKCLCVLLKDRD  81

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DPSL + INATLA  LP  C  P N+++C  LL+L P+S +AK+FQ Y       N+ S 
Sbjct  82   DPSLGLNINATLAATLPTTCRAPVNMTDCISLLHLTPDSQEAKLFQGYQKLTHTGNSNST  141

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
                  +          KSDG K K+ V V +A G+ L++
Sbjct  142  TTAAAAAAD--------KSDGGKAKKWVGVEIAFGVSLWI  173



>ref|XP_006369483.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
 gb|ERP66052.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
Length=197

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 96/141 (68%), Gaps = 0/141 (0%)
 Frame = +1

Query  319  KDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDI  498
            KD  ECAE+L  LA CL YV G+AKAPT DCC+GLK VL  ++KCLC+++KD NDP L +
Sbjct  33   KDSEECAEQLVGLATCLPYVGGDAKAPTPDCCNGLKQVLKDNKKCLCVIIKDRNDPELGL  92

Query  499  KINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAAPVKG  678
            KINATLAL LP  C  PAN+S+CP LLNL PNSPDA++F   ANS+    ++   +P  G
Sbjct  93   KINATLALSLPSVCHAPANVSQCPALLNLPPNSPDAQIFYQLANSSNHIASSPALSPSPG  152

Query  679  SPSGGATSSDVKSDGCKRKRL  741
                   S+  +S+GC   ++
Sbjct  153  GAQPQGRSAQQESNGCHSGKI  173



>ref|XP_004955761.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Setaria italica]
Length=204

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 96/141 (68%), Gaps = 3/141 (2%)
 Frame = +1

Query  241  MDPKIMAClfllqllvlfGPAS---SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDC  411
            MDP+  A +  L +     PA     D A D+AEC++KL  LA CL YV  EA APT DC
Sbjct  1    MDPRAAASVLALFVAAAMSPAVVVVGDFAADRAECSDKLVGLATCLTYVQDEASAPTPDC  60

Query  412  CSGLKGVLDKSRKCLCLLVKDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAP  591
            C+GLK VL  SRKCLC+LVKD +DP+L +K+N T ALGLP  C+ PANIS+CP LLNLAP
Sbjct  61   CAGLKTVLQSSRKCLCVLVKDKDDPNLGLKLNVTKALGLPAVCNAPANISDCPRLLNLAP  120

Query  592  NSPDAKVFQDYANSAKGSNTT  654
            NS +A+VF+ YA  A    TT
Sbjct  121  NSKEAQVFEQYAKQAAAQGTT  141



>ref|XP_010934252.1| PREDICTED: protein YLS3 [Elaeis guineensis]
Length=204

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 95/137 (69%), Gaps = 6/137 (4%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            ASSD A D+AECA++L  LA CL YV   A APT DCCSGLK VL KSRKCLC+L+KD +
Sbjct  41   ASSDFASDRAECADQLTGLATCLTYVENRASAPTPDCCSGLKQVLAKSRKCLCVLIKDRD  100

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT--  654
            +PSL +KIN T A+ LP  C   ANISECP+LLNL PNS DA++F+ + N+ + +  T  
Sbjct  101  NPSLGVKINVTTAMALPTVCHASANISECPKLLNLPPNSKDAQIFEQHGNTTQATANTGA  160

Query  655  ----SPAAPVKGSPSGG  693
                +  A V+G+  GG
Sbjct  161  TSSVASGASVQGNYHGG  177



>ref|XP_008351727.1| PREDICTED: protein YLS3-like [Malus domestica]
Length=193

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 106/164 (65%), Gaps = 2/164 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  S ++ +DKAECA++L  LAPCL YV G+AK+PT DCCSG+K V+ KS+KCLC+L+KD
Sbjct  23   GFGSCNIDQDKAECADQLVGLAPCLPYVGGDAKSPTIDCCSGIKVVVQKSKKCLCVLIKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP L +KINATLAL LP  C  P NIS C +LLNL  NSPDAK+F DY N  +  ++T
Sbjct  83   RDDPKLGLKINATLALNLPSSCHVPINISRCVDLLNLPSNSPDAKMFXDYENKTEARSST  142

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMG--LFLYV  780
            +       S S G  + +    G   K L+ + +  G  L  Y+
Sbjct  143  TAPISSGNSTSSGTVAQEKSDGGSLGKSLMGIEMLFGSLLLFYI  186



>ref|XP_011025176.1| PREDICTED: protein YLS3 [Populus euphratica]
Length=190

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 106/160 (66%), Gaps = 0/160 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A SD  +D+AECA++L  LA CL YVSG+AKAPT DCCSGLK VLDKS+KCLC+L+KD
Sbjct  23   GSAKSDFQQDRAECADQLVGLATCLPYVSGDAKAPTLDCCSGLKQVLDKSKKCLCVLIKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             ++P+L +K N +L   LP  C +P N++EC +LL+L  NSPDAK F+ +AN  + ++  
Sbjct  83   RDNPNLGVKFNVSLVAKLPSLCHSPVNVTECIDLLHLPANSPDAKFFEGFANITQSASID  142

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFL  774
            +PA     + S  +++++  SD     R +   +  G  L
Sbjct  143  TPAGSGSSTGSNPSSAAEKSSDERPAHRWLVAEIVSGSLL  182



>ref|XP_006838654.1| hypothetical protein AMTR_s00002p00240480 [Amborella trichopoda]
 gb|ERN01223.1| hypothetical protein AMTR_s00002p00240480 [Amborella trichopoda]
Length=190

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 106/156 (68%), Gaps = 2/156 (1%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            DLA+D+ EC E+L  LA CL YV GEA +PT+DCC G K V++KS KC C+L+KDS DP+
Sbjct  26   DLAEDRKECTEQLTGLATCLPYVQGEAASPTKDCCRGFKQVVEKSDKCFCILIKDSTDPN  85

Query  490  LDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAAP  669
            L IKIN +LA  LP  CST  NIS CPE+L+++PN+P+A++F+ +A SA  +NT++PA+ 
Sbjct  86   LGIKINTSLAAKLPHSCSTSVNISRCPEILHISPNAPEAQIFKQFA-SAVATNTSAPAS-  143

Query  670  VKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLY  777
            V  + SG    +   S   +     +  +  GLF++
Sbjct  144  VSSTGSGKQNGTSSGSSSDESGASRDERIWRGLFVW  179



>gb|ACU14650.1| unknown [Glycine max]
Length=193

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A+SD+ +DKAEC +KL  LA CL YV GEAK P  DCCSG++ V+DKS++CLC+L+KD
Sbjct  21   GFATSDINQDKAECTDKLLGLAGCLPYVGGEAKVPAMDCCSGIREVIDKSKRCLCILIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP+  +KIN TLAL LPD C TP NI++C +LL+LAPNS +AKVF+ + N+   +N T
Sbjct  81   RDDPNPGLKINVTLALSLPDACQTPTNITQCVDLLHLAPNSTEAKVFEGFKNAL--TNKT  138

Query  655  SPAA  666
            SP++
Sbjct  139  SPSS  142



>ref|XP_008451096.1| PREDICTED: protein YLS3-like [Cucumis melo]
Length=187

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 114/163 (70%), Gaps = 11/163 (7%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A+S++ +D+ EC+++L  LAPCL YVSG+AK PT DCCSGLK V+ KS+KCLC+L+KD +
Sbjct  22   AASNIDQDRTECSDQLIGLAPCLPYVSGDAKTPTIDCCSGLKQVVQKSKKCLCVLIKDKD  81

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP+L +KIN +LAL LP  C  PANI+EC  LL+L+PNS +AK+F++   +++ S  +SP
Sbjct  82   DPNLGLKINGSLALALPHACHAPANITECISLLHLSPNSTEAKIFKESNPTSEPS--SSP  139

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLV-----EVNVAMGLFL  774
               V GS S    +++ KSDG   KR +      + + +G F+
Sbjct  140  DTKVHGSSS----AANEKSDGGMGKRWIGGTEMIMKILLGFFI  178



>ref|XP_009770685.1| PREDICTED: protein YLS3-like [Nicotiana sylvestris]
Length=192

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 100/165 (61%), Gaps = 8/165 (5%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            +SD  KDK EC + L  LA CL YV+  A APT DCC+GLK VL  S+KCLCLL+KD ND
Sbjct  18   NSDTEKDKEECTQSLIGLATCLPYVTANAPAPTPDCCTGLKQVLKASKKCLCLLIKDRND  77

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANS----AKGSNT  651
            P L + +N TLAL LP  C  PANIS+CP LL+L PNSPDA+VF    N     A     
Sbjct  78   PDLGLNLNVTLALSLPSVCQAPANISQCPALLHLPPNSPDAQVFYQIGNGSSSIASSPQA  137

Query  652  TSPAAPVKGSPSG---GATSSDVKSDGCKR-KRLVEVNVAMGLFL  774
             SP   V  SP+G   GA S+   +DGC   KR   +   +G+ L
Sbjct  138  NSPTPSVGSSPTGTPAGAASAPKSNDGCHIGKRWFGLEAIVGVVL  182



>ref|XP_004504343.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Cicer arietinum]
Length=193

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 124/193 (64%), Gaps = 19/193 (10%)
 Frame = +1

Query  166  RGSPHFPSLPSLYFACP*LIFPNTTMDPKIMAClfllqllvlfGPASSDLAKDKAECAEK  345
             GS    + PSL+F+   LIF                 L+++FG A+SD+ +DKAEC +K
Sbjct  1    MGSKSVTTNPSLFFSI--LIF-----------------LVLMFGLANSDVNQDKAECTDK  41

Query  346  LGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIKINATLALG  525
            L  LA CL +V+G+AK+P  DCC+G+K V++ S++CLC+L+KD +DP+L +KIN TLAL 
Sbjct  42   LLTLANCLPFVTGQAKSPNIDCCTGVKDVINNSKRCLCILIKDRDDPNLGLKINVTLALE  101

Query  526  LPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAAPVKGSPSGGATSS  705
            LP+ C TP NI++C ++L+LAP SP+AK+F+D   S + +++T+ A     +  G +T +
Sbjct  102  LPNDCKTPTNITKCVDILHLAPKSPEAKIFEDIQKSMEKNSSTTVAPASNSTGKGTSTIT  161

Query  706  DVKSDGCKRKRLV  744
                 G  +K L+
Sbjct  162  HENGGGWGKKWLM  174



>ref|XP_008378010.1| PREDICTED: protein YLS3-like [Malus domestica]
Length=198

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 104/149 (70%), Gaps = 2/149 (1%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A++D AKD+ EC ++L  +A CL YV G+AKAPT DCCSGLK VL+ ++KCLC+++KD N
Sbjct  24   ATADSAKDREECTQQLVGMATCLPYVGGQAKAPTPDCCSGLKQVLNNNKKCLCVIIKDRN  83

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF-QDYANSAKGSNTTS  657
            DP L ++IN TLALGLP  C  PAN+S+CPELL+L P SP+A+VF Q   NS K +++ +
Sbjct  84   DPELGLQINVTLALGLPSVCKAPANVSKCPELLHLDPKSPEAQVFYQLEGNSTKTASSLA  143

Query  658  PAAPVKGSPSGGATSSDVKSDGCKRKRLV  744
            P+  V G P+   +     S    R+ +V
Sbjct  144  PSPSVDG-PTSARSVGPSSSSWAARQNIV  171



>gb|KFK38683.1| hypothetical protein AALP_AA3G147000 [Arabis alpina]
Length=187

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 105/164 (64%), Gaps = 4/164 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDL KD+ EC ++L ALAPCL YV G+AKAPT+DCC G   V+ KS KC+C+L+KD
Sbjct  17   GFGSSDLTKDREECTDQLLALAPCLTYVGGDAKAPTKDCCGGFGQVIAKSEKCVCVLIKD  76

Query  475  SNDPSLDIKINATLALGLPDRCST-PANISECPELLNLAPNSPDAKVFQDYANSAKG-SN  648
             +DP L IK NATLA+ LP  C   P NI+EC  LL++ PNS  AK F+      +  +N
Sbjct  77   KDDPQLGIKFNATLAVHLPSACHIAPPNITECISLLHIPPNSTLAKEFESLEKFVEANTN  136

Query  649  TTSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
            TTSP+  VKG  +GGA +  VKS+G K    V   +    FL +
Sbjct  137  TTSPSKNVKG--TGGAKAESVKSNGNKSWLGVVELLIFAQFLLI  178



>ref|XP_008231395.1| PREDICTED: protein YLS3-like isoform X2 [Prunus mume]
Length=190

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A++D AKD+ EC ++L  +A CL YV G+AK+PT DCCSGLK VL+ ++KCLC+++KD
Sbjct  21   GMAAADSAKDRDECTQQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF-QDYANSAKGSNT  651
             NDP L ++IN TLALGLP  C  PAN+S+CPELL+L P SP+A+VF Q   NS + +N+
Sbjct  81   RNDPELGLQINVTLALGLPSVCQVPANVSKCPELLHLDPKSPEAQVFYQLERNSTQTANS  140

Query  652  TSPAAPVKGSPS  687
            +   +P  G+P+
Sbjct  141  SLAPSPSVGAPA  152



>ref|XP_004504341.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Cicer arietinum]
Length=194

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 123/196 (63%), Gaps = 19/196 (10%)
 Frame = +1

Query  169  GSPHFPSLPSLYFACP*LIFPNTTMDPKIMAClfllqllvlfGPASSDLAKDKAECAEKL  348
            GS    + PSL+F+   LIF                 L+++FG A SD+ +DKAEC +KL
Sbjct  2    GSKSVTTNPSLFFST--LIF-----------------LVLMFGLAYSDVNQDKAECTDKL  42

Query  349  GALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIKINATLALGL  528
              LA CL +V+G+AK+P  DCC+G+K V++ S++CLC+L+KD +DP+L +KIN TLAL L
Sbjct  43   LILANCLPFVTGQAKSPNIDCCTGVKDVINNSKRCLCILIKDHDDPNLGLKINVTLALQL  102

Query  529  PDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAAPVKGSPSGGATSSD  708
            P+ C TP NI++C  +L+L P SP+AK+F+D  NS + +++T+       +  G +T   
Sbjct  103  PNDCKTPTNITKCVGILHLPPKSPEAKIFEDIQNSMEKNSSTAVPPASNSTGKGTSTRGQ  162

Query  709  VKSDGCKRKRLVEVNV  756
             K+ G  RKR +   V
Sbjct  163  EKNGGGWRKRWLMAEV  178



>ref|XP_004502215.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Cicer arietinum]
Length=184

 Score =   146 bits (369),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 110/165 (67%), Gaps = 6/165 (4%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDL KD+ ECA+KL  LA CL YV G+A  P  DCC+ LK VLDK++KC+C+L+KD
Sbjct  21   GFVNSDLTKDREECADKLVTLASCLPYVGGDANTPAIDCCTALKLVLDKTKKCICILIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             NDP L   +NATLA+ LP+ C  P+NIS+C +LL+L+P S +AKVF+   NS + +N++
Sbjct  81   RNDPKLGFTLNATLAVQLPNACHIPSNISQCVDLLHLSPKSAEAKVFEGLGNSTQ-TNSS  139

Query  655  SPAAPVKGSPSGGATSSDVKSDGC---KRKRLVEVNVAMGLFLYV  780
            +P +   G    G +SS  +  GC   KR  + E+  A+  F+++
Sbjct  140  TPVS--NGGAEKGPSSSSEEKSGCDLGKRWLVAELVFAILPFVFI  182



>ref|XP_007219100.1| hypothetical protein PRUPE_ppa015466mg, partial [Prunus persica]
 gb|EMJ20299.1| hypothetical protein PRUPE_ppa015466mg, partial [Prunus persica]
Length=147

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A++D AKD+ EC ++L  +A CL YV G+AK PT DCCSGLK VL+ ++KCLC++++D
Sbjct  21   GMAAADSAKDRDECTQQLAGMATCLPYVQGQAKTPTPDCCSGLKQVLNSNKKCLCVIIQD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF-QDYANSAKGSNT  651
             NDP LD++IN TLALGLP  C  PAN+S+CPELL+L P SP+A+VF Q   NS + +N+
Sbjct  81   RNDPELDLQINVTLALGLPSVCQVPANVSKCPELLHLDPKSPEAQVFYQLERNSTQTANS  140

Query  652  TSPAAP  669
            +   +P
Sbjct  141  SLAPSP  146



>ref|XP_008802527.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
 ref|XP_008802528.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=187

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G ASSD A D+AECA+K+ AL+ CL Y+ G A+APT DCCS +K V++KS KC+C+LVKD
Sbjct  25   GFASSDYASDRAECADKVMALSTCLTYMQGSARAPTPDCCSSVKQVVEKSFKCVCVLVKD  84

Query  475  SNDPSL-DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK  639
             N+P L   K+N TLALGLP RC  PAN S+CP LLNL  NS DAKVF+ Y N+ K
Sbjct  85   RNEPELASFKVNVTLALGLPSRCHVPANASDCPRLLNLPLNSTDAKVFEQYENALK  140



>ref|XP_004229337.1| PREDICTED: protein YLS3 [Solanum lycopersicum]
Length=194

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 98/161 (61%), Gaps = 4/161 (2%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            +SD  KDK EC + L  LA CL YV G A APT DCC+GLK VL  S+KCLCLL+KD ND
Sbjct  23   NSDTEKDKEECTQSLIGLATCLPYVGGNAPAPTPDCCTGLKQVLKDSKKCLCLLIKDRND  82

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYAN---SAKGSNTT  654
            P L +++N TLAL LP  C  PANISECP LL+L  NSPDA+VF   AN   S  GS   
Sbjct  83   PDLGLQLNVTLALTLPSVCKAPANISECPALLHLPANSPDAQVFYQIANNSSSIAGSPLA  142

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKR-KRLVEVNVAMGLFL  774
                P  GS   GA +   KS GC   KR   +   +G+ L
Sbjct  143  HSPIPSVGSSPTGAPAGAPKSAGCHIGKRYFGLEAIVGVVL  183



>gb|AFK37798.1| unknown [Lotus japonicus]
Length=186

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 115/166 (69%), Gaps = 7/166 (4%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDLA D  +C +KL  LA C  YV G+AK P+ DCCSGLK VL++S+KCLC+L+KD
Sbjct  17   GFGSSDLAADIQDCGDKLVGLAGCRPYVGGDAKVPSIDCCSGLKVVLEQSKKCLCILIKD  76

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP L  K+NATLA+ LP  C  PANI++C +LL+L+P SP+AKVF+ +  S+K +N++
Sbjct  77   RDDPDLGFKMNATLAVHLPSACHAPANITQCVDLLHLSPKSPEAKVFEGFQGSSK-TNSS  135

Query  655  SPAAPVKGSPSGGATSSDV---KSDGCKRKRLVEVNVAMGL-FLYV  780
            +P +  KG    G++SS +   KS G  ++ LV   V + L F+++
Sbjct  136  TPVS--KGGVDQGSSSSTIAQDKSYGLGKRLLVAEVVTIILPFVFM  179



>ref|XP_011093401.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=197

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            +SD +KD+ ECA+ L  LA CL YV G AK PT DCCSGLK VL  ++KCLC+++KD ND
Sbjct  22   TSDNSKDRQECADSLVGLATCLPYVGGTAKTPTPDCCSGLKQVLKTNKKCLCIVIKDRND  81

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA  663
            P L + IN TLALGLP  C+ PANIS+CP LLNL PNSP+A++F     ++ G   T+ A
Sbjct  82   PDLGLNINVTLALGLPAVCNAPANISQCPALLNLPPNSPEAQIFYQLGKNSTG---TTAA  138

Query  664  APVKGSPS  687
            +PV G P+
Sbjct  139  SPVAGGPT  146



>ref|XP_004165809.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cucumis sativus]
Length=187

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 112/163 (69%), Gaps = 11/163 (7%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A+SD+ +D+ +C+++L  LA CL YVSG+AK PT DCCSGLK V+ KS+KCLC+L+KD +
Sbjct  22   AASDIDQDRTDCSDQLIGLAQCLPYVSGDAKTPTIDCCSGLKQVVQKSKKCLCVLIKDKD  81

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP+L +KIN +LAL LP  C  PANI+EC  LL+L+PNS +AK+F++   +++ S  +SP
Sbjct  82   DPNLGLKINGSLALALPHACHAPANITECISLLHLSPNSTEAKIFKESNPTSEPS--SSP  139

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLV-----EVNVAMGLFL  774
               V GS S     ++ KSDG   KR +      V + +G F+
Sbjct  140  DTKVHGSSS----VANEKSDGGMGKRWIGGTEMIVKILLGFFI  178



>ref|XP_006359139.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Solanum tuberosum]
Length=193

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 99/161 (61%), Gaps = 4/161 (2%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            +SD  KDK EC + L  LA CL YV G A APT DCC+GLK VL  S+KCLCLL+KD ND
Sbjct  23   NSDTEKDKEECTQSLIGLATCLPYVGGNAPAPTPDCCTGLKQVLKASKKCLCLLIKDRND  82

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYAN---SAKGSNTT  654
            P L +++N TLAL LP  C  PANISECP LL+L  NSP+A+VF   AN   S  GS + 
Sbjct  83   PDLGLQLNVTLALTLPSVCKAPANISECPALLHLPANSPEAQVFYQIANNSSSIAGSPSA  142

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKR-KRLVEVNVAMGLFL  774
                P  GS   GA +   KS GC   KR   +   +G+ L
Sbjct  143  HSPIPSVGSSPTGAPAGAPKSAGCHIGKRWFGLEAIVGVVL  183



