BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c90514_g1_i1 len=678 path=[656:0-677]

Length=678
                                                                      Score     E

gb|KEH36510.1|  receptor-interacting protein, putative                  160   5e-46   
ref|XP_004485701.1|  PREDICTED: uncharacterized protein LOC101497320    161   5e-46   
ref|XP_003545825.1|  PREDICTED: uncharacterized protein LOC100783932    160   8e-46   
gb|ACU19806.1|  unknown                                                 160   1e-45   Glycine max [soybeans]
ref|XP_010277918.1|  PREDICTED: uncharacterized protein LOC104612259    159   2e-45   
ref|XP_002304996.2|  hypothetical protein POPTR_0004s03340g             159   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011001146.1|  PREDICTED: uncharacterized protein LOC105108514    158   7e-45   
ref|XP_010087917.1|  hypothetical protein L484_002782                   156   1e-44   
ref|XP_010327230.1|  PREDICTED: uncharacterized protein LOC104649495    156   2e-44   
ref|XP_009761687.1|  PREDICTED: uncharacterized protein LOC104213836    155   9e-44   
ref|XP_006352595.1|  PREDICTED: uncharacterized protein LOC102591571    155   1e-43   
ref|XP_007135619.1|  hypothetical protein PHAVU_010G144100g             154   1e-43   
ref|XP_011043313.1|  PREDICTED: uncharacterized protein LOC105138792    154   2e-43   
ref|XP_009600049.1|  PREDICTED: uncharacterized protein LOC104095603    154   2e-43   
ref|XP_010646355.1|  PREDICTED: uncharacterized protein LOC104878183    154   2e-43   
ref|XP_002317247.2|  hypothetical protein POPTR_0011s04140g             154   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011086134.1|  PREDICTED: uncharacterized protein LOC105167940    153   3e-43   
ref|XP_008224931.1|  PREDICTED: uncharacterized protein LOC103324628    153   7e-43   
emb|CBI40860.3|  unnamed protein product                                155   9e-43   
gb|AFK40448.1|  unknown                                                 151   2e-42   
ref|XP_007213395.1|  hypothetical protein PRUPE_ppa026297mg             151   3e-42   
ref|XP_006467907.1|  PREDICTED: uncharacterized protein LOC102631200    150   6e-42   
emb|CDX79062.1|  BnaA01g11290D                                          150   6e-42   
ref|XP_009137194.1|  PREDICTED: uncharacterized protein LOC103861233    150   6e-42   
ref|XP_009134779.1|  PREDICTED: uncharacterized protein LOC103859048    150   6e-42   
emb|CDX98686.1|  BnaA03g44710D                                          150   6e-42   
emb|CDX82824.1|  BnaC01g12740D                                          150   7e-42   
emb|CDX94038.1|  BnaC07g36720D                                          150   7e-42   
ref|XP_010065470.1|  PREDICTED: uncharacterized protein LOC104452696    150   7e-42   
ref|XP_009374718.1|  PREDICTED: uncharacterized protein LOC103963582    150   9e-42   
ref|XP_002524693.1|  conserved hypothetical protein                     149   1e-41   Ricinus communis
ref|XP_003543091.1|  PREDICTED: uncharacterized protein LOC100784070    149   1e-41   
ref|XP_006449201.1|  hypothetical protein CICLE_v10017095mg             149   2e-41   
gb|KFK28727.1|  hypothetical protein AALP_AA7G039300                    149   3e-41   
ref|XP_006413778.1|  hypothetical protein EUTSA_v10026468mg             149   3e-41   
ref|NP_680733.1|  uncharacterized protein                               149   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841849.1|  hypothetical protein AMTR_s00003p00270950          148   5e-41   
ref|XP_002869887.1|  hypothetical protein ARALYDRAFT_492739             148   5e-41   
ref|XP_009399209.1|  PREDICTED: uncharacterized protein LOC103983...    148   5e-41   
ref|XP_010905552.1|  PREDICTED: uncharacterized protein LOC105032...    147   6e-41   
ref|XP_006284699.1|  hypothetical protein CARUB_v10005959mg             148   6e-41   
ref|XP_010449059.1|  PREDICTED: uncharacterized protein LOC104731395    148   6e-41   
ref|XP_010434178.1|  PREDICTED: uncharacterized protein LOC104718186    148   7e-41   
ref|XP_008355986.1|  PREDICTED: uncharacterized protein LOC103419665    147   1e-40   
ref|XP_004134733.1|  PREDICTED: uncharacterized protein LOC101211873    145   6e-40   
emb|CDP17922.1|  unnamed protein product                                146   7e-40   
ref|XP_008661704.1|  PREDICTED: uncharacterized protein LOC100275...    144   1e-39   
ref|NP_001143161.1|  uncharacterized protein LOC100275650               144   2e-39   Zea mays [maize]
ref|XP_008661699.1|  PREDICTED: uncharacterized protein LOC100275...    144   2e-39   
ref|XP_002447177.1|  hypothetical protein SORBIDRAFT_06g029910          144   2e-39   Sorghum bicolor [broomcorn]
ref|XP_008661701.1|  PREDICTED: uncharacterized protein LOC100275...    144   2e-39   
ref|XP_008439915.1|  PREDICTED: uncharacterized protein LOC103484560    144   2e-39   
ref|XP_008661702.1|  PREDICTED: uncharacterized protein LOC100275...    144   2e-39   
ref|XP_010538258.1|  PREDICTED: uncharacterized protein LOC104812675    144   2e-39   
ref|XP_006652881.1|  PREDICTED: uncharacterized protein LOC102722207    144   3e-39   
ref|XP_010686269.1|  PREDICTED: uncharacterized protein LOC104900536    142   1e-38   
gb|EMT03270.1|  hypothetical protein F775_32363                         142   1e-38   
ref|XP_003580636.1|  PREDICTED: uncharacterized protein LOC100842097    142   2e-38   
ref|NP_001054010.1|  Os04g0635700                                       141   5e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976957.1|  PREDICTED: uncharacterized protein LOC101774...    140   5e-38   
emb|CAH67654.1|  H0410G08.9                                             140   5e-38   Oryza sativa [red rice]
ref|XP_004976958.1|  PREDICTED: uncharacterized protein LOC101774...    140   5e-38   
ref|XP_010439474.1|  PREDICTED: uncharacterized protein LOC104722915    140   9e-38   
dbj|BAK06439.1|  predicted protein                                      139   3e-37   
gb|ABQ42033.1|  putative receptor-interacting protein                   129   3e-34   Sonneratia alba
gb|ABQ42035.1|  putative receptor-interacting protein                   129   4e-34   Sonneratia ovata
gb|ABQ42034.1|  putative receptor-interacting protein                   129   4e-34   Sonneratia caseolaris
gb|ABQ42036.1|  putative receptor-interacting protein                   129   6e-34   Sonneratia apetala
ref|XP_006285716.1|  hypothetical protein CARUB_v10007187mg             120   6e-31   
ref|XP_010905553.1|  PREDICTED: uncharacterized protein LOC105032...    117   2e-29   
gb|KHN08589.1|  Vesicle-associated protein 4-2                          111   2e-25   
ref|XP_002969271.1|  hypothetical protein SELMODRAFT_69311              104   4e-25   
ref|XP_007025819.1|  Uncharacterized protein TCM_030007                 104   1e-23   
ref|WP_015145947.1|  hypothetical protein                             80.5    5e-16   
ref|WP_013323184.1|  hypothetical protein                             77.4    6e-15   
ref|WP_026721842.1|  hypothetical protein                             75.9    2e-14   
ref|WP_009633028.1|  hypothetical protein                             75.9    3e-14   
ref|WP_002736270.1|  hypothetical protein                             75.5    3e-14   
ref|WP_024969855.1|  hypothetical protein                             75.5    3e-14   
ref|WP_019497426.1|  hypothetical protein                             75.5    3e-14   
ref|WP_002754699.1|  hypothetical protein                             75.1    4e-14   
ref|WP_015228977.1|  hypothetical protein                             75.1    4e-14   
ref|WP_015955070.1|  hypothetical protein                             75.1    4e-14   
ref|WP_011317306.1|  hypothetical protein                             75.1    5e-14   
ref|WP_002794861.1|  hypothetical protein                             74.7    7e-14   
ref|WP_015130438.1|  hypothetical protein                             74.7    7e-14   
ref|WP_017303101.1|  hypothetical protein                             74.7    7e-14   
ref|WP_010996646.1|  hypothetical protein                             74.7    7e-14   
ref|WP_002746191.1|  MULTISPECIES: hypothetical protein               74.3    8e-14   
ref|WP_006511097.1|  hypothetical protein                             73.9    1e-13   
ref|WP_026731383.1|  hypothetical protein                             73.6    2e-13   
ref|WP_017655183.1|  hypothetical protein                             73.6    2e-13   
ref|WP_026072465.1|  hypothetical protein                             73.2    2e-13   
ref|WP_017322265.1|  hypothetical protein                             73.2    2e-13   
ref|WP_012411123.1|  hypothetical protein                             73.2    2e-13   
ref|WP_015211231.1|  hypothetical protein                             72.4    4e-13   
ref|WP_015154065.1|  hypothetical protein                             72.4    4e-13   
ref|WP_039714291.1|  hypothetical protein                             72.4    5e-13   
ref|WP_015226197.1|  hypothetical protein                             72.0    5e-13   
ref|WP_006194428.1|  hypothetical protein                             72.0    6e-13   
ref|WP_039741129.1|  hypothetical protein                             72.0    7e-13   
ref|WP_029632974.1|  hypothetical protein [                           71.6    9e-13   
ref|WP_015190663.1|  hypothetical protein                             71.2    1e-12   
ref|WP_015140223.1|  hypothetical protein                             70.9    1e-12   
ref|WP_016868018.1|  hypothetical protein                             70.9    1e-12   
ref|WP_006101849.1|  hypothetical protein                             71.2    2e-12   
ref|WP_015184213.1|  hypothetical protein                             70.5    2e-12   
ref|WP_018400762.1|  hypothetical protein                             70.5    2e-12   
ref|WP_035990849.1|  hypothetical protein                             70.5    2e-12   
ref|WP_017309176.1|  hypothetical protein                             70.5    2e-12   
ref|WP_009458252.1|  MULTISPECIES: hypothetical protein               70.1    2e-12   
ref|WP_017316118.1|  hypothetical protein                             70.1    3e-12   
ref|WP_015194587.1|  hypothetical protein                             69.7    3e-12   
ref|WP_038081932.1|  hypothetical protein                             69.3    4e-12   
ref|WP_026135052.1|  hypothetical protein                             69.3    5e-12   
ref|WP_006277479.1|  hypothetical protein                             69.3    6e-12   
ref|WP_016863448.1|  hypothetical protein                             68.9    7e-12   
ref|WP_015112306.1|  hypothetical protein                             68.9    7e-12   
ref|WP_015199509.1|  hypothetical protein                             68.2    1e-11   
ref|WP_009545926.1|  MULTISPECIES: hypothetical protein               68.2    1e-11   
ref|WP_012593787.1|  MULTISPECIES: hypothetical protein               67.8    2e-11   
ref|WP_008278531.1|  hypothetical protein                             67.4    2e-11   
ref|WP_016876441.1|  hypothetical protein                             67.4    3e-11   
ref|WP_027843137.1|  hypothetical protein                             67.4    3e-11   
ref|WP_009343211.1|  hypothetical protein                             67.0    3e-11   
ref|WP_008313079.1|  hypothetical protein                             67.0    4e-11   
ref|WP_015213827.1|  hypothetical protein                             67.0    4e-11   
ref|WP_036485938.1|  hypothetical protein                             65.9    7e-11   
ref|WP_035154705.1|  hypothetical protein                             65.9    9e-11   
ref|WP_007306397.1|  hypothetical protein                             65.9    1e-10   
ref|WP_039200507.1|  hypothetical protein                             65.5    1e-10   
ref|WP_024546229.1|  hypothetical protein                             65.1    2e-10   
ref|WP_012306999.1|  hypothetical protein                             65.1    2e-10   
ref|WP_015151530.1|  hypothetical protein                             64.7    2e-10   
ref|WP_015132581.1|  hypothetical protein                             64.7    2e-10   
ref|WP_030006577.1|  hypothetical protein                             63.9    3e-10   
ref|WP_015218105.1|  hypothetical protein                             63.5    6e-10   
ref|WP_015122733.1|  hypothetical protein                             63.5    7e-10   
ref|WP_008236066.1|  hypothetical protein                             63.2    7e-10   
ref|WP_028082502.1|  hypothetical protein                             63.2    7e-10   
ref|WP_039725466.1|  hypothetical protein                             63.5    8e-10   
ref|WP_006530311.1|  hypothetical protein                             63.2    8e-10   
ref|WP_015166455.1|  hypothetical protein                             62.8    1e-09   
ref|WP_015222869.1|  hypothetical protein                             62.8    1e-09   
ref|WP_019501895.1|  hypothetical protein                             64.3    1e-09   
ref|WP_015080923.1|  hypothetical protein                             62.8    1e-09   
ref|WP_013190240.1|  hypothetical protein                             62.8    1e-09   
ref|WP_015169309.1|  hypothetical protein                             62.0    2e-09   
ref|WP_027402419.1|  hypothetical protein                             62.0    2e-09   
ref|WP_016951204.1|  hypothetical protein                             61.2    4e-09   
gb|AIE74266.1|  hypothetical protein D082_17380                       59.3    2e-08   
ref|WP_019506344.1|  hypothetical protein                             58.5    4e-08   
ref|WP_010874268.1|  hypothetical protein                             57.8    6e-08   
ref|WP_036531402.1|  hypothetical protein                             57.8    7e-08   
ref|WP_006515511.1|  hypothetical protein                             57.8    8e-08   
ref|XP_009399210.1|  PREDICTED: uncharacterized protein LOC103983...  55.5    1e-07   
ref|WP_015157718.1|  hypothetical protein                             57.4    1e-07   
ref|WP_023074237.1|  hypothetical protein                             56.2    3e-07   
ref|WP_006455894.1|  hypothetical protein                             56.2    3e-07   
ref|WP_022604816.1|  hypothetical protein                             55.8    7e-07   
ref|XP_010905554.1|  PREDICTED: uncharacterized protein LOC105032...  55.8    7e-07   
ref|XP_010905555.1|  PREDICTED: uncharacterized protein LOC105032...  55.5    8e-07   
ref|WP_009628284.1|  hypothetical protein                             55.5    2e-06   
ref|WP_017294235.1|  hypothetical protein                             53.1    3e-06   
ref|WP_015122813.1|  hypothetical protein                             49.7    1e-04   
ref|WP_017717489.1|  hypothetical protein                             49.3    2e-04   
ref|WP_009787485.1|  hypothetical protein                             48.1    5e-04   
ref|WP_007353115.1|  MULTISPECIES: hypothetical protein               48.1    5e-04   



