BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c90510_g1_i1 len=349 path=[327:0-348]

Length=349
                                                                      Score     E

ref|XP_009769005.1|  PREDICTED: NAC domain-containing protein 68-...  91.7    5e-20   
ref|XP_009589539.1|  PREDICTED: NAC domain-containing protein 78-...  88.6    6e-19   
ref|XP_004244376.2|  PREDICTED: NAC domain-containing protein 102...  72.0    4e-13   
ref|XP_002529759.1|  conserved hypothetical protein                   69.7    1e-12   Ricinus communis
ref|XP_009602357.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  68.9    2e-12   
ref|XP_007010701.1|  Transcription factor-like protein                68.9    5e-12   
ref|XP_008226300.1|  PREDICTED: NAC domain-containing protein 19-...  69.3    7e-12   
gb|ACF19785.1|  NAC transcription factor                              68.9    8e-12   Nicotiana tabacum [American tobacco]
gb|ACF19788.1|  NAC transcription factor                              68.2    8e-12   Nicotiana tabacum [American tobacco]
ref|XP_002529756.1|  conserved hypothetical protein                   69.3    1e-11   Ricinus communis
ref|XP_002530971.1|  transcription factor, putative                   70.5    1e-11   Ricinus communis
ref|XP_009801092.1|  PREDICTED: NAC domain-containing protein 90-...  68.6    2e-11   
ref|XP_008347110.1|  PREDICTED: NAC domain-containing protein 12-...  68.6    2e-11   
ref|XP_009630818.1|  PREDICTED: protein SOMBRERO-like                 67.8    2e-11   
ref|XP_009370823.1|  PREDICTED: NAC domain-containing protein 7-like  68.2    2e-11   
ref|XP_009787362.1|  PREDICTED: NAC transcription factor 29-like      68.6    3e-11   
ref|XP_009617292.1|  PREDICTED: NAC transcription factor 29-like      68.6    3e-11   
ref|XP_009627678.1|  PREDICTED: protein SOMBRERO-like                 67.4    3e-11   
ref|XP_006348977.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 3-like   67.0    3e-11   
ref|XP_010322988.1|  PREDICTED: NAC domain-containing protein 45-...  68.9    4e-11   
ref|XP_007213429.1|  hypothetical protein PRUPE_ppa025596mg           66.6    4e-11   
ref|XP_007213476.1|  hypothetical protein PRUPE_ppa023804mg           68.2    6e-11   
ref|XP_008361192.1|  PREDICTED: NAC domain-containing protein 12-...  67.4    6e-11   
ref|XP_008226305.1|  PREDICTED: NAC domain-containing protein 66-...  66.6    6e-11   
ref|XP_009774958.1|  PREDICTED: protein ATAF2-like                    67.8    6e-11   
ref|XP_008337178.1|  PREDICTED: NAC domain-containing protein 12-...  67.0    6e-11   
ref|XP_008368783.1|  PREDICTED: NAC domain-containing protein 12-...  67.0    6e-11   
ref|XP_008368782.1|  PREDICTED: NAC domain-containing protein 7-like  66.2    7e-11   
ref|XP_008355426.1|  PREDICTED: NAC domain-containing protein 12-...  66.6    8e-11   
ref|XP_008368781.1|  PREDICTED: NAC domain-containing protein 12-...  66.6    9e-11   
ref|XP_009782736.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 1-like   67.0    9e-11   
ref|XP_009370821.1|  PREDICTED: NAC domain-containing protein 7-like  66.2    1e-10   
ref|XP_006366896.1|  PREDICTED: NAC domain-containing protein 78-...  65.9    1e-10   
ref|XP_009763090.1|  PREDICTED: uncharacterized protein LOC104215049  67.0    2e-10   
ref|XP_004234876.2|  PREDICTED: NAC transcription factor 29-like      65.5    2e-10   
ref|XP_009770805.1|  PREDICTED: protein SOMBRERO-like                 64.3    3e-10   
ref|XP_007213127.1|  hypothetical protein PRUPE_ppa024063mg           64.3    3e-10   
ref|XP_009370828.1|  PREDICTED: NAC domain-containing protein 68-...  65.5    3e-10   
ref|XP_009786835.1|  PREDICTED: NAC domain-containing protein 19-...  66.2    3e-10   
ref|XP_009794230.1|  PREDICTED: NAC domain-containing protein 78-...  65.9    3e-10   
ref|XP_009798779.1|  PREDICTED: putative NAC domain-containing pr...  65.9    4e-10   
gb|ACF19787.1|  NAC transcription factor                              63.9    5e-10   Nicotiana tabacum [American tobacco]
ref|XP_009630787.1|  PREDICTED: protein SOMBRERO-like                 63.9    5e-10   
ref|XP_009762991.1|  PREDICTED: NAC domain-containing protein 78-...  65.1    5e-10   
ref|XP_006359056.1|  PREDICTED: NAC domain-containing protein 78-...  64.7    5e-10   
ref|XP_007010727.1|  Transcription factor-like protein                63.2    5e-10   
ref|XP_008228498.1|  PREDICTED: protein BEARSKIN1-like                65.1    7e-10   
ref|XP_007204918.1|  hypothetical protein PRUPE_ppa019675mg           65.1    7e-10   
ref|XP_009370826.1|  PREDICTED: NAC domain-containing protein 68-...  64.3    7e-10   
ref|XP_008227178.1|  PREDICTED: NAC domain-containing protein 2-like  64.7    8e-10   
ref|XP_008245774.1|  PREDICTED: NAC domain-containing protein 67-...  63.2    9e-10   
ref|XP_009789986.1|  PREDICTED: NAC domain-containing protein 78-...  63.2    9e-10   
ref|XP_007213177.1|  hypothetical protein PRUPE_ppa027019mg           64.7    1e-09   
ref|XP_006437291.1|  hypothetical protein CICLE_v10033436mg           64.3    1e-09   
ref|XP_008227089.1|  PREDICTED: NAC domain-containing protein 2-like  64.3    1e-09   
ref|XP_008218760.1|  PREDICTED: uncharacterized protein LOC103319043  64.3    1e-09   
ref|XP_009621726.1|  PREDICTED: uncharacterized protein LOC104113311  64.3    1e-09   
ref|XP_009370825.1|  PREDICTED: NAC domain-containing protein 7-like  63.5    1e-09   
ref|XP_006388817.1|  hypothetical protein POPTR_0097s00280g           63.5    2e-09   
ref|XP_009772253.1|  PREDICTED: NAC domain-containing protein 2-like  62.4    2e-09   
ref|XP_009603640.1|  PREDICTED: protein BEARSKIN1-like                62.4    2e-09   
ref|XP_009590494.1|  PREDICTED: protein SOMBRERO-like                 62.4    2e-09   
ref|XP_004236507.2|  PREDICTED: NAC domain-containing protein 2-like  62.4    2e-09   
ref|XP_009793650.1|  PREDICTED: protein SOMBRERO-like                 62.0    2e-09   
ref|XP_004497954.1|  PREDICTED: NAC domain-containing protein 68-...  62.8    2e-09   
ref|XP_003590172.1|  NAC domain protein                               63.2    2e-09   
ref|XP_008465646.1|  PREDICTED: NAC domain-containing protein 72-...  62.8    3e-09   
ref|XP_009612742.1|  PREDICTED: NAC domain-containing protein 78-...  62.0    3e-09   
ref|XP_006437042.1|  hypothetical protein CICLE_v10033879mg           63.5    3e-09   
ref|XP_006356572.1|  PREDICTED: NAC transcription factor 25-like      63.2    3e-09   
ref|XP_006348969.1|  PREDICTED: uncharacterized protein LOC102606428  61.2    3e-09   
ref|XP_007216175.1|  hypothetical protein PRUPE_ppa015761mg           63.2    4e-09   
ref|XP_008443554.1|  PREDICTED: protein SOMBRERO-like                 62.0    4e-09   
ref|XP_007216726.1|  hypothetical protein PRUPE_ppa025721mg           62.8    4e-09   
ref|XP_006422232.1|  hypothetical protein CICLE_v10006869mg           61.2    4e-09   
ref|XP_002533045.1|  NAC domain-containing protein, putative          62.8    4e-09   Ricinus communis
ref|XP_009600309.1|  PREDICTED: NAC domain-containing protein 76-...  62.4    4e-09   
gb|KDO61624.1|  hypothetical protein CISIN_1g046632mg                 60.8    5e-09   
ref|XP_007212744.1|  hypothetical protein PRUPE_ppa019456mg           60.8    5e-09   
ref|XP_008245708.1|  PREDICTED: NAC domain-containing protein 67-...  62.4    5e-09   
ref|XP_009760677.1|  PREDICTED: NAC domain-containing protein 78-...  61.2    5e-09   
gb|KDO37354.1|  hypothetical protein CISIN_1g041697mg                 60.8    6e-09   
ref|XP_002313991.1|  hypothetical protein POPTR_0009s07640g           60.5    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009784097.1|  PREDICTED: NAC domain-containing protein 78-...  60.8    6e-09   
ref|XP_006475540.1|  PREDICTED: NAC domain-containing protein 2-like  60.8    7e-09   
ref|XP_006437282.1|  hypothetical protein CICLE_v10033459mg           60.1    7e-09   
ref|XP_006495077.1|  PREDICTED: NAC domain-containing protein 18-...  60.1    7e-09   
gb|ACF19789.1|  NAC transcription factor                              60.5    8e-09   Nicotiana tabacum [American tobacco]
ref|XP_009591317.1|  PREDICTED: NAC domain-containing protein 78-...  60.8    8e-09   
ref|XP_009600052.1|  PREDICTED: NAC domain-containing protein 78-...  59.7    8e-09   
gb|KDO57718.1|  hypothetical protein CISIN_1g046003mg                 62.4    8e-09   
gb|ACF19790.1|  NAC transcription factor                              59.7    8e-09   Nicotiana tabacum [American tobacco]
ref|XP_009795944.1|  PREDICTED: protein ATAF2-like                    60.5    9e-09   
gb|AGL39738.1|  NAC transcription factor 082                          60.5    9e-09   
ref|XP_009341990.1|  PREDICTED: NAC transcription factor ONAC010-...  59.7    1e-08   
ref|XP_009604942.1|  PREDICTED: NAC domain-containing protein 2-like  61.2    1e-08   
ref|XP_004490175.1|  PREDICTED: NAC transcription factor 25-like      61.6    1e-08   
ref|XP_006432683.1|  hypothetical protein CICLE_v10003273mg           60.1    1e-08   
gb|KDP42192.1|  hypothetical protein JCGZ_02922                       59.7    1e-08   
ref|XP_007027186.1|  Uncharacterized protein TCM_022059               60.8    1e-08   
gb|KGN59694.1|  hypothetical protein Csa_3G838730                     60.8    1e-08   
ref|XP_006437287.1|  hypothetical protein CICLE_v10033541mg           61.2    1e-08   
ref|XP_004142192.1|  PREDICTED: NAC domain-containing protein 68-...  60.8    1e-08   
ref|XP_004139160.1|  PREDICTED: NAC domain-containing protein 68-...  60.5    1e-08   
ref|XP_006495078.1|  PREDICTED: NAC domain-containing protein 7-like  60.8    1e-08   
ref|XP_006437303.1|  hypothetical protein CICLE_v10033526mg           60.8    1e-08   
ref|XP_007019807.1|  Uncharacterized protein TCM_036193               60.8    2e-08   
gb|KGN66647.1|  hypothetical protein Csa_1G652300                     60.5    2e-08   
ref|XP_009792222.1|  PREDICTED: NAC domain-containing protein 78-...  60.1    2e-08   
ref|XP_009605650.1|  PREDICTED: NAC domain-containing protein 18-...  57.8    2e-08   
ref|XP_002529767.1|  transcription factor, putative                   59.7    3e-08   Ricinus communis
ref|XP_004228763.1|  PREDICTED: NAC domain-containing protein 78-...  58.9    4e-08   
gb|AES82706.2|  NAC transcription factor-like protein                 58.2    4e-08   
ref|XP_009601217.1|  PREDICTED: NAC domain-containing protein 78-...  58.9    4e-08   
ref|XP_006437271.1|  hypothetical protein CICLE_v10033719mg           59.7    4e-08   
ref|XP_009611780.1|  PREDICTED: uncharacterized protein LOC104105233  57.4    4e-08   
ref|XP_003626488.1|  NAC domain-containing protein                    58.2    5e-08   
ref|XP_006348012.1|  PREDICTED: NAC domain-containing protein 68-...  59.3    5e-08   
ref|XP_010058231.1|  PREDICTED: NAC domain-containing protein 68-...  59.3    5e-08   
ref|XP_006437279.1|  hypothetical protein CICLE_v10033536mg           59.3    5e-08   
ref|XP_009627656.1|  PREDICTED: NAC transcription factor NAM-B2-like  58.5    6e-08   
ref|XP_006437305.1|  hypothetical protein CICLE_v10033957mg           58.9    7e-08   
ref|XP_008361191.1|  PREDICTED: NAC domain-containing protein 12-...  58.9    7e-08   
ref|XP_004146370.1|  PREDICTED: NAC domain-containing protein 90-...  57.4    7e-08   
ref|XP_009631912.1|  PREDICTED: transcription factor JUNGBRUNNEN ...  58.2    8e-08   
ref|XP_006348968.1|  PREDICTED: NAC domain-containing protein 74-...  57.4    8e-08   
ref|XP_010058221.1|  PREDICTED: NAC transcription factor 29-like      58.5    9e-08   
ref|XP_004137930.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 1-like   56.6    9e-08   
ref|XP_009767422.1|  PREDICTED: NAC domain-containing protein 78-...  58.2    1e-07   
ref|XP_010317945.1|  PREDICTED: NAC domain-containing protein 2-like  57.8    1e-07   
ref|XP_010058220.1|  PREDICTED: NAC transcription factor 29-like      58.5    1e-07   
ref|XP_009761286.1|  PREDICTED: NAC domain-containing protein 2-like  58.5    1e-07   
ref|XP_006385817.1|  hypothetical protein POPTR_0003s14920g           56.6    1e-07   
ref|XP_010058219.1|  PREDICTED: NAC transcription factor 29-like      58.2    1e-07   
ref|XP_006345198.1|  PREDICTED: NAC domain-containing protein 78-...  57.4    1e-07   
ref|XP_010055621.1|  PREDICTED: NAC domain-containing protein 68-...  58.2    1e-07   
ref|XP_007019853.1|  Uncharacterized protein TCM_036236               58.2    1e-07   
ref|XP_006345197.1|  PREDICTED: NAC domain-containing protein 2-like  57.4    1e-07   
ref|XP_009794658.1|  PREDICTED: protein SOMBRERO-like                 57.0    2e-07   
ref|XP_008443625.1|  PREDICTED: NAC domain-containing protein 18-...  56.6    2e-07   
ref|XP_007019811.1|  Uncharacterized protein TCM_036197               57.8    2e-07   
gb|AGL39733.1|  NAC transcription factor 077                          56.2    2e-07   
ref|XP_009597084.1|  PREDICTED: NAC domain-containing protein 68-...  58.2    2e-07   
ref|XP_011003330.1|  PREDICTED: NAC domain-containing protein 4-like  57.8    2e-07   
ref|XP_008229046.1|  PREDICTED: NAC domain-containing protein 18-...  55.5    3e-07   
ref|XP_004306296.1|  PREDICTED: uncharacterized protein LOC101303446  57.4    3e-07   
gb|AGL39735.1|  NAC transcription factor 079                          57.0    3e-07   
ref|XP_006437281.1|  hypothetical protein CICLE_v10033346mg           57.0    3e-07   
gb|AGL39734.1|  NAC transcription factor 078                          56.2    3e-07   
gb|KCW72112.1|  hypothetical protein EUGRSUZ_E00551                   56.6    3e-07   
ref|XP_009766553.1|  PREDICTED: NAC domain-containing protein 78-...  55.1    4e-07   
gb|KDO36290.1|  hypothetical protein CISIN_1g038876mg                 54.7    4e-07   
gb|ACF19791.1|  NAC transcription factor                              56.6    4e-07   Nicotiana tabacum [American tobacco]
ref|XP_010058227.1|  PREDICTED: NAC domain-containing protein 71-...  57.0    5e-07   
ref|XP_009631312.1|  PREDICTED: NAC domain-containing protein 78-...  55.1    6e-07   
ref|XP_009342921.1|  PREDICTED: uncharacterized protein LOC103934887  56.6    7e-07   
ref|XP_008245899.1|  PREDICTED: NAC domain-containing protein 67-...  55.8    7e-07   
ref|XP_007213064.1|  hypothetical protein PRUPE_ppa020506mg           55.8    7e-07   
ref|XP_008226306.1|  PREDICTED: NAC domain-containing protein 66-...  55.8    7e-07   
ref|XP_009622624.1|  PREDICTED: uncharacterized protein LOC104113990  56.6    8e-07   
gb|AGL39736.1|  NAC transcription factor 080                          55.5    8e-07   
ref|XP_009602879.1|  PREDICTED: NAC domain-containing protein 2-like  55.8    8e-07   
gb|AGL39737.1|  NAC transcription factor 081                          55.1    9e-07   
ref|XP_006345191.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 1-like   55.5    9e-07   
ref|XP_007224606.1|  hypothetical protein PRUPE_ppa026935mg           53.1    1e-06   
ref|XP_009386218.1|  PREDICTED: NAC domain-containing protein 78-...  56.2    1e-06   
ref|XP_009628603.1|  PREDICTED: NAC transcription factor 29-like      55.5    1e-06   
ref|XP_007010693.1|  Uncharacterized protein TCM_044619               53.1    1e-06   
ref|XP_006437301.1|  hypothetical protein CICLE_v10033744mg           55.5    1e-06   
ref|XP_002321355.2|  hypothetical protein POPTR_0015s00520g           55.5    1e-06   Populus trichocarpa [western balsam poplar]
emb|CDM85525.1|  unnamed protein product                              55.5    1e-06   
ref|XP_010312399.1|  PREDICTED: uncharacterized protein LOC104644424  55.1    2e-06   
ref|XP_002529768.1|  conserved hypothetical protein                   55.1    2e-06   Ricinus communis
ref|XP_006495082.1|  PREDICTED: NAC domain-containing protein 7-like  52.8    2e-06   
ref|XP_010058232.1|  PREDICTED: NAC domain-containing protein 68-...  54.7    2e-06   
ref|XP_002308850.2|  hypothetical protein POPTR_0006s02930g           55.1    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_008226297.1|  PREDICTED: NAC domain-containing protein 68-...  54.7    2e-06   
gb|ACF19786.1|  NAC transcription factor                              54.3    2e-06   Nicotiana tabacum [American tobacco]
ref|XP_009598748.1|  PREDICTED: NAC domain-containing protein 78-...  54.3    2e-06   
ref|XP_010046032.1|  PREDICTED: NAC domain-containing protein 2-like  52.4    2e-06   
ref|XP_004309935.1|  PREDICTED: uncharacterized protein LOC101306295  55.1    3e-06   
ref|XP_006280728.1|  hypothetical protein CARUB_v10026697mg           54.3    3e-06   
gb|KCW79922.1|  hypothetical protein EUGRSUZ_C01264                   52.0    4e-06   
ref|XP_009130209.1|  PREDICTED: NAC domain-containing protein 7-like  53.9    4e-06   
ref|XP_002525963.1|  transcription factor, putative                   53.9    4e-06   Ricinus communis
emb|CDY30716.1|  BnaA02g33380D                                        53.9    5e-06   
ref|XP_006394405.1|  hypothetical protein EUTSA_v10004488mg           53.9    5e-06   
gb|KCW70814.1|  hypothetical protein EUGRSUZ_F03963                   51.6    5e-06   
gb|ABO36626.1|  hypothetical protein LYC_68t000011                    53.5    5e-06   Solanum lycopersicum
ref|XP_006430488.1|  hypothetical protein CICLE_v10013622mg           52.0    5e-06   
ref|XP_002525549.1|  conserved hypothetical protein                   53.1    6e-06   Ricinus communis
ref|XP_006492969.1|  PREDICTED: uncharacterized protein LOC102614024  53.5    7e-06   
gb|KDO57427.1|  hypothetical protein CISIN_1g045647mg                 52.0    8e-06   
ref|XP_009623547.1|  PREDICTED: NAC transcription factor 25-like      52.8    9e-06   
ref|XP_002864789.1|  hypothetical protein ARALYDRAFT_332471           52.8    9e-06   
ref|XP_009628610.1|  PREDICTED: uncharacterized protein LOC104118924  50.4    1e-05   
ref|XP_002513765.1|  transcription factor, putative                   52.4    1e-05   Ricinus communis
ref|XP_009616658.1|  PREDICTED: protein ATAF2-like                    52.4    1e-05   
ref|XP_004306365.1|  PREDICTED: protein FEZ-like                      52.4    1e-05   
ref|XP_010050567.1|  PREDICTED: NAC domain-containing protein 67-...  52.4    1e-05   
gb|KDO61599.1|  hypothetical protein CISIN_1g045641mg                 52.8    1e-05   
ref|XP_010039251.1|  PREDICTED: NAC transcription factor ONAC010-...  51.6    1e-05   
ref|XP_010039248.1|  PREDICTED: NAC domain-containing protein 19-...  52.0    2e-05   
ref|XP_008459335.1|  PREDICTED: NAC domain-containing protein 100...  52.0    2e-05   
ref|XP_009387227.1|  PREDICTED: NAC domain-containing protein 68-...  49.7    2e-05   
gb|KDO38203.1|  hypothetical protein CISIN_1g042765mg                 51.6    2e-05   
gb|KCW70813.1|  hypothetical protein EUGRSUZ_F03962                   49.7    2e-05   
ref|XP_010477985.1|  PREDICTED: NAC domain-containing protein 7-like  51.6    2e-05   
ref|XP_006341872.1|  PREDICTED: NAC domain-containing protein 2-like  50.8    2e-05   
ref|XP_010444086.1|  PREDICTED: NAC domain-containing protein 7-like  51.6    2e-05   
ref|XP_010042159.1|  PREDICTED: NAC domain-containing protein 55-...  49.3    2e-05   
ref|XP_010483951.1|  PREDICTED: NAC domain-containing protein 7-like  51.6    2e-05   
ref|XP_009418629.1|  PREDICTED: NAC domain-containing protein 78 ...  52.0    3e-05   
ref|XP_009418630.1|  PREDICTED: NAC domain-containing protein 78 ...  52.0    3e-05   
ref|XP_007212407.1|  hypothetical protein PRUPE_ppa016426mg           49.3    3e-05   
ref|XP_003548767.1|  PREDICTED: NAC domain-containing protein 100     51.6    3e-05   
ref|XP_009372720.1|  PREDICTED: NAC domain-containing protein 2-like  51.6    3e-05   
ref|XP_009418258.1|  PREDICTED: uncharacterized protein LOC103998499  52.0    3e-05   
ref|XP_009397818.1|  PREDICTED: uncharacterized protein LOC103982574  51.6    3e-05   
ref|XP_006430448.1|  hypothetical protein CICLE_v10013879mg           51.6    3e-05   
ref|NP_201044.1|  NAC-domain transcription factor                     51.2    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009786309.1|  PREDICTED: NAC domain-containing protein 2-like  51.2    3e-05   
ref|XP_002529750.1|  hypothetical protein RCOM_0574280                51.6    3e-05   Ricinus communis
ref|XP_009412871.1|  PREDICTED: NAC domain-containing protein 68-...  49.7    3e-05   
ref|XP_006430447.1|  hypothetical protein CICLE_v10013691mg           51.6    3e-05   
ref|XP_006478541.1|  PREDICTED: uncharacterized protein LOC102614734  51.6    3e-05   
ref|XP_010042381.1|  PREDICTED: NAC domain-containing protein 55-...  50.4    3e-05   
ref|XP_008229554.1|  PREDICTED: NAC domain-containing protein 43-...  49.7    3e-05   
ref|XP_008227085.1|  PREDICTED: NAC domain-containing protein 72-...  51.2    4e-05   
ref|XP_010317371.1|  PREDICTED: uncharacterized protein LOC104646072  48.5    4e-05   
gb|KDO37819.1|  hypothetical protein CISIN_1g043513mg                 51.2    4e-05   
ref|XP_009799422.1|  PREDICTED: uncharacterized protein LOC104245505  48.9    4e-05   
ref|XP_006482375.1|  PREDICTED: uncharacterized protein LOC102620925  51.2    4e-05   
gb|KHG13515.1|  NAC domain-containing protein                         50.8    4e-05   
gb|ACI15343.1|  NAC domain protein NAC6                               50.8    4e-05   Gossypium hirsutum [American cotton]
ref|XP_010065056.1|  PREDICTED: NAC domain-containing protein 19-...  50.8    4e-05   
ref|XP_002967532.1|  hypothetical protein SELMODRAFT_408624           50.8    4e-05   
ref|XP_002960173.1|  hypothetical protein SELMODRAFT_402243           50.8    5e-05   