>emb|CDP07663.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 98/162 (60%), Gaps = 4/162 (2%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A SD AKDK EC   L  LA CL YV G AK PT DCCSGLK VL  ++KCLCL++KD N
Sbjct  23   AISDDAKDKQECTNALVGLATCLPYVGGNAKFPTPDCCSGLKEVLKTNKKCLCLVIKDRN  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYAN---SAKGSNT  651
            DP L + IN TLALGLP  C+ PANISECP LL+L PNSPDA+VF    +   S  GS  
Sbjct  83   DPDLGLSINVTLALGLPSVCNAPANISECPALLHLDPNSPDAQVFYQNGHASSSIAGSPV  142

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLY  777
            + P A    SP   A      +   K+   VE  V   LFL+
Sbjct  143  SGPTATAASSPGPNAKQHSDGNRSGKQWFGVEA-VVTTLFLW  183



>ref|XP_010534886.1| PREDICTED: protein YLS3-like [Tarenaya hassleriana]
Length=191

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 113/191 (59%), Gaps = 25/191 (13%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDLA+D+AEC+E+L  LA CL YV G+AK PT+DCC+G K V+DKS+KC+C+L+KD
Sbjct  20   GIGNSDLAQDRAECSEQLVGLATCLPYVGGDAKVPTKDCCAGFKAVIDKSKKCICILIKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L +KINATLA+ LP  C  PA NIS+C  LL L PNSP AK F+        +N+
Sbjct  80   RDDPELGLKINATLAVHLPTVCHQPAPNISDCTSLLKLPPNSPAAKEFESLGKVEGNANS  139

Query  652  TS---PAAPVKGSPSGGATSSDV-KSDGCKRKRLVEVNVAMGLFLYVfilifnl*fq*f*  819
            TS   P    KG  +  A  ++  KSDG   KR        G  + V             
Sbjct  140  TSSPNPQGTSKGETTTKAKGAEAEKSDGGNIKR-------KGWLVVV-------------  179

Query  820  VFLYFCISYIF  852
             FL +C++ +F
Sbjct  180  TFLIYCLTSLF  190



>ref|XP_007052623.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96780.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=177

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 105/162 (65%), Gaps = 4/162 (2%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A +D  +DK EC ++L ALA CL YV G+AKAPT DCCSGLK VL+ ++KCLC+++KD N
Sbjct  5    AMADSDQDKEECTQQLVALATCLPYVGGDAKAPTPDCCSGLKQVLNNNKKCLCVIIKDRN  64

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L + IN TLAL LP  C+ PAN+S+CPELL++ PNS +A+VF   + S+ G      
Sbjct  65   DPDLGLNINVTLALALPSVCNAPANVSKCPELLHMDPNSREAQVFYQLSKSSNGGANNPA  124

Query  661  AAPVKGSPSGGATSSDV--KSDGC--KRKRLVEVNVAMGLFL  774
             +P   S S  +  +++  K DGC    KR + + +  G  L
Sbjct  125  PSPTGNSISSKSEGANIPQKGDGCCSTGKRWLRLEIITGWTL  166



>gb|KHG04910.1| hypothetical protein F383_07676 [Gossypium arboreum]
Length=208

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 102/167 (61%), Gaps = 13/167 (8%)
 Frame = +1

Query  319  KDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDI  498
            KDK EC E+L  LA CL YV G AKAPT DCCSGLK VL  ++KCLC+++KD NDP L +
Sbjct  38   KDKEECTEQLIGLATCLPYVGGNAKAPTPDCCSGLKQVLKNNKKCLCIIIKDRNDPDLGL  97

Query  499  KINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDY-----ANSAKGSNTTSPA  663
             IN TLAL LP  C+ PANIS+CPELL++ PNSP+A+VF        +N    S  ++P 
Sbjct  98   NINVTLALSLPSVCNAPANISKCPELLHMDPNSPEAQVFYQLSKSSSSNGGHQSPASAPT  157

Query  664  APVKGSP---SGGATSSDVKSD-----GCKRKRLVEVNVAMGLFLYV  780
            A V  SP   S G  S +++       GC+R   V V +   L  Y 
Sbjct  158  ASVGESPISSSEGEKSPELQKGHGNCYGCRRNTWVIVTLWTFLLCYF  204



>gb|EEC81687.1| hypothetical protein OsI_25271 [Oryza sativa Indica Group]
Length=198

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 97/138 (70%), Gaps = 7/138 (5%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYV----SGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDS  477
            D A D+AECA+KL AL+ CL +V    SG A APT DCCSGLK VL  SRKCLC+L+KD 
Sbjct  11   DFAADRAECADKLMALSTCLTFVQDGASGGAAAPTPDCCSGLKAVLAASRKCLCVLIKDR  70

Query  478  NDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYAN---SAKGSN  648
            +DP+LD+KIN T AL LP  C+ PANIS+CP LLNL PNS DA++F+ +A    + +GS 
Sbjct  71   DDPNLDLKINVTKALSLPQLCNAPANISDCPRLLNLPPNSKDAQIFEQFAKQQAAMQGSP  130

Query  649  TTSPAAPVKGSPSGGATS  702
            + SP      S  GG+++
Sbjct  131  SASPVGEQTFSHQGGSSA  148



>ref|XP_006369482.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
 gb|ERP66051.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
Length=161

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = +1

Query  319  KDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDI  498
            KD  ECAE+L  LA CL YV G+AKAPT DCC+GLK VL  ++KCLC+++KD NDP L +
Sbjct  33   KDSEECAEQLVGLATCLPYVGGDAKAPTPDCCNGLKQVLKDNKKCLCVIIKDRNDPELGL  92

Query  499  KINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAAPVKG  678
            KINATLAL LP  C  PAN+S+CP LLNL PNSPDA++F   ANS   SN  + +  +  
Sbjct  93   KINATLALSLPSVCHAPANVSQCPALLNLPPNSPDAQIFYQLANS---SNHIASSPALSP  149

Query  679  SPSG  690
            SP G
Sbjct  150  SPGG  153



>ref|XP_004144111.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cucumis sativus]
 gb|KGN66415.1| hypothetical protein Csa_1G602030 [Cucumis sativus]
Length=187

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 112/163 (69%), Gaps = 11/163 (7%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            ++SD+ +D+ +C+++L  LA CL YVSG+AK PT DCCSGLK V+ KS+KCLC+L+KD +
Sbjct  22   SASDIDQDRTDCSDQLIGLAQCLPYVSGDAKTPTIDCCSGLKQVVQKSKKCLCVLIKDKD  81

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP+L +KIN +LAL LP  C  PANI+EC  LL+L+PNS +AK+F++   +++ S  +SP
Sbjct  82   DPNLGLKINGSLALALPHACHAPANITECISLLHLSPNSTEAKIFKESNPTSEPS--SSP  139

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLV-----EVNVAMGLFL  774
               V GS S     ++ KSDG   KR +      V + +G F+
Sbjct  140  DTKVHGSSS----VANEKSDGGMGKRWIGGTEMIVKILLGFFI  178



>ref|XP_011010692.1| PREDICTED: protein YLS3-like [Populus euphratica]
Length=190

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 104/165 (63%), Gaps = 8/165 (5%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A SD  +D+ ECA++L  LA CL YV G+AKAPT DCCSGLK VLDKS KCLC+L+KD
Sbjct  23   GTARSDFQQDRTECADQLVGLATCLPYVGGDAKAPTIDCCSGLKQVLDKSVKCLCVLIKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             ++P L IK N +L   LP  C  P N+++C ++L+L   SPDAKVF  +AN   G    
Sbjct  83   RDNPDLGIKFNVSLVAKLPSLCHAPVNVTKCIDILHLPAGSPDAKVFAGFANITGG----  138

Query  655  SPAAPVKGSPSGGATSS-DVKSDGCKR---KRLVEVNVAMGLFLY  777
            S AAPV  + S G+ SS   +  G +R   + LV   V  GL L+
Sbjct  139  SVAAPVASANSTGSKSSAAAEKSGAERPANRWLVTAEVLCGLLLW  183



>ref|XP_009409233.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=196

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 102/166 (61%), Gaps = 7/166 (4%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G   SD A D+AECA +L  LA CL Y+ G AKAPT DCCSG K V+ KS KCLC+L+++
Sbjct  21   GSVRSDFASDRAECAGQLIGLATCLTYIGGSAKAPTVDCCSGFKQVVTKSLKCLCVLIRN  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQD-------YANS  633
             ++P+L  KIN T AL LP +C TPA ++ECP LLNL  NS +AKVF++       YA S
Sbjct  81   RDNPNLGFKINVTRALLLPSKCDTPAQVTECPRLLNLPQNSAEAKVFEEFGEELKAYAAS  140

Query  634  AKGSNTTSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLF  771
            + G++TTS A   K S   G  S     +  KR+  + +N     F
Sbjct  141  SYGNSTTSMATGGKTSDQKGNGSLSKSGEANKRRLGMSMNGGFWTF  186



>ref|XP_010917572.1| PREDICTED: protein YLS3-like [Elaeis guineensis]
 ref|XP_010917573.1| PREDICTED: protein YLS3-like [Elaeis guineensis]
Length=187

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            ASSD++ D+ EC+++L  LA CL +V G AKAPT DCC+GLK VL KS KCLC+L+KDS+
Sbjct  23   ASSDVSSDQKECSDQLVGLATCLSFVQGNAKAPTPDCCTGLKQVLAKSPKCLCILIKDSD  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK  639
            DP L IK N +LAL LP  CS PANISECP+LLNL PNS DA++F+  AN+ +
Sbjct  83   DPQLGIKFNVSLALRLPSLCSAPANISECPKLLNLPPNSQDAEIFKQAANTTQ  135



>ref|XP_002512201.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF50235.1| lipid binding protein, putative [Ricinus communis]
Length=133

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A +D  KDK ECAE+L  LA CL YV G AK+PT DCC+GLK VL  ++KCLC+++KD
Sbjct  3    GFAMADADKDKEECAEQLVGLATCLPYVGGNAKSPTPDCCTGLKEVLKNNKKCLCVVIKD  62

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSA  636
             NDP L +KIN TLALGLP  C   AN+S+CP LL+LAPNSPDA+VF  +  S+
Sbjct  63   RNDPDLGLKINVTLALGLPTVCHATANVSQCPALLHLAPNSPDAQVFYQFTKSS  116



>gb|KFK38682.1| hypothetical protein AALP_AA3G147000 [Arabis alpina]
Length=188

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 104/164 (63%), Gaps = 3/164 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDL KD+ EC ++L ALAPCL YV G+AKAPT+DCC G   V+ KS KC+C+L+KD
Sbjct  17   GFGSSDLTKDREECTDQLLALAPCLTYVGGDAKAPTKDCCGGFGQVIAKSEKCVCVLIKD  76

Query  475  SNDPSLDIKINATLALGLPDRCST-PANISECPELLNLAPNSPDAKVFQDYANSAKG-SN  648
             +DP L IK NATLA+ LP  C   P NI+EC  LL++ PNS  AK F+      +  +N
Sbjct  77   KDDPQLGIKFNATLAVHLPSACHIAPPNITECISLLHIPPNSTLAKEFESLEKFVEANTN  136

Query  649  TTSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
            TTSP+  VK   +GGA +  VKS+G K    V   +    FL +
Sbjct  137  TTSPSKNVK-EGTGGAKAESVKSNGNKSWLGVVELLIFAQFLLI  179



>ref|XP_010228246.1| PREDICTED: protein YLS3-like isoform X1 [Brachypodium distachyon]
Length=199

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 88/114 (77%), Gaps = 2/114 (2%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D A D+AEC++KL ALA CL +V G+A APT DCC+GLK VL  SRKCLC+LVKD +DP 
Sbjct  25   DFAADRAECSDKLVALATCLTFVQGQAPAPTPDCCAGLKTVLQSSRKCLCVLVKDRDDPG  84

Query  490  LDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYA--NSAKGS  645
            L +KIN T ALGLP  CS  ANIS+CP LLNL PNS DA+VF+D+A   +A+GS
Sbjct  85   LGLKINVTRALGLPAACSAAANISDCPRLLNLPPNSKDAQVFEDFAKQQAAQGS  138



>ref|XP_008231394.1| PREDICTED: protein YLS3-like isoform X1 [Prunus mume]
Length=191

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 100/133 (75%), Gaps = 2/133 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A++D AKD+ EC ++L  +A CL YV G+AK+PT DCCSGLK VL+ ++KCLC+++KD
Sbjct  21   GMAAADSAKDRDECTQQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF-QDYANSAKGSNT  651
             NDP L ++IN TLALGLP  C  PAN+S+CPELL+L P SP+A+VF Q   NS + +N+
Sbjct  81   RNDPELGLQINVTLALGLPSVCQVPANVSKCPELLHLDPKSPEAQVFYQLERNSTQTANS  140

Query  652  T-SPAAPVKGSPS  687
            + +P+    G+P+
Sbjct  141  SLAPSPSAVGAPA  153



>ref|XP_002299127.1| hypothetical protein POPTR_0001s04590g [Populus trichocarpa]
 gb|ABK96104.1| unknown [Populus trichocarpa]
 gb|EEE83932.1| hypothetical protein POPTR_0001s04590g [Populus trichocarpa]
Length=189

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 103/165 (62%), Gaps = 9/165 (5%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A SD  +D+ ECA++L  LA CL YV G+AKAPT DCCSGLK VLDKS KCLC+L+KD
Sbjct  23   GTARSDFQQDRTECADQLVGLATCLPYVGGDAKAPTIDCCSGLKQVLDKSVKCLCVLIKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             ++P L IK N +L   LP  C  P N++ C ++L+L   SPDAKVF  +AN      T 
Sbjct  83   RDNPDLGIKFNVSLVAKLPSLCHAPVNVTNCIDILHLPAGSPDAKVFAGFANI-----TG  137

Query  655  SPAAPVKGSPSGGATSSD-VKSDGCKR---KRLVEVNVAMGLFLY  777
            S AAPV  + S G+ SS   +  G +R   + LV   V  GL L+
Sbjct  138  SVAAPVASANSTGSKSSTAAEKSGAERPANRWLVAAEVLCGLLLW  182



>ref|XP_009354800.1| PREDICTED: protein YLS3-like [Pyrus x bretschneideri]
Length=149

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A++D AKD+ EC ++L  +A CL YV G+AKAPT DCCSGLK VL+ ++KCLC+++KD N
Sbjct  24   ATADSAKDREECTQQLVGMATCLPYVGGQAKAPTPDCCSGLKQVLNNNKKCLCVIIKDRN  83

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF-QDYANSAKGSNTTS  657
            DP L +++N TLALGLP  C  PAN+S+CPELL+L P SP+A+VF Q   NS K +++ +
Sbjct  84   DPELGLQMNVTLALGLPSVCKAPANVSKCPELLHLDPKSPEAQVFYQLEGNSTKTASSLA  143

Query  658  PA  663
            P+
Sbjct  144  PS  145



>ref|XP_002881958.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58217.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 110/189 (58%), Gaps = 16/189 (8%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D AKDK EC E+L  +A CL YV G+AK+PT DCCSGLK VL+ ++KCLC++++D N
Sbjct  25   AGDDKAKDKEECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRN  84

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L ++IN +LAL LP  C   A++++CP LL+L PNSPDA+VF      AKGSN TSP
Sbjct  85   DPDLGLQINVSLALALPSVCHATADVTKCPALLHLDPNSPDAQVFYQL---AKGSNKTSP  141

Query  661  AAPVKGSPSGGATSSDV--KSDGCKRKRLVEV---NVAMGLFLYVfilifnl*fq*f*VF  825
            A+   G  SG  + S      DG    R   V   N A   +     L          V 
Sbjct  142  ASAPTGLASGPTSMSPTAGSDDGNNSGRTTSVPGRNNAQSFYKQWLGLEV--------VV  193

Query  826  LYFCISYIF  852
             +F I YIF
Sbjct  194  HFFVICYIF  202



>ref|XP_003601632.1| Non-specific lipid-transfer protein-like protein [Medicago truncatula]
Length=186

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 109/163 (67%), Gaps = 2/163 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDL +D+ +CA+KL  LA CL YV G A  PT DCC+ LK VL+ ++KC+C+L+KD
Sbjct  18   GFVSSDLTEDRKDCADKLVTLASCLPYVGGSANTPTIDCCTNLKQVLNNTKKCICILIKD  77

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
            SNDP L   +NATLA+ LP+ C  P+NISEC +LL+L+P SP+AKVF+   NS K +N++
Sbjct  78   SNDPKLGFPMNATLAVQLPNACHIPSNISECVDLLHLSPKSPEAKVFEGLGNSTK-TNSS  136

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLV-EVNVAMGLFLYV  780
            +P +         ++S +    G  R+ LV EV  A+  FL++
Sbjct  137  TPISSGSAEKGSSSSSEEKSGGGLGRRWLVAEVVCAILPFLFI  179



>gb|KDP20375.1| hypothetical protein JCGZ_05258 [Jatropha curcas]
Length=196

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 104/162 (64%), Gaps = 13/162 (8%)
 Frame = +1

Query  319  KDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDI  498
            KD+ ECAE+L  LA CL YV   +K+PT DCC+GLK VL  ++KCLC+++KD NDP L +
Sbjct  28   KDREECAEQLVGLATCLPYVGATSKSPTPDCCNGLKQVLRDNKKCLCVIIKDRNDPDLGL  87

Query  499  KINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA----  666
            KIN TLALGLP  C   AN+S+CP LL+LAPNSPDA+VF  +A S+  S  TSPA     
Sbjct  88   KINVTLALGLPSVCHATANVSQCPALLHLAPNSPDAQVFYQFAKSSNQSG-TSPAPSPSD  146

Query  667  ---PVKGSPSGGATSSDVKSDGC--KRKRLVEVNVA-MGLFL  774
               P  G+  G   S+   S GC   RK L  + +  +GL L
Sbjct  147  DENPASGTSQG--QSAQKMSSGCSTSRKALFGLQIVFLGLSL  186



>ref|XP_009628615.1| PREDICTED: protein YLS3-like [Nicotiana tomentosiformis]
Length=177

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G ASSD A+D+ EC  +L  L+ CL YV G+A+ PT  CC+ L+  L K++ CLCL+VKD
Sbjct  18   GFASSDFAEDRKECQNQLLHLSSCLSYVGGDAQLPTPACCAQLRKDLHKTKYCLCLIVKD  77

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             N+P +  KINATLALGLP  C  P N+SECP LL LAPNSPDA+VF D+A+ +K  N T
Sbjct  78   RNEPDIGFKINATLALGLPYICGAPTNVSECPALLKLAPNSPDAQVFIDFASHSKTGNNT  137

Query  655  S  657
            +
Sbjct  138  N  138



>ref|XP_010934234.1| PREDICTED: protein YLS3-like isoform X1 [Elaeis guineensis]
Length=183

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            ASSD A D+AECA+++  L+ CL Y+ G A+APT DCCS LK V+DKS KCLC+LVKD N
Sbjct  27   ASSDYASDRAECADQVIKLSTCLTYMQGSARAPTPDCCSSLKQVVDKSFKCLCILVKDRN  86

Query  481  DPSL-DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYAN  630
            +P L   K+N T AL LP +C  PAN S CP LLNL PNSPDAK+F++Y N
Sbjct  87   EPELASFKVNVTFALRLPSKCGVPANASACPRLLNLPPNSPDAKIFEEYGN  137



>ref|XP_006386057.1| hypothetical protein POPTR_0003s21390g [Populus trichocarpa]
 gb|ERP63854.1| hypothetical protein POPTR_0003s21390g [Populus trichocarpa]
Length=165

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A SD  +D+AECA++L  LA CL YVS +AKAPT DCCSGLK VLDKS+KCLC+L+KD
Sbjct  23   GSAKSDFQQDRAECADQLVGLATCLPYVSDDAKAPTLDCCSGLKQVLDKSKKCLCVLIKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             ++P+L IK N +L   LP  C +P N++EC  LL+L  NSPDAK F+ +AN  +  +  
Sbjct  83   RDNPNLGIKFNVSLVAKLPSLCHSPVNVTECINLLHLPANSPDAKFFEGFANVTQSGSID  142

Query  655  SPA  663
            +P 
Sbjct  143  TPV  145



>ref|XP_010544520.1| PREDICTED: protein YLS3-like [Tarenaya hassleriana]
Length=199

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 107/173 (62%), Gaps = 18/173 (10%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            +S D A+DK EC ++L  LA CL YV G+AKAPT DCCSGL+ VL  ++KCLC L++D N
Sbjct  22   SSGDKAQDKEECTQELVGLATCLTYVQGQAKAPTPDCCSGLRQVLKTNKKCLCELIRDRN  81

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L ++IN +LALGLP  C   A++++CP LL+L PNSP+A+VF       KG N T P
Sbjct  82   DPDLGLQINVSLALGLPSVCHAAADVTKCPSLLHLDPNSPEAQVFYQL---GKGLNNTGP  138

Query  661  A-------------APVKGSPSGG-ATSSDVKSDG-CKRKRLVEVNVAMGLFL  774
            +             +P  GS S G ATS    SDG  +RKR + + +   L L
Sbjct  139  SSGPTSSTLGPTGPSPTPGSTSDGRATSVRGTSDGQTQRKRWLGIEIVAQLVL  191



>ref|XP_002304871.1| hypothetical protein POPTR_0003s21390g [Populus trichocarpa]
 gb|EEE79850.1| hypothetical protein POPTR_0003s21390g [Populus trichocarpa]
Length=190

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 101/160 (63%), Gaps = 0/160 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A SD  +D+AECA++L  LA CL YVS +AKAPT DCCSGLK VLDKS+KCLC+L+KD
Sbjct  23   GSAKSDFQQDRAECADQLVGLATCLPYVSDDAKAPTLDCCSGLKQVLDKSKKCLCVLIKD  82