>gb|KEH36510.1| receptor-interacting protein, putative [Medicago truncatula]
Length=140

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RRTFLTLEEAGLVE+SGL  HERFLCRLTISSLNLLKVISEQEGCPIEELNAG++CDWFL
Sbjct  57   RRTFLTLEEAGLVEMSGLSTHERFLCRLTISSLNLLKVISEQEGCPIEELNAGKVCDWFL  116

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN++SAVLQWD S+FQF
Sbjct  117  KDKLKREQNIDSAVLQWDDSDFQF  140



>ref|XP_004485701.1| PREDICTED: uncharacterized protein LOC101497320 [Cicer arietinum]
Length=141

 Score =   161 bits (407),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RRTFLTLEEAGLVE+SGL  HERFLCRLTISSLNLLKVISEQEGCPIEELNAG++CDWFL
Sbjct  58   RRTFLTLEEAGLVELSGLSTHERFLCRLTISSLNLLKVISEQEGCPIEELNAGKVCDWFL  117

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN++SAVLQWD S+FQF
Sbjct  118  KDKLKREQNIDSAVLQWDDSDFQF  141



>ref|XP_003545825.1| PREDICTED: uncharacterized protein LOC100783932 [Glycine max]
Length=137

 Score =   160 bits (405),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 91/114 (80%), Gaps = 7/114 (6%)
 Frame = +2

Query  227  VLAPLKRPRNLRVKasssgagaggegqnssRRTFLTLEEAGLVEISGLDAHERFLCRLTI  406
            ++AP K  R ++VK S +            RRTFLTLEEAGLVEISGL  HERFLCRLTI
Sbjct  31   LIAPRKTSRRIQVKCSGAENKGE-------RRTFLTLEEAGLVEISGLSTHERFLCRLTI  83

Query  407  SSLNLLKVISEQEGCPIEELNAGRICDWFLKDKLKREQNLESAVLQWDSSEFQF  568
            SSLNLL+VISEQEGCPIEELNA +ICDWFLKDKLKREQNL SAVLQWD SEFQF
Sbjct  84   SSLNLLRVISEQEGCPIEELNAAKICDWFLKDKLKREQNLGSAVLQWDDSEFQF  137



>gb|ACU19806.1| unknown [Glycine max]
Length=137

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 91/114 (80%), Gaps = 7/114 (6%)
 Frame = +2

Query  227  VLAPLKRPRNLRVKasssgagaggegqnssRRTFLTLEEAGLVEISGLDAHERFLCRLTI  406
            ++AP K  R ++VK S +            RRTFLTLEEAGLVEISGL  HERFLCRLTI
Sbjct  31   LIAPRKTSRRIQVKCSGAENKGE-------RRTFLTLEEAGLVEISGLSTHERFLCRLTI  83

Query  407  SSLNLLKVISEQEGCPIEELNAGRICDWFLKDKLKREQNLESAVLQWDSSEFQF  568
            SSLNLL+VISEQEGCPIEELNA +ICDWFLKDKLKREQNL SAVLQWD SEFQF
Sbjct  84   SSLNLLRVISEQEGCPIEELNAAKICDWFLKDKLKREQNLGSAVLQWDVSEFQF  137



>ref|XP_010277918.1| PREDICTED: uncharacterized protein LOC104612259 [Nelumbo nucifera]
Length=136

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FLTLEEAGLVEISGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGRICDWFL
Sbjct  53   RRSFLTLEEAGLVEISGLSTHERFLCRLTISSLNLLRVISEQEGLPIEELNAGRICDWFL  112

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQNLESAVLQWD SEFQF
Sbjct  113  KDKLKREQNLESAVLQWDDSEFQF  136



>ref|XP_002304996.2| hypothetical protein POPTR_0004s03340g [Populus trichocarpa]
 gb|EEE85507.2| hypothetical protein POPTR_0004s03340g [Populus trichocarpa]
Length=139

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 103/149 (69%), Gaps = 10/149 (7%)
 Frame = +2

Query  122  MNALKLYKLGNQHALLSWsysaaprsparvprayTVLAPLKRPRNLRVKasssgagagge  301
            M++LKLY+  +Q   L         +  +     T  AP K  R  R K +  G      
Sbjct  1    MSSLKLYRSYHQSPFLP--------NVHKKMVKETTFAPNKVVR--RRKLAVRGCSGQES  50

Query  302  gqnssRRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRI  481
             + +  R+FL+LEEAGLVEISGL  HERFLCRLTISSLNLL+V+SEQEGCPIEELNAGR+
Sbjct  51   EKKTGSRSFLSLEEAGLVEISGLSTHERFLCRLTISSLNLLRVVSEQEGCPIEELNAGRV  110

Query  482  CDWFLKDKLKREQNLESAVLQWDSSEFQF  568
            CDWFLKDKLKREQN+ESAVLQWD SE QF
Sbjct  111  CDWFLKDKLKREQNMESAVLQWDDSELQF  139



>ref|XP_011001146.1| PREDICTED: uncharacterized protein LOC105108514 [Populus euphratica]
Length=139

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 103/149 (69%), Gaps = 10/149 (7%)
 Frame = +2

Query  122  MNALKLYKLGNQHALLSWsysaaprsparvprayTVLAPLKRPRNLRVKasssgagagge  301
            M++LKLY+  +Q   +         +  +     T  AP K  R  R K +  G      
Sbjct  1    MSSLKLYRSYHQSLFIP--------NVHKKMVKQTTFAPNKVVR--RRKLAVRGCSGQES  50

Query  302  gqnssRRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRI  481
             + +  R+FL+LEEAGLVEISGL  HERFLCRLTISSLNLL+V+SEQEGCPIEELNAGR+
Sbjct  51   EKKTGSRSFLSLEEAGLVEISGLSTHERFLCRLTISSLNLLRVVSEQEGCPIEELNAGRV  110

Query  482  CDWFLKDKLKREQNLESAVLQWDSSEFQF  568
            CDWFLKDKLKREQN+ESAVLQWD SE QF
Sbjct  111  CDWFLKDKLKREQNIESAVLQWDDSELQF  139



>ref|XP_010087917.1| hypothetical protein L484_002782 [Morus notabilis]
 gb|EXB30591.1| hypothetical protein L484_002782 [Morus notabilis]
Length=111

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR FL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEGCPIEELNAGR+CDWF+
Sbjct  28   RRNFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGCPIEELNAGRVCDWFV  87

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN++SAVLQWD SEFQF
Sbjct  88   KDKLKREQNIDSAVLQWDDSEFQF  111



>ref|XP_010327230.1| PREDICTED: uncharacterized protein LOC104649495 [Solanum lycopersicum]
Length=139

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RRTFLTLEEAGLVE+SGL  HERFLCRLTISSLNLLKVI EQEGC IEELNAG+ICDWFL
Sbjct  56   RRTFLTLEEAGLVEVSGLSTHERFLCRLTISSLNLLKVIGEQEGCSIEELNAGKICDWFL  115

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQNL+SAVLQWD S+FQ 
Sbjct  116  KDKLKREQNLDSAVLQWDESDFQL  139



>ref|XP_009761687.1| PREDICTED: uncharacterized protein LOC104213836 [Nicotiana sylvestris]
Length=138

 Score =   155 bits (391),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FLTLEEAGLVE+SGL  HERFLCRLTISSLNLL+VI+EQEGC IEELNAGRICDWFL
Sbjct  55   RRSFLTLEEAGLVEVSGLSTHERFLCRLTISSLNLLRVIAEQEGCSIEELNAGRICDWFL  114

Query  497  KDKLKREQNLESAVLQWDSSEFQ  565
            KDKLKREQNL+SAVLQWD S+FQ
Sbjct  115  KDKLKREQNLDSAVLQWDESDFQ  137



>ref|XP_006352595.1| PREDICTED: uncharacterized protein LOC102591571 [Solanum tuberosum]
Length=139

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RRTFLTLEEAGLVE+SGL  HERFLCRLTISSLNLL+VI+EQEGC IEELNAG++CDWFL
Sbjct  56   RRTFLTLEEAGLVEVSGLSTHERFLCRLTISSLNLLRVIAEQEGCSIEELNAGKVCDWFL  115

Query  497  KDKLKREQNLESAVLQWDSSEFQ  565
            KDKLKREQNL+SAVLQWD S+FQ
Sbjct  116  KDKLKREQNLDSAVLQWDESDFQ  138



>ref|XP_007135619.1| hypothetical protein PHAVU_010G144100g [Phaseolus vulgaris]
 gb|ESW07613.1| hypothetical protein PHAVU_010G144100g [Phaseolus vulgaris]
Length=138

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            R+ FLT+EEAGLVEISGL  HERFLCRLTISSLNLL+VISEQEGCPIEELNA ++CDWFL
Sbjct  55   RQVFLTMEEAGLVEISGLSTHERFLCRLTISSLNLLRVISEQEGCPIEELNAAKVCDWFL  114

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQNL SAVLQWD SEFQF
Sbjct  115  KDKLKREQNLGSAVLQWDESEFQF  138



>ref|XP_011043313.1| PREDICTED: uncharacterized protein LOC105138792 [Populus euphratica]
Length=139

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+LEEAGLVE+SGL  HERFLCRLTISSLNLL VISEQEGC IEELNAGR+CDWFL
Sbjct  56   RRSFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLSVISEQEGCTIEELNAGRVCDWFL  115

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN+ESAVLQWD SE QF
Sbjct  116  KDKLKREQNIESAVLQWDDSELQF  139



>ref|XP_009600049.1| PREDICTED: uncharacterized protein LOC104095603 [Nicotiana tomentosiformis]
Length=137

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FLTLEEAGLVE+SGL  HERFLCRLTISSLNLL+VI+EQEGC IEELNAGRICDWFL
Sbjct  54   RRSFLTLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVIAEQEGCSIEELNAGRICDWFL  113

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQNLESAVLQWD S+F  
Sbjct  114  KDKLKREQNLESAVLQWDESDFHL  137



>ref|XP_010646355.1| PREDICTED: uncharacterized protein LOC104878183 [Vitis vinifera]
Length=160

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FLTLEEAGLVE+SGL  HERFLCRLTISSLNLL+VI+EQEGC IEELNAG++CDWF+
Sbjct  77   RRSFLTLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVIAEQEGCSIEELNAGKVCDWFV  136

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQNLESAVL+WD SEFQF
Sbjct  137  KDKLKREQNLESAVLKWDDSEFQF  160



>ref|XP_002317247.2| hypothetical protein POPTR_0011s04140g [Populus trichocarpa]
 gb|EEE97859.2| hypothetical protein POPTR_0011s04140g [Populus trichocarpa]
Length=139

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+LEEAGLVE+SG+  HERFLCRLTISSLNLL+VISEQEGC IEELNAGR+CDWFL
Sbjct  56   RRSFLSLEEAGLVEMSGISTHERFLCRLTISSLNLLRVISEQEGCTIEELNAGRVCDWFL  115

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN+ESAVLQWD SE QF
Sbjct  116  KDKLKREQNIESAVLQWDDSELQF  139



>ref|XP_011086134.1| PREDICTED: uncharacterized protein LOC105167940 [Sesamum indicum]
Length=137

 Score =   153 bits (387),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+LEEAGLVEISGL  HERFLCRLTISSLNLL+VISEQEGC IE+LNAGRICDWFL
Sbjct  54   RRSFLSLEEAGLVEISGLSTHERFLCRLTISSLNLLRVISEQEGCRIEDLNAGRICDWFL  113

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQNLESAVLQWD SEF
Sbjct  114  KDKLKREQNLESAVLQWDDSEF  135



>ref|XP_008224931.1| PREDICTED: uncharacterized protein LOC103324628 [Prunus mume]
Length=150

 Score =   153 bits (386),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +2

Query  227  VLAPLKRPRNLRVKasssgagaggegqnssRRTFLTLEEAGLVEISGLDAHERFLCRLTI  406
            +L+P KR   +R  +S  G  A  E  +  RR FLTLEEAGLVEISGL  HERFLCRLTI
Sbjct  38   ILSPHKRKLGVRASSSGQGGEAAEEKSSE-RRPFLTLEEAGLVEISGLSTHERFLCRLTI  96

Query  407  SSLNLLKVISEQEGCPIEELNAGRICDWFLKDKLKREQNLESAVLQW-DSSEF  562
            SSLNLL+VISEQEGCPIEELNAG++CDWF+KDKLKREQNL+SAVLQW DSSEF
Sbjct  97   SSLNLLRVISEQEGCPIEELNAGKVCDWFVKDKLKREQNLDSAVLQWDDSSEF  149



>emb|CBI40860.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   155 bits (392),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FLTLEEAGLVE+SGL  HERFLCRLTISSLNLL+VI+EQEGC IEELNAG++CDWF+
Sbjct  145  RRSFLTLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVIAEQEGCSIEELNAGKVCDWFV  204

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQNLESAVL+WD SEFQF
Sbjct  205  KDKLKREQNLESAVLKWDDSEFQF  228



>gb|AFK40448.1| unknown [Lotus japonicus]
Length=138

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RRTFLTLEEAGLVEISGL  HERFLCRLTISSLNLL+VISEQEGC IEELNAG++CDWFL
Sbjct  55   RRTFLTLEEAGLVEISGLSTHERFLCRLTISSLNLLRVISEQEGCSIEELNAGKVCDWFL  114

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN++SAVLQWD S   F
Sbjct  115  KDKLKREQNIDSAVLQWDDSNLPF  138



>ref|XP_007213395.1| hypothetical protein PRUPE_ppa026297mg [Prunus persica]
 gb|EMJ14594.1| hypothetical protein PRUPE_ppa026297mg [Prunus persica]
Length=150

 Score =   151 bits (382),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +2

Query  227  VLAPLKRPRNLRVKasssgagaggegqnssRRTFLTLEEAGLVEISGLDAHERFLCRLTI  406
            +L+P KR  ++R  +S  G  A  +  +  RR FLTLEEAGLVEISGL  HERFLCRLTI
Sbjct  38   ILSPNKRKLSVRASSSGQGGEAAEKKSSE-RRPFLTLEEAGLVEISGLSTHERFLCRLTI  96