ref|XP_006655336.1|  PREDICTED: NAC domain-containing protein 48-...  49.3    5e-05   
gb|AFW65457.1|  putative NAC domain transcription factor superfam...  48.9    5e-05   
ref|NP_001136644.1|  putative NAC domain transcription factor sup...  50.4    5e-05   Zea mays [maize]
ref|XP_007137751.1|  hypothetical protein PHAVU_009G1528000g          48.9    6e-05   
ref|XP_006384228.1|  hypothetical protein POPTR_0004s10700g           50.4    6e-05   
ref|XP_002305976.2|  hypothetical protein POPTR_0004s10720g           50.4    6e-05   Populus trichocarpa [western balsam poplar]
emb|CDX87246.1|  BnaC09g05610D                                        50.4    6e-05   
dbj|BAG15877.1|  nam-like protein                                     50.1    7e-05   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_004231183.2|  PREDICTED: uncharacterized protein LOC101262060  49.7    7e-05   
ref|XP_006359319.1|  PREDICTED: NAC domain-containing protein 2-like  50.1    7e-05   
gb|AEQ61905.1|  NAC domain-containing protein 1                       50.1    7e-05   
ref|XP_010039246.1|  PREDICTED: uncharacterized protein LOC104427938  50.4    7e-05   
ref|XP_003619003.1|  NAC domain protein                               50.1    8e-05   
ref|XP_006432090.1|  hypothetical protein CICLE_v10001956mg           50.1    8e-05   
ref|NP_001275792.1|  NAC domain-containing protein 2-like             50.1    8e-05   
ref|XP_004171621.1|  PREDICTED: NAC domain-containing protein 100...  50.1    8e-05   
gb|KDO52223.1|  hypothetical protein CISIN_1g021910mg                 50.1    8e-05   
ref|XP_002439823.1|  hypothetical protein SORBIDRAFT_09g020750        50.1    8e-05   Sorghum bicolor [broomcorn]
ref|XP_004141575.1|  PREDICTED: NAC domain-containing protein 100...  50.1    9e-05   
gb|KGN52475.1|  hypothetical protein Csa_5G637160                     50.1    9e-05   
ref|XP_003541838.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2-like   50.1    9e-05   
ref|XP_010065054.1|  PREDICTED: NAC domain-containing protein 7-like  49.7    9e-05   
ref|XP_009618980.1|  PREDICTED: uncharacterized protein LOC104111...  49.7    9e-05   
gb|KDO57412.1|  hypothetical protein CISIN_1g0449402mg                48.9    9e-05   
gb|KDO36596.1|  hypothetical protein CISIN_1g047622mg                 49.7    9e-05   
ref|XP_007212719.1|  hypothetical protein PRUPE_ppa018799mg           50.1    1e-04   
ref|XP_009615661.1|  PREDICTED: uncharacterized protein LOC104108353  50.1    1e-04   
ref|XP_006482373.1|  PREDICTED: putative mediator of RNA polymera...  50.1    1e-04   
ref|XP_002535107.1|  conserved hypothetical protein                   50.1    1e-04   Ricinus communis
ref|XP_002529748.1|  conserved hypothetical protein                   47.8    1e-04   Ricinus communis
gb|ACU23692.1|  unknown                                               47.4    1e-04   Glycine max [soybeans]
ref|XP_009618981.1|  PREDICTED: uncharacterized protein LOC104111...  49.3    1e-04   
gb|AGL39680.1|  NAC transcription factor 024                          49.3    1e-04   
ref|XP_003554001.1|  PREDICTED: NAC domain-containing protein 100...  49.7    1e-04   
ref|XP_002309945.1|  hypothetical protein POPTR_0007s04780g           49.3    1e-04   Populus trichocarpa [western balsam poplar]
gb|KHN08165.1|  NAC domain-containing protein 100                     49.7    1e-04   
ref|XP_007149487.1|  hypothetical protein PHAVU_005G074500g           49.7    1e-04   
ref|NP_001170390.1|  uncharacterized protein LOC100384376             48.9    1e-04   Zea mays [maize]
ref|XP_008385925.1|  PREDICTED: NAC transcription factor NAM-B1-like  48.9    1e-04   
dbj|BAJ88812.1|  predicted protein                                    47.8    1e-04   
ref|XP_007208161.1|  hypothetical protein PRUPE_ppa019846mg           49.7    1e-04   
emb|CDY16776.1|  BnaA09g06060D                                        49.3    1e-04   
ref|XP_009112020.1|  PREDICTED: NAC domain-containing protein 7-like  49.3    1e-04   
ref|XP_007010785.1|  Uncharacterized protein TCM_044739               47.8    1e-04   
gb|EMS45984.1|  NAC domain-containing protein 71                      47.4    1e-04   
ref|XP_010940544.1|  PREDICTED: uncharacterized protein LOC105059077  49.7    1e-04   
gb|EYU44971.1|  hypothetical protein MIMGU_mgv1a009356mg              49.3    1e-04   
gb|EYU20601.1|  hypothetical protein MIMGU_mgv1a011938mg              48.9    2e-04   
dbj|BAC43493.1|  putative ATAF2 protein                               47.4    2e-04   
ref|XP_010694507.1|  PREDICTED: NAC domain-containing protein 2       49.3    2e-04   
dbj|BAD25783.1|  putative OsNAC7 protein                              49.3    2e-04   
ref|XP_010550583.1|  PREDICTED: NAC domain-containing protein 7 i...  48.9    2e-04   
emb|CAC42087.1|  putative NAC domain protein                          48.9    2e-04   
ref|XP_009125108.1|  PREDICTED: NAC domain-containing protein 100...  48.9    2e-04   
ref|NP_001066035.1|  Os12g0123800                                     49.3    2e-04   
gb|EAY82109.1|  hypothetical protein OsI_37307                        49.3    2e-04   
gb|KDO47583.1|  hypothetical protein CISIN_1g007598mg                 49.7    2e-04   
ref|XP_009383926.1|  PREDICTED: NAC domain-containing protein 78-...  49.7    2e-04   
ref|XP_011031100.1|  PREDICTED: NAC domain-containing protein 2-like  48.9    2e-04   
ref|XP_006436536.1|  hypothetical protein CICLE_v10031147mg           49.3    2e-04   
ref|XP_004978885.1|  PREDICTED: NAC domain-containing protein 71-...  48.9    2e-04   
ref|XP_006436535.1|  hypothetical protein CICLE_v10031147mg           49.3    2e-04   
ref|XP_002306280.1|  hypothetical protein POPTR_0005s07060g           48.9    2e-04   
ref|XP_009150429.1|  PREDICTED: NAC domain-containing protein 102...  48.5    2e-04   
gb|KDO47587.1|  hypothetical protein CISIN_1g007598mg                 49.3    2e-04   
emb|CDY41537.1|  BnaA06g22900D                                        48.5    2e-04   
ref|XP_006489766.1|  PREDICTED: NAC domain-containing protein 67-...  48.9    2e-04   
dbj|BAJ95252.1|  predicted protein                                    48.1    2e-04   
gb|EEC73685.1|  hypothetical protein OsI_08250                        48.9    2e-04   
ref|XP_009383919.1|  PREDICTED: NAC domain-containing protein 78-...  49.3    2e-04   
gb|KDO47588.1|  hypothetical protein CISIN_1g007598mg                 48.9    2e-04   
ref|XP_011024336.1|  PREDICTED: NAC transcription factor NAM-A1       49.3    2e-04   
ref|XP_004244660.1|  PREDICTED: NAC domain-containing protein 66-...  48.9    2e-04   
gb|EYU33773.1|  hypothetical protein MIMGU_mgv1a025108mg              48.9    2e-04   
ref|XP_002517861.1|  conserved hypothetical protein                   48.1    2e-04   
gb|KDO47585.1|  hypothetical protein CISIN_1g007598mg                 49.3    2e-04   
gb|KDO47584.1|  hypothetical protein CISIN_1g007598mg                 49.3    2e-04   
gb|KDO47586.1|  hypothetical protein CISIN_1g007598mg                 49.3    2e-04   
ref|XP_011022862.1|  PREDICTED: NAC domain-containing protein 2-like  48.5    2e-04   
ref|XP_010550582.1|  PREDICTED: NAC domain-containing protein 7 i...  48.9    2e-04   
ref|XP_007137752.1|  hypothetical protein PHAVU_009G152900g           48.5    2e-04   
ref|XP_002306342.1|  hypothetical protein POPTR_0005s08440g           48.9    2e-04   
gb|AAP35051.1|  NAC-domain protein 5-7                                48.5    2e-04   
ref|XP_010039252.1|  PREDICTED: NAC domain-containing protein 19-...  47.8    2e-04   
emb|CDX84443.1|  BnaC03g50570D                                        48.1    2e-04   
ref|XP_003577115.1|  PREDICTED: NAC transcription factor 29-like      48.9    2e-04   
ref|XP_006582149.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2-li...  48.5    2e-04   
ref|XP_009421199.1|  PREDICTED: NAC transcription factor NAM-B2-like  48.5    3e-04   
emb|CDY00280.1|  BnaA06g21810D                                        48.1    3e-04   
gb|AGV29490.1|  putative NAC domain class transcription factor        47.4    3e-04   
gb|AFN55270.1|  NAC domain-containing protein                         48.5    3e-04   
ref|XP_002323203.1|  hypothetical protein POPTR_0016s02780g           48.5    3e-04   
gb|AHE80971.1|  NAC domain-containing protein                         48.1    3e-04   
dbj|BAD91001.1|  ONAC300                                              48.5    3e-04   
ref|XP_002450434.1|  hypothetical protein SORBIDRAFT_05g005450        48.5    3e-04   
ref|NP_001266835.1|  uncharacterized protein LOC100830276             48.5    3e-04   
ref|XP_004301620.1|  PREDICTED: uncharacterized protein LOC101304390  48.5    3e-04   
ref|XP_006297669.1|  hypothetical protein CARUB_v10013694mg           48.5    3e-04   
ref|XP_002317507.2|  hypothetical protein POPTR_0011s12190g           48.5    3e-04   
ref|XP_006482361.1|  PREDICTED: NAC transcription factor 29-like      48.5    3e-04   
ref|XP_003526018.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2-li...  48.5    3e-04   
ref|XP_007133204.1|  hypothetical protein PHAVU_011G160400g           48.5    3e-04   
ref|XP_006647601.1|  PREDICTED: NAC domain-containing protein 7-like  48.1    3e-04   
ref|XP_008677690.1|  PREDICTED: uncharacterized protein LOC100384...  48.5    3e-04   
ref|XP_004142632.1|  PREDICTED: NAC domain-containing protein 2-like  48.1    3e-04   
ref|XP_004161162.1|  PREDICTED: LOW QUALITY PROTEIN: NAC domain-c...  48.1    3e-04   
gb|EMT11023.1|  NAC domain-containing protein 43                      48.5    3e-04   
gb|EAZ23973.1|  hypothetical protein OsJ_07700                        48.1    3e-04   
ref|XP_010912541.1|  PREDICTED: NAC domain-containing protein 48-...  48.1    3e-04   
ref|XP_010486659.1|  PREDICTED: NAC domain-containing protein 8-like  48.5    3e-04   
ref|XP_010933504.1|  PREDICTED: NAC domain-containing protein 45-...  48.1    3e-04   
ref|XP_002315336.1|  no apical meristem family protein                48.5    3e-04   
dbj|BAP19106.1|  NAC transcription factor                             48.1    3e-04   
ref|XP_010464724.1|  PREDICTED: NAC domain-containing protein 74-...  48.5    3e-04   
ref|XP_004959950.1|  PREDICTED: protein SOMBRERO-like                 48.1    4e-04   
ref|XP_008459334.1|  PREDICTED: NAC domain-containing protein 100...  48.1    4e-04   
gb|AFK44664.1|  unknown                                               46.2    4e-04   
ref|XP_008444188.1|  PREDICTED: LOW QUALITY PROTEIN: NAC domain-c...  47.8    4e-04   
ref|XP_010935812.1|  PREDICTED: NAC domain-containing protein 78-...  48.5    4e-04   
ref|XP_008783580.1|  PREDICTED: NAC domain-containing protein 100...  48.1    4e-04   
ref|XP_010931444.1|  PREDICTED: NAC domain-containing protein 100...  48.1    4e-04   
emb|CDY37008.1|  BnaC06g12550D                                        47.8    4e-04   
ref|XP_008466736.1|  PREDICTED: NAC domain-containing protein 2       47.8    4e-04   
ref|XP_006858416.1|  hypothetical protein AMTR_s00071p00055960        48.5    4e-04   
ref|XP_010935813.1|  PREDICTED: NAC domain-containing protein 78-...  48.5    4e-04   
ref|XP_002517859.1|  conserved hypothetical protein                   48.1    4e-04   
ref|XP_002510719.1|  transcription factor, putative                   48.1    4e-04   
gb|KEH43316.1|  NAC transcription factor-like protein                 48.1    4e-04   
ref|XP_003603870.1|  NAC domain-containing protein                    48.1    4e-04   
gb|AES74121.2|  CUP-shaped cotyledon-like protein                     48.1    4e-04   
ref|XP_009338985.1|  PREDICTED: NAC domain-containing protein 100...  48.1    4e-04   
gb|EAZ17676.1|  hypothetical protein OsJ_33216                        46.2    4e-04   
gb|AIS74869.1|  NAC1                                                  47.8    4e-04   
ref|NP_001238186.1|  NAC domain protein                               48.1    4e-04   
ref|XP_009405277.1|  PREDICTED: NAC domain-containing protein 7-like  47.4    4e-04   
ref|XP_008385689.1|  PREDICTED: protein BEARSKIN1-like                47.8    4e-04   
emb|CDX78352.1|  BnaA03g02640D                                        47.4    4e-04   
ref|XP_002456411.1|  hypothetical protein SORBIDRAFT_03g035820        47.8    4e-04   
ref|XP_010484780.1|  PREDICTED: NAC domain-containing protein 74-...  48.1    4e-04   
ref|XP_010941123.1|  PREDICTED: NAC domain-containing protein 7-like  47.8    5e-04   
ref|XP_011083280.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2        47.8    5e-04   
gb|AGL39699.1|  NAC transcription factor 043                          48.1    5e-04   
ref|XP_007021572.1|  NAC domain protein, IPR003441, putative          47.8    5e-04   
gb|ACL14366.1|  CUP-SHAPED COTYLEDON3                                 47.8    5e-04   
ref|XP_004298024.1|  PREDICTED: NAC domain-containing protein 19-...  47.0    5e-04   
gb|KDO37814.1|  hypothetical protein CISIN_1g047610mg                 47.8    5e-04   
gb|EYU36590.1|  hypothetical protein MIMGU_mgv1a0262081mg             46.2    5e-04   
gb|KHN36474.1|  Protein CUP-SHAPED COTYLEDON 2                        46.2    5e-04   
ref|XP_008794847.1|  PREDICTED: NAC domain-containing protein 7-like  47.8    5e-04   
emb|CDY30258.1|  BnaC04g31690D                                        47.4    5e-04   
emb|CDY58006.1|  BnaC03g74980D                                        47.8    5e-04   
emb|CDP05952.1|  unnamed protein product                              47.8    5e-04   
gb|AFK39979.1|  unknown                                               47.0    5e-04   
gb|AIU39724.1|  NAC transcription factor 105                          47.4    5e-04   
gb|AGM34010.1|  abscisic-acid-responsive NAC transcription factor     47.4    5e-04   
ref|XP_009131103.1|  PREDICTED: protein ATAF2-like                    47.4    5e-04   
ref|XP_010550286.1|  PREDICTED: NAC domain-containing protein 100...  47.8    5e-04   
dbj|BAJ88421.1|  predicted protein                                    47.8    5e-04   
dbj|BAF36563.1|  NAC domain protein                                   47.8    5e-04   
tpg|DAA34939.1|  TPA: CUP-SHAPED COTYLEDON 2                          47.8    5e-04   
gb|KFK25233.1|  hypothetical protein AALP_AA8G084600                  47.4    5e-04   
gb|AAP35048.1|  NAC-domain protein 1-1                                47.4    5e-04   
gb|KHN45836.1|  Protein CUP-SHAPED COTYLEDON 2                        46.2    5e-04   
ref|XP_009103539.1|  PREDICTED: NAC domain-containing protein 7 i...  47.4    5e-04   
emb|CDY30778.1|  BnaC07g16780D                                        47.4    5e-04   
ref|XP_002321175.2|  hypothetical protein POPTR_0014s16160g           47.8    6e-04   
ref|XP_004962039.1|  PREDICTED: NAC domain-containing protein 48-...  47.4    6e-04   
ref|NP_001274382.1|  protein CUP-SHAPED COTYLEDON 2-like              47.4    6e-04   
ref|XP_010064463.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2        47.8    6e-04   
ref|XP_008792523.1|  PREDICTED: NAC domain-containing protein 100...  47.8    6e-04   
ref|XP_003541166.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2-like   47.8    6e-04   
gb|ACD39411.1|  NAC-like transcription factor                         47.4    6e-04   
ref|XP_009103538.1|  PREDICTED: NAC domain-containing protein 7 i...  47.4    6e-04   
ref|XP_009394029.1|  PREDICTED: NAC domain-containing protein 7-like  47.4    6e-04   
gb|KHN28079.1|  Protein CUP-SHAPED COTYLEDON 2                        47.4    6e-04   
ref|XP_008463701.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2-like   47.4    6e-04   
ref|XP_004146099.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2-like   47.4    6e-04   
ref|XP_008787998.1|  PREDICTED: NAC domain-containing protein 100...  47.4    6e-04   
gb|AAP35050.1|  NAC-domain protein 5-1                                47.0    6e-04   
ref|XP_008779162.1|  PREDICTED: uncharacterized protein LOC103698888  47.8    6e-04   
ref|XP_009139909.1|  PREDICTED: NAC domain-containing protein 100     47.4    6e-04   
ref|XP_003523205.1|  PREDICTED: NAC domain-containing protein 2       47.4    6e-04   
ref|XP_004502479.1|  PREDICTED: NAC domain-containing protein 2-like  47.4    6e-04   
gb|ACL14372.1|  NO APICAL MERISTEM1                                   47.4    6e-04   
ref|XP_004489492.1|  PREDICTED: protein FEZ-like                      47.4    7e-04   
ref|XP_002452850.1|  hypothetical protein SORBIDRAFT_04g033570        47.4    7e-04   
ref|XP_007161814.1|  hypothetical protein PHAVU_001G100500g           47.4    7e-04   
ref|XP_010528773.1|  PREDICTED: NAC domain-containing protein 100...  45.8    7e-04   
dbj|BAJ97015.1|  predicted protein                                    46.2    7e-04   
ref|NP_198777.1|  NAC-domain transcription factor                     47.0    7e-04   
gb|ACL14373.1|  NO APICAL MERISTEM2                                   47.4    7e-04   
ref|XP_009615270.1|  PREDICTED: NAC domain-containing protein 43-...  47.4    7e-04   
ref|XP_007015431.1|  NAC domain containing protein 25, putative       47.4    7e-04   
ref|XP_010922873.1|  PREDICTED: NAC domain-containing protein 100...  47.4    7e-04   
ref|XP_010549618.1|  PREDICTED: NAC domain-containing protein 100...  47.4    7e-04   
ref|XP_009122872.1|  PREDICTED: NAC domain-containing protein 7-like  47.4    7e-04   
emb|CDY41352.1|  BnaA01g31670D                                        47.4    7e-04   
ref|XP_009615269.1|  PREDICTED: NAC domain-containing protein 43-...  47.4    7e-04   
gb|AGS08763.1|  NAC domain protein                                    47.4    7e-04   
emb|CDY66026.1|  BnaCnng49350D                                        47.0    7e-04   
ref|XP_008374563.1|  PREDICTED: NAC domain-containing protein 100...  47.4    7e-04   
gb|ACD39367.1|  NAC domain protein                                    45.8    7e-04   
emb|CAM57978.1|  NAC transcription factor                             47.0    7e-04   
ref|XP_010090441.1|  NAC domain-containing protein 78                 47.4    7e-04   
ref|XP_004488746.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2-like   47.4    7e-04   
gb|EMT11879.1|  NAC domain-containing protein 43                      47.4    8e-04   
ref|XP_010036181.1|  PREDICTED: NAC domain-containing protein 100...  47.4    8e-04   
ref|XP_003568425.1|  PREDICTED: NAC domain-containing protein 48-...  47.0    8e-04   
ref|NP_680161.1|  protein ATAF2                                       47.0    8e-04   
ref|XP_002448830.1|  hypothetical protein SORBIDRAFT_06g034010        47.0    8e-04   
ref|NP_001266811.1|  uncharacterized protein LOC100832773             47.0    8e-04   
gb|AFI56799.1|  no apical meristem                                    47.4    8e-04   
dbj|BAJ94096.1|  predicted protein                                    47.0    8e-04   
ref|XP_006352217.1|  PREDICTED: NAC domain-containing protein 66-...  47.0    8e-04   
ref|XP_009796445.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 3-li...  47.4    8e-04   
ref|XP_009357365.1|  PREDICTED: NAC transcription factor 29-like      47.4    8e-04   
emb|CDP12272.1|  unnamed protein product                              47.0    8e-04   
gb|AED99725.1|  stress-related NAC transcription factor               47.0    9e-04   
gb|EMS47515.1|  NAC domain-containing protein 48                      46.6    9e-04   
gb|AEF32523.1|  stress-related NAM transcription factor               47.0    9e-04   
emb|CDY20001.1|  BnaA09g02500D                                        47.0    9e-04   
ref|XP_009616121.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 3        47.0    9e-04   
ref|XP_003532905.1|  PREDICTED: NAC domain-containing protein 74-...  47.0    9e-04   
emb|CAN71645.1|  hypothetical protein VITISV_041776                   45.8    9e-04   
ref|XP_011071688.1|  PREDICTED: NAC domain-containing protein 100...  47.0    9e-04   
gb|ACD39377.1|  NAC domain protein                                    45.4    9e-04   
ref|XP_003564785.1|  PREDICTED: NAC domain-containing protein 48-...  46.6    9e-04   
ref|XP_009122498.1|  PREDICTED: protein ATAF2                         46.6    9e-04   
dbj|BAF41989.1|  CUP-SHAPED COTYLEDON3                                47.0    9e-04   
gb|KHN20086.1|  Protein CUP-SHAPED COTYLEDON 3                        47.0    0.001   
gb|AHB63601.1|  NAC1 transcription factor                             46.6    0.001   
ref|XP_002448842.1|  hypothetical protein SORBIDRAFT_06g034210        47.0    0.001   
ref|XP_010558708.1|  PREDICTED: NAC domain-containing protein 100...  47.0    0.001   
ref|XP_006399391.1|  hypothetical protein EUTSA_v10014325mg           46.6    0.001   
ref|XP_010454055.1|  PREDICTED: NAC domain-containing protein 100...  47.0    0.001   
gb|KEH38685.1|  CUP-shaped cotyledon protein, putative                47.0    0.001   
emb|CDY41351.1|  BnaA01g31680D                                        45.4    0.001   
ref|XP_010678483.1|  PREDICTED: NAC domain-containing protein 100     47.0    0.001   
ref|XP_011087231.1|  PREDICTED: NAC domain-containing protein 100...  47.0    0.001   
ref|XP_006430478.1|  hypothetical protein CICLE_v10013730mg           47.0    0.001   
gb|AHN60141.1|  NAC transcription factor 51                           47.0    0.001   
gb|EYU24357.1|  hypothetical protein MIMGU_mgv1a022548mg              46.6    0.001   
ref|XP_008809236.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2-like   47.0    0.001   