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             ++P+L IK N +L   LP  C +P N++EC  LL+L  NSPDAK F+ +AN  +  +  
Sbjct  83   RDNPNLGIKFNVSLVAKLPSLCHSPVNVTECINLLHLPANSPDAKFFEGFANVTQSGSID  142

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFL  774
            +P        S  +++++  SD     R +   +  G  L
Sbjct  143  TPVGSGSSIGSNPSSAAEKSSDERPANRWLVAEIVCGSLL  182



>gb|EEE66751.1| hypothetical protein OsJ_23458 [Oryza sativa Japonica Group]
Length=198

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 96/138 (70%), Gaps = 7/138 (5%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYV----SGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDS  477
            D A D+AECA+KL AL+ CL +V    SG A APT DCCSGLK VL  SRKCLC+L+KD 
Sbjct  11   DFAADRAECADKLMALSTCLTFVQDGASGGAAAPTPDCCSGLKAVLAASRKCLCVLIKDR  70

Query  478  NDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYAN---SAKGSN  648
            +DP+L +KIN T AL LP  C+ PANIS+CP LLNL PNS DA++F+ +A    + +GS 
Sbjct  71   DDPNLGLKINVTKALSLPQLCNAPANISDCPRLLNLPPNSKDAQIFEQFAKQQAAMQGSP  130

Query  649  TTSPAAPVKGSPSGGATS  702
            + SP      S  GG+++
Sbjct  131  SASPVGEQTFSHQGGSSA  148



>ref|XP_011047088.1| PREDICTED: protein YLS3 isoform X1 [Populus euphratica]
Length=176

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 100/151 (66%), Gaps = 13/151 (9%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDP  486
            SDLA DK EC E+L +L+ CL +V G+ K P   CCSGL+  + K+ KCLC++VKD N+P
Sbjct  28   SDLAADKRECNEQLASLSACLPFVGGDTKVPPPTCCSGLRQEISKTEKCLCIIVKDRNEP  87

Query  487  SLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
             L  KINATLAL LP  C+ PAN+S CPE+L+LAPNS DA+VF+D+A S K +       
Sbjct  88   DLGFKINATLALSLPSICNAPANVSACPEMLHLAPNSTDAQVFEDFAASNKSN-------  140

Query  667  PVKGSPSGGATSSDVKSDGCKRKRLVEVNVA  759
                + +G  TSS   S+  K K+ +EV++ 
Sbjct  141  ---AAVAGDRTSS---SNTMKEKKWLEVSMV  165



>ref|XP_010098644.1| putative GPI-anchored protein [Morus notabilis]
 gb|EXB75445.1| putative GPI-anchored protein [Morus notabilis]
Length=177

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A+ D AKD+ EC E+L  LA CL YV G+AKAPT DCCSGLK VL  ++KCLC++++D N
Sbjct  6    ATEDPAKDREECTEQLVGLATCLPYVGGQAKAPTPDCCSGLKQVLKDNKKCLCVVIRDRN  65

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF-QDYANSAKGSNTTS  657
            DP L ++IN TLAL LP  C+ PAN+S+CPELL + P+SP+A+VF Q   NS K  +  S
Sbjct  66   DPDLGLQINVTLALSLPSVCNAPANVSKCPELLKMDPHSPEAQVFYQLERNSTKTDSNPS  125

Query  658  PAAPVKGSPSG  690
            P+    G  SG
Sbjct  126  PSPSAGGHISG  136



>ref|XP_009776706.1| PREDICTED: protein YLS3-like [Nicotiana sylvestris]
Length=178

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 96/144 (67%), Gaps = 7/144 (5%)
 Frame = +1

Query  226  FPNTTMDPKIMAClfllqllvlfGPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQ  405
            FP+ T+   I+        L++ G ASSD A+D+ EC  +L  L+ CL YV G+A+ PT 
Sbjct  3    FPSVTISNFILM-------LLMIGFASSDFAEDRKECQNQLLHLSSCLSYVGGDAQLPTP  55

Query  406  DCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNL  585
             CC+ L+  L K++ CLCL+VKD N+P++  KINATLALGLP  C  P N+SECP +L L
Sbjct  56   ACCAQLRKDLHKTKYCLCLIVKDRNEPNIGYKINATLALGLPYVCGAPTNVSECPAILKL  115

Query  586  APNSPDAKVFQDYANSAKGSNTTS  657
            APNSPDA+VF D+ + +K  N  S
Sbjct  116  APNSPDAQVFIDFVSHSKTGNNAS  139



>gb|AFK48853.1| unknown [Medicago truncatula]
Length=186

 Score =   141 bits (356),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 108/163 (66%), Gaps = 2/163 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G   SDL +D+ +CA+KL  LA CL YV G A  PT DCC+ LK VL+ ++KC+C+L+KD
Sbjct  18   GFVGSDLTEDRKDCADKLVTLASCLPYVGGSANTPTIDCCTNLKQVLNNTKKCICILIKD  77

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
            SNDP L   +NATLA+ LP+ C  P+NISEC +LL+L+P SP+AKVF+   NS K +N++
Sbjct  78   SNDPKLGFPMNATLAVQLPNACHIPSNISECVDLLHLSPKSPEAKVFEGLGNSTK-TNSS  136

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLV-EVNVAMGLFLYV  780
            +P +         ++S +    G  R+ LV EV  A+  FL++
Sbjct  137  TPISSGSAEKGSSSSSEEKSGGGLGRRWLVAEVVCAILPFLFI  179



>gb|KDO46035.1| hypothetical protein CISIN_1g029183mg [Citrus sinensis]
Length=197

 Score =   141 bits (356),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 95/150 (63%), Gaps = 11/150 (7%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDP  486
            +D AKD+ EC  +L  L+ CL YV G+AKAPT DCCSGLK VL   +KCLC++++D NDP
Sbjct  16   ADKAKDREECTNQLVGLSTCLPYVGGDAKAPTPDCCSGLKQVLKNDKKCLCVIIRDRNDP  75

Query  487  SLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
             L + IN TLALGLP  C  PAN+S+CP LL+L PNSP+A+VF  +     G N +SP  
Sbjct  76   ELGLNINVTLALGLPSVCHAPANVSQCPALLHLDPNSPEAQVFYQF-----GRNPSSPHT  130

Query  667  PVKGSPS------GGATSSDVKSDGCKRKR  738
             +  +P+      GG   + + +D     R
Sbjct  131  VITSTPTPSPTAAGGGGKNPISADSSSNNR  160



>ref|XP_006295014.1| hypothetical protein CARUB_v10024085mg [Capsella rubella]
 gb|EOA27912.1| hypothetical protein CARUB_v10024085mg [Capsella rubella]
Length=201

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 110/187 (59%), Gaps = 15/187 (8%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D AKDK EC E+L  +A CL YV G+AK+PT DCCSGLK VL+ ++KCLC++++D N
Sbjct  24   AGDDKAKDKEECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRN  83

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L +++N +LAL LP  C   A+I++CP LL+L PNSPDA+VF       KG N T P
Sbjct  84   DPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQVFNQL---GKGLNKTGP  140

Query  661  AAPVKGS---PSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYVfilifnl*fq*f*VFLY  831
            A+   GS   PS  A S D K+ G +   +   N A G +                V  +
Sbjct  141  ASGPAGSAPEPSLTAGSDDGKNSG-RTTSVPGSNHAQGFYKQWLGFEV--------VAHF  191

Query  832  FCISYIF  852
            F + YIF
Sbjct  192  FVVFYIF  198



>gb|KEH35234.1| Lipid transfer protein [Medicago truncatula]
Length=143

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDL +D+ +CA+KL  LA CL YV G A  PT DCC+ LK VL+ ++KC+C+L+KD
Sbjct  18   GFVSSDLTEDRKDCADKLVTLASCLPYVGGSANTPTIDCCTNLKQVLNNTKKCICILIKD  77

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
            SNDP L   +NATLA+ LP+ C  P+NISEC +LL+L+P SP+AKVF+   NS K +N++
Sbjct  78   SNDPKLGFPMNATLAVQLPNACHIPSNISECVDLLHLSPKSPEAKVFEGLGNSTK-TNSS  136

Query  655  SPAA  666
            +P +
Sbjct  137  TPIS  140



>ref|NP_181959.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAC16080.1| unknown protein [Arabidopsis thaliana]
 gb|AAP12845.1| At2g44300 [Arabidopsis thaliana]
 dbj|BAE73266.1| xylogen like protein 10 [Arabidopsis thaliana]
 gb|AEC10405.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=204

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 107/186 (58%), Gaps = 16/186 (9%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D  KDK EC E+L  +A CL YV G+AK+PT DCCSGLK VL+ ++KCLC++++D NDP 
Sbjct  27   DKTKDKEECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRNDPD  86

Query  490  LDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAAP  669
            L ++IN +LAL LP  C   A++++CP LL+L PNSPDA+VF      AKG N T PA+ 
Sbjct  87   LGLQINVSLALALPSVCHAAADVTKCPALLHLDPNSPDAQVFYQL---AKGLNKTGPASA  143

Query  670  VKGSPSGGATSSDVKS--DGCKRKRLVEV---NVAMGLFLYVfilifnl*fq*f*VFLYF  834
              GS  G  + S      DG    R   V   N A   +     L          VF +F
Sbjct  144  PTGSSPGPISISPTSGSDDGNNSGRTTSVPGRNHAQSFYKQWLGLEV--------VFHFF  195

Query  835  CISYIF  852
             I YIF
Sbjct  196  VIFYIF  201



>ref|XP_006482799.1| PREDICTED: protein YLS3-like [Citrus sinensis]
Length=159

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 90/133 (68%), Gaps = 5/133 (4%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDP  486
            +D AKD+ EC  +L  L+ CL YV G+AKAPT DCCSGLK VL   +KCLC++++D NDP
Sbjct  27   ADKAKDREECTNQLVGLSTCLPYVGGDAKAPTPDCCSGLKQVLKNDKKCLCVIIRDMNDP  86

Query  487  SLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
             L + IN TL LGLP  C  PAN+S+CP LL+L PNSP+A+VF  +     G N +SP  
Sbjct  87   ELGLNINVTLTLGLPSVCHAPANVSQCPALLHLDPNSPEAQVFYQF-----GRNPSSPHT  141

Query  667  PVKGSPSGGATSS  705
             +  +P+   T++
Sbjct  142  VITSTPTPSPTAA  154



>ref|NP_001240276.1| uncharacterized protein LOC100792950 precursor [Glycine max]
 gb|ACU24068.1| unknown [Glycine max]
 gb|KHN38165.1| Putative GPI-anchored protein [Glycine soja]
Length=195

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 109/168 (65%), Gaps = 7/168 (4%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A  D +KDK EC E+L  LA CL YV G+A+APT DCCSGLK VL  ++KCLC+++KD
Sbjct  21   GIAMGDSSKDKEECTEQLAGLATCLPYVGGQAQAPTPDCCSGLKQVLKNNKKCLCVIIKD  80

Query  475  SNDPSL-DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             NDP L  ++IN TLAL LP  C++P N+S+CPELL++ P S +A+VF         + T
Sbjct  81   RNDPDLGGLQINVTLALNLPTACNSPVNVSKCPELLHMDPKSAEAQVFYQLEKGPSKNGT  140

Query  652  ---TSPAAPVKGSPSGGA-TSSDVKSDG-CKRKRLVEVNV-AMGLFLY  777
                SP+A V  SPS     ++  K+D  CK KRL  + + A+GL ++
Sbjct  141  GPAPSPSAAVGASPSSNQKANTPQKNDAFCKEKRLFGLEILAIGLQIW  188



>dbj|BAJ95766.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 91/125 (73%), Gaps = 2/125 (2%)
 Frame = +1

Query  331  ECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIKINA  510
            EC++KL ALA CL +V G+ +APT DCC GLK VL  S KCLC+LVKD +DP LD+K+N 
Sbjct  33   ECSDKLVALATCLTFVQGQGQAPTPDCCGGLKTVLQTSPKCLCVLVKDRDDPGLDLKLNV  92

Query  511  TLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYA--NSAKGSNTTSPAAPVKGSP  684
            T ALGLP  CS PANIS+CP LL+L PNS DA+VF+ +A   +A+ S + +P+AP  G+ 
Sbjct  93   TRALGLPAACSAPANISDCPRLLHLPPNSKDAQVFEQFAKQQAAQSSPSGAPSAPSTGAQ  152

Query  685  SGGAT  699
               AT
Sbjct  153  KSAAT  157



>gb|AFK38594.1| unknown [Lotus japonicus]
Length=195

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 109/171 (64%), Gaps = 13/171 (8%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A +D + DK EC E+L  LA CL Y+ GE+KAP  DCCSGLK VL +++KCLCL++KD
Sbjct  21   GIAMADSSTDKQECTEQLTGLATCLPYIQGESKAPPPDCCSGLKQVLKQNKKCLCLIIKD  80

Query  475  SNDPSL-DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
              DP L  + IN T AL LP  C+ PANIS+CPELL++ P S +A+VF       +GSN 
Sbjct  81   RKDPDLGGLMINVTSALSLPTVCNAPANISKCPELLHMDPKSKEAQVFYQL---NRGSNN  137

Query  652  TSPAAPVKGSPSGG------ATSSDVKSDG-CKRKRLVEV-NVAMGLFLYV  780
            + P +P  G+  GG       T++  K+D  CK KRL    N+A GL +++
Sbjct  138  SGP-SPAPGTSVGGNAVRSQTTTATQKNDAMCKEKRLFGFDNLAAGLLVWL  187



>gb|EEC74584.1| hypothetical protein OsI_10163 [Oryza sativa Indica Group]
Length=177

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 7/126 (6%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D++ D+ ECA++L  LAPCL YV GEAKAP  DCC GL+ VL KS KCLC+LVKD +
Sbjct  7    ARGDMSADRTECADQLVGLAPCLQYVQGEAKAPAPDCCGGLRQVLGKSPKCLCVLVKDKD  66

Query  481  DPSLDIKINATLALGLPDRC-STPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTS  657
            DP+L IKINATLAL LP  C +T AN+S CP+LL++ PNS DA +F      + G +  S
Sbjct  67   DPNLGIKINATLALALPSACGATHANVSHCPQLLHIPPNSKDAAIF------SPGGDKGS  120

Query  658  PAAPVK  675
            PAAP K
Sbjct  121  PAAPAK  126



>ref|XP_006397606.1| hypothetical protein EUTSA_v10001634mg [Eutrema salsugineum]
 gb|ESQ39059.1| hypothetical protein EUTSA_v10001634mg [Eutrema salsugineum]
Length=208

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 93/135 (69%), Gaps = 6/135 (4%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A+ D AKDKAEC E+L  LA CL YV  +AK+PT DCCSGLK V++  +KCLC++++D N
Sbjct  23   AAEDKAKDKAECTEQLVGLATCLPYVQEQAKSPTPDCCSGLKQVINSDKKCLCVIIQDRN  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L +KIN +LAL LP  C   A++++CP LL+L PNSPDA+ F   AN   GSN T P
Sbjct  83   DPDLGLKINVSLALALPSVCHVTADVTKCPALLHLDPNSPDAQFFYQLAN---GSNKTGP  139

Query  661  AAPVKG---SPSGGA  696
            A+   G    P+G A
Sbjct  140  ASAPTGLAPEPTGSA  154



>ref|XP_011047089.1| PREDICTED: protein YLS3 isoform X2 [Populus euphratica]
Length=156

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDP  486
            SDLA DK EC E+L +L+ CL +V G+ K P   CCSGL+  + K+ KCLC++VKD N+P
Sbjct  28   SDLAADKRECNEQLASLSACLPFVGGDTKVPPPTCCSGLRQEISKTEKCLCIIVKDRNEP  87

Query  487  SLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGS  645
             L  KINATLAL LP  C+ PAN+S CPE+L+LAPNS DA+VF+D+A S K +
Sbjct  88   DLGFKINATLALSLPSICNAPANVSACPEMLHLAPNSTDAQVFEDFAASNKSN  140



>gb|AFK48341.1| unknown [Lotus japonicus]
Length=149

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDLA D  +C +KL  LA C  YV G+AK P+ DCCSGLK VL++S+KCLC+L+KD
Sbjct  17   GFGSSDLAADIQDCGDKLVGLAGCRPYVGGDAKVPSIDCCSGLKVVLEQSKKCLCILIKD  76

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +DP L  K+NATLA+ LP  C  PANI++C +LL+L+P SP+AKVF+ +  S+K +N++
Sbjct  77   RDDPDLGFKMNATLAVHLPSACHAPANITQCVDLLHLSPKSPEAKVFEGFQGSSK-TNSS  135

Query  655  SPAAPVKGSPSGGATSSDVK  714
            +P +       GG  S  +K
Sbjct  136  TPVS------KGGVDSGIIK  149



>gb|AII99869.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=182

 Score =   139 bits (349),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 8/165 (5%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDL KD+ ECA+KL  LA CL YV G+A  P  DCC+ LK VLDK++KC+C+L+KD
Sbjct  21   GFVNSDLTKDREECADKLVTLASCLPYVGGDANTPAIDCCTALKLVLDKTKKCICILIKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             NDP L   +NATLA+ LP+ C  P+NIS+   LL+L+P S +AKVF+   NS + +N++
Sbjct  81   RNDPKLGFTLNATLAVQLPNACHIPSNISQ--YLLHLSPKSAEAKVFEGLGNSTQ-TNSS  137

Query  655  SPAAPVKGSPSGGATSSDVKSDGC---KRKRLVEVNVAMGLFLYV  780
            +P +   G    G +SS  +  GC   KR  + E+  A+  F+++
Sbjct  138  TPVS--NGGAEKGPSSSSEEKSGCDLGKRWLVAELVFAILPFVFI  180



>ref|XP_010518028.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=201

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 107/188 (57%), Gaps = 17/188 (9%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D AKDK EC E+L  +A CL YV G+AK+PT DCCSGLK VL+ ++KCLC++++D N
Sbjct  24   AGDDKAKDKDECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRN  83

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L +++N +LAL LP  C   A+I++CP LL+L PNSPDA+VF   AN      T S 
Sbjct  84   DPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQVFYQLAN-----KTVSA  138

Query  661  AAPVKGSPSGGATSSDVKSDGCKRK-RLVEV---NVAMGLFLYVfilifnl*fq*f*VFL  828
            +AP   SP   + S    SD  K   R   V   N A   +     L          V  
Sbjct  139  SAPTGSSPGPTSMSPTAGSDAGKNSGRTASVPGSNHAQSFYKQWLGLEV--------VAH  190

Query  829  YFCISYIF  852
            +F  SYIF
Sbjct  191  FFVFSYIF  198



>gb|ACU15623.1| unknown [Glycine max]
Length=193

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A  D +KDK EC E+L  LA CL YV G+A+APT DCCSGLK VL  ++KCLC+++KD
Sbjct  21   GIAMGDSSKDKEECTEQLAGLATCLPYVGGQAQAPTPDCCSGLKQVLKNNKKCLCVIIKD  80

Query  475  SNDPSL-DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF-QDYANSAKGSN  648
             NDP L  ++IN TLAL LP  C++P N+S+CPELL++ P S +A+VF Q     +K   
Sbjct  81   RNDPDLGGLQINVTLALNLPTACNSPVNVSKCPELLHMDPKSAEAQVFYQLEKGPSKNGT  140

Query  649  TTSPAAPVKGSPSGGA-TSSDVKSDG-CKRKRLVEVNV-AMGLFLY  777
              +P+  V  SPS     ++  K+D  CK KRL  + + A+GL ++
Sbjct  141  GPAPSPSVGASPSSNQKANTPQKNDAFCKEKRLFGLEILAIGLQIW  186



>ref|XP_010506351.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=201

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 93/140 (66%), Gaps = 5/140 (4%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D AKDK EC E+L  +A CL YV G+AK+PT DCCSGLK VL+ ++KCLC++++D N
Sbjct  24   AGDDKAKDKDECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRN  83

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L +++N +LAL LP  C   A+I++CP LL+L PNSPDA+VF   AN      T S 
Sbjct  84   DPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQVFYQLAN-----KTVSA  138

Query  661  AAPVKGSPSGGATSSDVKSD  720
            +AP   SP   + S    SD
Sbjct  139  SAPTGSSPGPTSMSPTAGSD  158



>gb|ABF94168.1| Protease inhibitor/seed storage/LTP family protein, expressed 
[Oryza sativa Japonica Group]
Length=187

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D++ D+ ECA++L  LAPCL YV GEAKAP  DCC GL+ VL KS KCLC+LVKD +DP+
Sbjct  20   DMSADRTECADQLVGLAPCLQYVQGEAKAPAPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  79

Query  490  LDIKINATLALGLPDRC-STPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
            L IKINATLAL LP  C +T AN+S CP+LL++ PNS DA +F      + G +  SPAA
Sbjct  80   LGIKINATLALALPSACGATHANVSHCPQLLHIPPNSKDAAIF------SPGGDKGSPAA  133

Query  667  PVK  675
            P K
Sbjct  134  PAK  136



>ref|XP_010508309.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=204

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%), Gaps = 4/129 (3%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D AKDK EC E+L  +A CL YV G+AK+PT DCCSGLK VL+ ++KCLC++++D N
Sbjct  24   AGDDKAKDKDECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRN  83

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN-TTS  657
            DP L +++N +LAL LP  C   A+I++CP LL+L PNSPDA+VF      AKGSN T S
Sbjct  84   DPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQVFYQL---AKGSNKTVS  140

Query  658  PAAPVKGSP  684
             +AP   +P
Sbjct  141  ASAPTGSAP  149



>gb|EEE58386.1| hypothetical protein OsJ_09548 [Oryza sativa Japonica Group]
Length=177