Query  407  SSLNLLKVISEQEGCPIEELNAGRICDWFLKDKLKREQNLESAVLQWDSS  556
            SSLNLL+VISEQEGCPIEELNAG++CDWF+KDKLKREQNL+SAVLQWD S
Sbjct  97   SSLNLLRVISEQEGCPIEELNAGKVCDWFVKDKLKREQNLDSAVLQWDDS  146



>ref|XP_006467907.1| PREDICTED: uncharacterized protein LOC102631200 [Citrus sinensis]
Length=144

 Score =   150 bits (380),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +R+FL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VI+EQEGC IEELNAGRICDWFL
Sbjct  61   KRSFLSLEEAGLVEVSGLRTHERFLCRLTISSLNLLRVIAEQEGCSIEELNAGRICDWFL  120

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDK++REQN ESAVLQWD S+FQF
Sbjct  121  KDKMRREQNSESAVLQWDDSDFQF  144



>emb|CDX79062.1| BnaA01g11290D [Brassica napus]
Length=155

 Score =   150 bits (380),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FLTL EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWF 
Sbjct  72   RRSFLTLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFF  131

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN+ESAVLQWD  +F F
Sbjct  132  KDKLKREQNMESAVLQWDDPDFPF  155



>ref|XP_009137194.1| PREDICTED: uncharacterized protein LOC103861233 [Brassica rapa]
Length=152

 Score =   150 bits (380),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWFL
Sbjct  69   RRSFLSLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFL  128

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN+ESAVLQWD  +F F
Sbjct  129  KDKLKREQNMESAVLQWDDPDFPF  152



>ref|XP_009134779.1| PREDICTED: uncharacterized protein LOC103859048 [Brassica rapa]
Length=155

 Score =   150 bits (380),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FLTL EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWF 
Sbjct  72   RRSFLTLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFF  131

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN+ESAVLQWD  +F F
Sbjct  132  KDKLKREQNMESAVLQWDDPDFPF  155



>emb|CDX98686.1| BnaA03g44710D [Brassica napus]
Length=152

 Score =   150 bits (380),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWFL
Sbjct  69   RRSFLSLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFL  128

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN+ESAVLQWD  +F F
Sbjct  129  KDKLKREQNMESAVLQWDDPDFPF  152



>emb|CDX82824.1| BnaC01g12740D [Brassica napus]
Length=152

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +R+FLTL EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWFL
Sbjct  69   KRSFLTLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFL  128

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN+ESAVLQWD  +F F
Sbjct  129  KDKLKREQNMESAVLQWDDPDFPF  152



>emb|CDX94038.1| BnaC07g36720D [Brassica napus]
Length=152

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWFL
Sbjct  69   RRSFLSLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFL  128

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQN+ESAVLQWD  +F F
Sbjct  129  KDKLKREQNMESAVLQWDDPDFPF  152



>ref|XP_010065470.1| PREDICTED: uncharacterized protein LOC104452696 [Eucalyptus grandis]
 gb|KCW62971.1| hypothetical protein EUGRSUZ_G00569 [Eucalyptus grandis]
Length=157

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FLTLEEAGL+EISGL  HERFLCRLTISSLNLL+V++EQEGC IEELNAGR+CDWFL
Sbjct  74   RRSFLTLEEAGLIEISGLSTHERFLCRLTISSLNLLRVVAEQEGCAIEELNAGRVCDWFL  133

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQ+ ESAVLQWD S+FQ 
Sbjct  134  KDKLKREQSPESAVLQWDDSDFQL  157



>ref|XP_009374718.1| PREDICTED: uncharacterized protein LOC103963582 [Pyrus x bretschneideri]
Length=140

 Score =   150 bits (378),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 89/113 (79%), Gaps = 4/113 (4%)
 Frame = +2

Query  224  TVLAPLKRPRNLRVKasssgagaggegqnssRRTFLTLEEAGLVEISGLDAHERFLCRLT  403
            TV AP    R L V+ASS    A  +     RR FLTLEEAGLVEISGL  HERFLCRLT
Sbjct  31   TVFAPCTHERRLGVRASSGKGEAEKKE----RRPFLTLEEAGLVEISGLSTHERFLCRLT  86

Query  404  ISSLNLLKVISEQEGCPIEELNAGRICDWFLKDKLKREQNLESAVLQWDSSEF  562
            ISSLNLL+VISEQEGC IEELNAG++CDWF+KDKLKREQNL+SAVLQWD SE 
Sbjct  87   ISSLNLLRVISEQEGCEIEELNAGKVCDWFVKDKLKREQNLDSAVLQWDDSEL  139



>ref|XP_002524693.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37712.1| conserved hypothetical protein [Ricinus communis]
Length=113

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+LEEAGLVEISGL  HERFLCRLTISSLNLL+VISE+EGC IEELNAG+ICDWF+
Sbjct  30   RRSFLSLEEAGLVEISGLSTHERFLCRLTISSLNLLRVISEEEGCAIEELNAGKICDWFV  89

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKRE+N++SAVLQWD SE QF
Sbjct  90   KDKLKREENIDSAVLQWDDSELQF  113



>ref|XP_003543091.1| PREDICTED: uncharacterized protein LOC100784070 [Glycine max]
Length=140

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 79/84 (94%), Gaps = 1/84 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            RTFLTLEEAGLVEISGL  HERFLCRLTISSLNLL+VISEQEGCPIEELNA +ICDWFLK
Sbjct  57   RTFLTLEEAGLVEISGLSTHERFLCRLTISSLNLLRVISEQEGCPIEELNAAKICDWFLK  116

Query  500  DKLKREQNLESAVLQW-DSSEFQF  568
            DKLKREQNL SAVLQW D+S+++F
Sbjct  117  DKLKREQNLGSAVLQWDDNSDYKF  140



>ref|XP_006449201.1| hypothetical protein CICLE_v10017095mg [Citrus clementina]
 gb|ESR62441.1| hypothetical protein CICLE_v10017095mg [Citrus clementina]
Length=144

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +R+FL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VI+EQEGC IEELNAGRICDWFL
Sbjct  61   KRSFLSLEEAGLVEVSGLRTHERFLCRLTISSLNLLRVIAEQEGCSIEELNAGRICDWFL  120

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDK++R+QN ESAVLQWD S+FQF
Sbjct  121  KDKMRRDQNSESAVLQWDDSDFQF  144



>gb|KFK28727.1| hypothetical protein AALP_AA7G039300 [Arabis alpina]
Length=153

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWFL
Sbjct  70   RRSFLSLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFL  129

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKRE N+ESAVLQWD  +F F
Sbjct  130  KDKLKREHNIESAVLQWDDPDFPF  153



>ref|XP_006413778.1| hypothetical protein EUTSA_v10026468mg [Eutrema salsugineum]
 gb|ESQ55231.1| hypothetical protein EUTSA_v10026468mg [Eutrema salsugineum]
Length=154

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWFL
Sbjct  71   RRSFLSLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFL  130

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKRE N+ESAVLQWD  +F F
Sbjct  131  KDKLKREHNIESAVLQWDDPDFPF  154



>ref|NP_680733.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL48254.1|AF451324_1 putative receptor-interacting protein [Arabidopsis thaliana]
 gb|ABR46186.1| At4g21445 [Arabidopsis thaliana]
 gb|AEE84452.1| uncharacterized protein AT4G21445 [Arabidopsis thaliana]
Length=154

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWFL
Sbjct  71   RRSFLSLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFL  130

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKRE N+ESAVLQWD  +F F
Sbjct  131  KDKLKREHNIESAVLQWDDPDFPF  154



>ref|XP_006841849.1| hypothetical protein AMTR_s00003p00270950 [Amborella trichopoda]
 gb|ERN03524.1| hypothetical protein AMTR_s00003p00270950 [Amborella trichopoda]
Length=142

 Score =   148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +R+FL+LEEAGLVE+SGLD HERFLCRLTISSLNLL+VISE+EG PIEELNAGRICDWF+
Sbjct  59   KRSFLSLEEAGLVEMSGLDTHERFLCRLTISSLNLLRVISEEEGFPIEELNAGRICDWFV  118

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQ+++SAVLQWD+ +FQ 
Sbjct  119  KDKLKREQDIDSAVLQWDNPDFQL  142



>ref|XP_002869887.1| hypothetical protein ARALYDRAFT_492739 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46146.1| hypothetical protein ARALYDRAFT_492739 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AID21641.1| At4g21445p-like protein [Arabidopsis lyrata]
 gb|AID21666.1| At4g21445p-like protein [Arabidopsis lyrata]
Length=153

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWFL
Sbjct  70   RRSFLSLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFL  129

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKRE N+ESAVLQWD  +F F
Sbjct  130  KDKLKREHNIESAVLQWDDPDFPF  153



>ref|XP_009399209.1| PREDICTED: uncharacterized protein LOC103983676 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=137

 Score =   148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+LEEAGLVE+SGL+ HERFLCRLTISSLNLL+VISEQEG PIEELNAGR+CDWFL
Sbjct  54   RRSFLSLEEAGLVEMSGLNTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRLCDWFL  113

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQ+L SAV+QWD S+ QF
Sbjct  114  KDKLKREQDLGSAVIQWDDSDSQF  137



>ref|XP_010905552.1| PREDICTED: uncharacterized protein LOC105032725 isoform X1 [Elaeis 
guineensis]
Length=135

 Score =   147 bits (372),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +R+FL+LEEAGLVEISGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGRICDW+L
Sbjct  54   KRSFLSLEEAGLVEISGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRICDWYL  113

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQ+ ESAVLQWD S+F
Sbjct  114  KDKLKREQDAESAVLQWDDSDF  135



>ref|XP_006284699.1| hypothetical protein CARUB_v10005959mg [Capsella rubella]
 gb|EOA17597.1| hypothetical protein CARUB_v10005959mg [Capsella rubella]
Length=148

 Score =   148 bits (373),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG+ICDWFL
Sbjct  65   RRSFLSLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCSIEELNAGKICDWFL  124

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKRE N+ESAVLQWD  +F F
Sbjct  125  KDKLKREHNIESAVLQWDDPDFPF  148



>ref|XP_010449059.1| PREDICTED: uncharacterized protein LOC104731395 [Camelina sativa]
Length=152

 Score =   148 bits (373),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG++CDWFL
Sbjct  69   RRSFLSLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCTIEELNAGKVCDWFL  128

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKRE N+ESAVLQWD  +F F
Sbjct  129  KDKLKREHNIESAVLQWDDPDFPF  152



>ref|XP_010434178.1| PREDICTED: uncharacterized protein LOC104718186 [Camelina sativa]
Length=152

 Score =   148 bits (373),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L EAGLVEISGL AHE+FLCRLTISSLNLL+VISEQEGC IEELNAG++CDWFL
Sbjct  69   RRSFLSLAEAGLVEISGLGAHEKFLCRLTISSLNLLRVISEQEGCTIEELNAGKVCDWFL  128

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKRE N+ESAVLQWD  +F F
Sbjct  129  KDKLKREHNIESAVLQWDDPDFPF  152



>ref|XP_008355986.1| PREDICTED: uncharacterized protein LOC103419665 [Malus domestica]
Length=144

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR FLTLEEAGLVEISGL  HERFLCRLTISSLNLL+VISEQEGC IEELNAG++CDWF+
Sbjct  62   RRPFLTLEEAGLVEISGLSTHERFLCRLTISSLNLLRVISEQEGCEIEELNAGKVCDWFV  121

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQNL+SAVLQWD SE 
Sbjct  122  KDKLKREQNLDSAVLQWDDSEL  143



>ref|XP_004134733.1| PREDICTED: uncharacterized protein LOC101211873 [Cucumis sativus]
 ref|XP_004155584.1| PREDICTED: uncharacterized LOC101211873 [Cucumis sativus]
 gb|KGN49180.1| hypothetical protein Csa_6G516880 [Cucumis sativus]
Length=144

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFLT+EEAGLVE+SGL  HERFLCRLTISSLNLLKVI+E+E C IEELNAGR+CDWFL
Sbjct  61   KRTFLTIEEAGLVEVSGLSTHERFLCRLTISSLNLLKVIAEEEKCSIEELNAGRLCDWFL  120

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQNL+SAVLQWD S+  F
Sbjct  121  KDKLKREQNLDSAVLQWDDSDPLF  144



>emb|CDP17922.1| unnamed protein product [Coffea canephora]
Length=176

 Score =   146 bits (368),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+LEEAGLVE+SGL  HERFLCRLT+SSLNLLKVI+EQEGC IEELNAGR+CDWFL
Sbjct  66   RRSFLSLEEAGLVEVSGLSPHERFLCRLTVSSLNLLKVIAEQEGCAIEELNAGRVCDWFL  125

Query  497  KDKLKREQNLESAVLQW  547
            KDKLKREQNLESAVLQW
Sbjct  126  KDKLKREQNLESAVLQW  142



>ref|XP_008661704.1| PREDICTED: uncharacterized protein LOC100275650 isoform X1 [Zea 
mays]
 ref|XP_008661705.1| PREDICTED: uncharacterized protein LOC100275650 isoform X7 [Zea 
mays]
Length=151

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGR+CDWFL
Sbjct  70   KRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRVCDWFL  129

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQN+ +AVLQWD   F
Sbjct  130  KDKLKREQNVGTAVLQWDDPGF  151



>ref|NP_001143161.1| uncharacterized protein LOC100275650 [Zea mays]
 gb|ACG29449.1| hypothetical protein [Zea mays]
 gb|ACG38642.1| hypothetical protein [Zea mays]
Length=153

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGR+CDWFL
Sbjct  72   KRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRVCDWFL  131

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQN+ +AVLQWD   F
Sbjct  132  KDKLKREQNVGTAVLQWDDPGF  153



>ref|XP_008661699.1| PREDICTED: uncharacterized protein LOC100275650 isoform X2 [Zea 
mays]
 ref|XP_008661700.1| PREDICTED: uncharacterized protein LOC100275650 isoform X3 [Zea 
mays]
 gb|AFW56933.1| hypothetical protein ZEAMMB73_155091 [Zea mays]
Length=157

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGR+CDWFL
Sbjct  76   KRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRVCDWFL  135