>ref|XP_009769005.1| PREDICTED: NAC domain-containing protein 68-like [Nicotiana sylvestris]
Length=227

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 64/90 (71%), Gaps = 3/90 (3%)
 Frame = +1

Query  49   DGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATL  228
            +G+ F PTDAEL+ YL  +V    +   VPI+E DLY+ +EPW +F+  +++ LY F  L
Sbjct  31   EGFRFHPTDAELVKYLLQYVLKGRLPELVPIVEEDLYS-KEPWVVFKDRKERTLYFFTEL  89

Query  229  KRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            K++   +SR+IR+V  GKG+WK+QD+GKP+
Sbjct  90   KKKKIENSRFIRSV--GKGSWKSQDKGKPV  117



>ref|XP_009589539.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=220

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = +1

Query  19   IAMERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSR  198
            + +E   H  +G+ F PTD EL+ YL  +V    +   +PI E DLY+ +EPW +F+  +
Sbjct  11   LCIENSVHT-EGFRFHPTDTELVKYLLQYVLKGRLPELIPIEEEDLYS-KEPWVVFKDRK  68

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            ++ LY F  LK++   +SR+IR+V  GKG+WK+QD+GKP+
Sbjct  69   ERTLYFFTELKKKKIENSRFIRSV--GKGSWKSQDKGKPV  106



>ref|XP_004244376.2| PREDICTED: NAC domain-containing protein 102-like [Solanum lycopersicum]
Length=183

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 3/78 (4%)
 Frame = +1

Query  85   LGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLKRRSSSDSRYIR  264
            + YL  +V  NP+ + VPI E DLY  ++PW  F   ++K +Y F  LK+    + R++R
Sbjct  1    MKYLLHYVIDNPLPTLVPIEEEDLY-LKDPWVFFDARKEKTIYCFTELKKLKKGNLRFVR  59

Query  265  TVGDGKGTWKAQDRGKPI  318
            TVGD  G+WK+QDRGK I
Sbjct  60   TVGD--GSWKSQDRGKAI  75



>ref|XP_002529759.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32625.1| conserved hypothetical protein [Ricinus communis]
Length=109

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 67/108 (62%), Gaps = 15/108 (14%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLG-YLALFVTGNPVL--STVPIMESDLYNGEEPWKIFQR--  192
            + ++ +P GY F PT+ EL+G YL   + G+ +L   T+ + +S+LY+ +EPW+++++  
Sbjct  3    QSKDQLPVGYRFSPTEGELVGHYLFKKLKGSSLLPFETMLVADSNLYDKDEPWQLWEKSG  62

Query  193  ------SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                  S D  +Y+F  LK++    SR +R+VGDG GTW   D GKP+
Sbjct  63   ARCSFNSDDHEIYLFTPLKKKR---SRILRSVGDG-GTWHGVDSGKPV  106



>ref|XP_009602357.1| PREDICTED: transcription factor JUNGBRUNNEN 1-like, partial [Nicotiana 
tomentosiformis]
Length=113

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF---QRSRDKVLYIFA  222
            G  F PTDAEL+ +L  F+ G  + S  P   +D+Y    PW+IF     S +KV Y F 
Sbjct  13   GVRFHPTDAELINFLKRFLKGETLSSEYPFQHADIYGDRPPWEIFGADSNSEEKVRYFFT  72

Query  223  TLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             LK++ S  +R  RT  +  GTWK Q    PI
Sbjct  73   RLKKQKSEHTRVHRTCAN--GTWKCQTGIVPI  102



>ref|XP_007010701.1| Transcription factor-like protein [Theobroma cacao]
 gb|EOY19511.1| Transcription factor-like protein [Theobroma cacao]
Length=169

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 54/98 (55%), Gaps = 10/98 (10%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVL--STVPIMESDLYNGEEPWKI------FQRSRDKV  207
            G+ F P+D  L+ YL   VT   +L    V I + DLY  +EPW+I      F    D+ 
Sbjct  4    GFGFEPSDRSLMCYLFSKVTSKSMLHLDQVQIKDFDLYGEKEPWEIWDLHGGFNLQSDED  63

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            LY F  LK++S + SR  R+VG   GTW  +D GKPIY
Sbjct  64   LYFFTKLKKKSQNGSRINRSVG--TGTWMGEDSGKPIY  99



>ref|XP_008226300.1| PREDICTED: NAC domain-containing protein 19-like [Prunus mume]
Length=272

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 59/100 (59%), Gaps = 9/100 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKI---FQRSR---D  201
            +P GY FRP++ ELL  YL   V GN     V +++ DLY  +EPW I   F  S     
Sbjct  26   LPVGYRFRPSEEELLLHYLFPRVNGNDYPKGV-VLDCDLYGTKEPWTIWRDFHHSSPDDQ  84

Query  202  KVLYIFATLKRRSSSDSRYIRTVGD-GKGTWKAQDRGKPI  318
            + +Y+F TLK+++ + SR+ RTVG  G G WK +D GK I
Sbjct  85   EDIYVFTTLKKKTPNGSRFCRTVGTAGTGVWKGEDSGKII  124