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 7/126 (6%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D++ D+ ECA++L  LAPCL YV GEAKAP  DCC GL+ VL KS KCLC+LVKD +
Sbjct  7    ARGDMSADRTECADQLVGLAPCLQYVQGEAKAPAPDCCGGLRQVLGKSPKCLCVLVKDKD  66

Query  481  DPSLDIKINATLALGLPDRC-STPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTS  657
            DP+L IKINATLAL LP  C +T AN+S CP+LL++ PNS DA +F      + G +  S
Sbjct  67   DPNLGIKINATLALALPCACGATHANVSHCPQLLHIPPNSKDAAIF------SPGGDKGS  120

Query  658  PAAPVK  675
            PAAP K
Sbjct  121  PAAPAK  126



>ref|XP_009397688.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=199

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 1/122 (1%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            SSD A+DKA C + L +LA CL YV G+AKAPT DCC GL  +L K+R CLC+L+KD N+
Sbjct  25   SSDFAQDKANCQDTLVSLATCLTYVEGQAKAPTPDCCDGLSKILSKNRTCLCVLIKDRNE  84

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA  663
            P L I  NATLA+ LP  C   +NISECPELL+L P+S +A++F+ +  + +G N +S  
Sbjct  85   PGLGITFNATLAMNLPTVCHASSNISECPELLHLPPHSKEAQIFEQFGKANQG-NASSGH  143

Query  664  AP  669
            AP
Sbjct  144  AP  145



>ref|XP_009394719.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=192

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = +1

Query  298  PASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDS  477
            PASSD A D  EC  +L  L  C+ YV G A+APT DCC+GLK V+ KS KCLC+LVKD 
Sbjct  28   PASSDTASDLQECGSQLIGLQTCIPYVEGTAQAPTPDCCTGLKDVVAKSPKCLCILVKDH  87

Query  478  NDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTS  657
            +DP L IKIN T AL LP  C+TP NIS CP+LLNL PNS +A++F+   ++A+ + T +
Sbjct  88   DDPQLPIKINLTRALALPKACNTPVNISACPKLLNLPPNSKEAEIFKQAGSAAQANATAT  147

Query  658  PAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLY  777
             + P   +  GG++S+  +  G      V +   +G  LY
Sbjct  148  TSPPSTPASDGGSSSNHSRWRG-----WVAMETVVGCVLY  182



>ref|XP_011088858.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=202

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A+SD +KD+ ECAE L  LA CL YV G AKAPT DCC+ LK +L+  +KCLC+++KD N
Sbjct  25   ATSDTSKDREECAESLVGLATCLPYVGGTAKAPTPDCCTALKQLLNTKKKCLCVIIKDRN  84

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L + IN TLALGLP  C+ PAN+S+CP LL L P+SP+A++F  +   +  S+++SP
Sbjct  85   DPDLGLNINVTLALGLPQVCNAPANVSQCPALLKLPPDSPEAQIFYQFGQKSSNSSSSSP  144

Query  661  AA  666
             A
Sbjct  145  VA  146



>ref|XP_003564265.1| PREDICTED: protein YLS3-like [Brachypodium distachyon]
Length=202

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYV--SGEAKAPTQDCCSGLKGVLDKSRKCLCLLV  468
            GPA +D A D+AECA++L  LA CL +V  +  A+APT DCCSG K VL  S+KCLC+LV
Sbjct  30   GPAGADFAADRAECADRLMGLATCLTFVEATATARAPTPDCCSGFKTVLGASKKCLCVLV  89

Query  469  KDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            KD ++P+L +KIN T A+ LP  CS PA  S+CP++LN++P+S +A++F+ YA   +G N
Sbjct  90   KDRDEPALGLKINVTRAMNLPSACSIPATFSDCPKILNMSPDSKEAEIFKQYAKEHEGKN  149



>ref|XP_006439006.1| hypothetical protein CICLE_v10033694mg [Citrus clementina]
 gb|ESR52246.1| hypothetical protein CICLE_v10033694mg [Citrus clementina]
Length=205

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 93/150 (62%), Gaps = 11/150 (7%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDP  486
            +D AKDK EC  +L  L+ CL YV G+AKAPT DCCSGLK VL   +KCLC++++D NDP
Sbjct  27   ADKAKDKEECTNQLVGLSTCLPYVGGDAKAPTPDCCSGLKQVLKNDKKCLCVIIRDMNDP  86

Query  487  SLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
             L + IN TL LGLP  C   AN+S+CP LL+L PNSP+A+VF  +     G N +SP  
Sbjct  87   ELGLNINVTLTLGLPSVCHATANVSQCPALLHLDPNSPEAQVFYQF-----GRNPSSPHT  141

Query  667  PVKGSP------SGGATSSDVKSDGCKRKR  738
             +  +P      +GG   + + +D     R
Sbjct  142  AITSTPAPSPTAAGGGGKNPISADSSSNNR  171



>ref|XP_004294978.1| PREDICTED: uncharacterized protein LOC101298982 [Fragaria vesca 
subsp. vesca]
Length=198

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGE--AKAPTQDCCSGLKGVLDKSRKCLCLLV  468
            G  SSD+ +D+A+CA++L  LAPCL YV G+  AK PT DCC+GLK V  KS KCLC+L+
Sbjct  24   GFGSSDIDQDRAQCADQLIGLAPCLSYVGGDKDAKTPTIDCCTGLKQVDAKSHKCLCVLI  83

Query  469  KDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            KD +DP L + INATLAL LP  C  P NI+ C +LL+L P S D K+F  YA   K  N
Sbjct  84   KDHDDPKLGLTINATLALNLPGACHVPVNITSCVDLLHLDPKSADGKMFLGYAEKTKAVN  143

Query  649  TTSPAAPVKGSPS  687
            +TS +    G+ +
Sbjct  144  STSASITSSGNST  156



>ref|XP_006392665.1| hypothetical protein EUTSA_v10011802mg [Eutrema salsugineum]
 gb|ESQ29951.1| hypothetical protein EUTSA_v10011802mg [Eutrema salsugineum]
Length=191

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 99/149 (66%), Gaps = 2/149 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G   SDLA+D+ EC  +L AL+PCL YV G+AKAPT+DCC G   V+ KS KC+C+L+KD
Sbjct  22   GFGGSDLAQDRDECTNQLIALSPCLPYVGGDAKAPTKDCCGGFGQVIVKSVKCVCILIKD  81

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP+L +K NATLA  LP  C   A NI++C  LL+L+PNS  A+ F+        +N+
Sbjct  82   KDDPNLGLKFNATLAAYLPTACHITAPNITKCISLLHLSPNSTLAREFESLGRIEGNANS  141

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCKRKR  738
            TSP+  VK   +GG  +  VKS G K+K+
Sbjct  142  TSPSQHVKDG-TGGGKAESVKSTGEKKKK  169



>emb|CDY64362.1| BnaAnng19290D [Brassica napus]
Length=202

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 104/176 (59%), Gaps = 21/176 (12%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D AKDK EC E+L  +A CL YV G+AK PT DCCSGLK VL   +KCLC++++D N
Sbjct  23   AGEDKAKDKEECTEQLVGMATCLPYVQGQAKTPTPDCCSGLKQVLKSDKKCLCVIIQDRN  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L ++IN +LAL LP  C   A++++CP LL++ P S +A+VF   AN   G N T P
Sbjct  83   DPDLGLQINVSLALALPSVCHAVADVTKCPALLHMDPKSQEAQVFYQLAN---GLNKTGP  139

Query  661  A-APVKGSP----------------SGGATSSDVKSDG-CKRKRLVEVNVAMGLFL  774
            A AP+  +P                SG ATS   K+     RKR + + VA  LF+
Sbjct  140  ASAPIISAPAPTSVSPTAGSEDGNNSGRATSLPSKNHAQSFRKRWLVLEVAAYLFI  195



>gb|KFK37241.1| hypothetical protein AALP_AA4G232200 [Arabis alpina]
Length=205

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 93/141 (66%), Gaps = 3/141 (2%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D AKDK EC E+L  +A CL YV G+AK+PT DCCSGLK VL+  +KCLC++++D N
Sbjct  25   AGEDKAKDKEECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNTDKKCLCVIIQDRN  84

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L ++IN +LAL LP  C   A++++CP LL+L P SP+A+VF   AN   GSN T  
Sbjct  85   DPDLGLQINVSLALALPTVCHATADVTKCPALLHLDPKSPEAQVFYQLAN---GSNKTGL  141

Query  661  AAPVKGSPSGGATSSDVKSDG  723
            A+   GS +G  + S     G
Sbjct  142  ASAPTGSATGPTSMSPTAGSG  162



>ref|XP_004158216.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized GPI-anchored 
protein At1g27950-like [Cucumis sativus]
Length=186

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 94/150 (63%), Gaps = 9/150 (6%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D  KD+ EC  +L  +A CL YVSG+AKAPT DCCSGLK VL   +KCLC++V+D NDP 
Sbjct  21   DDKKDREECTPQLAGMATCLPYVSGDAKAPTPDCCSGLKEVLKNDKKCLCVIVRDRNDPD  80

Query  490  LDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA--  663
            L ++IN TLAL LPD C   AN+S CP LLN+  NS DA+VF  Y    K S+  +PA  
Sbjct  81   LGLQINVTLALSLPDICHATANVSNCPALLNMPSNSSDAQVF--YQLEGKSSSALAPAPM  138

Query  664  -----APVKGSPSGGATSSDVKSDGCKRKR  738
                 +P   S  GG + S  + +G KR +
Sbjct  139  LSPSSSPTINSTVGGGSKSGAEGEGYKRGK  168



>ref|NP_001059125.1| Os07g0198300 [Oryza sativa Japonica Group]
 dbj|BAC84186.1| lipid transfer protein-like [Oryza sativa Japonica Group]
 dbj|BAF21039.1| Os07g0198300 [Oryza sativa Japonica Group]
 dbj|BAG87637.1| unnamed protein product [Oryza sativa Japonica Group]
Length=207

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 83/110 (75%), Gaps = 4/110 (4%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYV----SGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDS  477
            D A D+AECA+KL AL+ CL +V    SG A APT DCCSGLK VL  SRKCLC+L+KD 
Sbjct  29   DFAADRAECADKLMALSTCLTFVQDGASGGAAAPTPDCCSGLKAVLAASRKCLCVLIKDR  88

Query  478  NDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYA  627
            +DP+L +KIN T AL LP  C+ PANIS+CP LLNL PNS DA++F+ +A
Sbjct  89   DDPNLGLKINVTKALSLPQLCNAPANISDCPRLLNLPPNSKDAQIFEQFA  138



>dbj|BAG92716.1| unnamed protein product [Oryza sativa Japonica Group]
Length=208

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 83/110 (75%), Gaps = 4/110 (4%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYV----SGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDS  477
            D A D+AECA+KL AL+ CL +V    SG A APT DCCSGLK VL  SRKCLC+L+KD 
Sbjct  29   DFAADRAECADKLMALSTCLTFVQDGASGGAAAPTPDCCSGLKAVLAASRKCLCVLIKDR  88

Query  478  NDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYA  627
            +DP+L +KIN T AL LP  C+ PANIS+CP LLNL PNS DA++F+ +A
Sbjct  89   DDPNLGLKINVTKALSLPQLCNAPANISDCPRLLNLPPNSKDAQIFEQFA  138



>gb|KEH19312.1| Lipid transfer protein [Medicago truncatula]
Length=195

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 12/169 (7%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G   SD +K+K EC  +L  LA CL YV GE K P  DCC GLK +L  ++KCLC+++KD
Sbjct  21   GIGMSDSSKEKQECTAQLTGLASCLPYVEGEGKTPAPDCCDGLKTLLKTNKKCLCVIIKD  80

Query  475  SNDPSL-DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             NDP L  I IN TLAL LP  C+ PANIS+CPELL++ PNS +A+VF    N +  SN 
Sbjct  81   RNDPDLGGIVINVTLALNLPTVCNAPANISKCPELLHMDPNSAEAQVFYTLNNGS--SNI  138

Query  652  TSPAAPVKGSPSGGAT----SSDVKSDGCKR-KRLVEVN-VAMGLFLYV  780
            +  AAP   SPS GA+    S+  K+D  ++ KRL+ +  +A+G+ ++ 
Sbjct  139  SPSAAP---SPSDGASSQARSTTQKNDAFRKEKRLIGLEFLAIGVLVWF  184



>ref|XP_008803424.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=187

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  325  KAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIKI  504
            + EC+++L  LA CL YV G AKAPT DCC+GL+ VL KS KCLC+L+KDS+DP L IK 
Sbjct  31   QKECSDQLVGLATCLSYVQGNAKAPTPDCCTGLEQVLVKSPKCLCILIKDSDDPQLSIKF  90

Query  505  NATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK  639
            N TLAL LP  CS PANISECP+LLNL PNS DA +F+  AN+ +
Sbjct  91   NVTLALRLPSLCSAPANISECPKLLNLPPNSKDAAIFKQAANATQ  135



>ref|XP_007133468.1| hypothetical protein PHAVU_011G181000g [Phaseolus vulgaris]
 gb|ESW05462.1| hypothetical protein PHAVU_011G181000g [Phaseolus vulgaris]
Length=196

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 109/172 (63%), Gaps = 15/172 (9%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A  D +K+K EC ++L  LA CL YV G+A APT DCCSGLK +L  ++KCLC+++KD
Sbjct  22   GIAMGDSSKEKEECTQQLVGLATCLPYVGGQAHAPTPDCCSGLKELLKNNKKCLCVIIKD  81

Query  475  SNDPSLD-IKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGS--  645
             NDP L  ++IN TLAL LP  C++P N+S+CPELL++ P S +A+VF       KGS  
Sbjct  82   RNDPDLSGLQINVTLALNLPTACNSPVNVSKCPELLHMDPKSQEAQVFYQL---EKGSSK  138

Query  646  NTTSPAAPVKGSPSGGATSSD------VKSDG-CKRKRLVEVNVAM-GLFLY  777
            N TSP AP   +  G  TSS+       K+D  CK  R   +NV + GL ++
Sbjct  139  NGTSP-APSSSAAVGANTSSNQTTSTPQKNDAFCKENRFFRLNVLLIGLQVW  189



>ref|XP_009106891.1| PREDICTED: protein YLS3-like [Brassica rapa]
Length=197

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 105/165 (64%), Gaps = 4/165 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDL +D+ EC ++L AL+PCL YV G AKAPT+DCC G   V+ KS KC+C+LVKD
Sbjct  21   GFGSSDLDQDREECTDQLIALSPCLPYVGGNAKAPTKDCCGGFDQVITKSEKCVCILVKD  80

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYAN-SAKG-S  645
             +DP+L +K NATLA  +P  C   A NI++C  LL+L+PNS  AK F+       +G +
Sbjct  81   KDDPNLGLKFNATLAAHIPTLCHITAPNITKCISLLHLSPNSTLAKEFESLGRIEYEGKT  140

Query  646  NTTSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
            N+TSP+  VK   +GG  +  VKS G K+  L    +   LF ++
Sbjct  141  NSTSPSHNVKDG-TGGGKAEQVKSTGEKKSWLAVELLIFALFSHL  184



>emb|CDY02452.1| BnaA08g00590D [Brassica napus]
Length=196

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 105/165 (64%), Gaps = 4/165 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDL +D+ EC ++L AL+PCL YV G AKAPT+DCC G   V+ KS KC+C+LVKD
Sbjct  20   GFGSSDLDQDREECTDQLIALSPCLPYVGGNAKAPTKDCCGGFDQVITKSEKCVCILVKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYAN-SAKG-S  645
             +DP+L +K NATLA  +P  C   A NI++C  LL+L+PNS  AK F+       +G +
Sbjct  80   KDDPNLGLKFNATLAAHIPTLCHITAPNITKCISLLHLSPNSTLAKEFESLGRIEYEGKT  139

Query  646  NTTSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
            N+TSP+  VK   +GG  +  VKS G K+  L    +   LF ++
Sbjct  140  NSTSPSHNVKDG-TGGGKAEQVKSTGEKKSWLAVELLIFALFSHL  183



>ref|XP_009592816.1| PREDICTED: protein YLS3-like isoform X1 [Nicotiana tomentosiformis]
Length=197

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 98/165 (59%), Gaps = 8/165 (5%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            +SD  KDK EC + L  LA CL YV+  A APT DCC+GLK VL  S+KCLCLL+KD ND
Sbjct  23   NSDTEKDKEECTQSLIGLATCLPYVTANAPAPTPDCCTGLKQVLKASKKCLCLLIKDRND  82

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGS----NT  651
            P L + +N TLAL LP  C  PANIS+CP LL+L PNSPDA+VF   +N +         
Sbjct  83   PDLGLNLNVTLALSLPSVCQAPANISQCPALLHLPPNSPDAQVFYQISNGSSSIASSPQA  142

Query  652  TSPAAPVKGSPSGGATSSDV---KSDGCKR-KRLVEVNVAMGLFL  774
             SP   V   P+G    +      +DGC   KR   ++  +G+ L
Sbjct  143  NSPIPSVGSIPTGAPAGAASAPKSNDGCHIGKRWFALDAILGVVL  187



>ref|XP_004135899.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cucumis sativus]
 gb|KGN45178.1| Non-specific lipid-transfer protein [Cucumis sativus]
Length=197

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 97/157 (62%), Gaps = 9/157 (6%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D  KD+ EC  +L  +A CL YVSG+AKAPT DCCSGLK VL   +KCLC++V+D NDP 
Sbjct  31   DDKKDREECTPQLAGMATCLPYVSGDAKAPTPDCCSGLKEVLQNDKKCLCVIVRDRNDPD  90

Query  490  LDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA--  663
            L ++IN TLAL LPD C   AN+S CP LLN+  NS DA+VF       K S+  +PA  
Sbjct  91   LGLQINVTLALSLPDICHATANVSNCPALLNMPSNSSDAQVFYQLGK-GKSSSALAPAPM  149

Query  664  -----APVKGSPSGGATSSDVKSDGCKR-KRLVEVNV  756
                 +P   S  GG + S  + +G KR K+ V + +
Sbjct  150  LSPSSSPTINSTVGGGSKSGAEGEGYKRGKKRVALEI  186



>ref|XP_004511135.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cicer arietinum]
Length=196

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 104/161 (65%), Gaps = 9/161 (6%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDP  486
            +D +KDK EC  ++  LA CL YV GE K P  DCC GLK +L+ ++KCLCL++KD NDP
Sbjct  25   ADSSKDKDECTSQITGLASCLPYVEGEGKTPAPDCCDGLKTLLNTNKKCLCLIIKDRNDP  84

Query  487  SL-DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA  663
             L  I+IN TLALGLP  C+ PANIS+CPELL++ P S +A+VF   +N   G     PA
Sbjct  85   DLGGIQINVTLALGLPTVCNAPANISKCPELLHMDPKSAEAQVFYGSSNVGPG-----PA  139

Query  664  -APVKGSPSGGATSSDVKSDGC-KRKRLVEVNV-AMGLFLY  777
             +P  G+   G  S+  KSD   K+K L  ++V  +GL L+
Sbjct  140  PSPSDGASPEGTRSTTQKSDAFSKKKGLFGLDVLGIGLLLW  180



>ref|XP_008775497.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=195

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            ASSD A D+AECA +L  LA CL YV   A  PT DCCSGLK VL  +RKCLC+L+KD +
Sbjct  28   ASSDFASDRAECANQLTGLATCLTYVENRALTPTPDCCSGLKQVLATNRKCLCVLIKDRD  87

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            +P L IK+N T A+ LP  C   +NISECP+LLNL P S +A++F+ Y  S   ++T + 
Sbjct  88   EPGLGIKLNVTTAMALPSVCRASSNISECPKLLNLPPGSAEAQIFEQYGRSPPAADTKAN  147

Query  661  AAPVKGSPSGGATS  702
            A     + +G A++
Sbjct  148  AGASTSNEAGSASA  161



>ref|XP_009592817.1| PREDICTED: protein YLS3-like isoform X2 [Nicotiana tomentosiformis]
Length=170

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            +SD  KDK EC + L  LA CL YV+  A APT DCC+GLK VL  S+KCLCLL+KD ND
Sbjct  23   NSDTEKDKEECTQSLIGLATCLPYVTANAPAPTPDCCTGLKQVLKASKKCLCLLIKDRND  82

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF  615
            P L + +N TLAL LP  C  PANIS+CP LL+L PNSPDA+VF
Sbjct  83   PDLGLNLNVTLALSLPSVCQAPANISQCPALLHLPPNSPDAQVF  126



>gb|ABB90545.1| lipid transfer protein [Triticum aestivum]
Length=185

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 91/135 (67%), Gaps = 2/135 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYV--SGEAKAPTQDCCSGLKGVLDKSRKCLCLLV  468
            G A +D A D+AECA+KL  LA CL YV  +  A++PT DCCSG + VL  S+KCLC+LV
Sbjct  19   GLAGADFAADRAECADKLMGLATCLTYVQLAATARSPTPDCCSGFRQVLGVSKKCLCVLV  78

Query  469  KDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            KD ++P+L IK N T A+ LP  C+ PA  S+CP++LN++P+S +A++F+ Y    +G N
Sbjct  79   KDRDEPTLGIKFNVTRAMNLPSACNIPATFSDCPKILNMSPDSKEAEIFKQYGIEHEGKN  138