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQN+ +AVLQWD   F
Sbjct  136  KDKLKREQNVGTAVLQWDDPGF  157



>ref|XP_002447177.1| hypothetical protein SORBIDRAFT_06g029910 [Sorghum bicolor]
 gb|EES11505.1| hypothetical protein SORBIDRAFT_06g029910 [Sorghum bicolor]
Length=160

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGR+CDWFL
Sbjct  79   KRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRVCDWFL  138

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQN+ +AVLQWD   F
Sbjct  139  KDKLKREQNIGTAVLQWDDPGF  160



>ref|XP_008661701.1| PREDICTED: uncharacterized protein LOC100275650 isoform X4 [Zea 
mays]
Length=156

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGR+CDWFL
Sbjct  75   KRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRVCDWFL  134

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQN+ +AVLQWD   F
Sbjct  135  KDKLKREQNVGTAVLQWDDPGF  156



>ref|XP_008439915.1| PREDICTED: uncharacterized protein LOC103484560 [Cucumis melo]
Length=144

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFLT+EEAGLVE+SGL  HERFLCRLTISSLNLL+VI+E+E C IEELNAGR+CDWFL
Sbjct  61   KRTFLTIEEAGLVEVSGLSTHERFLCRLTISSLNLLRVIAEEEKCSIEELNAGRLCDWFL  120

Query  497  KDKLKREQNLESAVLQWDSSE  559
            KDKLKREQNL+SAVLQWD S+
Sbjct  121  KDKLKREQNLDSAVLQWDDSD  141



>ref|XP_008661702.1| PREDICTED: uncharacterized protein LOC100275650 isoform X5 [Zea 
mays]
 ref|XP_008661703.1| PREDICTED: uncharacterized protein LOC100275650 isoform X6 [Zea 
mays]
Length=152

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGR+CDWFL
Sbjct  71   KRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRVCDWFL  130

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQN+ +AVLQWD   F
Sbjct  131  KDKLKREQNVGTAVLQWDDPGF  152



>ref|XP_010538258.1| PREDICTED: uncharacterized protein LOC104812675 [Tarenaya hassleriana]
Length=140

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL++EEAGLVEISGL AHE+FLCRLTISSLNLL+VI EQEGC +EELNAG+ICDWFL
Sbjct  57   RRSFLSIEEAGLVEISGLGAHEKFLCRLTISSLNLLRVIGEQEGCRMEELNAGKICDWFL  116

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKREQ+ +SAVLQWD  +F F
Sbjct  117  KDKLKREQDFDSAVLQWDDPDFPF  140



>ref|XP_006652881.1| PREDICTED: uncharacterized protein LOC102722207 [Oryza brachyantha]
Length=173

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            R TFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGR+CDWFL
Sbjct  92   RMTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRVCDWFL  151

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQN+ +AVLQWD   F
Sbjct  152  KDKLKREQNVGTAVLQWDDPGF  173



>ref|XP_010686269.1| PREDICTED: uncharacterized protein LOC104900536 [Beta vulgaris 
subsp. vulgaris]
Length=161

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            R+TFL++EEAGLVEISGL  HERFLCRLTISSLNLL+VI+EQE C IEELNAGRICDWFL
Sbjct  75   RKTFLSIEEAGLVEISGLSIHERFLCRLTISSLNLLRVIAEQEACTIEELNAGRICDWFL  134

Query  497  KDKLKREQNLESAVLQWDSSE-FQ  565
            KDKLKREQN+ SAVLQWD  + FQ
Sbjct  135  KDKLKREQNIGSAVLQWDDDDPFQ  158



>gb|EMT03270.1| hypothetical protein F775_32363 [Aegilops tauschii]
Length=148

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG  IEELNAGR+CDWFL
Sbjct  66   KRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVAIEELNAGRVCDWFL  125

Query  497  KDKLKREQNLESAVLQWD  550
            KDKLKREQNL++AVLQWD
Sbjct  126  KDKLKREQNLDTAVLQWD  143



>ref|XP_003580636.1| PREDICTED: uncharacterized protein LOC100842097 [Brachypodium 
distachyon]
Length=155

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG  IEELNAGR+CDWFL
Sbjct  74   KRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVAIEELNAGRVCDWFL  133

Query  497  KDKLKREQNLESAVLQWD  550
            KDKLK+EQNL+SAVLQWD
Sbjct  134  KDKLKKEQNLDSAVLQWD  151



>ref|NP_001054010.1| Os04g0635700 [Oryza sativa Japonica Group]
 emb|CAE03007.2| OSJNBa0043L09.26 [Oryza sativa Japonica Group]
 dbj|BAF15924.1| Os04g0635700 [Oryza sativa Japonica Group]
 gb|EAY95710.1| hypothetical protein OsI_17578 [Oryza sativa Indica Group]
 gb|EAZ32117.1| hypothetical protein OsJ_16313 [Oryza sativa Japonica Group]
 dbj|BAG88200.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93809.1| unnamed protein product [Oryza sativa Japonica Group]
Length=163

 Score =   141 bits (355),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAG +CDWF+
Sbjct  82   QRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGLVCDWFV  141

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQN+ SAVLQWD   F
Sbjct  142  KDKLKREQNVGSAVLQWDDPGF  163



>ref|XP_004976957.1| PREDICTED: uncharacterized protein LOC101774547 isoform X1 [Setaria 
italica]
Length=158

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGR+CDWF+
Sbjct  77   KRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRVCDWFI  136

Query  497  KDKLKREQNLESAVLQWD  550
            KDKLKREQ L +AVLQWD
Sbjct  137  KDKLKREQGLGTAVLQWD  154



>emb|CAH67654.1| H0410G08.9 [Oryza sativa Indica Group]
Length=163

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAG +CDWF+
Sbjct  82   QRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGLVCDWFV  141

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQN+ SAVLQWD   F
Sbjct  142  KDKLKREQNVGSAVLQWDDPGF  163



>ref|XP_004976958.1| PREDICTED: uncharacterized protein LOC101774547 isoform X2 [Setaria 
italica]
Length=157

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG PIEELNAGR+CDWF+
Sbjct  76   KRTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVPIEELNAGRVCDWFI  135

Query  497  KDKLKREQNLESAVLQWD  550
            KDKLKREQ L +AVLQWD
Sbjct  136  KDKLKREQGLGTAVLQWD  153



>ref|XP_010439474.1| PREDICTED: uncharacterized protein LOC104722915 [Camelina sativa]
Length=150

 Score =   140 bits (352),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FL+L E GLVEISGL AHE+FLCRLTISSLNLL+V  EQEGC IEELNAG++CDWFL
Sbjct  67   RRSFLSLAEDGLVEISGLGAHEKFLCRLTISSLNLLRVNLEQEGCTIEELNAGKVCDWFL  126

Query  497  KDKLKREQNLESAVLQWDSSEFQF  568
            KDKLKRE N+ESAVLQWD  +F F
Sbjct  127  KDKLKREHNIESAVLQWDDPDFPF  150



>dbj|BAK06439.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=157

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            RTFL+LEEAGLVE+SGL  HERFLCRLTISSLNLL+VISEQEG  IEELNAGR+CDWFLK
Sbjct  76   RTFLSLEEAGLVEMSGLSTHERFLCRLTISSLNLLRVISEQEGVAIEELNAGRVCDWFLK  135

Query  500  DKLKREQNLESAVLQWD  550
            DKLK+EQNL +AVLQWD
Sbjct  136  DKLKQEQNLGTAVLQWD  152



>gb|ABQ42033.1| putative receptor-interacting protein [Sonneratia alba]
Length=105

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            R+TFLTLEEAGLVE+SGL  HERFLCRLTISSLNL++VIS+QEGCPIEELNAGRICDWF+
Sbjct  38   RQTFLTLEEAGLVEVSGLSTHERFLCRLTISSLNLMRVISDQEGCPIEELNAGRICDWFV  97

Query  497  KDKLKREQ  520
            KDKLKREQ
Sbjct  98   KDKLKREQ  105



>gb|ABQ42035.1| putative receptor-interacting protein [Sonneratia ovata]
Length=105

 Score =   129 bits (324),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            R+TFLTLEEAGLVE+SGL  HERFLCRLTISSLNL++VIS+QEGCPIEELNAGRICDWF+
Sbjct  38   RQTFLTLEEAGLVEVSGLSTHERFLCRLTISSLNLMRVISDQEGCPIEELNAGRICDWFV  97

Query  497  KDKLKREQ  520
            KDKLKREQ
Sbjct  98   KDKLKREQ  105



>gb|ABQ42034.1| putative receptor-interacting protein [Sonneratia caseolaris]
Length=105

 Score =   129 bits (323),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            R+TFLTLEEAGLVE+SGL  HERFLCRLTISSLNL++VIS+QEGCPIEELNAGRICDWF+
Sbjct  38   RQTFLTLEEAGLVEVSGLSTHERFLCRLTISSLNLMRVISDQEGCPIEELNAGRICDWFV  97

Query  497  KDKLKREQ  520
            KDKLKREQ
Sbjct  98   KDKLKREQ  105



>gb|ABQ42036.1| putative receptor-interacting protein [Sonneratia apetala]
Length=105

 Score =   129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            R+TFLTLEEAGLVE+SGL  HERFLCRLTISSLNL++VIS+QEGCPIEELNAGRICDWF+
Sbjct  38   RQTFLTLEEAGLVEVSGLGTHERFLCRLTISSLNLMRVISDQEGCPIEELNAGRICDWFV  97

Query  497  KDKLKREQ  520
            KDKLKREQ
Sbjct  98   KDKLKREQ  105



>ref|XP_006285716.1| hypothetical protein CARUB_v10007187mg, partial [Capsella rubella]
 gb|EOA18614.1| hypothetical protein CARUB_v10007187mg, partial [Capsella rubella]
Length=87

 Score =   120 bits (301),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 69/84 (82%), Gaps = 9/84 (11%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLT---------ISSLNLLKVISEQEGCPIEELN  469
            RR+FL+L EAGLVEISGL AHE+F+CRLT         ISSLNLL++ISEQEGC  EELN
Sbjct  4    RRSFLSLAEAGLVEISGLGAHEKFICRLTDEISDFIGQISSLNLLRMISEQEGCSTEELN  63

Query  470  AGRICDWFLKDKLKREQNLESAVL  541
             G+ICDWFLKDKLKRE N++SAVL
Sbjct  64   GGKICDWFLKDKLKREHNIKSAVL  87



>ref|XP_010905553.1| PREDICTED: uncharacterized protein LOC105032725 isoform X2 [Elaeis 
guineensis]
Length=122

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 64/82 (78%), Gaps = 13/82 (16%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            +R+FL+LEEAGLVEISGL  HERFLCRLT             EG PIEELNAGRICDW+L
Sbjct  54   KRSFLSLEEAGLVEISGLSTHERFLCRLT-------------EGVPIEELNAGRICDWYL  100

Query  497  KDKLKREQNLESAVLQWDSSEF  562
            KDKLKREQ+ ESAVLQWD S+F
Sbjct  101  KDKLKREQDAESAVLQWDDSDF  122



>gb|KHN08589.1| Vesicle-associated protein 4-2 [Glycine soja]
Length=336

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 68/95 (72%), Gaps = 9/95 (9%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            RTFLTLEEAGLVEISGL  HERFLCRLTISSLNLL+VISEQEGCPIEELNA +ICDW + 
Sbjct  57   RTFLTLEEAGLVEISGLSTHERFLCRLTISSLNLLRVISEQEGCPIEELNAAKICDW-VD  115

Query  500  DKLK--------REQNLESAVLQWDSSEFQF*NPP  580
            D +         + Q  +S    W+  + +F  PP
Sbjct  116  DHVAASRAWKSWKNQAQQSKGKVWNLFKLRFLTPP  150



>ref|XP_002969271.1| hypothetical protein SELMODRAFT_69311, partial [Selaginella moellendorffii]
 gb|EFJ29359.1| hypothetical protein SELMODRAFT_69311, partial [Selaginella moellendorffii]
Length=80

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 62/79 (78%), Gaps = 3/79 (4%)
 Frame = +2

Query  323  TFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD  502
            TFL+ EEAGL+E+SGL  HERFL RLT+SSLNLLKVI++QEG  +E LNAG ICDWF+KD
Sbjct  5    TFLSAEEAGLIEMSGLGIHERFLARLTVSSLNLLKVIAKQEGRSMESLNAGIICDWFVKD  64

Query  503  KLKREQNLESAVLQWDSSE  559
            K K    +ESA L+W   E
Sbjct  65   KAK---GMESATLKWGEEE  80



>ref|XP_007025819.1| Uncharacterized protein TCM_030007 [Theobroma cacao]
 gb|EOY28441.1| Uncharacterized protein TCM_030007 [Theobroma cacao]
Length=189

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFL  496
            RR+FLTLEEAGLVEISGL  HERFLCRLTISSLNLL+VISEQEGC IEELNAGR+  + +
Sbjct  119  RRSFLTLEEAGLVEISGLSTHERFLCRLTISSLNLLRVISEQEGCSIEELNAGRVTRFII  178

Query  497  KD  502
            ++
Sbjct  179  RN  180



>ref|WP_015145947.1| hypothetical protein [Pleurocapsa minor]
 ref|YP_007083209.1| hypothetical protein Ple7327_4555 [Pleurocapsa sp. PCC 7327]
 gb|AFY79652.1| hypothetical protein Ple7327_4555 [Pleurocapsa sp. PCC 7327]
Length=87

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LLK+I+E  G PIEEL   +I +WF KD 
Sbjct  13   FLTLEESADVDAALLSSPEKFLTRLTISSLRLLKIIAEDRGIPIEELTHKQIIEWFEKDG  72

Query  503  KLKREQNLESAVLQW  547
            K++R++ +E+AVL+W
Sbjct  73   KIRRDRGVEAAVLKW  87



>ref|WP_013323184.1| hypothetical protein [Cyanothece sp. PCC 7822]
 ref|YP_003888366.1| hypothetical protein Cyan7822_3137 [Cyanothece sp. PCC 7822]
 gb|ADN15091.1| conserved hypothetical protein [Cyanothece sp. PCC 7822]
Length=84

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L + E+FL RLTISSL LLK+I++  G P+EE+   ++ DWF KD 
Sbjct  10   FLTPEESADVDKALLTSPEKFLTRLTISSLRLLKIIAQDRGVPLEEITHQQVIDWFEKDG  69