>gb|ACF19785.1| NAC transcription factor [Nicotiana tabacum]
Length=238

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF---QRSRDKVLYIFA  222
            G  F PTDAEL+ +L  F+ G  + S  P   +D+Y    PW+IF     S +KV Y F 
Sbjct  13   GVRFHPTDAELINFLKRFLKGETLSSEYPFQHADIYGDRPPWEIFGADSNSEEKVRYFFT  72

Query  223  TLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             LK++ S  +R  RT  +  GTWK Q    PI
Sbjct  73   RLKKQKSEHTRVRRTCAN--GTWKGQTGIVPI  102



>gb|ACF19788.1| NAC transcription factor [Nicotiana tabacum]
Length=169

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF---QRSRDKVLYIFA  222
            G  F PTDAEL+ +L  F+ G  + S  P   +D+Y    PW+IF     S +KV Y F 
Sbjct  13   GVRFHPTDAELINFLKRFLKGETLSSEYPFQHADIYGDRPPWEIFGADSNSEEKVRYFFT  72

Query  223  TLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             LK++ S  +R  RT  +  GTWK Q    PI
Sbjct  73   RLKKQKSEHTRVRRTCAN--GTWKGQTGIVPI  102



>ref|XP_002529756.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32622.1| conserved hypothetical protein [Ricinus communis]
Length=291

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 66/108 (61%), Gaps = 15/108 (14%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLG-YLALFVTGNPVL--STVPIMESDLYNGEEPWKIFQR--  192
            + ++ +P GY F PT+ EL+G YL   +  + +L   T+ + +S+LY+ +EPW+++++  
Sbjct  3    QSKDQLPVGYRFSPTEGELVGHYLFKKLKSSSLLPFETILVADSNLYDKDEPWQLWEKSG  62

Query  193  ------SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                  S D  +Y+F  LK++    SR +R+VGDG GTW   D GKP+
Sbjct  63   ARCSFNSDDHEIYLFTPLKKKR---SRILRSVGDG-GTWHGVDSGKPV  106



>ref|XP_002530971.1| transcription factor, putative [Ricinus communis]
 gb|EEF31406.1| transcription factor, putative [Ricinus communis]
Length=508

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 57/104 (55%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEH----IPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ  189
            MER       +P GY F PTD EL L YL   V   P+     I E D+Y   EPW+I+ 
Sbjct  3    MERDNQEALILPPGYRFDPTDQELVLHYLLNRVARKPLSCQYFISEIDIYGDMEPWQIWD  62

Query  190  ---RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGK  312
               ++ + VLY+F  LK+R+++ S  +R +G   G+W  +D GK
Sbjct  63   SLGKADNDVLYVFTPLKKRAANGSTILRRIGSNGGSWHGEDSGK  106



>ref|XP_009801092.1| PREDICTED: NAC domain-containing protein 90-like [Nicotiana sylvestris]
Length=272

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRSRD----KVLYI  216
            G  F PT+AEL+ +L  F+   P+ S  P  + +D+Y  + PW+IF+ + D    KV Y 
Sbjct  13   GVRFYPTEAELINFLKRFLKSKPLPSECPNFQLADIYGDQPPWEIFRANSDHPEEKVRYF  72

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F  LK++ S  +R  RT  +  GTWK Q +G PI
Sbjct  73   FTRLKKQKSEHTRVRRTCAN--GTWKVQTKGFPI  104



>ref|XP_008347110.1| PREDICTED: NAC domain-containing protein 12-like [Malus domestica]
Length=303

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 57/105 (54%), Gaps = 13/105 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR---------  192
            +P GY F P D ELL GYL   + G      + + +SDLY  EEP  I++R         
Sbjct  7    VPVGYRFMPRDDELLLGYLRPKLDGQDYPKGI-VHDSDLYGLEEPSDIWRRLNCASHDGQ  65

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              + DK +Y+F TL  ++ + SR  RTVG   GTWK +D GK IY
Sbjct  66   DCTDDKDIYVFTTLNSKAPNGSRVCRTVGTTGGTWKGEDAGKEIY  110



>ref|XP_009630818.1| PREDICTED: protein SOMBRERO-like [Nicotiana tomentosiformis]
Length=239

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 52/93 (56%), Gaps = 6/93 (6%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRS---RDKVLYIF  219
            G  F PT+ EL+ +L  F+ G P+LS  P  + +D+Y  + PW+IF  S    +KV Y F
Sbjct  13   GVRFHPTEVELINFLKRFLKGEPLLSECPNFQLADIYGDQPPWEIFGTSDHLEEKVRYFF  72

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              LK++ S  +R  RT  +  GTWK Q    PI
Sbjct  73   TRLKKQKSEHTRVRRTCAN--GTWKGQTGIDPI  103



>ref|XP_009370823.1| PREDICTED: NAC domain-containing protein 7-like [Pyrus x bretschneideri]
Length=305

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 57/106 (54%), Gaps = 13/106 (12%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR--------  192
            H+P GY F P D ELL  YL   + G      + + + DLY  EEP  I++R        
Sbjct  6    HVPVGYRFMPRDDELLLDYLRPRLDGQDYPKGI-VHDCDLYGLEEPSDIWRRLNRASHEG  64

Query  193  ---SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               + DK +Y+F TL  ++ + SR+ RTVG   GTWK +D GK IY
Sbjct  65   HECTVDKDIYVFTTLNSKAPNGSRFCRTVGTTGGTWKGEDAGKKIY  110



>ref|XP_009787362.1| PREDICTED: NAC transcription factor 29-like [Nicotiana sylvestris]
Length=317

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +1

Query  61   FRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLKRRS  240
            F PTDAEL+ +L  F+ G  + +  PI  +++Y    PW+I     +K+ Y  + LK+R 
Sbjct  12   FYPTDAELIYFLKKFLKGESLPNECPIRLAEIYGDRPPWEISDHPEEKIGYFISPLKKRK  71

Query  241  SSDSRYIRTVGDGKGTWKAQDRGKPI  318
             S  R+ RT  +  GTWKAQ  G PI
Sbjct  72   ESHKRFRRTCAN--GTWKAQTGGDPI  95



>ref|XP_009617292.1| PREDICTED: NAC transcription factor 29-like [Nicotiana tomentosiformis]
Length=321

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF---QRSRDKVLYIFA  222
            G  F PTDAEL+ +L  F+ G  + S  P   +D+Y    PW+IF     S +KV Y F 
Sbjct  13   GVRFHPTDAELINFLKRFLKGETLSSEYPFQHADIYGDRPPWEIFGADSNSEEKVRYFFT  72

Query  223  TLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             LK++ S  +R  RT  +  GTWK Q    PI
Sbjct  73   RLKKQKSEHTRVRRTCAN--GTWKGQTGIVPI  102



>ref|XP_009627678.1| PREDICTED: protein SOMBRERO-like [Nicotiana tomentosiformis]
Length=260

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 55/101 (54%), Gaps = 10/101 (10%)
 Frame = +1

Query  40   HIPDGYI----FRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRS---  195
            H+  G I    F PT+AEL+ +L  F+ G P+ S  P  + +D+Y  + PW+IF  S   
Sbjct  10   HVRRGCIMCVRFHPTEAELINFLKRFLKGEPLPSECPNFQLADIYGDQPPWEIFGASDHP  69

Query  196  RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             +KV Y F  LK++ S  +R  RT  +  GTWK Q    PI
Sbjct  70   EEKVCYFFTRLKKQKSEHTRVRRTCAN--GTWKGQTGIDPI  108



>ref|XP_006348977.1| PREDICTED: protein CUP-SHAPED COTYLEDON 3-like [Solanum tuberosum]
Length=210

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 3/91 (3%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQRSRDKVLYIFATL  228
            GYIF P + EL+ YL  F    P+ +    ME  +LY   EPW+IF+ + +   Y     
Sbjct  10   GYIFSPKNIELMNYLVGFTRDEPLPNQNQFMEVVNLYAENEPWQIFEGTNNYTHYFITPQ  69

Query  229  KRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            K+++S   R  RTVG+  GTWK Q +GK ++
Sbjct  70   KKKNSKWKRVARTVGN--GTWKPQGKGKEVF  98



>ref|XP_010322988.1| PREDICTED: NAC domain-containing protein 45-like [Solanum lycopersicum]
Length=518

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 57/106 (54%), Gaps = 12/106 (11%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSR--  198
            ME +E   +GY F PTD+ELL YL  F+T N +     I E D+YN ++PW  +   R  
Sbjct  22   MEFEE---EGYRFHPTDSELLTYLLRFITENNLCDNGFITECDVYN-QQPWITYGYGRHC  77

Query  199  ------DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                  D   + +    R   SD+R+ R V +G GTWK +D+GK I
Sbjct  78   GGQDDGDTNNFRYFISPRHKKSDNRFSRHVANGLGTWKQRDKGKWI  123



>ref|XP_007213429.1| hypothetical protein PRUPE_ppa025596mg [Prunus persica]
 gb|EMJ14628.1| hypothetical protein PRUPE_ppa025596mg [Prunus persica]
Length=202

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLALF-VTGNPVLSTVPIMESDLYNGEEPWKIFQR------SR  198
            ++P G+ FRP D +LLGY  L  V G   +    I E DLY   EPW I+        ++
Sbjct  9    NLPVGFKFRPRDDQLLGYYLLNKVRGTSFMYDNVIPEMDLYGKIEPWDIWHEYGGRNLAK  68

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             + LY F  LK  S  DSR  RT+  G GTWK ++ G P+
Sbjct  69   SEDLYFFTKLKSLSDKDSRVARTI--GSGTWKGENSGTPV  106



>ref|XP_007213476.1| hypothetical protein PRUPE_ppa023804mg [Prunus persica]
 gb|EMJ14675.1| hypothetical protein PRUPE_ppa023804mg [Prunus persica]
Length=379

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLALF-VTGNPVLSTVPIMESDLYNGEEPWKIFQR------SR  198
            ++P G+ FRP D +LLGY  L  V G   +    I E DLY   EPW I+        ++
Sbjct  9    NLPVGFKFRPRDDQLLGYYLLNKVRGTSFMYDNVIPEMDLYGKIEPWDIWHEYGGRNLAK  68

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             + LY F  LK  S  DSR  RT+  G GTWK ++ G P+
Sbjct  69   SEDLYFFTKLKSLSDKDSRVARTI--GSGTWKGENSGTPV  106



>ref|XP_008361192.1| PREDICTED: NAC domain-containing protein 12-like [Malus domestica]
Length=303

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR---------  192
            +P GY F P D ELL GYL   + G      + + + DLY  EEP  I++R         
Sbjct  7    VPVGYRFMPRDDELLLGYLRPKLDGQDYPKGI-VHDCDLYGLEEPSDIWRRLNCASHDGQ  65

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              + DK +Y+F TL  ++ + SR  RTVG   GTWK +D GK IY
Sbjct  66   DCTDDKDIYVFTTLNSKAPNGSRVCRTVGTTGGTWKGEDAGKEIY  110



>ref|XP_008226305.1| PREDICTED: NAC domain-containing protein 66-like [Prunus mume]
Length=255

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 9/100 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIMESDLYNGEEPWKI---FQRSR---D  201
            +P GY FRP++ EL L YL   + G      V + + DLY  +EPW+I   F  S     
Sbjct  7    VPVGYKFRPSEEELFLHYLLPRLNGEDYPEGV-VPDCDLYGTKEPWEIWRDFHHSSPDDQ  65

Query  202  KVLYIFATLKRRSSSDSRYIRTVG-DGKGTWKAQDRGKPI  318
            + +Y+F TLK+++ + SR+ RTVG  G G WK +D GK I
Sbjct  66   EDIYVFTTLKKKTPNGSRFCRTVGAAGTGVWKGEDSGKKI  105



>ref|XP_009774958.1| PREDICTED: protein ATAF2-like [Nicotiana sylvestris]
Length=368

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/104 (37%), Positives = 60/104 (58%), Gaps = 10/104 (10%)
 Frame = +1

Query  37   EHIP--DGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQR-----  192
            EH+   +G+ FRPTD+E L +L  FV G  +  +  I  + D+Y  +EPW+I+       
Sbjct  2    EHLKFEEGFRFRPTDSEGLTFLLRFVAGQEMHDSGFITTNVDVYGKQEPWEIYDSGVPCG  61

Query  193  -SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               D   Y +   K +  S++RY R+VG+ KGTWK  ++GKP++
Sbjct  62   DDEDNSSYRYFITKLKKKSNARYHRSVGN-KGTWKQDNKGKPVH  104



>ref|XP_008337178.1| PREDICTED: NAC domain-containing protein 12-like [Malus domestica]
Length=303

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR---------  192
            +P GY F P D ELL GYL   + G      + + + DLY  EEP  I++R         
Sbjct  7    VPVGYRFMPRDDELLLGYLRPKLDGQDYPKGI-VHDCDLYGLEEPSDIWRRLNXASHDGQ  65

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              + DK +Y+F TL  ++ + SR  RTVG   GTWK +D GK IY
Sbjct  66   XCTDDKDIYVFTTLNSKAPNGSRVCRTVGTTGGTWKGEDAGKEIY  110



>ref|XP_008368783.1| PREDICTED: NAC domain-containing protein 12-like [Malus domestica]
Length=303

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR---------  192
            +P GY F P D ELL GYL   + G      + + + DLY  EEP  I++R         
Sbjct  7    VPVGYRFMPRDDELLLGYLRPKLDGQDYPKGI-VHDCDLYGLEEPSDIWRRLNRASHDGQ  65

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              + DK +Y+F TL  ++ + SR  RTVG   GTWK +D GK IY
Sbjct  66   ECTDDKDIYVFTTLNSKAPNGSRVCRTVGTTGGTWKGEDAGKEIY  110



>ref|XP_008368782.1| PREDICTED: NAC domain-containing protein 7-like [Malus domestica]
Length=229

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 56/106 (53%), Gaps = 13/106 (12%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR--------  192
             +P GY F P D ELL GYL   + G      + + + DLY  EEP  I++R        
Sbjct  6    QVPVGYRFMPRDDELLLGYLRPKLDGQDYPKGI-VHDCDLYGLEEPSDIWRRLNRASHDG  64

Query  193  ---SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               + DK +Y+F TL  ++ + SR  RTVG   GTWK +D GK IY
Sbjct  65   QECTDDKDIYVFTTLNSKAPNGSRVCRTVGTTGGTWKGEDAGKEIY  110



>ref|XP_008355426.1| PREDICTED: NAC domain-containing protein 12-like [Malus domestica]
Length=303

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR---------  192
            +P GY F P D ELL GYL   + G      + + + DLY  EEP  I++R         
Sbjct  7    VPVGYRFMPRDDELLLGYLRPKLDGQDYPKGI-VHDXDLYGLEEPSDIWRRLNCASHDGQ  65

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              + DK +Y+F TL  ++ + SR  RTVG   GTWK +D GK IY
Sbjct  66   DCTDDKDIYVFTTLNSKAPNGSRVCRTVGTTGGTWKGEDAGKEIY  110



>ref|XP_008368781.1| PREDICTED: NAC domain-containing protein 12-like [Malus domestica]
Length=303

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR---------  192
            +P GY F P D ELL GYL   + G      + + + DLY  EEP  I++R         
Sbjct  7    VPVGYRFMPRDDELLLGYLRPKLDGQDYPKGI-VHDXDLYGLEEPSDIWRRLNXASHDGQ  65

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              + DK +Y+F TL  ++ + SR  RTVG   GTWK +D GK IY
Sbjct  66   ECTDDKDIYVFTTLNSKAPNGSRVCRTVGTTGGTWKGEDAGKEIY  110



>ref|XP_009782736.1| PREDICTED: protein CUP-SHAPED COTYLEDON 1-like [Nicotiana sylvestris]
Length=342

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 8/98 (8%)
 Frame = +1

Query  49   DGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQ------RSRDKV  207
            +G+ FRPTD+E L YL  FV G  +     I  + D+Y  +EPW+I+          D  
Sbjct  7    EGFRFRPTDSEGLTYLLRFVAGQELHDAGFITTNVDVYGKQEPWEIYDDGVPCGDDEDNT  66

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
             Y +   K +  S++RY R+VG+ KGTWK  ++GKP++
Sbjct  67   SYRYFITKLKKKSNARYHRSVGN-KGTWKQDNKGKPVH  103



>ref|XP_009370821.1| PREDICTED: NAC domain-containing protein 7-like [Pyrus x bretschneideri]
Length=303

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR---------  192
            +P GY F P D ELL  YL   + G  V     + + DLY  EEP  I++R         
Sbjct  7    VPVGYRFMPRDDELLLDYLRPKLDGQ-VYPKGIVHDCDLYGLEEPSDIWRRLNRASHDGH  65

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              + DK +YIF TL  ++ + SR+ RTVG   GTWK +D GK IY
Sbjct  66   ECTDDKDIYIFTTLNSKAPNGSRFCRTVGTTGGTWKGEDAGKKIY  110



>ref|XP_006366896.1| PREDICTED: NAC domain-containing protein 78-like [Solanum tuberosum]
Length=261

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 45/85 (53%), Gaps = 4/85 (5%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLST-VPIMESDLYNGEEPWKIF-QRSRDKVLYIFAT  225
            G  F PTD EL+ YL  F  G   L+   PI  +D+Y  + PW+IF   S +K  Y    
Sbjct  6    GIRFHPTDTELINYLKRFFKGELSLNQQCPIQFADIYGDQPPWEIFGANSEEKFRYFITP  65

Query  226  LKRRSSSDSRYIRTVGDGKGTWKAQ  300
            LK+R   D R+ RT    KGTWK Q
Sbjct  66   LKKRKIKDKRFCRTC--AKGTWKGQ  88



>ref|XP_009763090.1| PREDICTED: uncharacterized protein LOC104215049, partial [Nicotiana 
sylvestris]
Length=457

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 8/98 (8%)
 Frame = +1

Query  46   PDGYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQ-----RSRDKV  207
            P G+ F PTD E+L YL  FV   P+ S   +M+ +DLY  +EPW+IF+      + +  
Sbjct  12   PMGHRFHPTDREVLKYLIGFVRDEPLHSQNELMQVADLYADKEPWQIFEAYDQGNNNNNT  71