Query  649  TTSPAAPVKGSPSGG  693
             T+  +      SGG
Sbjct  139  ATAGGSAAVTGTSGG  153



>emb|CDY69589.1| BnaC04g53090D [Brassica napus]
Length=197

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 99/168 (59%), Gaps = 10/168 (6%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D AKDK EC E+L  +A CL YV G+AK PT DCCSGLK VL   +K LC++++D N
Sbjct  23   AGEDKAKDKEECTEQLVGMATCLPYVQGQAKTPTPDCCSGLKQVLKSDKKFLCVIIQDRN  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L ++IN +LAL LP  C   A++++CP LL++ P S +A+VF   AN    S   S 
Sbjct  83   DPDLGLQINVSLALALPSVCHAVADVTKCPALLHMDPKSQEAQVFYQLANGLNKSGPGSA  142

Query  661  AAPVKGSP---------SGGATSSDVKSDG-CKRKRLVEVNVAMGLFL  774
             AP   SP         SG ATS   K+     RKR + + VA  LF+
Sbjct  143  PAPTSISPTAGSEDGNNSGRATSLPSKNHAQSFRKRWLVLEVAAYLFI  190



>ref|XP_006658373.1| PREDICTED: protein YLS3-like [Oryza brachyantha]
Length=203

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 86/115 (75%), Gaps = 3/115 (3%)
 Frame = +1

Query  325  KAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIKI  504
            +AEC++KL ALA CL +V  EA APT DCC+GL+ VL  SRKCLC+L+KD +DP+L++KI
Sbjct  27   RAECSDKLVALATCLTFVQDEAAAPTPDCCAGLRTVLQASRKCLCVLIKDRDDPNLNLKI  86

Query  505  NATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYAN---SAKGSNTTSP  660
            N T AL LP  C+ PANIS+CP LLNL PNS +A+VF  +A    + +GS + SP
Sbjct  87   NVTKALSLPSLCNAPANISDCPRLLNLPPNSTEAQVFLQFAKQQAAMQGSPSASP  141



>ref|XP_002459511.1| hypothetical protein SORBIDRAFT_02g005900 [Sorghum bicolor]
 gb|EER96032.1| hypothetical protein SORBIDRAFT_02g005900 [Sorghum bicolor]
Length=210

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 91/138 (66%), Gaps = 6/138 (4%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVS--GEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            D A D+AEC++KL  LA CL YV     A APT DCC+GL+ VL  SRKCLC+LVKD +D
Sbjct  30   DFAADRAECSDKLVGLATCLTYVQEDATAAAPTPDCCAGLETVLQSSRKCLCVLVKDRDD  89

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA  663
            P+L +KIN T AL LP  C+ PANIS+CP LLNL P S DA+VF+ +A  A    T    
Sbjct  90   PNLGLKINVTKALRLPAVCNAPANISDCPRLLNLPPGSKDAQVFEQFARQAAAQGT----  145

Query  664  APVKGSPSGGATSSDVKS  717
            AP  G  +  A++S  KS
Sbjct  146  APSGGGSAAKASASPQKS  163



>gb|AAG51569.1|AC027034_15 unknown protein; 63629-62263 [Arabidopsis thaliana]
 gb|AAL06529.1|AF412076_1 At1g55260/F7A10_16 [Arabidopsis thaliana]
 gb|AAL90923.1| At1g55260/F7A10_16 [Arabidopsis thaliana]
 dbj|BAE73268.1| xylogen like protein 12 [Arabidopsis thaliana]
Length=184

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDLA+D+ EC  +L  L+ C+ YV G+AKAPT+DCC+G   V+ KS KC+C+LV+D
Sbjct  20   GFGNSDLAQDREECTNQLIELSTCIPYVGGDAKAPTKDCCAGFGQVIRKSEKCVCILVRD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L IKINATLA  LP  C   A NI++C  +L+L  NS  AK F++        N+
Sbjct  80   KDDPQLGIKINATLAAHLPSACHITAPNITDCISILHLPRNSTLAKEFENLGRIEDNYNS  139

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFL  774
            TSP   +    +GG  +  VKS+G K K  + V + + L +
Sbjct  140  TSPTQ-IHKDGTGGGKAEPVKSNGWKEKSWLGVELLIYLLV  179



>gb|AAM61728.1| unknown [Arabidopsis thaliana]
Length=168

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDLA+D+ EC  +L  L+ C+ YV G+AKAPT+DCC+G   V+ KS KC+C+LV+D
Sbjct  4    GFGNSDLAQDREECTNQLIELSTCIPYVGGDAKAPTKDCCAGFGQVIRKSEKCVCILVRD  63

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L IKINATLA  LP  C   A NI++C  +L+L  NS  AK F++        N+
Sbjct  64   KDDPQLGIKINATLAAHLPSACHITAPNITDCISILHLPRNSTLAKEFENLGRIEDNYNS  123

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFL  774
            TSP   +    +GG  +  VKS+G K K  + V + + L +
Sbjct  124  TSPTQ-IHKDGTGGGKAEPVKSNGWKEKSWLGVELLIYLLV  163



>ref|NP_564682.2| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE33214.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=227

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDLA+D+ EC  +L  L+ C+ YV G+AKAPT+DCC+G   V+ KS KC+C+LV+D
Sbjct  63   GFGNSDLAQDREECTNQLIELSTCIPYVGGDAKAPTKDCCAGFGQVIRKSEKCVCILVRD  122

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L IKINATLA  LP  C   A NI++C  +L+L  NS  AK F++        N+
Sbjct  123  KDDPQLGIKINATLAAHLPSACHITAPNITDCISILHLPRNSTLAKEFENLGRIEDNYNS  182

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFL  774
            TSP   +    +GG  +  VKS+G K K  + V + + L +
Sbjct  183  TSPTQ-IHKDGTGGGKAEPVKSNGWKEKSWLGVELLIYLLV  222



>ref|XP_010480053.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=183

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 4/157 (3%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDLA+D+ EC  +L AL+ CL YV G+AKAPT+DCC+G   V+ KS+KC+C+LVKD
Sbjct  20   GFGSSDLAQDRDECTNQLIALSTCLPYVGGDAKAPTKDCCAGFGQVITKSQKCVCILVKD  79

Query  475  SNDPSLDIKINATLALGLPDRCS-TPANISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L +K NA+LA  LP  C  T  NI+EC  +L+L  NS  AK F+      +  NT
Sbjct  80   KDDPQLGLKFNASLAAHLPAACHITAFNITECISVLHLPRNSTLAKEFESLGRIEENYNT  139

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAM  762
            TSP+       +GG  +   KS+G K+K  + V + +
Sbjct  140  TSPSHK---DGTGGGKAESAKSNGWKKKSWLGVELLI  173



>gb|KHG28399.1| hypothetical protein F383_02239 [Gossypium arboreum]
Length=181

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 98/159 (62%), Gaps = 3/159 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G ASSD+ +DKAEC   L  LAPCL +V GEAK PT DCC GLK VL KS+KCLC++++D
Sbjct  17   GLASSDVNQDKAECKNHLMGLAPCLSFVDGEAKTPTVDCCGGLKQVLGKSKKCLCVVIRD  76

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             +D S  +KINATLA  LP  C    N+++C  LL+LAPNS +AK+F+ Y    +     
Sbjct  77   KDDSSAGLKINATLAAALPYACRAKVNMTDCISLLHLAPNSQEAKLFEGYQKLTERHPIM  136

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLF  771
            +   P   S +G +T +  +  G  +   + +  ++ +F
Sbjct  137  ATTTP---STTGKSTGNGTEKSGGGKGNEMALGASLWVF  172



>ref|XP_009143014.1| PREDICTED: protein YLS3-like [Brassica rapa]
Length=202

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 102/176 (58%), Gaps = 21/176 (12%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D AKDK EC E+L  +A CL YV G+AK PT DCCSGLK VL   +KCLC++++D N
Sbjct  23   AGEDKAKDKEECTEQLVGMATCLPYVQGQAKTPTPDCCSGLKQVLKSDKKCLCVIIQDRN  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L ++IN +LAL LP  C   A++++CP LL++ P S +A+VF   AN   G N T P
Sbjct  83   DPDLGLQINVSLALALPSVCHAVADVTKCPALLHMDPKSQEAQVFYQLAN---GLNKTGP  139

Query  661  A--------APVKGSP---------SGGATSSDVKSDG-CKRKRLVEVNVAMGLFL  774
            A        AP   SP         SG ATS   K+     RK  + + VA  LF+
Sbjct  140  ASASTISAPAPTSVSPTAGSEDGNNSGRATSLPSKNHAQSFRKPWLVLEVAAHLFI  195



>ref|XP_002466262.1| hypothetical protein SORBIDRAFT_01g004610 [Sorghum bicolor]
 gb|EER93260.1| hypothetical protein SORBIDRAFT_01g004610 [Sorghum bicolor]
Length=195

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 103/150 (69%), Gaps = 3/150 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVS--GEAKAPTQDCCSGLKGVLDKSRKCLCLLV  468
            G A +D AKD+A CA+KL  LA CL +V     A+APT DCC+GLK V+  S+ C+C+LV
Sbjct  25   GVARADFAKDRAMCADKLMGLATCLTFVQDKATARAPTPDCCAGLKQVVAASKMCMCVLV  84

Query  469  KDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            KD ++P+L  KIN T A+ LP  CS PA  S+CP++L ++P++P+A++F++YA   +G N
Sbjct  85   KDRDEPALGFKINVTRAMDLPSLCSNPATFSDCPKILGMSPDAPEAEIFKEYAKKHEGQN  144

Query  649  -TTSPAAPVKGSPSGGATSSDVKSDGCKRK  735
             TT PAA    + +G +TS+   +DG  R+
Sbjct  145  GTTIPAAATGAAATGKSTSAAPTADGAGRQ  174



>ref|XP_008461230.1| PREDICTED: protein YLS3-like [Cucumis melo]
Length=192

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 89/138 (64%), Gaps = 3/138 (2%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D  KDK EC  +L  +A CL YVSG+AK PT DCCSGLK VL  ++KCLC++VKD NDP 
Sbjct  29   DDKKDKEECTPQLAGMATCLPYVSGDAKTPTPDCCSGLKEVLKNNKKCLCVIVKDRNDPD  88

Query  490  LDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAAP  669
            L ++IN TLALGLPD C   AN+S CP LLNL  NS +A+VF       K S+  +PA  
Sbjct  89   LGLQINVTLALGLPDICHATANVSNCPALLNLPSNSSEAQVFYQLGK-GKSSSALAPAPI  147

Query  670  VKGSPSGGATSSDVKSDG  723
            +  SPS  AT S     G
Sbjct  148  I--SPSSPATISSTVGGG  163



>ref|NP_001185235.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE33215.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=224

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 99/161 (61%), Gaps = 5/161 (3%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDLA+D+ EC  +L  L+ C+ YV G+AKAPT+DCC+G   V+ KS KC+C+LV+D
Sbjct  63   GFGNSDLAQDREECTNQLIELSTCIPYVGGDAKAPTKDCCAGFGQVIRKSEKCVCILVRD  122

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L IKINATLA  LP  C   A NI++C  +L+L  NS  AK F++        N+
Sbjct  123  KDDPQLGIKINATLAAHLPSACHITAPNITDCISILHLPRNSTLAKEFENLGRIEDNYNS  182

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFL  774
            TSP    K    GG  +  VKS+G K K  + V + + L +
Sbjct  183  TSPTQIHK----GGGKAEPVKSNGWKEKSWLGVELLIYLLV  219



>gb|AES71883.2| Lipid transfer protein [Medicago truncatula]
Length=203

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 109/180 (61%), Gaps = 19/180 (11%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDL +D+ +CA+KL  LA CL YV G A  PT DCC+ LK VL+ ++KC+C+L+KD
Sbjct  18   GFVSSDLTEDRKDCADKLVTLASCLPYVGGSANTPTIDCCTNLKQVLNNTKKCICILIKD  77

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISEC-----------------PELLNLAPNSPD  603
            SNDP L   +NATLA+ LP+ C  P+NISEC                  +LL+L+P SP+
Sbjct  78   SNDPKLGFPMNATLAVQLPNACHIPSNISECVGNGIDLEPRSVLLLKVSDLLHLSPKSPE  137

Query  604  AKVFQDYANSAKGSNTTSPAAPVKGSPSGGATSSDVKSDGCKRKRLV-EVNVAMGLFLYV  780
            AKVF+   NS K +N+++P +         ++S +    G  R+ LV EV  A+  FL++
Sbjct  138  AKVFEGLGNSTK-TNSSTPISSGSAEKGSSSSSEEKSGGGLGRRWLVAEVVCAILPFLFI  196



>ref|XP_002881957.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58216.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 4/136 (3%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D  KDK  C EKL  +A CL YV G+AK+PT DCCSGLK VL+   KCLC++++D N
Sbjct  25   AGDDKEKDKEGCTEKLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSDMKCLCVIIQDRN  84

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L +++N +LALGLP  C   A+I++CP LL+L P SP+A VF      AKG N T P
Sbjct  85   DPDLGLQVNVSLALGLPSVCHATADITKCPALLHLDPKSPEAHVFYQL---AKGLNETGP  141

Query  661  A-APVKGSPSGGATSS  705
            A AP   +P   + SS
Sbjct  142  ASAPTGSAPEPTSMSS  157



>ref|XP_010462370.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=183

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 100/164 (61%), Gaps = 5/164 (3%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDLA+D+ EC  +L AL+ CL YV G+AKAPT+DCC+G   V+  S KC+C+LVKD
Sbjct  20   GFGSSDLAQDRDECMNQLVALSTCLPYVGGDAKAPTKDCCAGFGQVITNSEKCVCILVKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L +K NA+LA  LP  C   A NI+EC  +L+L  NS  AK F+      +  NT
Sbjct  80   KDDPQLGLKFNASLAAHLPTACHITAPNITECISILHLPRNSTLAKEFESLGRIEENFNT  139

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVN-VAMGLFLYV  780
            TSP+       +GG  +   KS+G ++K  ++V  +   LF  +
Sbjct  140  TSPS---HKDGTGGGKAESAKSNGWRKKSWLDVELLIFALFTLI  180



>dbj|BAJ87912.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=185

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYV--SGEAKAPTQDCCSGLKGVLDKSRKCLCLLV  468
            G A +D A DKAEC +KL  LA CL YV  S  A+APT DCCSG + VL  S+KCLC+LV
Sbjct  23   GLAGADFAADKAECVDKLMGLATCLTYVQVSATARAPTPDCCSGFRQVLGVSKKCLCVLV  82

Query  469  KDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            KD ++P+L IK N T A+ LP  C+ PA  S+CP++LN++P+S +A++F+ Y    +G N
Sbjct  83   KDRDEPTLGIKFNVTRAMNLPSACNIPATFSDCPKILNMSPDSKEAEIFKQYGIEHEGKN  142



>ref|XP_010069341.1| PREDICTED: protein YLS3-like [Eucalyptus grandis]
Length=163

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 101/158 (64%), Gaps = 13/158 (8%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
             +SD+A+DK EC  +L  L+PCL +V G++KAP+  CC+ L+  L+++R+CLC+L++D +
Sbjct  12   VTSDVAQDKQECEAQLVNLSPCLPFVGGDSKAPSVPCCANLRKDLNETRRCLCMLIRDRD  71

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            +P L  K+NATLAL LP  C +P+++S CP LL+L PNSPDA+VF+ + N++   +    
Sbjct  72   EPGLGFKLNATLALALPSICHSPSDVSHCPALLHLDPNSPDAQVFEQFTNASYAGSI---  128

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFL  774
                      G  SS V S+G  +     V VA+ L L
Sbjct  129  ---------NGDRSSLVSSNGLAKGPW-RVGVALWLLL  156



>ref|XP_004306485.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Fragaria vesca subsp. vesca]
Length=207

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 5/112 (4%)
 Frame = +1

Query  331  ECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIKINA  510
            ECA++L  +A CL YV GEA APT DCCSGLK VL+ ++KCLC++++D NDP L ++IN 
Sbjct  45   ECAQQLVGMATCLPYVGGEAMAPTPDCCSGLKQVLNNNKKCLCVIIQDRNDPDLGLQINV  104

Query  511  TLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
            TLALGLP  C   AN+S+CPELL+L P SP+A+VF    N     N+T  AA
Sbjct  105  TLALGLPSVCHAAANVSKCPELLHLDPKSPEAQVFYQLQN-----NSTQAAA  151



>ref|XP_003558736.1| PREDICTED: protein YLS3-like [Brachypodium distachyon]
Length=193

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDP  486
            +D++ D++ECAE+L  LAPCL YV G+A++P  DCC GL+ VL KS KCLC+LVKD +DP
Sbjct  22   ADMSADRSECAEQLVGLAPCLQYVQGQARSPAPDCCGGLRQVLGKSPKCLCVLVKDKDDP  81

Query  487  SLDIKINATLALGLPDRC-STPANISECPELLNLAPNSPDAKVF  615
            +L I INA+LAL LP  C +T AN+S CPELL+L PNS DA +F
Sbjct  82   NLGININASLALALPSACGATKANVSHCPELLHLPPNSKDAAIF  125



>ref|XP_006305663.1| hypothetical protein CARUB_v10010370mg [Capsella rubella]
 gb|EOA38561.1| hypothetical protein CARUB_v10010370mg [Capsella rubella]
Length=191

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 87/138 (63%), Gaps = 1/138 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDLA+D+ EC  +L AL+ CL YV G AKAPT+DCC+G   V+ KS KC+C+LVKD
Sbjct  20   GFGNSDLAQDRDECTNQLIALSTCLPYVGGGAKAPTKDCCAGFNQVITKSEKCVCILVKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L +KINATLA  LP  C   A NI+EC  +L+LA NS  AK F+      +  N+
Sbjct  80   KDDPQLGLKINATLAAHLPTACHITAPNITECISILHLARNSTLAKEFESLGRIEENYNS  139

Query  652  TSPAAPVKGSPSGGATSS  705
            TSP    K    GG   S
Sbjct  140  TSPTQIHKDGTGGGKAES  157



>ref|NP_181958.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 sp|O64864.1|YLS3_ARATH RecName: Full=Protein YLS3; AltName: Full=Protein YELLOW-LEAF-SPECIFIC 
GENE 3; AltName: Full=Xylogen-like protein 9; Short=AtXYLP9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16079.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC42777.1| putative non-specific lipid transfer protein nLTP [Arabidopsis 
thaliana]
 gb|AAO63932.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE73265.1| xylogen like protein 9 [Arabidopsis thaliana]
 gb|AEC10404.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=205

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A +D  KDK EC  +L  +A CL YV G+AK+PT DCCSGLK V++   KCLC+++++ N
Sbjct  25   AGADKGKDKEECTAQLVGMATCLPYVQGKAKSPTPDCCSGLKQVINSDMKCLCMIIQERN  84

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L +++N +LAL LP  C   A+I++CP LL+L PNSPDA+VF      AKG N T  
Sbjct  85   DPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQVFYQL---AKGLNETVS  141

Query  661  AAPVKGSPS  687
            A+   GS S
Sbjct  142  ASAPTGSAS  150



>ref|XP_010501137.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=183

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 99/164 (60%), Gaps = 5/164 (3%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDLA+D+ EC  +L AL+ CL YV G+AKAPT+DCC+G   V+ KS KC+C+LVKD
Sbjct  20   GFGSSDLAQDRDECTNQLIALSTCLPYVGGDAKAPTKDCCAGFGQVITKSEKCICILVKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L +K NA+LA  LP  C   A NI+EC  +L+L  NS  AK F+      +  N 
Sbjct  80   KDDPQLGLKFNASLAAHLPTACHITAPNITECISILHLPRNSTLAKEFESLGRIEENFNA  139

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVN-VAMGLFLYV  780
            TS +       +GG  +   KS+G ++K  ++V  +   LF  +
Sbjct  140  TSTSHK---DGTGGGKAESAKSNGWRKKSWLDVELLIFALFTLI  180



>gb|KCW57668.1| hypothetical protein EUGRSUZ_H00429, partial [Eucalyptus grandis]
Length=116

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
             +SD+A+DK EC  +L  L+PCL +V G++KAP+  CC+ L+  L+++R+CLC+L++D +
Sbjct  6    VTSDVAQDKQECEAQLVNLSPCLPFVGGDSKAPSVPCCANLRKDLNETRRCLCMLIRDRD  65

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANS  633
            +P L  K+NATLAL LP  C +P+++S CP LL+L PNSPDA+VF+ + N+
Sbjct  66   EPGLGFKLNATLALALPSICHSPSDVSHCPALLHLDPNSPDAQVFEQFTNA  116



>ref|XP_007029080.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY09582.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=205

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
             SSD A+DK EC+ +L AL+ C+ +V G  K P   CC+ L+  +++++KCLCLLV D N
Sbjct  46   VSSDWAEDKKECSNQLVALSTCIPFVGGNTKVPDSTCCTNLRKKINQTKKCLCLLVADRN  105

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTS  657
            DP L  K+NATLAL LP  C  P+N SECPELL+L PNS DA+VF+ +A + +  N+++
Sbjct  106  DPDLGFKVNATLALILPSICHAPSNASECPELLHLPPNSTDAQVFEQFAATFEEGNSSA  164



>ref|XP_010693844.1| PREDICTED: protein YLS3 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=176

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 89/131 (68%), Gaps = 5/131 (4%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
             SSD +KDKAEC E+L  L+ CL YV+GEAKAP+  CC+ L   L+ S+KCLC+LVKD N
Sbjct  23   VSSDFSKDKAECQEQLITLSSCLNYVAGEAKAPSPQCCTVLHKKLNVSKKCLCILVKDRN  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            +PSL +K+NAT AL LP  C TP++   C  LL+L P SP+A+VF + ANS +  ++   
Sbjct  83   EPSLGLKLNATRALMLPSICHTPSSSLVCIGLLHLDPKSPEARVFVELANSTRVDDS---  139