Query  503  KLKREQNLESAVLQW  547
            K++REQ  ++AVL+W
Sbjct  70   KIRREQGTDAAVLKW  84



>ref|WP_026721842.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=85

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LLK I+++    +E+L   ++ DWF KD 
Sbjct  11   FLTLEESAKVDAALLSSSEKFLSRLTISSLKLLKYIAQEYNIAVEDLTTEQVIDWFEKDS  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+A L+W
Sbjct  71   KVRREQGVEAAYLKW  85



>ref|WP_009633028.1| hypothetical protein [Synechocystis sp. PCC 7509]
Length=84

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLE++  V+ + L ++E+FL RLT+SSLNLLK I+++    IE+L   +I  WF KD 
Sbjct  10   FLTLEDSAQVDAALLASNEKFLARLTVSSLNLLKHIAQEYAVNIEDLTTRQIIAWFEKDG  69

Query  503  KLKREQNLESAVLQW  547
            K++REQ  ESA LQW
Sbjct  70   KIRREQGSESAYLQW  84



>ref|WP_002736270.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI05261.1| Similar to tr|Q8YU64|Q8YU64 [Microcystis aeruginosa PCC 9443]
 emb|CCI09512.1| Similar to tr|Q8YU64|Q8YU64 [Microcystis aeruginosa PCC 7941]
 emb|CCI15883.1| Similar to tr|Q8YU64|Q8YU64 [Microcystis aeruginosa PCC 9806]
 emb|CCI19506.1| Similar to tr|Q8YU64|Q8YU64 [Microcystis aeruginosa PCC 9807]
 emb|CCI26394.1| Similar to tr|Q8YU64|Q8YU64 [Microcystis aeruginosa PCC 9809]
 emb|CCI38337.1| Similar to tr|Q8YU64|Q8YU64 [Microcystis aeruginosa PCC 9701]
 gb|ELP53879.1| hypothetical protein O53_2690 [Microcystis aeruginosa TAIHU98]
 gb|EPF17259.1| hypothetical protein MAESPC_04924 [Microcystis aeruginosa SPC777]
 dbj|GAL94696.1| hypothetical protein N44_03276 [Microcystis aeruginosa NIES-44]
Length=81

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            R FLT EE+  V+ + L + E+FL RLTISSL LLK+I+E  G  +EEL   ++  W  K
Sbjct  5    RQFLTPEESADVDAALLTSPEKFLTRLTISSLRLLKIIAEDTGVTLEELTHKQVIQWLEK  64

Query  500  D-KLKREQNLESAVLQW  547
            D KL+REQ +E+AVL+W
Sbjct  65   DSKLRREQGIEAAVLKW  81



>ref|WP_024969855.1| hypothetical protein [Microcystis aeruginosa]
Length=81

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            R FLT EE+  V+ + L A E+FL RLTISSL LLK+I+E  G  +EEL   ++  W  K
Sbjct  5    RQFLTPEESADVDAALLTAPEKFLTRLTISSLRLLKIIAEDTGVTLEELTHKQVIQWLEK  64

Query  500  D-KLKREQNLESAVLQW  547
            D +L+REQ +E+AVL+W
Sbjct  65   DSQLRREQGIEAAVLKW  81



>ref|WP_019497426.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=84

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLE++G V+ + L + E+FL R+T+SS  LL  I+++ G PIEEL   +I  WF KD 
Sbjct  10   FLTLEDSGKVDAALLSSPEKFLARITLSSQKLLIHIAKEHGIPIEELTTQQIIAWFEKDG  69

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+A LQW
Sbjct  70   KIRREQGIEAAYLQW  84



>ref|WP_002754699.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH93096.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9432]
Length=81

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            R FLT EE+  V+ + L + E+FL RLTISSL LLK+I+E  G  +EEL   ++  W  K
Sbjct  5    RQFLTPEESADVDAALLTSPEKFLTRLTISSLRLLKIIAEDTGVTLEELTHEQVIQWLEK  64

Query  500  D-KLKREQNLESAVLQW  547
            D KL+REQ +E+AVL+W
Sbjct  65   DSKLRREQGIEAAVLKW  81



>ref|WP_015228977.1| hypothetical protein [Dactylococcopsis salina]
 ref|YP_007171328.1| hypothetical protein Dacsa_1274 [Dactylococcopsis salina PCC 
8305]
 gb|AFZ49971.1| hypothetical protein Dacsa_1274 [Dactylococcopsis salina PCC 
8305]
Length=83

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L + E+FL RLTISSL LLK I++QEG  +EEL   +I  WF  D 
Sbjct  9    FLTQEESAEVDKALLSSPEKFLTRLTISSLRLLKTIAQQEGVTVEELTPEQIIAWFENDG  68

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+A L+W
Sbjct  69   KIRREQGIEAATLKW  83



>ref|WP_015955070.1| hypothetical protein [Cyanothece sp. PCC 7424]
 ref|YP_002378341.1| hypothetical protein PCC7424_3071 [Cyanothece sp. PCC 7424]
 gb|ACK71473.1| conserved hypothetical protein [Cyanothece sp. PCC 7424]
Length=83

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L   E+FL RLTISSL LLK+I+E  G  +E+L   ++ DWF KD 
Sbjct  9    FLTSEESADVDKALLTLPEKFLTRLTISSLRLLKIIAEDRGVSVEDLTHQQVIDWFEKDS  68

Query  503  KLKREQNLESAVLQW  547
            K++REQ +++AVL+W
Sbjct  69   KIRREQGIDAAVLKW  83



>ref|WP_011317306.1| hypothetical protein [Anabaena variabilis]
 ref|YP_320943.1| hypothetical protein Ava_0422 [Anabaena variabilis ATCC 29413]
 gb|ABA20048.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=86

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LL+ I+++ G  IE L   ++  WF KD 
Sbjct  12   FLTLEESAKVDAALLSSPEKFLTRLTISSLKLLQHIAQEHGVSIENLTTQQVISWFEKDS  71

Query  503  KLKREQNLESAVLQW  547
            KL+REQ +ES+ L+W
Sbjct  72   KLRREQGIESSYLKW  86



>ref|WP_002794861.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI27140.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
Length=81

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            R FLT EE+  V+ + L + E+FL RLTISSL LLK+I+E  G  +E+L   ++  W  K
Sbjct  5    RQFLTPEESADVDAALLTSPEKFLTRLTISSLRLLKIIAEDTGVTLEQLTHKQVIQWLEK  64

Query  500  D-KLKREQNLESAVLQW  547
            D KL+REQ +E+AVL+W
Sbjct  65   DSKLRREQGIEAAVLKW  81



>ref|WP_015130438.1| hypothetical protein [Calothrix sp. PCC 7507]
 ref|YP_007067470.1| hypothetical protein Cal7507_4258 [Calothrix sp. PCC 7507]
 gb|AFY34636.1| hypothetical protein Cal7507_4258 [Calothrix sp. PCC 7507]
Length=86

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LLK I++    PIE+L   ++  WF KD 
Sbjct  12   FLTLEESANVDAALLSSPEKFLTRLTISSLKLLKYIAQDYDVPIEDLTTKQLIAWFEKDS  71

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E++ L+W
Sbjct  72   KIRREQGIEASYLKW  86



>ref|WP_017303101.1| hypothetical protein [Spirulina subsalsa]
Length=85

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL++EE+  V+ + L + E+FL RLTISSL LL+VI++    PI EL+  +I  WF KD 
Sbjct  11   FLSVEESADVDQALLSSSEKFLTRLTISSLRLLQVIAQDYQVPIAELSHQQIIQWFEKDS  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+AVL+W
Sbjct  71   KIRREQGIEAAVLKW  85



>ref|WP_010996646.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_486530.1| hypothetical protein asl2490 [Nostoc sp. PCC 7120]
 dbj|BAB74189.1| asl2490 [Nostoc sp. PCC 7120]
Length=86

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LL+ I+++ G  IE+L   ++  WF KD 
Sbjct  12   FLTLEESAKVDAALLSSPEKFLTRLTISSLKLLQHIAQEYGVSIEDLTTQQVISWFEKDS  71

Query  503  KLKREQNLESAVLQW  547
            K++REQ +ES+ L+W
Sbjct  72   KIRREQGIESSYLKW  86



>ref|WP_002746191.1| MULTISPECIES: hypothetical protein [Microcystis]
 ref|YP_001656824.1| hypothetical protein MAE_18100 [Microcystis aeruginosa NIES-843]
 emb|CAO89933.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 dbj|BAG01632.1| hypothetical protein MAE_18100 [Microcystis aeruginosa NIES-843]
 emb|CCH97435.1| Similar to tr|Q8YU64|Q8YU64 [Microcystis aeruginosa PCC 9717]
 emb|CCI34259.1| Similar to tr|Q8YU64|Q8YU64 [Microcystis sp. T1-4]
 gb|ELS46560.1| hypothetical protein C789_3654 [Microcystis aeruginosa DIANCHI905]
Length=81

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            R FLT EE+  V+ + L + E+FL RLTISSL LLK+I+E  G  +EEL   ++  W  K
Sbjct  5    RQFLTPEESADVDAALLTSPEKFLTRLTISSLRLLKIIAEDTGVTLEELTHKQVIQWLEK  64

Query  500  D-KLKREQNLESAVLQW  547
            D +L+REQ +E+AVL+W
Sbjct  65   DSQLRREQGIEAAVLKW  81



>ref|WP_006511097.1| hypothetical protein [Xenococcus sp. PCC 7305]
 gb|ELS01764.1| hypothetical protein Xen7305DRAFT_00014690 [Xenococcus sp. PCC 
7305]
Length=83

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+G ++ + LD+ E+FL RLTISSL LL++IS +   PIEEL   +I  WF KD 
Sbjct  9    FLSTEESGDIDAALLDSSEKFLTRLTISSLRLLQIISGELKIPIEELTHKQIIAWFEKDG  68

Query  503  KLKREQNLESAVLQW  547
            K++REQ  ++A L+W
Sbjct  69   KIRREQGKDAATLKW  83



>ref|WP_026731383.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=86

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LLK I+++    +E+L   ++  WF KD 
Sbjct  12   FLTLEESAQVDAALLSSPEKFLTRLTISSLKLLKHIADEYNVAVEDLTTKQVIAWFEKDS  71

Query  503  KLKREQNLESAVLQW  547
            K+KREQ +E+A L+W
Sbjct  72   KIKREQGIEAAYLKW  86



>ref|WP_017655183.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=86

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LL+ I+E  G  IEEL   ++  WF KD 
Sbjct  12   FLTLEESADVDAALLSSPEKFLTRLTISSLKLLQHIAEDYGIKIEELTTKQVIAWFEKDG  71

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E++ L+W
Sbjct  72   KIRREQGIEASYLKW  86



>ref|WP_026072465.1| hypothetical protein [Nodosilinea nodulosa]
Length=88

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L + E+FL RLTIS+ NLL+ I+     P+E L A +I  WF KD 
Sbjct  8    FLSPEESAEVDKALLSSPEKFLARLTISTANLLRAIAADTDTPMEALTAAQITQWFEKDA  67

Query  503  KLKREQNLESAVLQWDSSEFQ  565
            KLKREQ + ++VL+W S + +
Sbjct  68   KLKREQGVNASVLKWQSEDLE  88



>ref|WP_017322265.1| hypothetical protein [cyanobacterium PCC 7702]
Length=86

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LLK I+++ G  +E+L + ++  WF KD 
Sbjct  12   FLTLEESAKVDAALLSSSEKFLTRLTISSLKLLKHIAQEYGVAVEDLTSEQVISWFEKDG  71

Query  503  KLKREQNLESAVLQW  547
            K++REQ  ++A L+W
Sbjct  72   KIRREQGSQAAYLKW  86



>ref|WP_012411123.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001868110.1| hypothetical protein Npun_R4820 [Nostoc punctiforme PCC 73102]
 gb|ACC83167.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=86

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LLK I+++ G  IE+L A +I  WF KD 
Sbjct  12   FLTLEESAKVDAALLSSPEKFLTRLTISSLKLLKHIAQEYGVVIEDLTAQQIIAWFEKDG  71

Query  503  KLKREQNLESAVLQW  547
            K++RE+ +E + L+W
Sbjct  72   KIRREEGIEGSYLKW  86



>ref|WP_015211231.1| hypothetical protein [Cylindrospermum stagnale]
 ref|YP_007150678.1| hypothetical protein Cylst_6025 [Cylindrospermum stagnale PCC 
7417]
 gb|AFZ27998.1| hypothetical protein Cylst_6025 [Cylindrospermum stagnale PCC 
7417]
Length=86

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL +L+ I++  G  +E+L   +I  WF KD 
Sbjct  12   FLTLEESAKVDAALLSSPEKFLTRLTISSLRILQHIAQDYGVAVEDLTTQQIIAWFEKDA  71

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+A L+W
Sbjct  72   KIRREQGIEAAYLKW  86



>ref|WP_015154065.1| hypothetical protein [Chroococcidiopsis thermalis]
 ref|YP_007091386.1| hypothetical protein Chro_2008 [Chroococcidiopsis thermalis PCC 
7203]
 gb|AFY87517.1| hypothetical protein Chro_2008 [Chroococcidiopsis thermalis PCC 
7203]
Length=85

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L + E+FL RLT+SSL LLK I+E  G  +E+L A ++  WF KD 
Sbjct  11   FLSAEESAKVDAALLSSPEKFLTRLTVSSLRLLKHIAEDYGVKMEDLTAEQVVAWFEKDG  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ LE+A L+W
Sbjct  71   KIRREQGLEAAFLKW  85



>ref|WP_039714291.1| hypothetical protein [Scytonema millei]
 gb|KIF22021.1| hypothetical protein QH73_26425 [Scytonema millei VB511283]
Length=85

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L + E+FL RLT+SSL LLK I+E  G  +E+L A ++  WF KD 
Sbjct  11   FLSTEESAKVDAALLSSPEKFLTRLTVSSLRLLKHIAEDYGVKMEDLTAEQVVAWFEKDG  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ LE+A L+W
Sbjct  71   KIRREQGLEAAFLKW  85



>ref|WP_015226197.1| hypothetical protein [Halothece sp. PCC 7418]
 ref|YP_007168536.1| hypothetical protein PCC7418_2162 [Halothece sp. PCC 7418]
 gb|AFZ44322.1| hypothetical protein PCC7418_2162 [Halothece sp. PCC 7418]
Length=83