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
             Y     K+   +  R  RTVG  KGTWK Q +G+ ++
Sbjct  72   RYFITPQKKEKPTWKRVSRTVG--KGTWKPQGKGREVF  107



>ref|XP_004234876.2| PREDICTED: NAC transcription factor 29-like [Solanum lycopersicum]
Length=282

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 46/85 (54%), Gaps = 4/85 (5%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLST-VPIMESDLYNGEEPWKIF-QRSRDKVLYIFAT  225
            G  F PTD EL+ YL  F  G   L+   PI  +D+Y  + PW+IF   S++K  Y    
Sbjct  6    GIRFHPTDTELINYLKRFFKGELSLNQQCPIQFADIYGDQPPWEIFGANSKEKFHYFITP  65

Query  226  LKRRSSSDSRYIRTVGDGKGTWKAQ  300
            LK+R   D R+ RT    KGTWK Q
Sbjct  66   LKKRKIKDKRFCRTC--VKGTWKGQ  88



>ref|XP_009770805.1| PREDICTED: protein SOMBRERO-like, partial [Nicotiana sylvestris]
Length=202

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 7/94 (7%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRSRD----KVLYI  216
            G  F PT+AEL+ +L  F+ G  + S  P  + +D+Y  + PW+IF  + D    KV YI
Sbjct  14   GVRFHPTEAELINFLKRFLKGELLPSECPNFQLADIYGDQPPWEIFGANSDHPKEKVRYI  73

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F  LK++ S  +R  RT  +  GTWK Q    PI
Sbjct  74   FTRLKKQKSEHTRVRRTCAN--GTWKGQTGIDPI  105



>ref|XP_007213127.1| hypothetical protein PRUPE_ppa024063mg, partial [Prunus persica]
 gb|EMJ14326.1| hypothetical protein PRUPE_ppa024063mg, partial [Prunus persica]
Length=218

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 59/101 (58%), Gaps = 11/101 (11%)
 Frame = +1

Query  43   IPDGYIFRPTDAEL-LGYLALFVTGNPV-LSTVPIMESDLYNGEEPWKI---FQRSR---  198
            +P GY FRP++ EL L YL   + G    +  VP  + DLY  +EPW+I   F  S    
Sbjct  7    VPVGYKFRPSEEELFLHYLLPRLNGEDYPIGIVP--DCDLYGTKEPWEIWRDFHHSSPDD  64

Query  199  DKVLYIFATLKRRSSSDSRYIRTVG-DGKGTWKAQDRGKPI  318
             + +Y+F TLK+++ + +R+ RTVG  G G WK +D GK I
Sbjct  65   QEDIYVFTTLKKKTPNGTRFCRTVGAAGTGVWKGEDSGKKI  105



>ref|XP_009370828.1| PREDICTED: NAC domain-containing protein 68-like [Pyrus x bretschneideri]
Length=305

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR---------  192
            +P GY F P D ELL  YL   + G      + + + DLY  EEP  I++R         
Sbjct  7    VPVGYRFMPRDDELLLDYLRPKLDGQDYPKGI-VHDCDLYGLEEPSDIWRRLNRASHEGH  65

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              + DK +Y+F TL  ++ + SR+ RTVG   GTWK +D GK IY
Sbjct  66   ECTDDKDIYVFTTLNLKAPNGSRFCRTVGTTGGTWKGEDAGKKIY  110



>ref|XP_009786835.1| PREDICTED: NAC domain-containing protein 19-like [Nicotiana sylvestris]
Length=424

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 51/95 (54%), Gaps = 6/95 (6%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS----RDKVLYIF  219
            G  FRPTD EL+ YL  FV+     S   I   DLY  ++PW IF+ +      KV Y F
Sbjct  15   GIRFRPTDEELVRYLLKFVSCK-TFSCDHIRVEDLYGNKKPWDIFENNFLGDDTKVNYFF  73

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
              LKR  +  SR+ R +  G G WK  D+ KP+++
Sbjct  74   TKLKRTKADGSRFSRGL-IGGGCWKGLDKSKPVFK  107



>ref|XP_009794230.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=372

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 8/98 (8%)
 Frame = +1

Query  46   PDGYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQ-----RSRDKV  207
            P G+ F PTD E+L YL  FV   P+ S   +M+ +DLY  +EPW+IF+      + +  
Sbjct  12   PMGHRFHPTDREVLKYLIGFVRDEPLHSQNELMQVADLYADKEPWQIFEAYDQGNNNNNT  71

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
             Y     K+   +  R  RTVG  KGTWK Q +G+ ++
Sbjct  72   RYFITPQKKEKPTWKRVSRTVG--KGTWKPQGKGREVF  107



>ref|XP_009798779.1| PREDICTED: putative NAC domain-containing protein 94 [Nicotiana 
sylvestris]
Length=445

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 6/94 (6%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS----RDKVLYIF  219
            G+ FRPTD EL+ YL  FV+     S   I   DLY  ++PW IF+ +      KV Y F
Sbjct  15   GFRFRPTDEELIRYLLKFVSCKS-FSFDHIRVEDLYGNKKPWDIFENNFLGDDTKVNYFF  73

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              LKR  +  SR+ R +  G G WK  D+ KP++
Sbjct  74   TKLKRTKAGGSRFSRGL-IGGGCWKGLDKHKPVF  106



>gb|ACF19787.1| NAC transcription factor [Nicotiana tabacum]
Length=242

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 7/94 (7%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRSRD----KVLYI  216
            G  F PT+AEL+ +L  F+ G  + S  P  + +D+Y  + PW+IF  + D    KV YI
Sbjct  14   GVRFHPTEAELINFLKRFLKGELLPSECPNFQLADIYGDQPPWEIFGANSDHPKEKVRYI  73

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F  LK++ S  +R  RT  +  GTWK Q    PI
Sbjct  74   FTRLKKQKSEHTRVRRTCAN--GTWKGQTGIDPI  105



>ref|XP_009630787.1| PREDICTED: protein SOMBRERO-like [Nicotiana tomentosiformis]
Length=244

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 51/93 (55%), Gaps = 6/93 (6%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRS---RDKVLYIF  219
            G  F PT+AEL+ +L  F+ G P+ S  P  + +D+Y  + PW+IF  S    +KV Y F
Sbjct  2    GVRFHPTEAELINFLKRFLKGEPLPSECPNFKLTDIYGDQPPWEIFVASDHPEEKVRYFF  61

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              LK++ S  +R  RT     GTWK Q    PI
Sbjct  62   TRLKKQKSEHTRVRRTC--AFGTWKGQTGIDPI  92



>ref|XP_009762991.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=335

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 8/98 (8%)
 Frame = +1

Query  46   PDGYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQ-----RSRDKV  207
            P G+ F PTD E+L YL  FV   P+ S   +M+ +DLY  +EPW+IF+      + +  
Sbjct  12   PMGHRFHPTDREVLKYLIGFVRDEPLHSQNELMQVADLYADKEPWQIFEAYDQGNNNNNT  71

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
             Y     K+   +  R  RTVG  KGTWK Q +G+ ++
Sbjct  72   RYFITPQKKEKPTWKRVSRTVG--KGTWKPQGKGREVF  107



>ref|XP_006359056.1| PREDICTED: NAC domain-containing protein 78-like [Solanum tuberosum]
Length=297

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 8/101 (8%)
 Frame = +1

Query  37   EHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQR------S  195
            E++ +G+ F PTDAE + +L  F+ G  +  +  I    D Y+ +EPW I+         
Sbjct  46   ENLKEGFRFSPTDAEAVTFLLKFIAGKLMNDSGFITTHVDTYSKQEPWDIYSHGVPCCND  105

Query  196  RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             D   Y F   K +  S SRY R VG+ KG+WK QD+ KP+
Sbjct  106  DDCTQYRFFITKLKKKSKSRYSRDVGN-KGSWKQQDKSKPV  145



>ref|XP_007010727.1| Transcription factor-like protein [Theobroma cacao]
 gb|EOY19537.1| Transcription factor-like protein [Theobroma cacao]
Length=169

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 53/98 (54%), Gaps = 10/98 (10%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVL--STVPIMESDLYNGEEPWKIF------QRSRDKV  207
            G+ F P+D  L+ YL   VT   +L      I + DLY  +EPW+I+       R   + 
Sbjct  4    GFGFGPSDRSLMCYLFSKVTSKSMLHFDQDQIKDFDLYGEKEPWEIWDLYGGCNRQSGED  63

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            LY F  LK++S + SR  R+VG   GTW  +D GKPIY
Sbjct  64   LYFFTKLKKKSQNGSRINRSVG--MGTWMGEDSGKPIY  99



>ref|XP_008228498.1| PREDICTED: protein BEARSKIN1-like [Prunus mume]
Length=397

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 9/96 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALF-VTGNPVLSTVPIMESDLYNGEEPWKIF------QRSRD  201
            +P G+ F P+D ELL Y  L  V G P + +  + E +LY  +EPW I+      +  + 
Sbjct  9    VPIGFKFHPSDDELLRYYLLNKVCGTPFMYSNVVPEFNLYGKKEPWDIWNDFGEQKLEKG  68

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRG  309
            + LY F  LK  +   SR  RT+G+  GTWK +DRG
Sbjct  69   EDLYFFTKLKLVTGKGSRVARTIGN--GTWKGEDRG  102



>ref|XP_007204918.1| hypothetical protein PRUPE_ppa019675mg [Prunus persica]
 gb|EMJ06117.1| hypothetical protein PRUPE_ppa019675mg [Prunus persica]
Length=365

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 53/104 (51%), Gaps = 9/104 (9%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLGYLALF-VTGNPVLSTVPIMESDLYNGEEPWKIFQR----  192
            E   ++P G+ FRP D +LLGY  L  V G   +    I E DLY   EPW I+      
Sbjct  5    ESAVNLPVGFKFRPRDDQLLGYYLLNKVRGTSFMYENVIPEMDLYGKIEPWDIWHEYGGH  64

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              ++ + LY F  LK  S  DSR  RT+  G GTWK ++ G  +
Sbjct  65   NLAKGEDLYFFTKLKSLSDKDSRAARTI--GSGTWKGENSGTTV  106



>ref|XP_009370826.1| PREDICTED: NAC domain-containing protein 68-like [Pyrus x bretschneideri]
Length=305

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR---------  192
            +P GY F P D ELL  YL   + G      + + + DLY  EEP  I++R         
Sbjct  7    VPVGYRFMPRDDELLLDYLRPKLDGQDYPKGI-VHDCDLYGLEEPSDIWRRLNRASHEGH  65

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              + DK +Y+F T+  ++ + SR+ RTVG   GTWK +D GK IY
Sbjct  66   ECTDDKDIYVFTTVNLKAPNGSRFCRTVGTTGGTWKGEDAGKKIY  110



>ref|XP_008227178.1| PREDICTED: NAC domain-containing protein 2-like [Prunus mume]
Length=381

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 53/104 (51%), Gaps = 9/104 (9%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLGYLALF-VTGNPVLSTVPIMESDLYNGEEPWKIFQR----  192
            E   ++P G+ FRP D +LLGY  L  V G   +    I E DLY   EPW I+      
Sbjct  5    ESAVNLPVGFKFRPRDDQLLGYYLLNKVRGTTFMYDNVIPEMDLYGKIEPWDIWHEYGGH  64

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              ++ + LY F  LK  S  DSR  RT+  G GTWK ++ G  +
Sbjct  65   NLAKGEDLYFFTKLKSLSDKDSRAARTI--GSGTWKGENSGTTV  106



>ref|XP_008245774.1| PREDICTED: NAC domain-containing protein 67-like [Prunus mume]
Length=249

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLALFV-TGNPVLSTVPIMESDLYNGEEPWKIFQR------SR  198
            ++P G+IF P D +LLGY  L   +G P      I E DLY   EPW I+        ++
Sbjct  9    NLPVGFIFCPRDDQLLGYYLLNKDSGKPFQYDNVIPEMDLYGKIEPWDIWHEYGGHNLAK  68

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             + LY F  LK  S  DSR  RT+  G GTWK ++ G  +
Sbjct  69   GEDLYFFTKLKSLSDKDSRVARTI--GSGTWKGENSGTTV  106



>ref|XP_009789986.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=256

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 7/88 (8%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRSRD----KVLYI  216
            G  F PT+AEL+ +L  F+ G P+ S  P  + +D+Y  + PWKIF  + D    KV Y 
Sbjct  13   GVRFHPTEAELINFLKRFLKGEPLPSECPNFQLADIYGDQPPWKIFGANSDHPEEKVHYF  72

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQ  300
               LK+  S  +R  RT  +  GTWK Q
Sbjct  73   LTRLKKPKSEHTRVRRTCAN--GTWKGQ  98



>ref|XP_007213177.1| hypothetical protein PRUPE_ppa027019mg [Prunus persica]
 gb|EMJ14376.1| hypothetical protein PRUPE_ppa027019mg [Prunus persica]
Length=447

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 53/104 (51%), Gaps = 9/104 (9%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLGYLALF-VTGNPVLSTVPIMESDLYNGEEPWKIFQR----  192
            E   ++P G+ FRP D +LLGY  L  V G   +    I E DLY   EPW I+      
Sbjct  71   ESAVNLPVGFKFRPRDDQLLGYYLLNKVRGTSFMYENVIPEMDLYGKIEPWDIWHEYGGH  130

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              ++ + LY F  LK  S  DSR  RT+  G GTWK ++ G  +
Sbjct  131  NLAKGEDLYFFTKLKSLSDKDSRAARTI--GSGTWKGENSGTTV  172



>ref|XP_006437291.1| hypothetical protein CICLE_v10033436mg [Citrus clementina]
 gb|ESR50531.1| hypothetical protein CICLE_v10033436mg [Citrus clementina]
Length=339

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 61/106 (58%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   V+G  + L+   IM+ +LY  E+P +I+    
Sbjct  2    QEHGPFLPHGFQFRPSDEELIEHYLKKKVSGIFIPLAEYFIMDCNLYE-EKPSEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  61   GPFLNADEDLYFFTQLKKKSSKGSRIDRKVGSSGGTWQGEDAGKDI  106



>ref|XP_008227089.1| PREDICTED: NAC domain-containing protein 2-like [Prunus mume]
Length=376

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLALF-VTGNPVLSTVPIMESDLYNGEEPWKIFQR------SR  198
            ++P G+ FRP D +LLGY  L  V G   +    I E DLY   EPW I+        ++
Sbjct  9    NLPVGFKFRPRDDQLLGYYLLNKVRGTSFMYENVIPEMDLYGKIEPWDIWYEYGGHNLAK  68

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             + LY F  LK  S  DSR  RT+  G GTWK ++ G  +
Sbjct  69   GEDLYFFTKLKSLSDKDSRVARTI--GSGTWKGENSGTTV  106



>ref|XP_008218760.1| PREDICTED: uncharacterized protein LOC103319043 [Prunus mume]
Length=425

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 54/99 (55%), Gaps = 9/99 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALF-VTGNPVLSTVPIMESDLYNGEEPWKIFQR------SRD  201
            +P G+ FRP+D ELL Y  L  V+G P   +  + E +LY  +EPW I+         + 
Sbjct  9    VPIGFKFRPSDDELLRYYLLNKVSGTPFKYSNVVPEFNLYGKKEPWDIWNDFGGQNLEKG  68

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            + LY F  LK  +   SR  RT+G+  GTWK +D+G  +
Sbjct  69   EDLYFFTKLKLVTGKGSRVARTIGN--GTWKGEDKGTTV  105



>ref|XP_009621726.1| PREDICTED: uncharacterized protein LOC104113311 [Nicotiana tomentosiformis]
Length=368

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 8/106 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQR---  192
            M++   + DG+ FRPTD+E L +L  FV G  +  +  I  + D+Y  +EPW+I+     
Sbjct  1    MDQHLKLEDGFRFRPTDSEGLMFLLRFVAGKEMHDSGFITTNVDVYGKQEPWEIYDNGVP  60

Query  193  ---SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
                 D   Y +   K +  S++RY R V + KGTWK   + KP++
Sbjct  61   CGDDEDNSSYRYFITKLKKKSNARYHRAV-ENKGTWKQDAKDKPVH  105



>ref|XP_009370825.1| PREDICTED: NAC domain-containing protein 7-like [Pyrus x bretschneideri]
Length=305

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 55/105 (52%), Gaps = 13/105 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR---------  192
            +P GY F P D ELL  YL   + G      + + + DLY  EEP  I++R         
Sbjct  7    VPVGYRFMPRDDELLLDYLRPKLDGQDYPKGI-VHDCDLYGLEEPSDIWRRLNRASHEGH  65

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
              + DK ++IF TL  ++ + SR  RTVG   GTWK +D GK IY
Sbjct  66   ECTDDKDIFIFTTLNSKAPNGSRVCRTVGTTGGTWKGEDAGKKIY  110



>ref|XP_006388817.1| hypothetical protein POPTR_0097s00280g [Populus trichocarpa]
 gb|ERP47731.1| hypothetical protein POPTR_0097s00280g [Populus trichocarpa]
Length=343

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 54/102 (53%), Gaps = 8/102 (8%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLG-YLALFVTGN-PVLSTVPIMESDLYNGEEPWKIF-----QRSRD  201
            +P G+IFRPT  +L+G YL   V G   V +   I + +LY  EEPW++F      +  D
Sbjct  8    LPPGFIFRPTGEQLIGHYLHHKVHGRLTVEADDMIKDYNLYGAEEPWELFNKVTGHKEGD  67

Query  202  KVLYIFATL-KRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
             VLY F TL K+ + S  R  RTVG   G W      + IYR
Sbjct  68   DVLYCFTTLDKKTAKSTKRMRRTVGTNGGKWHGDSLEEVIYR  109