Query  661  AAPVKGSPSGG  693
              PV    SGG
Sbjct  140  --PVSPRTSGG  148



>ref|XP_006305662.1| hypothetical protein CARUB_v10010370mg [Capsella rubella]
 gb|EOA38560.1| hypothetical protein CARUB_v10010370mg [Capsella rubella]
Length=188

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 85/129 (66%), Gaps = 1/129 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDLA+D+ EC  +L AL+ CL YV G AKAPT+DCC+G   V+ KS KC+C+LVKD
Sbjct  20   GFGNSDLAQDRDECTNQLIALSTCLPYVGGGAKAPTKDCCAGFNQVITKSEKCVCILVKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L +KINATLA  LP  C   A NI+EC  +L+LA NS  AK F+      +  N+
Sbjct  80   KDDPQLGLKINATLAAHLPTACHITAPNITECISILHLARNSTLAKEFESLGRIEENYNS  139

Query  652  TSPAAPVKG  678
            TSP    KG
Sbjct  140  TSPTQIHKG  148



>gb|ACG31262.1| lipid transfer protein [Zea mays]
Length=192

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 87/123 (71%), Gaps = 7/123 (6%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D+  DK ECA++L  LAPCL YV G+A+AP  DCC GL+ VL KS KCLC+LVKD +DP+
Sbjct  25   DMNADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  84

Query  490  LDIKINATLALGLPDRC-STPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
            L IKINATLAL LP+ C +T AN+S C +LL++ P S DA VF      + GS+  S AA
Sbjct  85   LGIKINATLALALPNACGATRANVSHCAQLLHIPPGSKDAAVF------SPGSDKGSTAA  138

Query  667  PVK  675
            P K
Sbjct  139  PAK  141



>ref|NP_001152188.1| lipid binding protein precursor [Zea mays]
 gb|ACG46301.1| lipid binding protein [Zea mays]
Length=206

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 82/125 (66%), Gaps = 2/125 (2%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKA--PTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            D A D+AEC+E+L  LA CL YV  +A A  PT DCC+GLK VL  SRKCLC+LVKD +D
Sbjct  31   DFAADRAECSEQLAGLATCLTYVQEQATATAPTPDCCAGLKAVLQSSRKCLCVLVKDRDD  90

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA  663
            P+L +K+N   ALGLP  C  PANIS+CP LL+L   S DA+VF+ YA     +      
Sbjct  91   PNLGLKLNVDKALGLPAVCHAPANISDCPRLLDLPAGSKDAQVFEQYAKQQAAAAAQGGG  150

Query  664  APVKG  678
            AP  G
Sbjct  151  APTSG  155



>gb|ACG45950.1| lipid transfer protein [Zea mays]
Length=192

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 87/123 (71%), Gaps = 7/123 (6%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D+  DK ECA++L  LAPCL YV G+A+AP  DCC GL+ VL KS KCLC+LVKD +DP+
Sbjct  25   DMNADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  84

Query  490  LDIKINATLALGLPDRC-STPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
            L IKINATLAL LP+ C +T AN+S C +LL++ P S DA VF      + GS+  S AA
Sbjct  85   LGIKINATLALALPNACGATRANVSHCAQLLHIPPGSKDAAVF------SPGSDKGSTAA  138

Query  667  PVK  675
            P K
Sbjct  139  PAK  141



>gb|ACG37967.1| lipid transfer protein [Zea mays]
Length=192

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 87/123 (71%), Gaps = 7/123 (6%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D+  DK ECA++L  LAPCL YV G+A+AP  DCC GL+ VL KS KCLC+LVKD +DP+
Sbjct  25   DMNADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  84

Query  490  LDIKINATLALGLPDRC-STPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
            L IKINATLAL LP+ C +T AN+S C +LL++ P S DA VF      + GS+  S AA
Sbjct  85   LGIKINATLALALPNACGATRANVSHCAQLLHIPPGSKDAAVF------SPGSDKGSTAA  138

Query  667  PVK  675
            P K
Sbjct  139  PAK  141



>gb|EMT07496.1| Non-specific lipid-transfer protein-like protein [Aegilops tauschii]
Length=185

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 85/121 (70%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYV--SGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            D A D+AECA+KL  LA CL YV  +  A++PT DCCSG + VL  S+KCLC+LVKD ++
Sbjct  27   DFAADRAECADKLMGLATCLTYVQLAATARSPTPDCCSGFRQVLAASKKCLCVLVKDRDE  86

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA  663
            P+L IK N T A+ LP  C+ PA  S+CP++LN++P+S +A++F+ Y    +G N T+  
Sbjct  87   PTLGIKFNVTRAMNLPSACNIPATFSDCPKILNMSPDSKEAEIFKQYGIEHEGKNATAGG  146

Query  664  A  666
            A
Sbjct  147  A  147



>gb|ACR37836.1| unknown [Zea mays]
 tpg|DAA43565.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=192

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 87/123 (71%), Gaps = 7/123 (6%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D++ DK ECA++L  LAPCL YV G+A+AP  DCC GL+ VL KS KCLC+LVKD +DP+
Sbjct  25   DMSADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  84

Query  490  LDIKINATLALGLPDRC-STPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
            L IKINATLAL LP+ C +T AN+S C +LL++ P S DA VF      + G +  S AA
Sbjct  85   LGIKINATLALALPNACGATRANVSHCAQLLHIPPGSKDAAVF------SPGGDKGSTAA  138

Query  667  PVK  675
            P K
Sbjct  139  PAK  141



>ref|XP_009418410.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=210

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 101/165 (61%), Gaps = 8/165 (5%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            ASSD++ D AEC   L A+  C+ +V G A+APT DCC+GLK VL    KCLC+LVK  +
Sbjct  43   ASSDISSDVAECGSHLLAMQTCITFVQGTAEAPTPDCCAGLKTVLANRPKCLCILVKMHD  102

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYAN--SAKGS---  645
            DP L IKIN T AL LP  CS  ANIS+CP++L L PNS +A++F+   +   AKG+   
Sbjct  103  DPQLPIKINVTRALALPTACSARANISKCPQILKLPPNSKEAEIFKQSGSPTQAKGNSTI  162

Query  646  NTTSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
            NTT+  +P   S +    S  ++  G   ++ V   VA  LFL +
Sbjct  163  NTTTGTSPRASSETSSGRSDYLEWRGWLARKAV---VACVLFLVM  204



>ref|XP_002468449.1| hypothetical protein SORBIDRAFT_01g046080 [Sorghum bicolor]
 gb|EER95447.1| hypothetical protein SORBIDRAFT_01g046080 [Sorghum bicolor]
Length=195

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 7/126 (6%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D+  DK ECA++L  LAPCL YV G+A+AP  DCC GL+ VL KS KCLC+LVKD +
Sbjct  24   AVGDMNADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKD  83

Query  481  DPSLDIKINATLALGLPDRC-STPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTS  657
            DP+L IKINATLAL LP+ C +T AN+S C +LL++ P S DA VF      + G +  S
Sbjct  84   DPNLGIKINATLALALPNACGATRANVSHCAQLLHIPPGSKDAAVF------SPGGDKGS  137

Query  658  PAAPVK  675
             AAP K
Sbjct  138  TAAPAK  143



>ref|XP_010693842.1| PREDICTED: protein YLS3 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=179

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 88/131 (67%), Gaps = 2/131 (2%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
             SSD +KDKAEC E+L  L+ CL YV+GEAKAP+  CC+ L   L+ S+KCLC+LVKD N
Sbjct  23   VSSDFSKDKAECQEQLITLSSCLNYVAGEAKAPSPQCCTVLHKKLNVSKKCLCILVKDRN  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            +PSL +K+NAT AL LP  C TP++   C  LL+L P SP+A+VF + ANS +       
Sbjct  83   EPSLGLKLNATRALMLPSICHTPSSSLVCIGLLHLDPKSPEARVFVELANSTRVDAVDD-  141

Query  661  AAPVKGSPSGG  693
             +PV    SGG
Sbjct  142  -SPVSPRTSGG  151



>ref|XP_002891826.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68085.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=190

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 95/149 (64%), Gaps = 2/149 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  +SDLA+D+ EC  +L  L+ C+ YV G+AKAPT+DCC+G   V+ KS KC+C+LV+D
Sbjct  20   GIGNSDLAQDREECTNQLIELSTCIPYVGGDAKAPTKDCCAGFGQVIRKSEKCVCILVRD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP L IKINA+LA  LP  C   A NI++C  +L++  NS  AK F+         N+
Sbjct  80   KDDPQLGIKINASLAAHLPSACHITAPNITDCISILHIPRNSTLAKEFESLGRIEDNYNS  139

Query  652  TSPAAPVKGSPSGGATSSDVKSDGCKRKR  738
            TS  + +    +GG  +  VKS+G K+K+
Sbjct  140  TS-TSQIHKDGAGGGKAESVKSNGWKKKK  167



>ref|XP_006397607.1| hypothetical protein EUTSA_v10001638mg [Eutrema salsugineum]
 gb|ESQ39060.1| hypothetical protein EUTSA_v10001638mg [Eutrema salsugineum]
Length=200

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 87/131 (66%), Gaps = 4/131 (3%)
 Frame = +1

Query  331  ECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIKINA  510
            EC E+L  +A CL YV G+AK+PT DCCSGLK V++  +KCLC++++D NDP L ++IN 
Sbjct  33   ECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVINSDKKCLCVIIQDRNDPDLGLQINV  92

Query  511  TLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA-APVKGSPS  687
            +LAL LP  C   A++++CP LL+L PNSPDA+VF   AN   G N T  A AP   +P 
Sbjct  93   SLALALPSVCHVTADVTKCPALLHLDPNSPDAQVFYQLAN---GLNKTGLASAPTGSAPE  149

Query  688  GGATSSDVKSD  720
              + S    SD
Sbjct  150  PTSMSPTAGSD  160



>ref|NP_001170312.1| putative bifunctional inhibitor/LTP/seed storage protein family 
precursor [Zea mays]
 gb|ACN36566.1| unknown [Zea mays]
 tpg|DAA59932.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=206

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKA--PTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            D A D+AEC+E+L  LA CL YV  +A A  PT DCC+GLK VL  SRKCLC+LVKD +D
Sbjct  32   DFAADRAECSEQLAGLATCLTYVQEQATATAPTPDCCAGLKAVLQSSRKCLCVLVKDRDD  91

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDY  624
            P+L +K+N   ALGLP  C  PANIS+CP LL+L   S DA+VF+ Y
Sbjct  92   PNLGLKLNVDKALGLPAVCHAPANISDCPRLLDLPAGSKDAQVFEQY  138



>gb|EMT07497.1| hypothetical protein F775_15194 [Aegilops tauschii]
Length=164

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 82/115 (71%), Gaps = 2/115 (2%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYV--SGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            D A DKAECA+KL  LA CL YV  +  A+APT DCCSG + VL  S++C+C+LVKD ++
Sbjct  30   DFAADKAECADKLMGLATCLTYVQLTATARAPTPDCCSGFRQVLGTSKRCMCILVKDRDE  89

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            P+L IK+N T ++ LP  C+  A  S+CP++LN+AP+S + ++F+ YA   +G N
Sbjct  90   PALGIKVNITRSMNLPSVCNIAATFSDCPKILNMAPDSKETEIFKQYAREHEGKN  144



>gb|EMT03137.1| hypothetical protein F775_19441 [Aegilops tauschii]
Length=181

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 11/161 (7%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYV--SGEAKAPTQDCCSGLKGVLDKSRKCLCLLV  468
            G A +D A D   CAEKL  LA CL  V  +  A+APT DCCSGL+ VL  S+KCLC+L+
Sbjct  23   GLAGADFASDSKMCAEKLAVLATCLPVVDATATARAPTPDCCSGLREVLGDSKKCLCVLI  82

Query  469  KDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            KD +DP++ IK+N T A+ LP  CS PA +S+CP+LL+++P+S +A++F+ YA   +G N
Sbjct  83   KDRDDPAIGIKVNVTRAMDLPSACSVPAVLSDCPKLLHISPDSKEAEIFKQYAIH-EGKN  141

Query  649  TTSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLF  771
             T+  A       GG  +  V  +G +   +V   V  GL 
Sbjct  142  ATAGTA-------GGKHTDAVSGEG-RHTAVVFAVVVSGLL  174



>emb|CDP10170.1| unnamed protein product [Coffea canephora]
Length=179

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
             SSD A+DK EC ++L  L+PC+ ++S E K P+  CC  L    D+ R+CLC+LV+D N
Sbjct  23   VSSDFAQDKRECQDQLAGLSPCVSFISEEEKHPSPVCCLRLGNNYDQKRRCLCMLVRDRN  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTS  657
            +P L  KINATLAL LP  C  PAN ++C + L+L P SPDA++F  ++NS+ GS TT+
Sbjct  83   EPGLGFKINATLALALPFICRIPANATQCLDFLHLDPRSPDAQIFLQFSNSS-GSRTTT  140



>ref|XP_003549079.1| PREDICTED: protein YLS3-like isoform X1 [Glycine max]
Length=191

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 99/168 (59%), Gaps = 8/168 (5%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D A+DK  CAE L   A CL Y+ G+ KAPT DCCS L   +  ++KC+CL++KD +
Sbjct  23   AMGDSAQDKQRCAESLAGAATCLPYLGGDTKAPTADCCSRLTQAMKTNKKCVCLILKDRD  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT-S  657
            DP L +KIN T+A+GLP  C TP N+S+C  LL+L P SP+A+ F      + G + + S
Sbjct  83   DPDLGLKINMTIAVGLPSLCKTPDNLSQCSALLHLDPKSPEAQAFNQIGQKSNGGSISPS  142

Query  658  PAAPVKGSPSGGATSSDVKSDGCKR------KRLVEVNVAM-GLFLYV  780
            P   V+GS   G      ++   K       KRL+E  VA+ GL +++
Sbjct  143  PTPSVEGSSQNGRNQGTDETATAKNSASYIGKRLLESLVAVAGLLIWL  190



>ref|XP_007152277.1| hypothetical protein PHAVU_004G115900g [Phaseolus vulgaris]
 gb|ESW24271.1| hypothetical protein PHAVU_004G115900g [Phaseolus vulgaris]
Length=193

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 7/160 (4%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D A++K +CAE L  +  CL Y+ GEAK PT+DCCSGL   +  ++KC+C+++KD +
Sbjct  23   AMGDSAQEKQKCAESLTGVTTCLPYLGGEAKTPTEDCCSGLTQAMKSNKKCICIILKDRD  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L +KIN T+A+GLP  C TP N S CP LL+L P SP+A+ F     ++ G + +  
Sbjct  83   DPDLGLKINITIAVGLPSICKTPDNFSRCPALLHLDPKSPEAQAFNQKGQNSNGGSLSPS  142

Query  661  AAP-VKGSP-----SGGATSSDVKSDGC-KRKRLVEVNVA  759
            A P  +GS       G   +  VK+D   K KRL+E  VA
Sbjct  143  ANPSAEGSSENCRNQGRDETVTVKNDASYKGKRLLEKFVA  182



>ref|NP_001152231.1| LOC100285869 precursor [Zea mays]
 gb|ACG46517.1| lipid binding protein [Zea mays]
Length=183

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVS--GEAKAPTQDCCSGLKGVLDKSRKCLCLLV  468
            G A +D A+D+A CA++L  LA CL +V     A+APT DCC+GLK V+  S+ C+C+LV
Sbjct  12   GVARADFAQDRAMCADRLMGLATCLTFVQDKATARAPTPDCCAGLKQVVAASKLCMCVLV  71

Query  469  KDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            KD ++P+L  KIN T A+ LP  CS PA  S+CP++L ++P++P+A++F++YA   + +N
Sbjct  72   KDRDEPALGFKINVTRAMDLPSLCSNPATFSDCPKILGMSPDAPEAEIFKEYAKKHESNN  131

Query  649  TTS  657
             T+
Sbjct  132  GTT  134



>gb|ABR16730.1| unknown [Picea sitchensis]
Length=188

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 79/120 (66%), Gaps = 9/120 (8%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A SD A D+ EC  +L  LA C+ YV G AK P +DCC GL  +  K  KCLC+L+KDS+
Sbjct  19   ALSDFAADQKECGSQLATLATCIPYVQGSAKFPAKDCCDGLLKLHLKDPKCLCVLIKDSS  78

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L I IN TLAL LPD C   AN+S CP LL+++PNSPDA+VF+         NTT+P
Sbjct  79   DPQLGITINKTLALQLPDDCKVAANVSRCPALLHISPNSPDAQVFK---------NTTTP  129



>gb|AAS07215.1| putative protease inhibitor [Oryza sativa Japonica Group]
 gb|ABF99419.1| Protease inhibitor/seed storage/LTP family protein [Oryza sativa 
Japonica Group]
 gb|EAY92238.1| hypothetical protein OsI_13958 [Oryza sativa Indica Group]
 gb|EAZ28964.1| hypothetical protein OsJ_13008 [Oryza sativa Japonica Group]
 dbj|BAH00959.1| unnamed protein product [Oryza sativa Japonica Group]
Length=195

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 83/115 (72%), Gaps = 2/115 (2%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVS--GEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            D A DKAECA+KL ALA CL YV     A+APT+DCC+GL  V+  S+KCLC+LVKD ++
Sbjct  26   DFAADKAECADKLMALATCLTYVEEKATARAPTRDCCAGLGQVVAGSKKCLCVLVKDRDE  85

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            P+L  +IN T A+ LP  CS  A  S+CP++LN++P+S +A++F+ YA   + +N
Sbjct  86   PALGFRINVTRAMDLPSGCSIAATFSDCPKMLNMSPDSKEAEIFKQYAREHESNN  140



>ref|NP_001266562.1| lipid binding protein [Zea mays]
 gb|ACG36478.1| lipid binding protein [Zea mays]
Length=205

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVS--GEAKAPTQDCCSGLKGVLDKSRKCLCLLV  468
            G A +D A+D+A CA++L  LA CL +V     A+APT DCC+GLK V+  S+ C+C+LV
Sbjct  31   GVARADFAQDRAMCADRLMGLATCLTFVQDKATARAPTPDCCAGLKQVVAASKLCMCVLV  90

Query  469  KDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            KD ++P+L  KIN T A+ LP  CS PA  S+CP++L ++P++P+A++F++YA   + +N
Sbjct  91   KDRDEPALGFKINVTRAMDLPSLCSNPATFSDCPKILGMSPDAPEAEIFKEYAKKHESNN  150

Query  649  TTS  657
             T+
Sbjct  151  GTT  153



>tpg|DAA52009.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=202

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVS--GEAKAPTQDCCSGLKGVLDKSRKCLCLLV  468
            G A +D A+D+A CA++L  LA CL +V     A+APT DCC+GLK V+  S+ C+C+LV
Sbjct  31   GVARADFAQDRAMCADRLMGLATCLTFVQDKATARAPTPDCCAGLKQVVAASKLCMCVLV  90

Query  469  KDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            KD ++P+L  KIN T A+ LP  CS PA  S+CP++L ++P++P+A++F++YA   + +N
Sbjct  91   KDRDEPALGFKINVTRAMDLPSLCSNPATFSDCPKILGMSPDAPEAEIFKEYAKKHESNN  150

Query  649  TTS  657
             T+
Sbjct  151  GTT  153



>ref|XP_004142249.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Cucumis sativus]
Length=146

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SS++ +D+AECA+++  LA CL YV GEAKAPT DCCSGLK VLDKSRKCLC+L+KD
Sbjct  19   GFVSSNIDQDRAECADQVVGLATCLPYVGGEAKAPTPDCCSGLKLVLDKSRKCLCVLIKD  78

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISEC  567
             +DPSL +K+N +LALGLP  C  PANI +C
Sbjct  79   RDDPSLGLKVNLSLALGLPSACHAPANIKDC  109



>ref|XP_004981375.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Setaria italica]
Length=200

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVS--GEAKAPTQDCCSGLKGVLDKSRKCLCLLV  468
            G A  D A D+AECA +L  LA CL +V     A+APT DCC+GLK V+  S+KC+C+LV
Sbjct  31   GVARGDFAADRAECANQLMGLATCLTFVQDKATARAPTPDCCAGLKQVVSASKKCMCVLV  90

Query  469  KDSNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            KD ++P+L  KIN T A+ LPD C+ PA  S+CP++L ++ ++P+A++F++YA   +  N
Sbjct  91   KDRDEPALGFKINVTRAMDLPDICNYPATFSDCPKILGMSTDAPEAEIFKEYAKKHESQN  150



>gb|EPS62245.1| non-specific lipid-transfer protein, partial [Genlisea aurea]
Length=133

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D++ D+A+CA+ LG +  CL YVS +AK+PT+DCCSG + VL +S +C+CLL+KD NDP 
Sbjct  1    DISVDRAKCADTLGGVITCLPYVSDQAKSPTKDCCSGFQTVLQESPQCICLLIKDRNDPG  60

Query  490  LDIKINATLALGLPDRCSTPAN--ISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPA  663
            L ++I+   A+ LP  C    N  + +CP +L+L PNSPDA+VFQ +AN           
Sbjct  61   LGLQIDVPRAMSLPQICKIHTNQTVGDCPAILHLPPNSPDAQVFQQFANVTGAQTPAHAP  120

Query  664  APV  672
            +PV
Sbjct  121  SPV  123



>ref|XP_004985580.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
isoform X2 [Setaria italica]
Length=194

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D+  D+ ECA++L  LAPCL YV G+A+AP  DCC GL+ VL KS KCLC+LVKD +DP+
Sbjct  26   DMNADRTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  85