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L + E+FL RLTISSL LLK I+++EG  +E+L   +I  WF KD 
Sbjct  9    FLTEEESLEVDKALLSSPEKFLTRLTISSLRLLKTIAQEEGVAVEDLTPEQIIAWFEKDG  68

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+A L+W
Sbjct  69   KIRREQGIEAATLKW  83



>ref|WP_006194428.1| hypothetical protein [Nodularia spumigena]
 gb|EAW47208.1| hypothetical protein N9414_05125 [Nodularia spumigena CCY9414]
 gb|AHJ26377.1| hypothetical protein NSP_200 [Nodularia spumigena CCY9414]
Length=86

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL R+TISSL +LK I+++ G  IE+L   ++  WF  D 
Sbjct  12   FLTLEESAKVDAALLSSSEKFLTRITISSLKVLKHIAQEYGVAIEDLTTQQLITWFETDA  71

Query  503  KLKREQNLESAVLQW  547
            K+KREQ +E++ L+W
Sbjct  72   KIKREQGIEASYLKW  86



>ref|WP_039741129.1| hypothetical protein [Hassallia byssoidea]
 gb|KIF36222.1| hypothetical protein PI95_11655 [Hassallia byssoidea VB512170]
Length=87

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LLK I+++    IE+L   ++  WF KD 
Sbjct  13   FLTLEESAKVDAALLSSPEKFLTRLTISSLKLLKHIAQEYDVKIEDLTTQQVIAWFEKDG  72

Query  503  KLKREQNLESAVLQW  547
            K++REQ  ESA L W
Sbjct  73   KIRREQGTESAYLNW  87



>ref|WP_029632974.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=87

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ S L + E+FL RLTISSL LLK I+++    IE+L   ++  WF KD 
Sbjct  13   FLTFEESAKVDASLLSSPEKFLTRLTISSLKLLKHIAQEYDVRIEDLTTQQVIAWFEKDS  72

Query  503  KLKREQNLESAVLQW  547
            K++REQ  ESA L W
Sbjct  73   KIRREQGTESAYLNW  87



>ref|WP_015190663.1| hypothetical protein [Gloeocapsa sp. PCC 7428]
 ref|YP_007129956.1| hypothetical protein Glo7428_4353 [Gloeocapsa sp. PCC 7428]
 gb|AFZ32796.1| hypothetical protein Glo7428_4353 [Gloeocapsa sp. PCC 7428]
Length=84

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISS  LLK I++     +E+L   +I DWF KD 
Sbjct  10   FLTLEESAKVDAALLSSSEKFLTRLTISSWKLLKHIAQDYNVAVEDLTTQQIIDWFEKDG  69

Query  503  KLKREQNLESAVLQW  547
            K++REQ  E+A L+W
Sbjct  70   KVRREQGNEAAYLKW  84



>ref|WP_015140223.1| hypothetical protein [Nostoc sp. PCC 7524]
 ref|YP_007077401.1| hypothetical protein Nos7524_4032 [Nostoc sp. PCC 7524]
 gb|AFY49804.1| hypothetical protein Nos7524_4032 [Nostoc sp. PCC 7524]
Length=86

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L + E+FL RLTISSL LLK I++  G  IE+L   +I  WF KD 
Sbjct  12   FLTPEESAKVDAALLSSPEKFLTRLTISSLKLLKHIAQDYGVTIEDLTTQQIVAWFEKDG  71

Query  503  KLKREQNLESAVLQW  547
            K++RE+ +E+A L+W
Sbjct  72   KIRREEGVEAAYLKW  86



>ref|WP_016868018.1| hypothetical protein [Fischerella muscicola]
Length=86

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LLK I+++    +E+L   ++  WF KD 
Sbjct  12   FLTLEESAKVDAALLSSSEKFLSRLTISSLKLLKHIAQEYSVSVEDLTTEQVIAWFEKDG  71

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E++ L+W
Sbjct  72   KIRREQGVEASYLKW  86



>ref|WP_006101849.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX75029.1| hypothetical protein MC7420_903 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=105

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L +HE+FL RLTISSL LL  I++  G  +EEL   ++ DWF  D 
Sbjct  31   FLSPEESAAVDQALLASHEKFLTRLTISSLRLLTHIAQDTGVAVEELTPQQVIDWFENDS  90

Query  503  KLKREQNLESAVLQW  547
            K++REQ  ++A L+W
Sbjct  91   KIRREQGSDAAFLKW  105



>ref|WP_015184213.1| hypothetical protein [Microcoleus sp. PCC 7113]
 ref|YP_007123483.1| hypothetical protein Mic7113_4380 [Microcoleus sp. PCC 7113]
 gb|AFZ20077.1| hypothetical protein Mic7113_4380 [Microcoleus sp. PCC 7113]
Length=85

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L + E+FL RLTISSL LL+ I++  G  IEEL   ++ DWF  D 
Sbjct  11   FLTPEESADVDKALLSSPEKFLTRLTISSLRLLQQIAKDTGVAIEELTHQQVIDWFENDG  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+A L+W
Sbjct  71   KIRREQGIEAAFLKW  85



>ref|WP_018400762.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=85

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L + E+FL RLT+SSL LL++I+++   PIE L   +I  WF KD 
Sbjct  11   FLTAEESADVDKALLSSPEKFLTRLTVSSLRLLQIIAKEYEVPIENLTHEQIIAWFEKDG  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+A L+W
Sbjct  71   KIRREQGIEAATLKW  85



>ref|WP_035990849.1| hypothetical protein [Leptolyngbya sp. KIOST-1]
Length=88

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT +E+  V+ + L + E+FL RLTIS+  LLKVI+     PIE L A ++  WF KD 
Sbjct  8    FLTPDESAEVDKALLTSPEKFLARLTISTAKLLKVIAADTDTPIEALTAVQMIQWFEKDA  67

Query  503  KLKREQNLESAVLQWDSSEF  562
            KLKREQ + ++VL+W + + 
Sbjct  68   KLKREQGVNASVLKWQAEDL  87



>ref|WP_017309176.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=86

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+LEE+  V+ + L + E+FL RLTISSL LLK I+++    IE+L   ++  WF KD 
Sbjct  12   FLSLEESAKVDAALLSSPEKFLTRLTISSLKLLKHIAQEYNVSIEDLTTEQVIAWFEKDG  71

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+A L+W
Sbjct  72   KVRREQGIEAAYLKW  86



>ref|WP_009458252.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC11035.1| hypothetical protein FJSC11DRAFT_3269 [Fischerella sp. JSC-11]
Length=86

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LLK I+++    +E+L   ++  WF KD 
Sbjct  12   FLTLEESAKVDAALLSSSEKFLSRLTISSLKLLKHIAQEYSVSMEDLTTEQVIAWFEKDG  71

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E++ L+W
Sbjct  72   KIRREQGVEASYLKW  86



>ref|WP_017316118.1| hypothetical protein [Mastigocladopsis repens]
Length=86

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EEA  V+ + L + E+FL R+TISSL LLK I+++    IEEL   ++  WF KD 
Sbjct  12   FLTPEEAVKVDAALLSSPEKFLTRITISSLRLLKQIAQEYDVKIEELTPQQVIAWFEKDG  71

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+A L+W
Sbjct  72   KIRREQGIEAAYLKW  86



>ref|WP_015194587.1| hypothetical protein [Stanieria cyanosphaera]
 ref|YP_007133891.1| hypothetical protein Sta7437_3422 [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ36925.1| hypothetical protein Sta7437_3422 [Stanieria cyanosphaera PCC 
7437]
Length=85

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L + E+FL RLTISS  LL++I+++ G  +++L   +I  WF KD 
Sbjct  11   FLSPEESADVDKALLSSSEKFLTRLTISSFRLLQIIAQETGVSLDQLTHTQIVAWFEKDG  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E+AVL+W
Sbjct  71   KIRREQGIEAAVLKW  85



>ref|WP_038081932.1| hypothetical protein [Tolypothrix bouteillei]
 gb|KIE08184.1| hypothetical protein DA73_0244110 [Tolypothrix bouteillei VB521301]
Length=85

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL R+TISSL LL  I+++    +E+L A ++  WF KD 
Sbjct  11   FLTLEESAKVDAALLSSPEKFLTRITISSLRLLNHIAQEYNVTVEDLTAQQVIAWFEKDS  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ +++A L+W
Sbjct  71   KIRREQGVDAAYLKW  85



>ref|WP_026135052.1| hypothetical protein [Scytonema hofmanni]
Length=85

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL R+TISSL LL  I+ +    IE+L A ++  WF KD 
Sbjct  11   FLTLEESAKVDAALLSSPEKFLTRITISSLRLLNHIAHEYNVTIEDLTAQQVIAWFEKDS  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ +++A L+W
Sbjct  71   KIRREQGVDAAYLKW  85



>ref|WP_006277479.1| hypothetical protein [Cylindrospermopsis raciborskii]
 gb|EFA69693.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=86

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT +E+  V+ + L + E+FL RLTISSL +L+ I+++   PIE+L A +I +WF  D 
Sbjct  12   FLTPDESAQVDAALLSSSEKFLTRLTISSLRILQHIAQEHELPIEQLTAKQIINWFESDG  71

Query  503  KLKREQNLESAVLQW  547
            K++RE+ LE A L+W
Sbjct  72   KIRREKGLEEAFLKW  86



>ref|WP_016863448.1| hypothetical protein [Fischerella muscicola]
Length=85

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL LLK I+++    +E+L   ++  WF  D 
Sbjct  11   FLTLEESAKVDAALLSSSEKFLSRLTISSLKLLKHIAQEYNIAVEDLTTEQVITWFETDG  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ  E+A L+W
Sbjct  71   KVRREQGTEAAYLKW  85



>ref|WP_015112306.1| hypothetical protein [Nostoc sp. PCC 7107]
 ref|YP_007049230.1| hypothetical protein Nos7107_1437 [Nostoc sp. PCC 7107]
 gb|AFY42080.1| hypothetical protein Nos7107_1437 [Nostoc sp. PCC 7107]
Length=86

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISS  LL+ I+++    IE+L   +I  WF KD 
Sbjct  12   FLTLEESAKVDAALLSSPEKFLTRLTISSHKLLQQIAQEYNVTIEDLTTQQIISWFEKDS  71

Query  503  KLKREQNLESAVLQW  547
            K++REQ +E++ L+W
Sbjct  72   KIRREQGIEASFLKW  86



>ref|WP_015199509.1| hypothetical protein [Calothrix parietina]
 ref|YP_007138856.1| hypothetical protein Cal6303_3968 [Calothrix sp. PCC 6303]
 gb|AFZ02884.1| hypothetical protein Cal6303_3968 [Calothrix sp. PCC 6303]
Length=86

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L + E+FL R+TISSL LLK ++E+   PIE+L   ++  WF  D 
Sbjct  12   FLTSEESAKVDAALLSSSEKFLTRITISSLRLLKHVAEENNVPIEDLTVQQVIQWFENDA  71

Query  503  KLKREQNLESAVLQW  547
            +++RE+  E+A L+W
Sbjct  72   RIRREEGAEAAFLKW  86



>ref|WP_009545926.1| MULTISPECIES: hypothetical protein [Cyanothece]
 ref|YP_001802097.1| hypothetical protein cce_0680 [Cyanothece sp. ATCC 51142]
 gb|ACB50031.1| unknown [Cyanothece sp. ATCC 51142]
Length=80

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L A E+FL RLTISSL LL +I++     +E+L   ++ DWF KD 
Sbjct  6    FLTSEESADVDKALLTAPEKFLTRLTISSLRLLTIIAKDYEVSVEDLTHQQVIDWFEKDG  65

Query  503  KLKREQNLESAVLQW  547
            K++RE+  E+AVL+W
Sbjct  66   KIRREKGPEAAVLKW  80



>ref|WP_012593787.1| MULTISPECIES: hypothetical protein [Cyanothece]
 ref|YP_002370666.1| hypothetical protein PCC8801_0413 [Cyanothece sp. PCC 8801]
 ref|YP_003136218.1| hypothetical protein Cyan8802_0424 [Cyanothece sp. PCC 8802]
 gb|ACK64510.1| conserved hypothetical protein [Cyanothece sp. PCC 8801]
 gb|ACU99382.1| conserved hypothetical protein [Cyanothece sp. PCC 8802]
Length=84

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L + E+FL RLTISSL LL++I++  G  ++EL   ++ +W  KD 
Sbjct  10   FLTPEESADVDKALLSSSEKFLTRLTISSLRLLQIIAKDIGVSLDELTHSQVIEWVEKDA  69

Query  503  KLKREQNLESAVLQW  547
            K+KRE+ +++AVL+W
Sbjct  70   KIKREKGIDAAVLKW  84



>ref|WP_008278531.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ88387.1| hypothetical protein CY0110_09555 [Cyanothece sp. CCY0110]
Length=84

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L A E+FL RLTISSL LL  I++     +E+L   ++ DWF KD 
Sbjct  10   FLTPEESADVDKALLTAPEKFLTRLTISSLRLLTTIAKDLEVSVEDLTHQQVIDWFEKDG  69

Query  503  KLKREQNLESAVLQW  547
            K++REQ  ++AVL+W
Sbjct  70   KIRREQGADAAVLKW  84



>ref|WP_016876441.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=86

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L + E+FL RLTISSL LLK I+ +    IE+L + ++  WF KD 
Sbjct  12   FLTSEESAKVDAALLSSPEKFLTRLTISSLKLLKHIATEHNVAIEDLTSEQVIAWFEKDG  71

Query  503  KLKREQNLESAVLQW  547
            K +RE+ +E+A L+W
Sbjct  72   KTRREKGIEAAYLKW  86



>ref|WP_027843137.1| hypothetical protein [Mastigocoleus testarum]
Length=86

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+LEE+  V+ + L + E+FL RLTISSL +L  I+E+ G  I++L   +I  WF KD 
Sbjct  12   FLSLEESAKVDAALLTSPEKFLTRLTISSLKVLTHIAEEYGVEIKDLTTPQIIAWFEKDS  71

Query  503  KLKREQNLESAVLQW  547
            K+++EQ  E+A L+W
Sbjct  72   KIRQEQGSEAAYLKW  86



>ref|WP_009343211.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA72709.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=86

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT +E+  ++ + L + E+FL RLTISSL +L+ I+++   PIE+L A +I +WF  D 
Sbjct  12   FLTPDESAQIDAALLSSSEKFLTRLTISSLRILQHIAQEYELPIEQLTAKQIINWFESDG  71