>ref|XP_009772253.1| PREDICTED: NAC domain-containing protein 2-like [Nicotiana sylvestris]
Length=240

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 53/95 (56%), Gaps = 8/95 (8%)
 Frame = +1

Query  52   GYIFRP-TDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----RSRDKVLY  213
            G  F+P  D +L+ YL  FV G P+ S   I   D+Y  ++P ++FQ      S D V Y
Sbjct  16   GTKFQPYNDQDLISYLQKFVCGMPIESD-RIRHIDVYGNKKPCELFQDLLGETSTDHVNY  74

Query  214  IFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            IF  LK++S     Y R++  G G+WK +D GKP+
Sbjct  75   IFTQLKKKSDGGKNYNRSITGG-GSWKGRDTGKPV  108



>ref|XP_009603640.1| PREDICTED: protein BEARSKIN1-like [Nicotiana tomentosiformis]
Length=259

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = +1

Query  49   DGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQR------SRDKV  207
            +G+ FRPTD+E L +L  FV G  +  +  I  + D+Y  +EPW+I+          D  
Sbjct  29   EGFRFRPTDSEGLMFLLRFVAGQEMHDSGFITTNVDVYGKQEPWEIYDNGVPCGDDEDST  88

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
             Y +   K +  S++RY R+VG+ KGTWK   + KP++
Sbjct  89   SYRYFITKLKKKSNARYHRSVGN-KGTWKQDAKDKPVH  125



>ref|XP_009590494.1| PREDICTED: protein SOMBRERO-like [Nicotiana tomentosiformis]
Length=253

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 6/93 (6%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRS---RDKVLYIF  219
            G  F PT+AEL+ +L  F+ G P+ S     + +D+Y  + PW+IF  S    +KV + F
Sbjct  13   GVRFHPTEAELINFLKRFLKGEPLPSECHNFQLADIYGDQPPWEIFGASDHPEEKVRFFF  72

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              LK++ S  +R  RT  +  GTWK Q    PI
Sbjct  73   TRLKKQKSEHTRVRRTCAN--GTWKGQTSIDPI  103



>ref|XP_004236507.2| PREDICTED: NAC domain-containing protein 2-like [Solanum lycopersicum]
Length=269

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 4/85 (5%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLST-VPIMESDLYNGEEPWKIFQRS-RDKVLYIFAT  225
            G  F PTD EL+ YL  F  G   L+   PI  +D+Y  + PW+IF  +  +K  Y    
Sbjct  6    GIRFHPTDTELINYLKRFFKGELSLNQQCPIQFADIYGDQPPWEIFGANFEEKFRYFITP  65

Query  226  LKRRSSSDSRYIRTVGDGKGTWKAQ  300
            LK+R   D+R+ RT    KGTWK Q
Sbjct  66   LKKRRIKDARFSRTC--AKGTWKGQ  88



>ref|XP_009793650.1| PREDICTED: protein SOMBRERO-like [Nicotiana sylvestris]
Length=242

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 7/94 (7%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRS----RDKVLYI  216
            G  F PT+AEL+ +L  F+ G  + S  P  + +D+Y  + PW+IF  S     +KV YI
Sbjct  14   GVRFHPTEAELINFLKRFLKGELLPSECPNFQLADIYGDQPPWEIFGASDHPEEEKVRYI  73

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F  LK++ S  +R  R   +  GTWK Q    PI
Sbjct  74   FTRLKKQKSEHTRVRRNCAN--GTWKGQTGIDPI  105



>ref|XP_004497954.1| PREDICTED: NAC domain-containing protein 68-like [Cicer arietinum]
Length=289

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 10/94 (11%)
 Frame = +1

Query  61   FRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYN-GEEPWKI---FQRSR---DKVLYI  216
             +PTD ELL  +L   +  NP+ + + I+E DL+   + PW+I   F+ S    +K LY 
Sbjct  11   LKPTDEELLKSFLYNKINNNPLPNHINILEHDLFGIKKNPWEIWEEFEASHSYCEKDLYF  70

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F  LK++S++ SR +RT+  G GTW+A+D  K I
Sbjct  71   FTLLKKKSATSSRMVRTI--GMGTWEAEDAKKDI  102



>ref|XP_003590172.1| NAC domain protein [Medicago truncatula]
 gb|AES60423.1| NAC transcription factor-like protein [Medicago truncatula]
Length=325

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = +1

Query  58   IFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLY-NGEEPWKIFQR------SRDKVLY  213
            +  PTD ELL  +L   +   P+ + + I+E DL+   + PW+I++       +R K LY
Sbjct  10   VITPTDDELLQQFLYNKIHNKPLPNHITILEHDLFGTAKNPWEIWEEFGTSNSNRGKDLY  69

Query  214  IFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
             F TLK++S++ SR +RT+G G+  W+ +D GK I+
Sbjct  70   FFTTLKKKSATSSRVVRTIGLGR--WEGEDSGKNIF  103



>ref|XP_008465646.1| PREDICTED: NAC domain-containing protein 72-like [Cucumis melo]
Length=322

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 49/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSR---DKVLYIFA  222
            G  FRPTD +LL YL   + G P      I + DLY G EPW+I+Q  +    + LY F 
Sbjct  17   GVKFRPTDQQLLHYLYCKINGQPYFQGA-IFDFDLYGGTEPWEIWQSFKGIDGEDLYFFT  75

Query  223  TLKRRSSS----DSRYIRTVGDGKGTWKAQDRGKPIY  321
             LKR + +     +   R +G   GTW  ++   PI+
Sbjct  76   KLKRSTKNCGQLSAHISRKIGLANGTWSGENSATPIF  112



>ref|XP_009612742.1| PREDICTED: NAC domain-containing protein 78-like, partial [Nicotiana 
tomentosiformis]
Length=273

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (52%), Gaps = 8/112 (7%)
 Frame = +1

Query  4    VLRAIIAMERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWK  180
            +LR  +   R   + +G+ FRP D+E L +L  FV G  +     I  + D+Y  +EPW+
Sbjct  28   LLRYSLLFIRHLELEEGFRFRPKDSEGLTFLLRFVAGQEMYDAGFITTNVDVYGKQEPWE  87

Query  181  IFQRS------RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            I++         D   Y     K +  S++RY R VG+ KG+WK   +GKP+
Sbjct  88   IYEHGVPCGDDEDSSSYPHFITKLKKKSNARYHRAVGN-KGSWKQDAKGKPM  138



>ref|XP_006437042.1| hypothetical protein CICLE_v10033879mg [Citrus clementina]
 gb|ESR50282.1| hypothetical protein CICLE_v10033879mg [Citrus clementina]
Length=453

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 40/106 (38%), Positives = 61/106 (58%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   ++G P+ L+   I + +LY+ ++P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELVEHYLKKKISGIPIPLAEYFITDCNLYD-KKPSEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   G W+ +D GK I
Sbjct  61   GPFLNADEDLYFFTQLKKKSSKGSRIDRKVGSSGGAWQGEDAGKDI  106



>ref|XP_006356572.1| PREDICTED: NAC transcription factor 25-like [Solanum tuberosum]
Length=398

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 45/87 (52%), Gaps = 4/87 (5%)
 Frame = +1

Query  46   PDGYIFRPTDAELLGYLALFVTGNPVLST-VPIMESDLYNGEEPWKIF-QRSRDKVLYIF  219
            P G  F PTD EL+ YL  F  G   L+   PI  +D+Y  + PW+IF   S +K  Y  
Sbjct  4    PMGIRFHPTDTELINYLKKFFNGELSLNQQCPIQFADIYGDQPPWEIFGANSEEKFRYFI  63

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQ  300
              LK+R +   R+ R     KGTWK Q
Sbjct  64   TPLKKRKTEYKRFSRIC--AKGTWKGQ  88



>ref|XP_006348969.1| PREDICTED: uncharacterized protein LOC102606428 [Solanum tuberosum]
Length=227

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 3/91 (3%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQRSRDKVLYIFATL  228
            GYIF P + E++ YL  F    P+ +    ME  +LY   EPW+IF+ +     Y     
Sbjct  10   GYIFSPKNIEVVKYLVGFTRDEPLPNQNQYMEVVNLYADNEPWQIFEGTNSYTRYFITPQ  69

Query  229  KRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            K+++    R  RTV  GKGTWK Q +GK ++
Sbjct  70   KKQNPKWKRVSRTV--GKGTWKPQGKGKEVF  98



>ref|XP_007216175.1| hypothetical protein PRUPE_ppa015761mg [Prunus persica]
 gb|EMJ17374.1| hypothetical protein PRUPE_ppa015761mg [Prunus persica]
Length=426

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 9/97 (9%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLALF-VTGNPVLSTVPIMESDLYNGEEPWKIF-QRSRDKV--  207
            +IP G+ FRP+D ELLGY  L  V G+       I E DLY   EPW ++ Q   +K+  
Sbjct  5    NIPMGFKFRPSDEELLGYYLLNKVRGSSFKYENVIPEFDLYGRIEPWDVWNQFGGNKLED  64

Query  208  ---LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRG  309
               LY F  LK  S+ ++R  RT+  G G+WKA++ G
Sbjct  65   GDDLYFFTKLKSSSAKNTRMARTI--GSGSWKAENSG  99



>ref|XP_008443554.1| PREDICTED: protein SOMBRERO-like [Cucumis melo]
Length=287

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 8/97 (8%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSR---DKVLYIFA  222
            G  FRPTD +LL YL   +   P      + + DLY G EPW+I+Q  +    + LY F 
Sbjct  17   GVKFRPTDQQLLRYLCCKIYDQPYFQGA-VFDFDLYGGIEPWEIWQSFKGIDGEDLYFFT  75

Query  223  TLKRRSSSD---SRYI-RTVGDGKGTWKAQDRGKPIY  321
             LKR +++    S +I R +G   GTW  ++   PIY
Sbjct  76   KLKRSTTNSGNLSTHINRKIGSANGTWSGENSATPIY  112



>ref|XP_007216726.1| hypothetical protein PRUPE_ppa025721mg [Prunus persica]
 gb|EMJ17925.1| hypothetical protein PRUPE_ppa025721mg [Prunus persica]
Length=374

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 9/96 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALF-VTGNPVLSTVPIMESDLYNGEEPWKIF------QRSRD  201
            +P G+ F P+D ELL Y  L  V G P + +  + E +LY  +EPW I+      +  + 
Sbjct  9    VPIGFKFHPSDDELLRYYLLNKVCGTPFMYSNVVPEFNLYGKKEPWDIWNDFGGQKLEKG  68

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRG  309
            + LY F  LK  +S  S   RT+G+  GTWK +DRG
Sbjct  69   EDLYFFTKLKLVTSKGSLVARTIGN--GTWKGEDRG  102



>ref|XP_006422232.1| hypothetical protein CICLE_v10006869mg [Citrus clementina]
 gb|ESR35472.1| hypothetical protein CICLE_v10006869mg [Citrus clementina]
Length=219

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 7/105 (7%)
 Frame = +1

Query  25   MERQE--HIPDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPW-KIFQR  192
            MER +   +P GY F PTD E++  YL   V G PV ++  I   D+Y  E  W +IF+R
Sbjct  1    MERHQLPALPPGYRFAPTDEEIVAHYLYNKVHGRPVSTSAVIDNIDVYRDENVWIRIFER  60

Query  193  SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYRY  327
            + +  LY F TLK+++ +  +  R      GTW++Q   + IYR+
Sbjct  61   TGENALYFFTTLKKKTENGVQVERET--NCGTWRSQKNTR-IYRH  102



>ref|XP_002533045.1| NAC domain-containing protein, putative [Ricinus communis]
 gb|EEF29335.1| NAC domain-containing protein, putative [Ricinus communis]
Length=376

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 15/105 (14%)
 Frame = +1

Query  34   QEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIM---ESDLYNGEEPWKIFQR----  192
            ++ IP GY F PTD EL+GY  LF   N  L  +  M   +++LY  +EP +++++    
Sbjct  5    KDQIPVGYRFNPTDCELVGYY-LFNKLNGCLLPIDNMLVADTNLYGKDEPLQLWEKFGGN  63

Query  193  ---SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                 D  +Y+F  LK++    SR +R+VG G GTW   D GKP+
Sbjct  64   CSFYSDGEIYLFTKLKKKG---SRILRSVGAG-GTWHGVDAGKPV  104



>ref|XP_009600309.1| PREDICTED: NAC domain-containing protein 76-like [Nicotiana tomentosiformis]
Length=324

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 48/92 (52%), Gaps = 5/92 (5%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF---QRSRDKVLYIFA  222
            G  F PT+ E++ +L  F+ G  + S      +D+Y    PW+IF     S +KV Y F 
Sbjct  13   GKRFHPTEGEMINFLKRFLKGETLPSEYRFQHADIYGDRPPWEIFGVDSNSEEKVGYFFT  72

Query  223  TLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             LK++ S  +R  RT  +  GTWKAQ    PI
Sbjct  73   QLKKQKSEHTRVHRTCAN--GTWKAQTGIVPI  102



>gb|KDO61624.1| hypothetical protein CISIN_1g046632mg, partial [Citrus sinensis]
Length=225

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 7/105 (7%)
 Frame = +1

Query  25   MERQE--HIPDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPW-KIFQR  192
            MER +   +P GY F PTD E++  YL   V G PV ++  I   D+Y  E  W +IF+R
Sbjct  1    MERHQLPALPPGYRFAPTDEEIVAHYLYNKVHGRPVSTSAVIDNIDVYRDENVWIRIFER  60

Query  193  SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYRY  327
            + +  LY F TLK+++ +  +  R      GTW++Q   + IYR+
Sbjct  61   TGENALYFFTTLKKKTENGVQVERET--NCGTWRSQKNTR-IYRH  102



>ref|XP_007212744.1| hypothetical protein PRUPE_ppa019456mg [Prunus persica]
 gb|EMJ13943.1| hypothetical protein PRUPE_ppa019456mg [Prunus persica]
Length=220

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLAL-FVTGNPVLSTVPIMESDLYNGEEPWKI---FQRSRD--  201
             +P GY FRP++ ELL +  L  V GN     V + + DLY  +EPW+I   F  S D  
Sbjct  5    QVPVGYRFRPSEEELLLHYLLPRVNGNNYPKGV-VPDCDLYGAKEPWEIWRDFHSSPDDQ  63

Query  202  KVLYIFATLKRRSSSDSRYIRTVGD-GKGTWKAQDRGKPI  318
            + +Y+F TLK+++ + SR+ RTVG  G G WK +D GK I
Sbjct  64   EDIYVFTTLKKKTPNGSRFCRTVGTAGTGVWKGEDSGKKI  103



>ref|XP_008245708.1| PREDICTED: NAC domain-containing protein 67-like [Prunus mume]
Length=351

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR------SR  198
            ++P GY FRP+D +LL  YL    +G P+     I E DLY   EPW I+        ++
Sbjct  9    NLPVGYTFRPSDDQLLEHYLLKKNSGEPLQYENVIPEMDLYGKIEPWDIWHECGGHKLAK  68

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             + LY F  LK     D+R  RT+  G GTWK ++ G  +
Sbjct  69   GEDLYFFTKLKSLGDKDTRVARTI--GSGTWKGENSGTTV  106



>ref|XP_009760677.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=255

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 7/94 (7%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRS----RDKVLYI  216
            G  F PT+AEL+ +L  F+ G  + S  P  + +D+Y  + PW+IF  S     +KV YI
Sbjct  14   GVRFHPTEAELINFLKRFLKGELLPSECPNFQLADIYGDQPPWEIFGASDHPEEEKVRYI  73

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F  LK++ S  +R  R   +  GTWK Q    PI
Sbjct  74   FTRLKKQKSEHTRVRRNCAN--GTWKGQTGIFPI  105



>gb|KDO37354.1| hypothetical protein CISIN_1g041697mg [Citrus sinensis]
Length=230

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 58/106 (55%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEHIP---DGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEHIP    G+ FRP+D EL+  YL   V+G  + L+   I + +LY   +P KI+    
Sbjct  2    QEHIPFLPHGFQFRPSDEELVEHYLKKKVSGTLIPLAEYFIRDCNLYE-TKPSKIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   G W+ +D GK I
Sbjct  61   GPFLNADEDLYFFTQLKKKSSKGSRIDRKVGSSGGAWQGEDAGKDI  106



>ref|XP_002313991.1| hypothetical protein POPTR_0009s07640g [Populus trichocarpa]
 gb|EEE87946.1| hypothetical protein POPTR_0009s07640g [Populus trichocarpa]
Length=222

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = +1

Query  46   PDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR------SRDK  204
            P GY F PTD EL   YL   V G P+ +TV   + +LY   EPW+I++       S + 
Sbjct  13   PPGYRFCPTDVELACFYLYRKVNGLPLPNTV--KDCNLYGDHEPWEIWEAFEGSELSNED  70

Query  205  VLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDR  306
             L+    LK RS+ DSR  R VG   GTWK   +
Sbjct  71   DLFFLTQLKNRSAKDSRSKRRVGRNGGTWKGDKK  104



>ref|XP_009784097.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=255

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 7/94 (7%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRS----RDKVLYI  216
            G  F PT+AEL+ +L  F+ G  + S  P  + +D+Y  + PW+IF  S     +KV YI
Sbjct  14   GVRFHPTEAELINFLKRFLKGELLPSECPNFQLADIYGDQPPWEIFGASDHPEEEKVRYI  73

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F  LK++ S  +R  R   +  GTWK Q    PI
Sbjct  74   FTRLKKQKSEHTRVRRNCAN--GTWKGQTGIFPI  105



>ref|XP_006475540.1| PREDICTED: NAC domain-containing protein 2-like [Citrus sinensis]
Length=244

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 7/105 (7%)
 Frame = +1

Query  25   MERQE--HIPDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPW-KIFQR  192
            MER +   +P GY F PTD E++  YL   V G PV ++  I   D+Y  E  W +IF+R
Sbjct  1    MERHQLPALPPGYRFAPTDEEIVAHYLYNKVHGRPVSTSAVIDNIDVYRDENVWIRIFER  60