Query  490  LDIKINATLALGLPDRC-STPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAA  666
            L IKINATLAL LP  C +T AN S C +LL++ P S DA +F      + G +  S AA
Sbjct  86   LGIKINATLALALPSACGATRANASHCAQLLHIPPGSKDAAIF------SPGGDKGSSAA  139

Query  667  PVK  675
            P K
Sbjct  140  PAK  142



>ref|XP_011075093.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=168

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDP  486
            SD A+DK +C ++L +L+ C+ +VSG+AKAPT  CCS L+  + KS+ CLC+LVKD NDP
Sbjct  21   SDSAQDKKKCQDQLVSLSSCIDFVSGDAKAPTPSCCSELRKDVIKSKLCLCILVKDRNDP  80

Query  487  SLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNT-TSPA  663
             L  K+NATLAL L   C  P++ S CP+LL LAPNSP+A++F+ +  ++   ++ T P+
Sbjct  81   QLGFKLNATLALTLIPLCHIPSDASVCPQLLELAPNSPEAQIFEQFNTTSSAVDSDTIPS  140

Query  664  APVKG  678
            +  KG
Sbjct  141  SSTKG  145



>emb|CDY54411.1| BnaC06g41560D [Brassica napus]
Length=196

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 1/138 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDL +D+ EC  +L  L+PCL YV G AKAPT+DCC G   V+ +S+KC+C+LVKD
Sbjct  20   GFGSSDLDQDREECTNQLIVLSPCLTYVGGNAKAPTKDCCGGFGQVITQSQKCVCILVKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP+L +K NA+LA  LP  C   A NI++C  LL+L+PNS  A+ F+        +N+
Sbjct  80   KDDPNLGLKFNASLAAHLPTACHITAPNITKCISLLHLSPNSTLAREFESLGRLEASANS  139

Query  652  TSPAAPVKGSPSGGATSS  705
              P+  VK    GG   S
Sbjct  140  APPSQNVKDGAGGGKAES  157



>gb|ABK22783.1| unknown [Picea sitchensis]
Length=182

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A +DL  D+ EC+ +L ++  C  YV G  K+P+ DCC+ LK V   + KCLC+LVKD
Sbjct  20   GSALADLEADQKECSSQLTSMTKCFSYVQGTDKSPSTDCCANLKNVYQTAPKCLCILVKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF  615
            S  P+L + IN TLALGLP  C   ANIS CP LLNL+PNSPDAK+F
Sbjct  80   STSPALGLSINQTLALGLPSACKVNANISACPALLNLSPNSPDAKIF  126



>ref|XP_009147517.1| PREDICTED: protein YLS3-like [Brassica rapa]
Length=196

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 1/138 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDL +D+ EC  +L  L+PCL YV G AKAPT+DCC G   V+ +S+KC+C+LVKD
Sbjct  20   GFGSSDLDQDREECTNQLVVLSPCLTYVGGNAKAPTKDCCGGFGQVITQSQKCVCILVKD  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP+L +K NA+LA  LP  C   A NI++C  LL+L+PNS  A+ F+        +N+
Sbjct  80   KDDPNLGLKFNASLAAHLPTACHITAPNITKCISLLHLSPNSTLAREFESLGRLEASANS  139

Query  652  TSPAAPVKGSPSGGATSS  705
              P   VK    GG   S
Sbjct  140  APPLQNVKDGAGGGKAES  157



>emb|CDY24046.1| BnaA06g00440D [Brassica napus]
Length=133

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 85/130 (65%), Gaps = 1/130 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSDL +D+ EC  +L  L+PCL YV G AKAPT+DCC G   V+ +S+KC+C+LVKD
Sbjct  4    GFGSSDLDQDREECTNQLVVLSPCLTYVGGNAKAPTKDCCGGFGQVITQSQKCVCILVKD  63

Query  475  SNDPSLDIKINATLALGLPDRCSTPA-NISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
             +DP+L +K NA+LA  LP  C   A NI++C  LL+L+PNS  A+ F+        +N+
Sbjct  64   KDDPNLGLKFNASLAAHLPTACHITAPNITKCISLLHLSPNSTLAREFESLGRLEASANS  123

Query  652  TSPAAPVKGS  681
              P   VKG+
Sbjct  124  APPLQNVKGN  133



>gb|KEH21671.1| RALF [Medicago truncatula]
Length=191

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 96/167 (57%), Gaps = 16/167 (10%)
 Frame = +1

Query  316  AKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLD  495
            A++K +CAE+L  L  CL Y+ G A +PT DCCSGL      ++KC+C+++KD +DP L 
Sbjct  29   AQEKQKCAEQLTDLTTCLPYLGGSANSPTSDCCSGLIQSTKNNKKCICIIIKDRDDPDLG  88

Query  496  IKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAAPVK  675
            +KIN TLALGLP  C+TP N S+C  LL+L P S +A+ F     ++ G+N+ SPA    
Sbjct  89   LKINITLALGLPSLCNTPDNFSQCSSLLHLDPKSSEAQAFNQLRQNSNGANSISPAT---  145

Query  676  GSPSGGATSSDVKSDGC------------KRKRLVEVNVAMGLFLYV  780
             SPS   +S   ++ G             K K L+   VA  L LY 
Sbjct  146  -SPSAEGSSQHSRNQGTDETVTTKNGAPFKGKSLLYSLVAGLLVLYF  191



>ref|XP_007152276.1| hypothetical protein PHAVU_004G115800g [Phaseolus vulgaris]
 gb|ESW24270.1| hypothetical protein PHAVU_004G115800g [Phaseolus vulgaris]
Length=193

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D A++K +CAE L  +A CL Y+ GEAK+PT+DCCSGL   +  ++KC+C+++KD +
Sbjct  23   AMGDSAQEKQKCAESLTGVATCLPYLGGEAKSPTEDCCSGLTQAMTSNKKCICVILKDRD  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNT  651
            DP L +KIN T+A+GLP  C TP N+S+CP LL+L P SP+A+ F       KG N+
Sbjct  83   DPDLGLKINITIAVGLPSLCKTPDNLSQCPALLHLDPKSPEAQAFNQ-----KGQNS  134



>ref|XP_003549048.1| PREDICTED: protein YLS3-like [Glycine max]
Length=191

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 98/168 (58%), Gaps = 8/168 (5%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D A+DK  CAE L  +  CL Y+ G+ K+PT DCCSGL   +  ++KC+C+++KD +
Sbjct  23   AMGDSAQDKQRCAESLTGVTTCLPYLGGDTKSPTADCCSGLTQAMKTNKKCVCVILKDRD  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF-QDYANSAKGSNTTS  657
            DP L +KIN T+A GLP  C TP N S+C  LL+L P SP+A+ F Q    S  GS   S
Sbjct  83   DPDLGLKINMTIAAGLPSLCKTPDNFSQCSALLHLDPKSPEAQAFNQIDQKSNGGSIRPS  142

Query  658  PAAPVKGSPSGG------ATSSDVKSDGCKRKRLVEVNVAM-GLFLYV  780
            P   V+GS   G       T++   S     KR +E  VA+ GL +++
Sbjct  143  PTPSVEGSSQNGRKQGTDETATAKNSASYIGKRFLESLVAVAGLLIWL  190



>ref|XP_003549102.1| PREDICTED: protein YLS3-like isoform X1 [Glycine max]
Length=191

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 99/168 (59%), Gaps = 8/168 (5%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A  D A+DK  CAE L  +A CL Y+  +AKAPT DCC GL   +  ++KC+CL++KD +
Sbjct  23   AMEDSAQDKQRCAESLTGVATCLPYLGADAKAPTADCCGGLTQAMKTNKKCVCLILKDRD  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT-S  657
             P L +KIN T+A+GLP  C TP N+S+C  LL+L P SP+A+ F      + G + + S
Sbjct  83   VPDLGLKINMTIAVGLPSLCKTPDNLSQCSALLHLDPKSPEAQAFNQIGQKSNGGSISPS  142

Query  658  PAAPVKGSPSGG------ATSSDVKSDGCKRKRLVEVNVAM-GLFLYV  780
            P    +GS   G       T++   S     KRL+E  VA+ GL +++
Sbjct  143  PTTSAEGSSQNGRNQGIDETATAKNSASYIGKRLLESLVAVAGLQIWL  190



>ref|XP_004172159.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like, 
partial [Cucumis sativus]
Length=125

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 90/157 (57%), Gaps = 40/157 (25%)
 Frame = +1

Query  319  KDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDI  498
            +D+AECA+++  LA CL YV GEAKAPT DCCSGLK VLDKSRKCLC+L+KD +DPSL +
Sbjct  1    QDRAECADQVVGLATCLPYVGGEAKAPTPDCCSGLKLVLDKSRKCLCVLIKDRDDPSLGL  60

Query  499  KINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSPAAPVKG  678
            K+N +LALGLP  C  PANI +C                                  V G
Sbjct  61   KVNLSLALGLPSACHAPANIKDC---------------------------------VVSG  87

Query  679  SPSGGATSSDVKSDGCKRKRLVEVNVAMGL----FLY  777
            S S    +S+VK+DG KR + + V + +      FL+
Sbjct  88   SSS---QNSEVKNDGTKRNQWLGVEMFIWFITSSFLF  121



>gb|EPS60733.1| hypothetical protein M569_14069, partial [Genlisea aurea]
Length=140

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G    D+ +D+A+C ++L A+A CL YVS EA  PT DCC G K VLD S  C CLL+KD
Sbjct  15   GFGQCDINEDRAKCGDQLMAVATCLPYVSDEAPKPTPDCCVGFKQVLDTSPACFCLLIKD  74

Query  475  SNDPSLDIKINATLALGLPDRC--STPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
             NDPSL ++IN T +L LP  C  +T A+IS+CP  L+LAPNS +A++F    ++   +N
Sbjct  75   RNDPSLGLQINVTRSLTLPQVCKVTTKASISDCPAALHLAPNSTEAQIFTQIGDT--KAN  132

Query  649  TTSPA  663
            +T+P+
Sbjct  133  STAPS  137



>ref|XP_010554897.1| PREDICTED: protein YLS3 [Tarenaya hassleriana]
Length=178

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 94/156 (60%), Gaps = 18/156 (12%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            SDL +D   C + +  L+ CL +V+ EAKAP   CCS LK  +DK  +++CLC LVKD +
Sbjct  23   SDLTQDIKGCEDAMSDLSSCLPFVTREAKAPDPTCCSSLKKEIDKGQTKRCLCTLVKDRD  82

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DPSL  K++A LA+ LP  C  PAN+S+CPELL+L  +S DA++F+ ++ S++ +     
Sbjct  83   DPSLGFKVDANLAMSLPSICHVPANVSQCPELLHLPLDSADARIFKQFSGSSQNNGM---  139

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGL  768
                     G A SS V     KRKR V V   +G+
Sbjct  140  --------GGVAASSSV-----KRKRPVAVWFRVGM  162



>ref|XP_006492819.1| PREDICTED: protein YLS3-like isoform X1 [Citrus sinensis]
Length=178

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 93/162 (57%), Gaps = 10/162 (6%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G   SD  K +  C ++L   + CL +V G+AK+P+  CCS +     K+RKCLCLLVKD
Sbjct  25   GFVRSDFNKGRKGCGDQLADFSACLPFVGGKAKSPSPTCCSSITKEGSKTRKCLCLLVKD  84

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             N+P    K+NATLAL LP     PA +S+CP LLNL PNS DA+V +  A ++ G+N+T
Sbjct  85   RNEPRHGFKMNATLALSLPSVRHAPATVSDCPALLNLPPNSTDAQVVEQLAANSGGNNST  144

Query  655  SPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
            +  A V  S           S+  K +R   +  A+ L+L +
Sbjct  145  AVTAVVPSS----------SSNTVKGRRWRGMVCAVSLWLVI  176



>ref|XP_006369481.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
 gb|ERP66050.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
Length=125

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +1

Query  319  KDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDI  498
            KD  ECAE+L  LA CL YV G+AKAPT DCC+GLK VL  ++KCLC+++KD NDP L +
Sbjct  33   KDSEECAEQLVGLATCLPYVGGDAKAPTPDCCNGLKQVLKDNKKCLCVIIKDRNDPELGL  92

Query  499  KINATLALGLPDRCSTPANISECP  570
            KINATLAL LP  C  PAN+S+CP
Sbjct  93   KINATLALSLPSVCHAPANVSQCP  116



>gb|KDO70843.1| hypothetical protein CISIN_1g043293mg, partial [Citrus sinensis]
Length=147

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G   SD  K +  C ++L   + CL +V G+AK+P+  CCS +     K+RKCLCLLVKD
Sbjct  25   GFVRSDFNKGRKGCGDQLADFSACLPFVGGKAKSPSPTCCSSITKEGSKTRKCLCLLVKD  84

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             N+P    K+NATLAL LP     PA +S+CP LLNL PNS DA+V +  A ++ G+N+T
Sbjct  85   RNEPRHGFKMNATLALSLPSVRHAPATVSDCPALLNLPPNSTDAQVVEQLAANSGGNNST  144

Query  655  S  657
            +
Sbjct  145  A  145



>gb|EYU27162.1| hypothetical protein MIMGU_mgv1a0260443mg, partial [Erythranthe 
guttata]
Length=89

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D AK+KAEC E L  LA CL YV G AK+PT DCC+GLK +L  ++KCLC+++KD NDP 
Sbjct  3    DNAKEKAECTESLVGLATCLPYVGGTAKSPTPDCCAGLKQLLKTNKKCLCVIIKDRNDPD  62

Query  490  LDIKINATLALGLPDRCSTPANISECP  570
            L + IN TLALGLP  C+ PANISECP
Sbjct  63   LGLDINVTLALGLPTACNAPANISECP  89



>gb|EMT29098.1| hypothetical protein F775_26764 [Aegilops tauschii]
Length=144

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +1

Query  385  EAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIKINATLALGLPDRCSTPANISE  564
            E +APT DCC GLK VL  S KCLC+LVKD +DP LD+K+N T ALGLP  CS PANIS+
Sbjct  7    EGQAPTPDCCGGLKTVLQTSPKCLCVLVKDRDDPGLDLKLNVTRALGLPAACSAPANISD  66

Query  565  CPELLNLAPNSPDAKVFQDYANS  633
            CP LLNL PNS DA+VF+ +A  
Sbjct  67   CPRLLNLPPNSKDAEVFEQFAKQ  89



>ref|XP_006492820.1| PREDICTED: protein YLS3-like isoform X2 [Citrus sinensis]
Length=177

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G   SD  K +  C ++L   + CL +V G+AK+P+  CCS +     K+RKCLCLLVKD
Sbjct  25   GFVRSDFNKGRKGCGDQLADFSACLPFVGGKAKSPSPTCCSSITKEGSKTRKCLCLLVKD  84

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             N+P    K+NATLAL LP     PA +S+CP LLNL PNS DA+V +  A ++ G+N+T
Sbjct  85   RNEPRHGFKMNATLALSLPSVRHAPATVSDCPALLNLPPNSTDAQVVEQLAANSGGNNST  144

Query  655  S  657
            +
Sbjct  145  A  145



>ref|XP_011086771.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=197

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = +1

Query  304  SSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSND  483
            +++L +D+ ECAE+L  LA C+ +VSG AK PT++CC   K V     KCLC+L+K+S+D
Sbjct  26   AANLEEDEKECAEQLTNLAACIPFVSGTAKQPTKECCDDTKKVKTAQPKCLCVLIKESSD  85

Query  484  PSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQ-DYANSAKGSNTTSP  660
            PS+ + IN TLAL +P  C+  A +S+CP LLNL  +SPDAK+F+   A+S+ G++  SP
Sbjct  86   PSMGLPINTTLALQMPAACNIDAKVSDCPSLLNLPADSPDAKIFKVGNADSSTGASADSP  145

Query  661  A  663
            +
Sbjct  146  S  146



>ref|XP_006651927.1| PREDICTED: protein YLS3-like [Oryza brachyantha]
Length=220

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = +1

Query  331  ECAEKLGALAPCLGYVS--GEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIKI  504
            ECA+KL  LA CL +V     A+APT+DCC+GL  V+  S+KCLC+LVKD ++P+L  +I
Sbjct  44   ECADKLMGLATCLTFVEEKATARAPTRDCCAGLGQVVAGSKKCLCVLVKDRDEPALGFRI  103

Query  505  NATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
            N T A+ LP  CS PA  S+CP+LLN++ +S +A++F+ YA   + S+
Sbjct  104  NVTRAMDLPSLCSIPATFSDCPKLLNISSDSKEAEIFKQYAREHESSD  151



>gb|KDO35899.1| hypothetical protein CISIN_1g039949mg, partial [Citrus sinensis]
Length=147

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 77/121 (64%), Gaps = 0/121 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G  SSD  + + EC ++L   + CL +V G+AK+PT  CCS +     K+RKCLCLLVKD
Sbjct  25   GFVSSDFNQGRKECGDQLADFSACLPFVGGKAKSPTPTCCSNITKEGSKTRKCLCLLVKD  84

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTT  654
             NDP    K+NATLAL LP     PA +S+CP LLN   N  DA+V +  A ++ G+N+T
Sbjct  85   RNDPRHGFKMNATLALSLPSVRHAPAKVSDCPALLNPPSNPTDAQVLEQLAANSGGNNST  144

Query  655  S  657
            +
Sbjct  145  T  145



>ref|XP_008242742.1| PREDICTED: protein YLS3-like [Prunus mume]
Length=197

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = +1

Query  313  LAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSL  492
            +  D+ ECAE++  LA C+ +VSG AK PT +CC   K V     KCLC+L+K+S DPS+
Sbjct  24   MEDDENECAEQMATLAACIPFVSGTAKKPTPECCENTKKVKANKPKCLCVLIKESTDPSM  83

Query  493  DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
             + +N TLAL +P  C+    IS+CP +L L PNSPDAK+F++    A  ++TTSP
Sbjct  84   GLPVNTTLALQMPSACNIDGKISDCPSILKLPPNSPDAKIFKE----ADSNSTTSP  135



>ref|XP_010088879.1| hypothetical protein L484_020867 [Morus notabilis]
 gb|EXB37076.1| hypothetical protein L484_020867 [Morus notabilis]
Length=199

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +1

Query  313  LAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSL  492
            +A D+ +CA++LG LA C+ +VSG AK PT +CC   + V +   KCLC+L+K+S DPS+
Sbjct  25   MADDEKDCADQLGNLASCIPFVSGTAKKPTPECCEDTRKVKETKPKCLCVLIKESTDPSV  84

Query  493  DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQD  621
             + IN TLAL +P  C+  A +S+CP +LNL PNSPDAK+F +
Sbjct  85   GLPINTTLALQMPSACNIDAKVSDCPSILNLPPNSPDAKIFSE  127



>ref|XP_007203697.1| hypothetical protein PRUPE_ppa022009mg [Prunus persica]
 gb|EMJ04896.1| hypothetical protein PRUPE_ppa022009mg [Prunus persica]
Length=207

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = +1

Query  313  LAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSL  492
            +  D+ ECAE++  LA C+ +VSG AK PT +CC   K V     KCLC+L+K S DPS+
Sbjct  24   MEDDENECAEQMATLAACIPFVSGTAKKPTPECCENTKKVKANKPKCLCVLIKQSTDPSM  83

Query  493  DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
             + +N TLAL +P  C+    IS+CP +L L PNSPDAK+F++    A  ++TTSP
Sbjct  84   SLPVNTTLALQMPSACNIDGKISDCPSILKLPPNSPDAKIFKE----ADSNSTTSP  135



>ref|XP_010934241.1| PREDICTED: protein YLS3-like isoform X2 [Elaeis guineensis]
Length=157

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 1/92 (1%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            ASSD A D+AECA+++  L+ CL Y+ G A+APT DCCS LK V+DKS KCLC+LVKD N
Sbjct  27   ASSDYASDRAECADQVIKLSTCLTYMQGSARAPTPDCCSSLKQVVDKSFKCLCILVKDRN  86

Query  481  DPSL-DIKINATLALGLPDRCSTPANISECPE  573
            +P L   K+N T AL LP +C  PAN S CP 
Sbjct  87   EPELASFKVNVTFALRLPSKCGVPANASACPR  118



>gb|AAM63806.1| unknown [Arabidopsis thaliana]
Length=165

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 83/129 (64%), Gaps = 5/129 (4%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            S+L++D   C + +  L  CL +V+ +AKAP   CCS LK  +DK  +RKCLC LVKD +
Sbjct  17   SELSQDIKGCQDAMSDLYSCLPFVTNKAKAPDSTCCSTLKVKIDKGQTRKCLCTLVKDRD  76

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK---GSNT  651
            DP L  K++A  A+ LP  C  PANIS+CP+LL+L P+SP +++F+ +  S+    G   
Sbjct  77   DPGLGFKVDANRAMSLPSACHVPANISQCPDLLHLLPDSPASQIFKQFTESSSQTVGHKA  136

Query  652  TSPAAPVKG  678
             S ++ +KG
Sbjct  137  VSTSSSIKG  145



>ref|NP_191414.1| protease inhibitor/(LTP) family protein [Arabidopsis thaliana]
 emb|CAB68193.1| putative protein [Arabidopsis thaliana]
 dbj|BAC43656.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|AAO39966.1| At3g58550 [Arabidopsis thaliana]
 gb|AEE79798.1| protease inhibitor/(LTP) family protein [Arabidopsis thaliana]
Length=177

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 83/129 (64%), Gaps = 5/129 (4%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            S+L++D   C + +  L  CL +V+ +AKAP   CCS LK  +DK  +RKCLC LVKD +
Sbjct  29   SELSQDIKGCQDAMSDLYSCLPFVTNKAKAPDSTCCSTLKVKIDKGQTRKCLCTLVKDRD  88