Query  503  KLKREQNLESAVLQW  547
            K++RE+ +E A L+W
Sbjct  72   KIRREKGVEEAFLKW  86



>ref|WP_008313079.1| hypothetical protein [Leptolyngbya sp. PCC 6406]
Length=94

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + +   E+FL RLTIS+  LLK I++  G PIE L   +I  WF  D 
Sbjct  8    FLTPEESAAVDRALMTTPEKFLTRLTISTAKLLKAIAQDLGTPIEALTPEQIIAWFEADA  67

Query  503  KLKREQNLESAVLQWDSSEFQ  565
            K K+EQ + ++VL+W + E +
Sbjct  68   KRKQEQGVNASVLKWQAPELE  88



>ref|WP_015213827.1| hypothetical protein [Anabaena cylindrica]
 ref|YP_007156088.1| hypothetical protein Anacy_1678 [Anabaena cylindrica PCC 7122]
 gb|AFZ57178.1| hypothetical protein Anacy_1678 [Anabaena cylindrica PCC 7122]
Length=86

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEE+  V+ + L + E+FL RLTISSL +L+ I++     IE+L   ++  WF KD 
Sbjct  12   FLTLEESAKVDAALLSSPEKFLTRLTISSLRILQYIAKDYEVAIEDLTTPQVIAWFEKDA  71

Query  503  KLKREQNLESAVLQW  547
            K++RE+ +E A L+W
Sbjct  72   KIRREEGIEEAFLKW  86



>ref|WP_036485938.1| hypothetical protein [Myxosarcina sp. GI1]
Length=79

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L   E+FL RLTISSL LL +I++  G  +EEL   ++  W   D 
Sbjct  5    FLSPEESADVDAALLSNSEKFLTRLTISSLRLLTIIAKDTGVAVEELTPKQVITWMENDS  64

Query  503  KLKREQNLESAVLQW  547
            K++REQ +++AVL+W
Sbjct  65   KVRREQGIDAAVLKW  79



>ref|WP_035154705.1| hypothetical protein [Calothrix sp. 336/3]
 gb|KFB84487.1| hypothetical protein IJ00_17695 [Calothrix sp. 336/3]
Length=85

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT  E+  V+ + L + E+FL R+T+SSL LL  I+++ G  +E L   +I  WF KD 
Sbjct  11   FLTATESAQVDAALLSSPEKFLTRITLSSLKLLIHIAQEYGVAVENLTNQQIIAWFEKDS  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ +ESA L+W
Sbjct  71   KIRREQGIESAYLKW  85



>ref|WP_007306397.1| hypothetical protein [Crocosphaera watsonii]
 gb|EAM49901.1| hypothetical protein CwatDRAFT_3030 [Crocosphaera watsonii WH 
8501]
 gb|EHJ12224.1| hypothetical protein CWATWH0003_3066 [Crocosphaera watsonii WH 
0003]
 emb|CCQ62287.1| hypothetical protein CWATWH0401_2737 [Crocosphaera watsonii WH 
0401]
 emb|CCQ53023.1| FIG00568091: hypothetical protein [Crocosphaera watsonii WH 8502]
 emb|CCQ54042.1| hypothetical protein CWATWH0005_122 [Crocosphaera watsonii WH 
0005]
 emb|CCQ65354.1| hypothetical protein CWATWH0402_1224 [Crocosphaera watsonii WH 
0402]
Length=84

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL  EE+  V+ + L A E+FL RLTISSL LL +I++     +E+L   +I DWF KD 
Sbjct  10   FLAPEESADVDKALLTAPEKFLTRLTISSLRLLTIIAQDIDVSLEDLTHQQIIDWFEKDG  69

Query  503  KLKREQNLESAVLQW  547
            K++RE+  E+AVL+W
Sbjct  70   KIRREKGEEAAVLKW  84



>ref|WP_039200507.1| hypothetical protein [Aphanizomenon flos-aquae]
 gb|KHG42509.1| hypothetical protein OA07_05025 [Aphanizomenon flos-aquae 2012/KM/D3]
Length=86

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L + E+FL RLTISSL +L+ I+++   PIEEL   +I  WF  D 
Sbjct  12   FLSSEESAQVDAALLSSPEKFLTRLTISSLRILQHIAKEYDVPIEELTTKQIITWFEIDA  71

Query  503  KLKREQNLESAVLQW  547
            K++RE+ +E A L+W
Sbjct  72   KVRREKGIEEAFLKW  86



>ref|WP_024546229.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=81

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT +E+  V+ + L + E+FL RLTISS  LL +I++   C IE+L+  +I  WF KD 
Sbjct  7    FLTPDESLDVDAAQLTSPEKFLTRLTISSQRLLGIIAQDLDCSIEQLSHQQIIQWFEKDA  66

Query  503  KLKREQNLESAVLQW  547
            K+++EQ  E+AVL+W
Sbjct  67   KIRQEQGPETAVLKW  81



>ref|WP_012306999.1| hypothetical protein [Synechococcus sp. PCC 7002]
 ref|YP_001734632.1| hypothetical protein SYNPCC7002_A1380 [Synechococcus sp. PCC 
7002]
 gb|ACA99376.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
Length=82

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  323  TFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD  502
             FLT EE+  V+ + L + E+FL RLTISS  LL +I++   CPIE L+   I  WF KD
Sbjct  7    NFLTPEESLDVDAALLSSPEKFLARLTISSQRLLGIIAQDLDCPIENLSHKEIIQWFEKD  66

Query  503  -KLKREQNLESAVLQW  547
             K ++E+  E+AVL+W
Sbjct  67   AKTRQEEGPEAAVLKW  82



>ref|WP_015151530.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007088839.1| hypothetical protein Oscil6304_5433 [Oscillatoria acuminata PCC 
6304]
 gb|AFY84919.1| hypothetical protein Oscil6304_5433 [Oscillatoria acuminata PCC 
6304]
Length=84

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L +HE+FL RLTISSL LL+ I+   G  +E L    I  WF KD 
Sbjct  10   FLTPEESYAVDGALLASHEKFLTRLTISSLKLLRHIATDSGVSMEALTHEEIIAWFEKDA  69

Query  503  KLKREQNLESAVLQW  547
            KL+ EQ  ++A L+W
Sbjct  70   KLRYEQGPDAAFLKW  84



>ref|WP_015132581.1| hypothetical protein [Leptolyngbya sp. PCC 7376]
 ref|YP_007069629.1| hypothetical protein Lepto7376_0356 [Leptolyngbya sp. PCC 7376]
 gb|AFY36795.1| hypothetical protein Lepto7376_0356 [Leptolyngbya sp. PCC 7376]
Length=80

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT +E+  V+ + L + E+FL RLTISS  LL +I+    C I +L   +I +WF KD 
Sbjct  6    FLTEDESLSVDAALLSSPEKFLARLTISSHRLLAIIAADRDCAIADLEYQQIIEWFEKDS  65

Query  503  KLKREQNLESAVLQW  547
            K++REQ +++AVL+W
Sbjct  66   KVRREQGVDAAVLKW  80



>ref|WP_030006577.1| hypothetical protein [Synechococcus sp. NKBG042902]
Length=80

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +2

Query  323  TFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD  502
             FLT EE+  V+ + L + E+FL RLTISS  LL +I++   CPIE L+   I  WF KD
Sbjct  5    NFLTPEESLDVDAALLSSPEKFLARLTISSQRLLGIIAQDLDCPIENLSHKEIIQWFEKD  64

Query  503  -KLKREQNLESAVLQW  547
             K ++E+  E+A+L+W
Sbjct  65   AKTRQEKGPEAAILKW  80



>ref|WP_015218105.1| hypothetical protein [Cyanobacterium aponinum]
 ref|YP_007160417.1| hypothetical protein Cyan10605_0219 [Cyanobacterium aponinum 
PCC 10605]
 gb|AFZ52373.1| hypothetical protein Cyan10605_0219 [Cyanobacterium aponinum 
PCC 10605]
Length=81

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            + FLT EE+  VE S L + E+FL RLTISSL +L++I++     ++ L++ +I  W  K
Sbjct  5    QQFLTQEESLAVEASLLTSEEKFLTRLTISSLRVLQLIAQDLDVSVDSLSSEQIIAWMEK  64

Query  500  D-KLKREQNLESAVLQW  547
            D K++REQ ++ A+L+W
Sbjct  65   DSKVRREQGIDKAILKW  81



>ref|WP_015122733.1| hypothetical protein [Rivularia sp. PCC 7116]
 ref|YP_007059731.1| hypothetical protein Riv7116_6870 [Rivularia sp. PCC 7116]
 gb|AFY59184.1| hypothetical protein Riv7116_6870 [Rivularia sp. PCC 7116]
Length=85

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ +E+  V+ + L + E+FL RLTISSL +L+ I+++    IEEL   +I  WF KD 
Sbjct  11   FLSSQESAKVDAALLSSPEKFLTRLTISSLRVLQQIAKENNIAIEELTTPQIIAWFEKDG  70

Query  503  KLKREQNLESAVLQW  547
            K++R++ +E+A L+W
Sbjct  71   KIRRDEGVEAAFLKW  85



>ref|WP_008236066.1| hypothetical protein [Richelia intracellularis]
 emb|CCH68425.1| hypothetical protein RINTHH_22700 [Richelia intracellularis HH01]
Length=82

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT+EE   +  + L + E+FL RLTISSL LL  I+++    IE+L +  +  WF KD 
Sbjct  8    FLTVEELNRINEALLSSPEKFLTRLTISSLRLLTYIAQEYDLAIEDLTSEHVIIWFEKDS  67

Query  503  KLKREQNLESAVLQW  547
            K+K EQ LE+A L+W
Sbjct  68   KIKVEQGLEAAYLKW  82



>ref|WP_028082502.1| hypothetical protein [Dolichospermum circinale]
Length=86

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L + E+FL RLTISSL +L+ I+++    IEEL   +I  WF  D 
Sbjct  12   FLSAEESAQVDAALLSSPEKFLTRLTISSLRILQHIAQEYDVSIEELTTKQIITWFETDA  71

Query  503  KLKREQNLESAVLQW  547
            K++RE+ ++ A L+W
Sbjct  72   KIRREKGIDQAFLKW  86



>ref|WP_039725466.1| hypothetical protein [Lyngbya confervoides]
 gb|KIF13799.1| hypothetical protein QP59_22760 [Aphanocapsa montana BDHKU210001]
 gb|KIF38736.1| hypothetical protein QQ91_15760 [Lyngbya confervoides BDU141951]
Length=93

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L + E+FL RLTIS+  LLK I+E    PI EL   +I  WF  D 
Sbjct  8    FLTPEESADVDKALLTSPEKFLTRLTISTSKLLKAIAEDCETPISELTPQQIIQWFEADS  67

Query  503  KLKREQNLESAVLQWDSSEFQ  565
            K K+EQ + ++VL+W++ + +
Sbjct  68   KRKQEQGINASVLKWEAQDLK  88



>ref|WP_006530311.1| hypothetical protein [Gloeocapsa sp. PCC 73106]
 gb|ELR96796.1| hypothetical protein GLO73106DRAFT_00005950 [Gloeocapsa sp. PCC 
73106]
Length=79

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT  E+  V+ + L + E+FL RLTISSL LLK+I+      +EEL   ++  WF KD 
Sbjct  5    FLTPAESEDVDRALLSSSEKFLTRLTISSLRLLKIIAADLNVSVEELTHEQLISWFEKDA  64

Query  503  KLKREQNLESAVLQW  547
             LKREQ +++A L+W
Sbjct  65   ALKREQGIDAATLKW  79



>ref|WP_015166455.1| hypothetical protein [Pseudanabaena sp. PCC 7367]
 ref|YP_007103929.1| hypothetical protein Pse7367_3258 [Pseudanabaena sp. PCC 7367]
 gb|AFY71501.1| hypothetical protein Pse7367_3258 [Pseudanabaena sp. PCC 7367]
Length=83

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+ LV+ + + + E+FL RLTISS+ ++  I+++ G  +E+L   +I  W  +D 
Sbjct  9    FLSEEESALVDRAMMSSSEKFLTRLTISSMRVVLHIAKEHGVKVEDLTVSQIIAWMEQDA  68

Query  503  KLKREQNLESAVLQW  547
            K+KREQ   +A LQW
Sbjct  69   KIKREQGEAAAFLQW  83



>ref|WP_015222869.1| hypothetical protein [Cyanobacterium stanieri]
 ref|YP_007165201.1| hypothetical protein Cyast_1591 [Cyanobacterium stanieri PCC 
7202]
 gb|AFZ47552.1| hypothetical protein Cyast_1591 [Cyanobacterium stanieri PCC 
7202]
Length=82

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            + +L+ EE+  VE++ L + E+FL RLTISSL LLK+I+      I +L   +I  W  K
Sbjct  5    QQYLSQEESMEVEMALLTSQEKFLTRLTISSLRLLKIIAADLQVEISQLTPQQIITWMEK  64

Query  500  D-KLKREQNLESAVLQWD  550
            D K++RE+ ++ AVL+W+
Sbjct  65   DSKIRREEGIDKAVLKWE  82



>ref|WP_019501895.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=170

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            R FLT EEA  V+ + L   E+F+ R+TISS+ +L  I++  G  +EEL   +I  W   
Sbjct  12   RKFLTPEEAHAVDGAMLSTMEKFMTRITISSVRVLSHIAQSYGLHVEELQTSQIVAWIES  71

Query  500  D-KLKREQNLESAVLQWDS  553
            D K++REQ   +A LQW S
Sbjct  72   DAKIRREQGEAAAFLQWSS  90



>ref|WP_015080923.1| hypothetical protein [Anabaena sp. 90]
 ref|YP_006997590.1| hypothetical protein ANA_C13089 [Anabaena sp. 90]
 gb|AFW95777.1| hypothetical protein ANA_C13089 [Anabaena sp. 90]
Length=86

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L + E+FL RLTISSL +L+ I+++    IEEL   +I  WF  D 
Sbjct  12   FLSSEESAQVDAALLSSPEKFLSRLTISSLRILQHIAQEYDVSIEELTTKQIITWFEIDA  71