Query  193  SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYRY  327
            + +  LY F TLK+++ +  +  R      GTW++Q +   IYR+
Sbjct  61   TGENALYFFTTLKKKTENGVQVERET--NCGTWRSQ-KNTRIYRH  102



>ref|XP_006437282.1| hypothetical protein CICLE_v10033459mg [Citrus clementina]
 gb|ESR50522.1| hypothetical protein CICLE_v10033459mg [Citrus clementina]
Length=166

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY  E+P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELIEHYLKKKVSGIFIPLAEYFIRDCNLYQ-EKPSEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  61   GPFLNADEDLYFFTQLKKKSSKGSRIDRKVGSSCGTWQGEDAGKDI  106



>ref|XP_006495077.1| PREDICTED: NAC domain-containing protein 18-like [Citrus sinensis]
Length=166

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY  E+P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELIEHYLKKKVSGIFIPLAEYFIRDCNLYE-EKPSEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  61   GPFLNADEDLYFFTQLKKKSSKGSRIDRKVGSSCGTWQGEDAGKDI  106



>gb|ACF19789.1| NAC transcription factor [Nicotiana tabacum]
Length=229

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 55/98 (56%), Gaps = 4/98 (4%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF-QRSRDK  204
            ER + +     FRP+D EL+  L  FV G  + +   I+ +D+Y+ +EPW +    S  K
Sbjct  4    ERTKPMEKTAQFRPSDTELIMQLMKFVAGKCLPTEELIVFADVYS-KEPWHLIGDISSKK  62

Query  205  VLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              Y    LK++  +D+R+ RT G+  GTW  Q++GK I
Sbjct  63   THYFLTQLKKKKPTDARFNRTTGN--GTWTQQNKGKKI  98



>ref|XP_009591317.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=257

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 6/93 (6%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRS---RDKVLYIF  219
            G  F PT+AEL+ +L  F+ G  + S  P  + +D+Y  + PW+IF  S    +KV Y F
Sbjct  13   GVRFHPTEAELINFLKRFLKGESLPSECPNFQLADIYGDQPPWEIFGASGHPEEKVRYFF  72

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              LK++    +R  RT  +  GTWK Q    PI
Sbjct  73   TRLKKQKIEHTRVRRTCAN--GTWKGQTGIDPI  103



>ref|XP_009600052.1| PREDICTED: NAC domain-containing protein 78-like, partial [Nicotiana 
tomentosiformis]
Length=176

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 53/99 (54%), Gaps = 8/99 (8%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQR------SRD  201
            + +G+ FRP D+E L +L  FV G  +     I  + D+Y  +EPW+I++         D
Sbjct  6    LEEGFRFRPKDSEGLTFLLRFVVGQEMYDAGFITTNVDVYGKQEPWEIYEHGVPCGDDED  65

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
               Y     K +  S++RY R VG+ KG+WK   +GKP+
Sbjct  66   SSSYPHFITKLKKKSNARYHRAVGN-KGSWKQDAKGKPM  103



>gb|KDO57718.1| hypothetical protein CISIN_1g046003mg [Citrus sinensis]
Length=458

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 39/106 (37%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   ++G P+ L+   I + +LY  ++P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELVEHYLKKKISGIPIPLAEYFITDCNLYE-KKPTEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ +Y F  LK++SS  SR  R VG   G W+ +D GK I
Sbjct  61   GPFLNADEDMYFFTQLKKKSSKGSRIDRKVGSSGGAWQGEDAGKDI  106



>gb|ACF19790.1| NAC transcription factor [Nicotiana tabacum]
Length=174

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 57/101 (56%), Gaps = 4/101 (4%)
 Frame = +1

Query  19   IAMERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSR  198
            +  ER + +     FRP+D +L+  L  FV G  + +   I+ +D+Y  +EPW++     
Sbjct  1    MPQERTKPMEKNPQFRPSDTDLIMQLLKFVAGKCLPTEELIVYADVY-SKEPWQLIGNMN  59

Query  199  DKVLYIFAT-LKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             K  + F T LK++  +D+R+ RT G+  GTW  Q++GK I
Sbjct  60   SKKTHYFLTQLKKKKPTDARFNRTTGN--GTWTQQNKGKQI  98



>ref|XP_009795944.1| PREDICTED: protein ATAF2-like [Nicotiana sylvestris]
Length=255

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 8/100 (8%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQR------SRD  201
            + +G+ FRPTD+E L +L  FV G  +     I  + D+Y  +EPW+I+          D
Sbjct  6    LEEGFRFRPTDSEGLTFLLRFVAGQEMHDAGFITTNIDVYGKQEPWEIYDNGVPCGDDED  65

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               Y +   K +  S++RY R+V + KGTWK   + KP++
Sbjct  66   NSSYCYFITKLKKKSNARYHRSVRN-KGTWKQDAKDKPVH  104



>gb|AGL39738.1| NAC transcription factor 082 [Jatropha curcas]
Length=240

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRD  201
            M  +  +P GY F PTD EL+  YL   V   P+   V +   D+Y  + PW+IF +S +
Sbjct  1    MAERSELPCGYRFVPTDEELVNFYLRRKVEKQPLPRGV-VRTRDIY-SKNPWEIFDKSCN  58

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWK  294
               Y+F TL+++ +S +R+ RT   G GTWK
Sbjct  59   GFFYVFTTLRKKQNSRTRFDRTA--GSGTWK  87



>ref|XP_009341990.1| PREDICTED: NAC transcription factor ONAC010-like [Pyrus x bretschneideri]
Length=181

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 4/94 (4%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWK-IFQRSRDKVLYI  216
            +P G  F P+D ELL  +L   V G P LS    +E DLY  E+ W+ +F ++ ++ LY 
Sbjct  9    LPVGCHFEPSDKELLLHFLNNKVHGLP-LSCNAAIECDLYGNEKTWRQLFDQTGERCLYF  67

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F  LK+++   SR  RT   G   WK+Q+  KP+
Sbjct  68   FTVLKKKTEKASRVERTSSGGCVIWKSQN-DKPV  100



>ref|XP_009604942.1| PREDICTED: NAC domain-containing protein 2-like [Nicotiana tomentosiformis]
Length=310

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF--QRSRDKVLYI  216
            +P G+ F PTD EL+ +L  +   + +L     +E       EPW+IF    S++K  Y 
Sbjct  7    LPMGFRFHPTDVELITFLERYAH-HGILPPDGDIEVAKIGDTEPWQIFGDSNSKEKTRYF  65

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             + LKR  +S  ++ RTV  G+GTWK Q  GKPI
Sbjct  66   VSKLKRFKNSTKKFSRTV--GQGTWKGQSGGKPI  97



>ref|XP_004490175.1| PREDICTED: NAC transcription factor 25-like [Cicer arietinum]
Length=370

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/98 (36%), Positives = 58/98 (59%), Gaps = 14/98 (14%)
 Frame = +1

Query  58   IFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEE-PWKIFQR--------SRDKV  207
            I +PTD EL   +L   +  NP+ + + I+E DL+  ++ PW+I++          RD  
Sbjct  11   IIKPTDEELFQSFLYNKINNNPLPNHIAIIELDLFGTKKNPWEIWEEFATSHSYCGRD--  68

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            LY F+ LK++S++ SR +R +G  KGTW+ +D G  I+
Sbjct  69   LYFFSALKKKSATSSRSVRLIG--KGTWEGEDTGTEIF  104



>ref|XP_006432683.1| hypothetical protein CICLE_v10003273mg, partial [Citrus clementina]
 gb|ESR45923.1| hypothetical protein CICLE_v10003273mg, partial [Citrus clementina]
Length=242

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 49/102 (48%), Gaps = 8/102 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF----QR  192
            ME + H+  G  F+PT+ EL+ +  L      VLS  PI E +LY    PW+IF      
Sbjct  1    MEARFHLGVGVRFKPTEEELIKFCLLKRAKGQVLSPCPIAECELYGKRSPWEIFDEGANN  60

Query  193  SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            S   + Y F +LK+  +   R  R    GKGTW  +   K I
Sbjct  61   SDKSIWYCFTSLKK--AGKKRISRVA--GKGTWHGESSAKEI  98



>gb|KDP42192.1| hypothetical protein JCGZ_02922 [Jatropha curcas]
Length=209

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRD  201
            M  +  +P GY F PTD EL+  YL   V   P+   V +   D+Y+ + PW+IF +S +
Sbjct  1    MAERSELPCGYRFVPTDEELVNFYLRRKVEKQPLPRGV-VRTRDIYS-KNPWEIFDKSCN  58

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWK  294
               Y+F TL+++ +S +R+ RT   G GTWK
Sbjct  59   GFFYVFTTLRKKQNSRTRFDRTA--GSGTWK  87



>ref|XP_007027186.1| Uncharacterized protein TCM_022059 [Theobroma cacao]
 gb|EOY07688.1| Uncharacterized protein TCM_022059 [Theobroma cacao]
Length=320

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 5/96 (5%)
 Frame = +1

Query  22   AMERQEHIPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIMESDLY-NGEEPWKIFQRS  195
             M      P GY F PT+ EL LGYL   V G   L +  +++ ++Y + +EPWKIF ++
Sbjct  46   VMSTTMKFPMGYRFVPTEEELVLGYLLKKVKG-ETLPSQAVIDCEIYGDDKEPWKIFNQT  104

Query  196  RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQD  303
                 Y+F  LK+++    R  RT   G GTWKAQ+
Sbjct  105  STDKFYVFTKLKKKNGRGRRIDRTA--GCGTWKAQN  138



>gb|KGN59694.1| hypothetical protein Csa_3G838730 [Cucumis sativus]
Length=304

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 51/97 (53%), Gaps = 8/97 (8%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS---RDKVLYIFA  222
            G  FRPTD +LL YL   + G P      + + DLY G EPW+I+Q       + LY F 
Sbjct  17   GVKFRPTDQQLLHYLHCKIYGQPYFQGA-VFDFDLYGGVEPWEIWQSFGGIDGEDLYFFT  75

Query  223  TLKRRSSSD---SRYI-RTVGDGKGTWKAQDRGKPIY  321
             LKR +++    S +I R +G   GTW  ++   PIY
Sbjct  76   KLKRSTTNSGNLSTHINRKIGLVNGTWSGENSASPIY  112



>ref|XP_006437287.1| hypothetical protein CICLE_v10033541mg [Citrus clementina]
 gb|ESR50527.1| hypothetical protein CICLE_v10033541mg [Citrus clementina]
Length=340

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY  E+P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELIEHYLKKKVSGIFIHLAEYFIRDCNLYE-EKPSEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  61   GPFLNADEDLYFFTQLKKKSSKGSRIDRKVGSSGGTWQGEDAGKDI  106



>ref|XP_004142192.1| PREDICTED: NAC domain-containing protein 68-like [Cucumis sativus]
 ref|XP_004165045.1| PREDICTED: NAC domain-containing protein 68-like [Cucumis sativus]
 gb|KGN54288.1| hypothetical protein Csa_4G296900 [Cucumis sativus]
Length=306

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 51/97 (53%), Gaps = 8/97 (8%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS---RDKVLYIFA  222
            G  FRPTD +LL YL   + G P      + + DLY G EPW+I+Q       + LY F 
Sbjct  17   GVKFRPTDQQLLHYLHCKIYGQPYFQGA-VFDFDLYGGVEPWEIWQSFGGIDGEDLYFFT  75

Query  223  TLKRRSSSD---SRYI-RTVGDGKGTWKAQDRGKPIY  321
             LKR +++    S +I R +G   GTW  ++   PIY
Sbjct  76   KLKRSTTNSGNLSTHINRKIGLVNGTWSGENSASPIY  112



>ref|XP_004139160.1| PREDICTED: NAC domain-containing protein 68-like [Cucumis sativus]
 ref|XP_004157155.1| PREDICTED: NAC domain-containing protein 68-like [Cucumis sativus]
Length=301

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 49/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS---RDKVLYIFA  222
            G  FRPTD +LL YL   + G P      + + DLY G EPW+I+Q       + LY F 
Sbjct  21   GLKFRPTDQQLLHYLHCKIYGQPYFQGA-VFDFDLYGGVEPWEIWQSFGGIDGEDLYFFT  79

Query  223  TLKRRSSS----DSRYIRTVGDGKGTWKAQDRGKPIY  321
             LKR +++     +   R +G   GTW  ++   PIY
Sbjct  80   KLKRSTTNCGNLSTHVNRKIGLVNGTWSGENSASPIY  116



>ref|XP_006495078.1| PREDICTED: NAC domain-containing protein 7-like [Citrus sinensis]
Length=339

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY  E+P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELIEHYLKKKVSGIFIPLAEYFIRDCNLYE-EKPSEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  61   GPFLNADEDLYFFTQLKKKSSKGSRIDRKVGSSGGTWQGEDAGKDI  106



>ref|XP_006437303.1| hypothetical protein CICLE_v10033526mg [Citrus clementina]
 gb|ESR50543.1| hypothetical protein CICLE_v10033526mg [Citrus clementina]
Length=339

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY  E+P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELIEHYLKKKVSGIFIPLAEYFIRDCNLYE-EKPSEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  61   GPFLNADEDLYFFTQLKKKSSKGSRIDRKVGSSGGTWQGEDAGKDI  106



>ref|XP_007019807.1| Uncharacterized protein TCM_036193 [Theobroma cacao]
 gb|EOY17032.1| Uncharacterized protein TCM_036193 [Theobroma cacao]
Length=358

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 52/95 (55%), Gaps = 8/95 (8%)
 Frame = +1

Query  43   IPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIMESDLYNGE--EPWKIFQRSRDKVLY  213
            +P GY F PTD +L L YL+  V G P+LS   + + ++Y  +  EPW IF  +  +  Y
Sbjct  18   VPPGYRFAPTDDQLILHYLSNKVKGQPLLSEA-VTDCEIYGDQDKEPWNIFDVTSPRTFY  76

Query  214  IFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            +F  LK +     R  RT   G+GTWK Q R  P+
Sbjct  77   VFTKLKNKGKG-KRIERTA--GRGTWKGQ-RTDPV  107



>gb|KGN66647.1| hypothetical protein Csa_1G652300 [Cucumis sativus]
Length=327

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 49/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS---RDKVLYIFA  222
            G  FRPTD +LL YL   + G P      + + DLY G EPW+I+Q       + LY F 
Sbjct  47   GLKFRPTDQQLLHYLHCKIYGQPYFQGA-VFDFDLYGGVEPWEIWQSFGGIDGEDLYFFT  105

Query  223  TLKRRSSS----DSRYIRTVGDGKGTWKAQDRGKPIY  321
             LKR +++     +   R +G   GTW  ++   PIY
Sbjct  106  KLKRSTTNCGNLSTHVNRKIGLVNGTWSGENSASPIY  142



>ref|XP_009792222.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=324

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 53/97 (55%), Gaps = 9/97 (9%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQ------RSRDKVL  210
            G+ F PTD E+L YL  FV   P+ S   +M+ +DLY  +EPW+IF+       + +   
Sbjct  2    GHRFHPTDREVLKYLIGFVRDEPLHSQNELMQVADLYADKEPWQIFEVYDQGNNNNNNTR  61

Query  211  YIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            Y     K+   +  R  RTVG  KGTWK Q +G+ ++
Sbjct  62   YFITPQKKEKPTWKRVSRTVG--KGTWKPQGKGREVF  96



>ref|XP_009605650.1| PREDICTED: NAC domain-containing protein 18-like, partial [Nicotiana 
tomentosiformis]
Length=109

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +1

Query  61   FRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF-QRSRDKVLYIFATLKRR  237
            FRP+D +L+  L  FV G  + +   I+ +D+Y+ +EPW++    +  K  Y    LK++
Sbjct  7    FRPSDTDLIMQLLKFVAGKCLPTEELIVFADVYS-KEPWQLIGDMNSKKTHYFLTQLKKK  65

Query  238  SSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              +D+R+ RT G+  GTW  Q++GK I
Sbjct  66   KPTDARFNRTTGN--GTWTQQNKGKQI  90



>ref|XP_002529767.1| transcription factor, putative [Ricinus communis]
 gb|EEF32633.1| transcription factor, putative [Ricinus communis]
Length=328

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 12/101 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIM---ESDLYNGEEPWKIFQRSRDKVLY  213
            +P G  F+PTD EL+       T N  LS V  M     DLY  +EPW+++ +     L+
Sbjct  8    LPSGCRFKPTDEELVAIYLFKKTNNLNLSDVENMVVPVCDLYGDKEPWELWDQFAQNQLF  67

Query  214  I------FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            I      F  LK++  S SR +R V  GKGTW  +++G+P+
Sbjct  68   INGDLFFFTELKKKPKS-SRILRRV--GKGTWHGENKGEPV  105



>ref|XP_004228763.1| PREDICTED: NAC domain-containing protein 78-like [Solanum lycopersicum]
Length=265

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 53/105 (50%), Gaps = 11/105 (10%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQR--------  192
            ++ +G+ F PTDAE + +L  F+ G  +  +  I    D Y  +EPW I+          
Sbjct  3    NLKEGFRFSPTDAEAVTFLLRFIAGKFMNDSGFITTHVDTYGKQEPWDIYSHGVACSNDD  62

Query  193  -SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
               D   Y F   K +  S+SRY R VG+ KG+WK QD+ K + R
Sbjct  63   EDNDCSQYRFFITKLKKKSESRYSRDVGN-KGSWKQQDKSKSVRR  106



>gb|AES82706.2| NAC transcription factor-like protein [Medicago truncatula]
Length=206

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 10/94 (11%)
 Frame = +1

Query  61   FRPTDAELL-GYLALFVTGNPVLSTVPIMESDLY----NGEEPWKIFQRSRD---KVLYI  216
            F PTD EL+  +L   +  NPV + + I++ +L+    N  E W+ F  S     K LY 
Sbjct  11   FTPTDDELIRSFLYNRIHNNPVPNYITILDYELFGIVKNPWEIWEEFAPSHSYCGKDLYF  70