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK---GSNT  651
            DP L  K++A  A+ LP  C  PANIS+CP+LL+L P+SP +++F+ +  S+    G   
Sbjct  89   DPGLGFKVDANRAMSLPSACHVPANISQCPDLLHLLPDSPASQIFKQFTESSSQTVGHKA  148

Query  652  TSPAAPVKG  678
             S ++ +KG
Sbjct  149  VSTSSSIKG  157



>ref|XP_009138957.1| PREDICTED: protein YLS3 [Brassica rapa]
Length=173

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            SDL +D   C + +  L  CL +V+ +AKAP   CC+ LK  LDK  +++CLC LVKD +
Sbjct  25   SDLNQDIKGCQDSMSDLYSCLHFVTNKAKAPDSTCCTTLKEKLDKGQTKRCLCTLVKDRD  84

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK---GSNT  651
            DP L  K++A  A+ LP  C  PANI++CPELL+L P+S  AK+F+ +  S+    G   
Sbjct  85   DPGLGFKVDANRAMSLPSACHVPANITQCPELLHLPPDSAAAKIFKQFTESSSQNVGHKA  144

Query  652  TSPAAPVKG  678
             S ++ VKG
Sbjct  145  VSTSSSVKG  153



>ref|XP_006476107.1| PREDICTED: protein YLS3-like [Citrus sinensis]
 gb|KDO80428.1| hypothetical protein CISIN_1g041699mg [Citrus sinensis]
Length=203

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +1

Query  322  DKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIK  501
            D+ ECAE+L  LA C+ +VSG AK PT +CC   + +     KCLC+L+K+S DPS+ + 
Sbjct  28   DEQECAEQLTNLASCIPFVSGTAKKPTSECCQDTQKLKASKPKCLCVLIKESTDPSMGLP  87

Query  502  INATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQD  621
            IN TLAL +P  C+  A++S CP+LLNLAP+SPDAK+F++
Sbjct  88   INTTLALQMPAACNIDASVSSCPKLLNLAPDSPDAKIFKE  127



>ref|XP_010516504.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=178

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 83/129 (64%), Gaps = 5/129 (4%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            SDL +D   C + +  L  CL YVS +AKAP   CCS LK  +DK  +++CLC LVKD +
Sbjct  29   SDLNQDIKGCQDAMSDLYSCLPYVSNKAKAPDSTCCSKLKVNIDKGQTKRCLCTLVKDRD  88

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK--GSNTT  654
            DP L  K++A  A+ LP  C  PANIS+CPELL+L  NSPD+++F+ +  S++  G    
Sbjct  89   DPGLGFKVDANRAMSLPSACHVPANISKCPELLHLPLNSPDSQIFKQFTESSQNVGHKVV  148

Query  655  SP-AAPVKG  678
            S  +A +KG
Sbjct  149  SKSSASIKG  157



>ref|NP_001132744.1| putative bifunctional inhibitor/LTP/seed storage protein family 
precursor [Zea mays]
 gb|ACF81727.1| unknown [Zea mays]
 tpg|DAA43567.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=211

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D++ DK ECA++L  LAPCL YV G+A+AP  DCC GL+ VL KS KCLC+LVKD +DP+
Sbjct  25   DMSADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  84

Query  490  LDIKINATLALGLPDRC-STPANISEC  567
            L IKINATLAL LP+ C +T AN+S C
Sbjct  85   LGIKINATLALALPNACGATRANVSHC  111



>gb|ACN27466.1| unknown [Zea mays]
 tpg|DAA43566.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=247

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D++ DK ECA++L  LAPCL YV G+A+AP  DCC GL+ VL KS KCLC+LVKD +DP+
Sbjct  25   DMSADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  84

Query  490  LDIKINATLALGLPDRC-STPANISEC  567
            L IKINATLAL LP+ C +T AN+S C
Sbjct  85   LGIKINATLALALPNACGATRANVSHC  111



>gb|EYU31694.1| hypothetical protein MIMGU_mgv1a0143491mg, partial [Erythranthe 
guttata]
 gb|EYU31695.1| hypothetical protein MIMGU_mgv1a0143491mg, partial [Erythranthe 
guttata]
Length=111

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G A  D+ KDK +CA +L  ++ CL YV GEAKAP+ DCC+G K VL  + +C+C+L+KD
Sbjct  18   GIAKCDIEKDKEKCANELLGISTCLPYVGGEAKAPSMDCCTGFKQVLRDNIECICILIKD  77

Query  475  SNDPSLDIKINATLALGLPDRCSTPAN--ISECP  570
             +DPSL +KINATLALGLP RC  P N  + +CP
Sbjct  78   RDDPSLGLKINATLALGLPTRCHAPTNQTVQDCP  111



>ref|XP_010506349.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=186

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 90/160 (56%), Gaps = 3/160 (2%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D AK++ +C E+  ++  CL Y+ G+AK+PT  CCSGLK +LD  + C+C++++D NDP+
Sbjct  27   DKAKNEEQCREERLSMGTCLPYMKGQAKSPTPVCCSGLKQILDSEKNCICVIIQDRNDPA  86

Query  490  LDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQ--DYANSAKGSNTTSPA  663
            L ++IN +L+  LP  C   A++++CP  L+L P SP+A+VF   D      G  +  P+
Sbjct  87   LGLQINISLSYTLPSVCHVTADVAKCPAFLHLDPKSPEAQVFYLIDQVLHKIGLASDPPS  146

Query  664  APVKGSPSGGATSSDVKSDGCKRKRLV-EVNVAMGLFLYV  780
             P    P     S        KR  +V    V   +F+ V
Sbjct  147  VPPTAGPDNNNNSGRTTHLFGKRWLVVAHFFVIFCIFILV  186



>ref|XP_006295054.1| hypothetical protein CARUB_v10024122mg [Capsella rubella]
 gb|EOA27952.1| hypothetical protein CARUB_v10024122mg [Capsella rubella]
Length=191

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 91/164 (55%), Gaps = 2/164 (1%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
            G    D AK++ +C E+  ++A CL Y+ G+AK+PT  CCSGLK +LD  + C+C++++D
Sbjct  24   GGGEEDKAKNEEQCTEEKLSMAKCLPYMKGQAKSPTPVCCSGLKQILDSDKNCICVIIQD  83

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQ--DYANSAKGSN  648
             NDP+L ++IN +L+  LP  C   A++++CP  L+L   SP+A+VF   D A    G  
Sbjct  84   RNDPALGLQINISLSYTLPSACHVTADVAKCPAFLHLDEKSPEAQVFYQIDQALHKMGLA  143

Query  649  TTSPAAPVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
            +  P+ P         +       G +   L++V     +  Y+
Sbjct  144  SDPPSGPPTAGSDNNNSGRTTHFFGKRWLGLIKVVAHFFVMFYI  187



>emb|CDP03376.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = +1

Query  301  ASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSN  480
            A + + +D+ +CA++L  LA C+ YVSG+ K PT +CC   K V     KCLC+L+K+S 
Sbjct  22   AVATIQEDEKDCADQLTNLAACIPYVSGDEKIPTPECCEDTKKVKSAKPKCLCVLIKEST  81

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQ  618
            DPS+ + IN TLAL +P  C   A +S+CP +LNLAP+SPDAK+F+
Sbjct  82   DPSMGLPINTTLALKMPSACKIDAKVSDCPSILNLAPDSPDAKIFE  127



>ref|XP_006451053.1| hypothetical protein CICLE_v10010697mg [Citrus clementina]
 gb|ESR64293.1| hypothetical protein CICLE_v10010697mg [Citrus clementina]
Length=203

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +1

Query  322  DKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSLDIK  501
            D+ ECAE+L  LA C+ +VSG AK PT +CC   + +      CLC+L+K+S DPS+ + 
Sbjct  28   DEQECAEQLTNLASCIPFVSGTAKKPTSECCQDTQKLKASKPNCLCVLIKESTDPSMGLP  87

Query  502  INATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQD  621
            IN TLAL +P  C+  A++S CP+LLNLAP+SPDAK+F++
Sbjct  88   INTTLALQMPAACNIDASVSSCPKLLNLAPDSPDAKIFKE  127



>gb|KDP32327.1| hypothetical protein JCGZ_13252 [Jatropha curcas]
Length=200

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +1

Query  313  LAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSL  492
            L +D+ +CA++L  LA C+ +VSG AK PT +CC   + +     KCLC+L+K+S+DPS+
Sbjct  25   LQQDEQDCADQLTNLASCIPFVSGTAKKPTPECCQDTQKLKSTKPKCLCVLIKESSDPSV  84

Query  493  DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTS  657
             + +N TLAL +P  C+  A +S+CP +LNL P+SPDAK+F++ A  +  + T+S
Sbjct  85   GLPVNTTLALQMPSVCNIDAKVSDCPTILNLPPDSPDAKIFKEAAGISDSTTTSS  139



>ref|XP_002878226.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54485.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=177

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 79/130 (61%), Gaps = 3/130 (2%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            S+L++D   C E +  L  CL +VS +AKAP   CCS LK  +DK  ++KCLC LVKD +
Sbjct  29   SELSQDIKGCQEAMSDLYSCLPFVSNKAKAPDSTCCSTLKAKIDKGQTKKCLCTLVKDRD  88

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L  K++   A+ LP  C  PANIS+CP+LL+L P+SP +++F+ + N +   N    
Sbjct  89   DPGLGFKVDGNRAMSLPSACHVPANISQCPDLLHLLPDSPASQIFKQF-NESSSQNVGHK  147

Query  661  AAPVKGSPSG  690
            A     S  G
Sbjct  148  AVSTSSSSKG  157



>ref|XP_006292695.1| hypothetical protein CARUB_v10018941mg [Capsella rubella]
 gb|EOA25593.1| hypothetical protein CARUB_v10018941mg [Capsella rubella]
Length=171

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 82/129 (64%), Gaps = 4/129 (3%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            SDL +D   C + +  L  CL +V+ +AKAP   CCS LK  +DK  ++KCLC LVKD +
Sbjct  24   SDLKQDLKGCQDAMSDLYSCLPFVTNKAKAPDSTCCSTLKVNIDKGQTKKCLCTLVKDRD  83

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK--GSNTT  654
            DP L  K++A  A+ LP  C  PANIS+CPELL+L  +SP +++F+ +  S++  G    
Sbjct  84   DPGLGFKVDANRAMSLPSACHVPANISKCPELLHLPLDSPASQIFKQFTESSQNVGHKAV  143

Query  655  SPAAPVKGS  681
            S +  +KGS
Sbjct  144  SKSTSIKGS  152



>ref|XP_010518027.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=187

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D AK++ +C E+  ++  CL Y+ G+AK+PT  CCSGLK +LD  +KC+C++++D NDP+
Sbjct  27   DKAKNEEQCREERLSMGTCLPYMKGQAKSPTPGCCSGLKQILDSEKKCICVIIQDRNDPA  86

Query  490  LDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVF  615
            L ++IN +L+  LP  C   A++++CP  L+L P SP+A+VF
Sbjct  87   LGLQINISLSYTLPSVCHVTADVAKCPAFLHLDPKSPEAQVF  128



>ref|XP_002515567.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF47016.1| lipid binding protein, putative [Ricinus communis]
Length=188

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +1

Query  313  LAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSL  492
            L +D+ +CA++L  LA C+ YVSG AK PT  CC   + V     KCLC+L+K+S DPS+
Sbjct  25   LQQDEQDCADQLTNLASCIPYVSGTAKNPTPQCCQDTQKVKASKPKCLCVLIKESTDPSM  84

Query  493  DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQD  621
             + +N TLAL +P  C+  A +S+CP +LNL P+SPDAK+F++
Sbjct  85   GLPVNTTLALHMPSACNIDAEVSDCPSILNLPPDSPDAKIFKE  127



>ref|XP_006402776.1| hypothetical protein EUTSA_v10006273mg [Eutrema salsugineum]
 gb|ESQ44229.1| hypothetical protein EUTSA_v10006273mg [Eutrema salsugineum]
Length=172

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            S+L +D   C + L  L  CL +V+ +AKAP   CC+ LK +LDK  +++CLC LVKD +
Sbjct  25   SELNQDIKGCQDSLSDLYSCLPFVTSKAKAPDSTCCTTLKEILDKGQTKRCLCTLVKDRD  84

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK--GSNTT  654
            DP L  K+ A  A+ LP  C  P NIS+CPELL+L P+S  A++F+ +  S++  G    
Sbjct  85   DPGLGFKVEANRAMSLPSTCHVPTNISQCPELLHLPPDSLAAQIFKQFTESSQNVGPRAA  144

Query  655  SPAAPVKG  678
            S    VKG
Sbjct  145  STGLSVKG  152



>ref|XP_010504811.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=179

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 76/115 (66%), Gaps = 2/115 (2%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            SDL +D   C + +  L  CL YVS +AKAP   CCS LK  +DK  +++CLC LVKD +
Sbjct  29   SDLNQDIKGCQDAMSDLYSCLPYVSNKAKAPDSTCCSKLKVNIDKGQTKRCLCTLVKDRD  88

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGS  645
            DP L  K++A  A+ LP  C  PANIS+CPELL+L  NSP +++F+ +  S++ +
Sbjct  89   DPGLGFKVDANRAMSLPSACHVPANISKCPELLHLPLNSPASQIFKQFTESSQNA  143



>ref|XP_002281585.1| PREDICTED: protein YLS3 [Vitis vinifera]
Length=194

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +1

Query  313  LAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSL  492
            +  D+ +CA++L  LA C+ +VSG AK PTQ CC   + V     KCLC+L+K+S DPSL
Sbjct  25   MEDDEKDCADQLTNLAACIPFVSGTAKKPTQQCCQDTQKVKSSKPKCLCVLIKESTDPSL  84

Query  493  DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
             + +N TLAL +P  C+  A +S+CP LL+L P+S DAK+F++  +SA+ S 
Sbjct  85   GLPVNTTLALQMPSACNIDAKVSDCPTLLSLPPDSADAKIFKEADSSAESST  136



>ref|XP_010508310.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=185

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (57%), Gaps = 2/159 (1%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D AK++ +C E+  ++  CL Y+ G+AK+PT  CCSGLK +LD  + C+C++++D NDP+
Sbjct  27   DKAKNEEQCKEERLSMGTCLPYMKGQAKSPTPVCCSGLKQILDSEKNCICVIIQDRNDPA  86

Query  490  LDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQ--DYANSAKGSNTTSPA  663
            L ++IN +L+  LP  C   A++++CP  L+L P SP+A+VF   D A    G  +  P+
Sbjct  87   LGLQINISLSYTLPSVCHVTADVAKCPAFLHLDPKSPEAQVFFQIDQALHKIGLASDPPS  146

Query  664  APVKGSPSGGATSSDVKSDGCKRKRLVEVNVAMGLFLYV  780
             P         +    +  G +   +    V   +F+ +
Sbjct  147  VPPTAGSDNNNSGRTTQFFGKQWLVVAHFFVIFCIFILL  185



>ref|XP_007013274.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY30893.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=199

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +1

Query  313  LAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSL  492
            +  D+ ECA++L  LA C+ +VSG A  PT  CC   + V     KCLC+L+K+S DPS+
Sbjct  26   MQDDEKECADQLANLASCIAFVSGTATKPTLQCCQDTQKVKATKPKCLCVLIKESTDPSM  85

Query  493  DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQD  621
             + +N TLAL +P  CS  A +S+CP +LNL P+SPDAK+F++
Sbjct  86   GLPVNTTLALQMPSACSIDAKVSDCPTILNLPPDSPDAKIFEE  128



>ref|XP_008809013.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=192

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = +1

Query  295  GPASSDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKD  474
             P  + L +D+ ECA++L  LAPC+ YVSG A  PT +CC+  + V     KCLC+L+ +
Sbjct  20   APCQATLEEDEKECADQLQNLAPCVPYVSGSAPKPTPECCADAEKVRASQPKCLCVLIVE  79

Query  475  SNDPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQD  621
            S DPSL + IN TLAL +P  C++ A +S CP +L L P+SP+A++F+D
Sbjct  80   STDPSLALPINTTLALHMPAACNSDAKVSNCPSILKLNPSSPEARIFKD  128



>ref|XP_004985579.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
isoform X1 [Setaria italica]
Length=266

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +1

Query  310  DLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPS  489
            D+  D+ ECA++L  LAPCL YV G+A+AP  DCC GL+ VL KS KCLC+LVKD +DP+
Sbjct  26   DMNADRTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  85

Query  490  LDIKINATLALGLPDRC-STPANISECPELLN  582
            L IKINATLAL LP  C +T AN S C   L+
Sbjct  86   LGIKINATLALALPSACGATRANASHCARKLH  117



>ref|XP_006402775.1| hypothetical protein EUTSA_v10006273mg [Eutrema salsugineum]
 gb|ESQ44228.1| hypothetical protein EUTSA_v10006273mg [Eutrema salsugineum]
Length=171

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 74/113 (65%), Gaps = 2/113 (2%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            S+L +D   C + L  L  CL +V+ +AKAP   CC+ LK +LDK  +++CLC LVKD +
Sbjct  25   SELNQDIKGCQDSLSDLYSCLPFVTSKAKAPDSTCCTTLKEILDKGQTKRCLCTLVKDRD  84

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK  639
            DP L  K+ A  A+ LP  C  P NIS+CPELL+L P+S  A++F+ +  S++
Sbjct  85   DPGLGFKVEANRAMSLPSTCHVPTNISQCPELLHLPPDSLAAQIFKQFTESSQ  137



>ref|XP_010427760.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=180

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            SDL +D   C + +  L  CL YVS +AKAP   CCS LK  +DK  +++CLC LVKD +
Sbjct  29   SDLNQDIKGCQDAMSDLYSCLPYVSNKAKAPDSTCCSKLKVNIDKGQTKRCLCTLVKDRD  88

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN----  648
            DP L  K++A  A+ LP  C  PANIS+CPELL+L  +SP +++F+ +  S++ +     
Sbjct  89   DPGLGFKVDANRAMSLPSACHVPANISKCPELLHLPLDSPASQIFKQFTESSQNAEHKDK  148

Query  649  -TTSPAAPVKG  678
              +  +A +KG
Sbjct  149  AVSKSSASIKG  159



>emb|CDY00571.1| BnaC04g23540D [Brassica napus]
Length=134

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 4/115 (3%)
 Frame = +1

Query  346  LGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSNDPSLDIKINATLA  519
            +  L  CL +V+ +AKAP   CC+ LK  LDK  +++CLC LVKD +DP L  K++A  A
Sbjct  1    MSDLYSCLPFVTNKAKAPDSTCCTTLKEKLDKGQTKRCLCTLVKDRDDPGLGFKVDANRA  60

Query  520  LGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAK--GSNTTSPAAPVKG  678
            + LP  C  PANIS+CPELL+L P+S  AK+F+ +  S++  G    S ++ VKG
Sbjct  61   MSLPSTCHVPANISQCPELLHLPPDSVAAKIFKQFTESSQNVGHKAVSTSSSVKG  115



>ref|XP_009104149.1| PREDICTED: protein YLS3-like [Brassica rapa]
Length=172

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 83/148 (56%), Gaps = 13/148 (9%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            SDL  D   C + +  L  CL +V+ +AKAP   CC+ LK  +DK  +++CLC LVKD +
Sbjct  25   SDLNLDIKGCQDSMSDLYSCLPFVTSKAKAPDSTCCTTLKEKIDKGQTKRCLCTLVKDRD  84

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L  K++A  A+ LP  C  PANIS+CPELL+L P+S  AK+F+ +  + +       
Sbjct  85   DPGLGFKVDANRAMSLPSTCHVPANISQCPELLHLPPDSVAAKIFKQFTEALQNVE----  140

Query  661  AAPVKGSPSGGATSSDVKSDGCKRKRLV  744
                   P    TSS VK    K+  LV
Sbjct  141  -------PRAVPTSSSVKRRDTKQFGLV  161



>emb|CBI28121.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +1

Query  313  LAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDKSRKCLCLLVKDSNDPSL  492
            +  D+ +CA++L  LA C+ +VSG AK PTQ CC   + V     KCLC+L+K+S DPSL
Sbjct  65   MEDDEKDCADQLTNLAACIPFVSGTAKKPTQQCCQDTQKVKSSKPKCLCVLIKESTDPSL  124

Query  493  DIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSN  648
             + +N TLAL +P  C+  A +S+CP LL+L P+S DAK+F++  +SA+ S 
Sbjct  125  GLPVNTTLALQMPSACNIDAKVSDCPTLLSLPPDSADAKIFKEADSSAESST  176



>emb|CDX98302.1| BnaC06g16630D [Brassica napus]
Length=176

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 78/130 (60%), Gaps = 4/130 (3%)
 Frame = +1

Query  307  SDLAKDKAECAEKLGALAPCLGYVSGEAKAPTQDCCSGLKGVLDK--SRKCLCLLVKDSN  480
            SDL +D   C + +  L  CL +V+ +AKAP   CC+ LK  ++K  +++CLC LVKD +
Sbjct  29   SDLNQDIKGCQDSMSDLYSCLPFVTSKAKAPDSTCCTTLKEKINKGQTKRCLCTLVKDRD  88

Query  481  DPSLDIKINATLALGLPDRCSTPANISECPELLNLAPNSPDAKVFQDYANSAKGSNTTSP  660
            DP L  K++A  A+ LP  C  PANIS+CPELL+L P+S  AK+F+ +    +  N    
Sbjct  89   DPGLGFKVDANRAMSLPSTCHVPANISQCPELLHLPPDSVAAKIFKQFTEGLQ--NVEPR  146

Query  661  AAPVKGSPSG  690
            A P   S  G
Sbjct  147  AVPTSSSVKG  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2058090802196