Query  503  KLKREQNLESAVLQW  547
            K++RE+ +E A L+W
Sbjct  72   KIRREKGIEEAFLKW  86



>ref|WP_013190240.1| hypothetical protein [Trichormus azollae]
 ref|YP_003720345.1| hypothetical protein Aazo_0794 ['Nostoc azollae' 0708]
 gb|ADI63222.1| conserved hypothetical protein ['Nostoc azollae' 0708]
Length=86

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTL+E+  V+ + L + E+FL RLTISSL +L+ I+++    IEEL   +I +WF  D 
Sbjct  12   FLTLDESSQVDAALLSSPEKFLTRLTISSLRILQHIAKEYDVRIEELTTKQIINWFEIDA  71

Query  503  KLKREQNLESAVLQW  547
            +++RE+ +E A L+W
Sbjct  72   EIRREKGVEEAFLKW  86



>ref|WP_015169309.1| hypothetical protein [Synechococcus sp. PCC 7502]
 ref|YP_007106789.1| hypothetical protein Syn7502_02702 [Synechococcus sp. PCC 7502]
 gb|AFY74654.1| hypothetical protein Syn7502_02702 [Synechococcus sp. PCC 7502]
Length=82

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ +E+  V+ + L  HE+FL RLTISS+ LL  I++     +EEL A ++  WF +D 
Sbjct  8    FLSTDESIAVDGALLSQHEKFLTRLTISSMRLLIHIAQDYQVTVEELKADQVIKWFERDA  67

Query  503  KLKREQNLESAVLQW  547
            K++ EQ  E+A L+W
Sbjct  68   KIRHEQGSEAAFLKW  82



>ref|WP_027402419.1| hypothetical protein [Aphanizomenon flos-aquae]
Length=86

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L + E+FL RLTISSL +L+ I+++    IEEL   +I  WF  D 
Sbjct  12   FLSSEESAQVDAALLSSPEKFLTRLTISSLRILQHIAKEYDVSIEELTTKQIITWFEIDA  71

Query  503  KLKREQNLESAVLQW  547
            K++RE+ +E A L+W
Sbjct  72   KVRREKGIEEAFLKW  86



>ref|WP_016951204.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=86

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FL+ EE+  V+ + L + E+FL RLTISSL +L+ I+++    IEEL   +I  WF  D 
Sbjct  12   FLSSEESAQVDAALLSSPEKFLTRLTISSLRILQHIAKEYDVSIEELTTKQIIVWFEIDA  71

Query  503  KLKREQNLESAVLQW  547
            K++RE+ +E A L+W
Sbjct  72   KIRREKGVEEAFLKW  86



>gb|AIE74266.1| hypothetical protein D082_17380 [Synechocystis sp. PCC 6714]
Length=81

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            + FLT  E+  V+ + L   E+FL RLTISS  LL+ I+ +E   I  L    I  WF K
Sbjct  5    QQFLTPAESHAVDGAMLSQSEKFLTRLTISSFRLLQTIAAEEQQAIANLTPEMIIAWFEK  64

Query  500  D-KLKREQNLESAVLQW  547
            D K KREQ  E AVL W
Sbjct  65   DAKRKREQGPEKAVLDW  81



>ref|WP_019506344.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=82

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            +L+ EE+  V+ + L + E+FL RLTISS  LL+ I++     +EEL   +I  WF  D 
Sbjct  8    YLSPEESADVDAALLSSSEKFLTRLTISSQRLLQKIAQDSQVSVEELTHHQIIQWFENDS  67

Query  503  KLKREQNLESAVLQW  547
            K+KREQ   +  L+W
Sbjct  68   KIKREQGDNAGTLKW  82



>ref|WP_010874268.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_442975.1| hypothetical protein ssr2781 [Synechocystis sp. PCC 6803]
 ref|YP_005384842.1| hypothetical protein SYNGTI_3080 [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005388011.1| hypothetical protein SYNPCCP_3079 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005410718.1| hypothetical protein SYNPCCN_3079 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005653034.1| hypothetical protein SYNGTS_3081 [Synechocystis sp. PCC 6803]
 ref|YP_007452850.1| hypothetical protein MYO_131170 [Synechocystis sp. PCC 6803]
 dbj|BAA18787.1| ssr2781 [Synechocystis sp. PCC 6803]
 dbj|BAK51829.1| hypothetical protein SYNGTS_3081 [Synechocystis sp. PCC 6803]
 dbj|BAL30827.1| hypothetical protein SYNGTI_3080 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL33996.1| hypothetical protein SYNPCCN_3079 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL37165.1| hypothetical protein SYNPCCP_3079 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM53342.1| hypothetical protein BEST7613_4411 [Bacillus subtilis BEST7613]
 gb|AGF53336.1| hypothetical protein MYO_131170 [Synechocystis sp. PCC 6803]
Length=83

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLK  499
            + FLT  E+  V+ + L   E+FL RLTISS  LL+ I+ +E   I +L    I  WF K
Sbjct  7    QQFLTPAESHAVDGALLSQSEKFLTRLTISSFRLLQTIAAEEQLAIADLTPEIIIAWFEK  66

Query  500  D-KLKREQNLESAVLQW  547
            D K KREQ  E  VL W
Sbjct  67   DAKRKREQGTEKPVLDW  83



>ref|WP_036531402.1| hypothetical protein [Neosynechococcus sphagnicola]
 gb|KGF73378.1| hypothetical protein DO97_19990 [Neosynechococcus sphagnicola 
sy1]
Length=85

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTL+++  V+ + L +HE+FL RLT+SSL LLK I+++   PIE L   ++  WF +D 
Sbjct  11   FLTLDQSAQVDAALLSSHEKFLTRLTLSSLKLLKHIAQENQIPIENLTTPQVIAWFEQDS  70

Query  503  KLKREQNLESAVLQW  547
            K++REQ  E+A LQW
Sbjct  71   KVRREQGSEAAYLQW  85



>ref|WP_006515511.1| hypothetical protein [Leptolyngbya sp. PCC 7375]
 gb|EKV01106.1| hypothetical protein Lepto7375DRAFT_3249 [Leptolyngbya sp. PCC 
7375]
Length=94

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L   E+FL RLT+S+  LL  I++     ++EL   +I  WF  D 
Sbjct  8    FLTPEESAEVDKALLTTPEKFLTRLTLSTAKLLAFIAKDMDTSVDELTTAQIITWFEADS  67

Query  503  KLKREQNLESAVLQWDSSEFQ  565
            K K+EQ + ++VL+W+++  +
Sbjct  68   KRKQEQGINASVLKWEATNLE  88



>ref|XP_009399210.1| PREDICTED: uncharacterized protein LOC103983676 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=104

 Score = 55.5 bits (132),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTI  406
            RR+FL+LEEAGLVE+SGL+ HERFLCRLT+
Sbjct  54   RRSFLSLEEAGLVEMSGLNTHERFLCRLTV  83


 Score = 27.7 bits (60),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  403  DIITKFTESNIRARRVSNRGA  465
            DIIT+  ES+IRA R S RGA
Sbjct  84   DIITESAESDIRAGRSSYRGA  104



>ref|WP_015157718.1| hypothetical protein [Chamaesiphon minutus]
 ref|YP_007095050.1| hypothetical protein Cha6605_0221 [Chamaesiphon minutus PCC 6605]
 gb|AFY91523.1| hypothetical protein Cha6605_0221 [Chamaesiphon minutus PCC 6605]
Length=81

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +2

Query  320  RTFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEG-CPIEELNAGRICDWFL  496
            + +LT  EA  VE + L  HE+FL R+TISSL +L+ I++ E    IE+L   +I  WF 
Sbjct  4    KQYLTHAEALEVEAALLSTHEKFLTRITISSLRMLQQIADDEQVAKIEDLTPQQIIKWFE  63

Query  497  KD-KLKREQNLESAVLQW  547
            +D + KR Q   +  LQW
Sbjct  64   RDAETKRSQGDTAGTLQW  81



>ref|WP_023074237.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
 gb|ESA34959.1| hypothetical protein N836_14455 [Leptolyngbya sp. Heron Island 
J]
Length=94

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L   E+FL RLT+S+  LL  I++     +++L   +I  WF  D 
Sbjct  8    FLTPEESAEVDKALLTTPEKFLTRLTLSTAKLLAFIAKDLETSVDDLTTAQIIAWFEVDA  67

Query  503  KLKREQNLESAVLQWDS  553
            K K+EQ + ++VL+WD+
Sbjct  68   KRKQEQGISASVLKWDA  84



>ref|WP_006455894.1| hypothetical protein [Synechococcus sp. PCC 7335]
 gb|EDX86135.1| hypothetical protein S7335_3838 [Synechococcus sp. PCC 7335]
Length=90

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT EE+  V+ + L   E+FL RLT+S+  LL  I++  G  +E L+  +I  WF  D 
Sbjct  5    FLTEEESAAVDAALLTTPEKFLTRLTLSTGKLLVYIAKDLGTTVEALDNQQIIAWFEADS  64

Query  503  KLKREQNLESAVLQWDS  553
            K K+ + ++S+VL+WD+
Sbjct  65   KRKQLEGIQSSVLKWDA  81



>ref|WP_022604816.1| hypothetical protein [Rubidibacter lacunae]
 gb|ERN42579.1| hypothetical protein KR51_00007370 [Rubidibacter lacunae KORDI 
51-2]
Length=116

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            +LT EE+  V+ + LD+ ERFL RLTISS  LL+ I+      + +L   +I  WF ++ 
Sbjct  42   YLTPEESTDVDKALLDSEERFLTRLTISSHRLLQTIARDLDVAMTDLTHQQIVAWFERES  101

Query  503  KLKREQNLESAVLQW  547
            K +REQ  +++ L+W
Sbjct  102  KARREQGPDASTLKW  116



>ref|XP_010905554.1| PREDICTED: uncharacterized protein LOC105032725 isoform X3 [Elaeis 
guineensis]
Length=119

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISS  412
            +R+FL+LEEAGLVEISGL  HERFLCRLT SS
Sbjct  54   KRSFLSLEEAGLVEISGLSTHERFLCRLTDSS  85



>ref|XP_010905555.1| PREDICTED: uncharacterized protein LOC105032725 isoform X4 [Elaeis 
guineensis]
Length=113

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  317  RRTFLTLEEAGLVEISGLDAHERFLCRLTISS  412
            +R+FL+LEEAGLVEISGL  HERFLCRLT SS
Sbjct  54   KRSFLSLEEAGLVEISGLSTHERFLCRLTDSS  85



>ref|WP_009628284.1| hypothetical protein [Pseudanabaena biceps]
 gb|ELS31628.1| hypothetical protein Pse7429DRAFT_3135 [Pseudanabaena biceps 
PCC 7429]
Length=166

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  368  LDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-KLKREQNLESAVLQ  544
            L +HE+FL R+ IS++  L  I++     +EEL+A +I  W  +D K+KREQ LE+A L 
Sbjct  106  LSSHEKFLTRMVISAMQALGAIAKDYSIHLEELSAEQIIAWVERDAKVKREQGLEAAFLS  165

Query  545  W  547
            W
Sbjct  166  W  166


 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLTLEEA  ++ + L   E+F+ R+TISSL ++  I++      EEL+  +I  W   D 
Sbjct  10   FLTLEEARAIDGAMLSMMEKFMTRITISSLRIIAKIAQGLSVHAEELSPQQIVQWIEHDS  69

Query  503  KLKREQNLESAVLQWDS  553
            ++++EQ  ++A L+W S
Sbjct  70   QVRQEQGEDAAFLKWTS  86



>ref|WP_017294235.1| hypothetical protein [Geminocystis herdmanii]
Length=81

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD-  502
            FLT  E+  VE + L + E+FL RLTISS  LL++I++     IE L + +I  W  KD 
Sbjct  7    FLTETESIEVEKALLTSSEKFLTRLTISSFKLLQIIAQDLEISIENLTSEQIILWMEKDS  66

Query  503  KLKREQNLESAVLQW  547
            ++KRE+  +  +L+W
Sbjct  67   RIKREKGEDQGILKW  81



>ref|WP_015122813.1| hypothetical protein [Synechococcus sp. PCC 6312]
 ref|YP_007059812.1| hypothetical protein Syn6312_0009 [Synechococcus sp. PCC 6312]
 gb|AFY59269.1| hypothetical protein Syn6312_0009 [Synechococcus sp. PCC 6312]
Length=132

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +2

Query  323  TFLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKD  502
            T LTLEEA  +E + L A ERFL R+ + SL  LK ++EQE   + +L+   I  W  +D
Sbjct  12   TLLTLEEAQAIEQTVLPAQERFLIRVALYSLRYLKPMAEQEQISLNQLSPELIYQWLEQD  71

Query  503  K-LKREQNLESAVLQW  547
            + L  E++     L W
Sbjct  72   ETLLGEEHQSPGFLTW  87



>ref|WP_017717489.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=136

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKDK  505
            FLTLEEA  V+ + + + E+F  RL I +L  LK I+   GC +EE+   ++  W   D+
Sbjct  11   FLTLEEAAEVDKALMSSREKFSTRLAIYALRSLKEIAGNTGCALEEVTPAQVRAWIENDR  70

Query  506  -LKREQNLES  532
             +KR+ ++++
Sbjct  71   SVKRDSDIDT  80



>ref|WP_009787485.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW33935.1| hypothetical protein L8106_15739 [Lyngbya sp. PCC 8106]
Length=125

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKDK  505
            FLT EEA  V+ + L + E+F  RL I +L  LK I+ ++   IE + A ++ DW  KD+
Sbjct  7    FLTSEEAIQVDAALLSSKEKFSTRLAIYALRCLKQIAAEKEISIEAVTAQQVSDWIKKDE  66

Query  506  LKREQNLE  529
             K +Q LE
Sbjct  67   -KMQQQLE  73



>ref|WP_007353115.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN53888.1| conserved hypothetical protein [ [[Oscillatoria] sp. PCC 6506]
Length=135

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  326  FLTLEEAGLVEISGLDAHERFLCRLTISSLNLLKVISEQEGCPIEELNAGRICDWFLKDK  505
            FLT EE   V+I+ L A E+F  RL I +L +LK I+++ G  +E +   ++ +W  KD+
Sbjct  7    FLTAEECAEVDIALLSAKEKFSTRLAIYALRVLKQIAQETGLTVEAITNQQVANWIEKDE  66

Query  506  -LKREQNLESA  535
             +K+E  ++++
Sbjct  67   SIKQEIEVDAS  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1017575415288