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F TLK++S++  R IRT+  G GTW+ +D GK I
Sbjct  71   FTTLKKKSATSKRLIRTI--GSGTWEGEDTGKGI  102



>ref|XP_009601217.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=274

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (51%), Gaps = 9/108 (8%)
 Frame = +1

Query  19   IAMERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQ--  189
            +A     H   G+ F PTD E+L YL  FV   P+     +M+  DLY  +EPW+IF+  
Sbjct  1    MAENSSSHRSMGHRFHPTDREVLKYLVGFVRNEPLPLQNELMQVVDLYADKEPWQIFEAY  60

Query  190  ----RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
                 + +   Y     K+   +  R  RTVG  KGTWK Q++G+ ++
Sbjct  61   DRGNNNNNNTRYFITPQKKEKPTWKRVSRTVG--KGTWKLQNKGRDVF  106



>ref|XP_006437271.1| hypothetical protein CICLE_v10033719mg [Citrus clementina]
 gb|ESR50511.1| hypothetical protein CICLE_v10033719mg [Citrus clementina]
Length=370

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 42/106 (40%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELLG-YLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY  E+P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELIELYLKKKVSGIFIPLAEYFIRDCNLYE-EKPSEIWNSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  61   GPYLNADEDLYFFTQLKKKSSKGSRIDRKVGSFGGTWQGEDAGKDI  106



>ref|XP_009611780.1| PREDICTED: uncharacterized protein LOC104105233 [Nicotiana tomentosiformis]
Length=134

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +1

Query  61   FRPTDAELLGYLALFVTGNPVLSTVPIMESDLY-NGEEPWKIFQR-SRDKVLYIFATLKR  234
            FRP+D +L+  L  FV G  + +   I  +D+Y N  EPW++    S  K  Y    LK+
Sbjct  7    FRPSDTDLITQLLKFVAGKCLPTEGLIGFADVYSNDNEPWRLIGDISSMKTHYFLTQLKK  66

Query  235  RSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            +  +D+R+ RT G+  GTW  Q++GK I
Sbjct  67   KKPTDARFNRTTGN--GTWTQQNKGKKI  92



>ref|XP_003626488.1| NAC domain-containing protein [Medicago truncatula]
Length=210

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 10/94 (11%)
 Frame = +1

Query  61   FRPTDAELL-GYLALFVTGNPVLSTVPIMESDLY----NGEEPWKIFQRSRD---KVLYI  216
            F PTD EL+  +L   +  NPV + + I++ +L+    N  E W+ F  S     K LY 
Sbjct  11   FTPTDDELIRSFLYNRIHNNPVPNYITILDYELFGIVKNPWEIWEEFAPSHSYCGKDLYF  70

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F TLK++S++  R IRT+  G GTW+ +D GK I
Sbjct  71   FTTLKKKSATSKRLIRTI--GSGTWEGEDTGKGI  102



>ref|XP_006348012.1| PREDICTED: NAC domain-containing protein 68-like [Solanum tuberosum]
Length=336

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 44/87 (51%), Gaps = 4/87 (5%)
 Frame = +1

Query  46   PDGYIFRPTDAELLGYLALFVTGNPVLST-VPIMESDLYNGEEPWKIF-QRSRDKVLYIF  219
            P G  F PTD EL+ YL  F  G   L+   PI  +D+Y  + PW+IF   S +K  Y  
Sbjct  4    PMGIRFHPTDTELINYLKRFFKGELCLNQQCPIQFADIYGDQPPWEIFGANSEEKFRYFI  63

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQ  300
              LK++     R+ R     KGTWK Q
Sbjct  64   TPLKKQKIEYKRFSRIC--AKGTWKGQ  88



>ref|XP_010058231.1| PREDICTED: NAC domain-containing protein 68-like [Eucalyptus 
grandis]
Length=312

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 5/84 (6%)
 Frame = +1

Query  52   GYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATL  228
            G+ F+PTD EL   YL   +   P+     I + D+Y G +PWKIF + R    Y+F  L
Sbjct  7    GFCFQPTDQELFSDYLMRRLNKEPLPDPNLIRDCDVYGGGDPWKIFDKDRGGKFYVFTVL  66

Query  229  KRRSSSDSRYIRTVGDGKGTWKAQ  300
            K+++   SR  RT   G G+WK +
Sbjct  67   KKKNR--SRVDRTA--GSGSWKEE  86



>ref|XP_006437279.1| hypothetical protein CICLE_v10033536mg [Citrus clementina]
 gb|ESR50519.1| hypothetical protein CICLE_v10033536mg [Citrus clementina]
Length=343

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY  ++P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELIEHYLKKKVSGIFIPLAEYFIRDCNLYE-KKPTEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  61   GPFLNADEDLYFFTQLKKKSSKGSRIDRKVGSSGGTWQGEDAGKDI  106



>ref|XP_009627656.1| PREDICTED: NAC transcription factor NAM-B2-like [Nicotiana tomentosiformis]
Length=258

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +1

Query  61   FRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF-QRSRDKVLYIFATLKRR  237
            FRP+D +L+  L  FV G  + +   I+ +D+Y+ +EPW++    +  K  Y    LK++
Sbjct  15   FRPSDTDLIMQLLKFVAGKCLPTEELIVYADVYS-KEPWQLIGDMNSKKTHYFLTQLKKK  73

Query  238  SSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              +D+R+ RT G+  GTW  Q++GK I
Sbjct  74   KPTDARFNRTTGN--GTWTQQNKGKQI  98



>ref|XP_006437305.1| hypothetical protein CICLE_v10033957mg [Citrus clementina]
 gb|ESR50545.1| hypothetical protein CICLE_v10033957mg [Citrus clementina]
Length=339

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 60/106 (57%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY  ++P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELIEHYLKKKVSGIFIPLAEYFIRDCNLYE-KKPSEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  61   GPFLNADEDLYFFTQLKKKSSKGSRIDRKVGSSGGTWQGEDAGKDI  106



>ref|XP_008361191.1| PREDICTED: NAC domain-containing protein 12-like [Malus domestica]
Length=318

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 51/97 (53%), Gaps = 13/97 (13%)
 Frame = +1

Query  67   PTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR-----------SRDKVL  210
            P D ELL GYL   + G      + + + DLY  EEP  I++R           + DK +
Sbjct  2    PRDDELLLGYLRPKLDGQDYPKGI-VHDCDLYGLEEPSDIWRRLNRASHDGQECTDDKDI  60

Query  211  YIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            Y+F TL  ++ + SR  RTVG   GTWK +D GK IY
Sbjct  61   YVFTTLNSKAPNGSRVCRTVGTTGGTWKGEDAGKXIY  97



>ref|XP_004146370.1| PREDICTED: NAC domain-containing protein 90-like [Cucumis sativus]
Length=211

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 57/98 (58%), Gaps = 11/98 (11%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLAL--FVTGNPVLSTVPIMESDLYNGEEPWKIFQRSR---DKV  207
            IP GYIF PT+ ELLGY      + G      +P++  DLY  +EP +I+Q+ R   ++ 
Sbjct  6    IPVGYIFCPTEEELLGYYLYNKVLGGQTPPLVLPVI--DLYT-QEPSQIWQQCRGVDNQD  62

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            +Y F TL+++    SR IR +G   GTW  +++ + ++
Sbjct  63   IYFFTTLQKKK---SRIIRKIGSNGGTWSGENKPQQVF  97



>ref|XP_009631912.1| PREDICTED: transcription factor JUNGBRUNNEN 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009631913.1| PREDICTED: transcription factor JUNGBRUNNEN 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009631914.1| PREDICTED: transcription factor JUNGBRUNNEN 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009631915.1| PREDICTED: transcription factor JUNGBRUNNEN 1-like [Nicotiana 
tomentosiformis]
Length=266

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +1

Query  61   FRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF-QRSRDKVLYIFATLKRR  237
            FRP+D +L+  L  FV G  + +   I+ +D+Y+ +EPW++    +  K  Y    LK++
Sbjct  7    FRPSDTDLIMQLLKFVAGKCLPTEELIVFADVYS-KEPWQLIGDMNSKKTHYFLTQLKKK  65

Query  238  SSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              +D+R+ RT G+  GTW  Q++GK I
Sbjct  66   KPTDARFNRTTGN--GTWTQQNKGKKI  90



>ref|XP_006348968.1| PREDICTED: NAC domain-containing protein 74-like [Solanum tuberosum]
Length=221

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (52%), Gaps = 3/91 (3%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQRSRDKVLYIFATL  228
            GYIF P + E++ YL  F    P+ +    ME  +LY   EPW+I + +     Y     
Sbjct  10   GYIFSPKNIEVMKYLVGFTRDEPLPNQNQYMEVVNLYAENEPWQILEGTNSYTRYFITPQ  69

Query  229  KRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            K+++    R  RTV  GKG WK Q +GK ++
Sbjct  70   KKQNPKWKRVSRTV--GKGAWKPQGKGKEVF  98



>ref|XP_010058221.1| PREDICTED: NAC transcription factor 29-like [Eucalyptus grandis]
Length=313

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 8/81 (10%)
 Frame = +1

Query  61   FRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLKRR  237
            FRPTD  L   YL    TG P+   + I E DLY+ +EPW+IF  + ++  Y+F TL++ 
Sbjct  7    FRPTDEHLFDHYLQQKATGAPLPPGL-IEECDLYS-QEPWRIFDTTSEQTFYVFTTLRKN  64

Query  238  SSSDSRYIRTVGDGKGTWKAQ  300
                SR +RT   G GTWK Q
Sbjct  65   K---SRVLRTA--GSGTWKEQ  80



>ref|XP_004137930.1| PREDICTED: protein CUP-SHAPED COTYLEDON 1-like [Cucumis sativus]
Length=170

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 57/98 (58%), Gaps = 11/98 (11%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLAL--FVTGNPVLSTVPIMESDLYNGEEPWKIFQRSR---DKV  207
            IP GY+F PT+ ELLGY      + G      +P++  DLY  +EP +I+Q+ R   ++ 
Sbjct  40   IPVGYVFCPTEEELLGYYLYNKVLGGQAPPLVLPVI--DLYT-QEPSQIWQQCRGVDNQD  96

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            +Y F TL+++    SR IR VG   GTW  +++ + ++
Sbjct  97   IYFFTTLQKKK---SRIIRKVGSNGGTWSGENKPQQVF  131



>ref|XP_009767422.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=286

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 51/95 (54%), Gaps = 6/95 (6%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS----RDKVLYIF  219
            G+ FRPTD EL+ YL  FV+     S   I   +LY  ++P  IF+ +      KV Y F
Sbjct  15   GFRFRPTDEELIRYLLKFVSCKS-FSFDHIRVENLYGKKKPSDIFENNFLGDDTKVNYFF  73

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
              LKR  +  SR+ R +  G G WK  D+ KP+++
Sbjct  74   TKLKRTKAGGSRFSRGLIGG-GCWKGLDKHKPVFK  107



>ref|XP_010317945.1| PREDICTED: NAC domain-containing protein 2-like [Solanum lycopersicum]
Length=262

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 4/85 (5%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLST-VPIMESDLYNGEEPWKIFQRSRD-KVLYIFAT  225
            G  F PTD +L+ YL  F  G   L+   PI+ +D+Y  + PW+IF  + + K  Y    
Sbjct  6    GIRFHPTDTKLINYLKRFFKGELSLNQECPILFADIYGDQPPWEIFGANFEVKYRYFITP  65

Query  226  LKRRSSSDSRYIRTVGDGKGTWKAQ  300
            LK+R   D+R+ RT    KG WK Q
Sbjct  66   LKKRRIKDTRFSRTC--AKGMWKGQ  88



>ref|XP_010058220.1| PREDICTED: NAC transcription factor 29-like [Eucalyptus grandis]
 gb|KCW72103.1| hypothetical protein EUGRSUZ_E00542 [Eucalyptus grandis]
Length=318

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 8/81 (10%)
 Frame = +1

Query  61   FRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLKRR  237
            FRPTD  L   YL    TG P+   + I E DLY+ +EPW+IF  + ++  Y+F TL++ 
Sbjct  7    FRPTDEHLFDHYLQQKATGAPLPPGL-IEECDLYS-QEPWRIFDTTSEQTFYVFTTLRKN  64

Query  238  SSSDSRYIRTVGDGKGTWKAQ  300
                SR +RT   G GTWK Q
Sbjct  65   K---SRVLRTA--GSGTWKEQ  80



>ref|XP_009761286.1| PREDICTED: NAC domain-containing protein 2-like [Nicotiana sylvestris]
Length=311

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF--QRSRDKVLYI  216
            +P G+ F PTD EL+ +L  +V    +L     +E       EPW+IF    S++K  Y 
Sbjct  7    LPMGFRFHPTDVELINFLKRYVH-RGILPPDGDIEVAKIGVTEPWQIFGDSNSKEKTRYF  65

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             + LKR  +S  ++ RTV  G+GTWK Q  G PI
Sbjct  66   VSKLKRFKNSTKKFSRTV--GRGTWKDQSGGAPI  97



>ref|XP_006385817.1| hypothetical protein POPTR_0003s14920g, partial [Populus trichocarpa]
 gb|ERP63614.1| hypothetical protein POPTR_0003s14920g, partial [Populus trichocarpa]
Length=148

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 45/95 (47%), Gaps = 4/95 (4%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNG--EEPWKIFQRSRDKVLYI  216
            IP GY F+P   ELL +  L       L    I+E DLYN   EE W+I + S  + +Y 
Sbjct  6    IPLGYRFKPNSIELLVHYLLKKVKRKPLPCDSIIECDLYNNSTEEWWEILKNSEAEEIYC  65

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            F  LK++    S   R      GTWK   + K IY
Sbjct  66   FTKLKKKGHGGSNKDRV--SKSGTWKGTQKTKEIY  98



>ref|XP_010058219.1| PREDICTED: NAC transcription factor 29-like [Eucalyptus grandis]
 gb|KCW72102.1| hypothetical protein EUGRSUZ_E00541 [Eucalyptus grandis]
Length=318

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 8/81 (10%)
 Frame = +1

Query  61   FRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLKRR  237
            FRPTD  L   YL    TG P+   + I E DLY+ +EPW+IF  + ++  Y+F TL++ 
Sbjct  7    FRPTDEHLFDHYLQQKATGAPLPPGL-IEECDLYS-QEPWRIFDTTSEQTFYVFTTLRKN  64

Query  238  SSSDSRYIRTVGDGKGTWKAQ  300
                SR +RT   G GTWK Q
Sbjct  65   K---SRVLRTA--GSGTWKEQ  80



>ref|XP_006345198.1| PREDICTED: NAC domain-containing protein 78-like [Solanum tuberosum]
Length=263

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 45/87 (52%), Gaps = 4/87 (5%)
 Frame = +1

Query  46   PDGYIFRPTDAELLGYLALFVTGNPVLST-VPIMESDLYNGEEPWKIFQRS-RDKVLYIF  219
            P G  F PTD EL+ YL  F  G   L+   PI  +D+Y  + PW+IF  +  +K  Y  
Sbjct  4    PMGIRFHPTDTELINYLKRFFKGELCLNEECPIQFADIYGDQPPWEIFGANFEEKFRYFI  63

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQ  300
              LK++ +   R+ R     KGTW+ Q
Sbjct  64   TPLKKQKTEYKRFSRIC--AKGTWQGQ  88



>ref|XP_010055621.1| PREDICTED: NAC domain-containing protein 68-like [Eucalyptus 
grandis]
Length=312

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 5/83 (6%)
 Frame = +1

Query  55   YIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLK  231
            + F+PTD EL   YL   +   P+     I + D+Y G EPWKIF + R    Y+F  LK
Sbjct  8    FCFQPTDQELFSDYLMRRLNEEPLPDPNLIRDCDVYGGGEPWKIFDKDRGGKFYVFTVLK  67

Query  232  RRSSSDSRYIRTVGDGKGTWKAQ  300
            +++   SR  RT   G G+WK +
Sbjct  68   KKNR--SRVDRTA--GSGSWKEE  86



>ref|XP_007019853.1| Uncharacterized protein TCM_036236 [Theobroma cacao]
 gb|EOY17078.1| Uncharacterized protein TCM_036236 [Theobroma cacao]
Length=354

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 52/95 (55%), Gaps = 8/95 (8%)
 Frame = +1

Query  43   IPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIMESDLYNGE--EPWKIFQRSRDKVLY  213
            +P GY F PTD +L L YL+  V G P L +  + + ++Y  +  EPW+IF  +  +  Y
Sbjct  38   VPPGYRFAPTDDQLILHYLSNKVRGQP-LPSEAVTDCEIYGDQDKEPWRIFDMTSPRKFY  96

Query  214  IFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            +F  LK +     R  RT   G+GTWK Q R  P+
Sbjct  97   VFTKLKNKGKG-KRIERTA--GRGTWKGQ-RTDPV  127



>ref|XP_006345197.1| PREDICTED: NAC domain-containing protein 2-like [Solanum tuberosum]
Length=272

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 45/87 (52%), Gaps = 4/87 (5%)
 Frame = +1

Query  46   PDGYIFRPTDAELLGYLALFVTGNPVLST-VPIMESDLYNGEEPWKIFQRS-RDKVLYIF  219
            P G  F PTD EL+ YL  F  G   L+   PI  +D+Y  + PW+IF  +  +K  Y  
Sbjct  4    PMGIRFHPTDTELINYLKRFFKGELCLNEECPIQFADIYGDQPPWEIFGANFEEKFRYFI  63

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQ  300
              LK++ +   R+ R     KGTW+ Q
Sbjct  64   TPLKKQKTEYKRFSRIC--AKGTWQGQ  88



>ref|XP_009794658.1| PREDICTED: protein SOMBRERO-like [Nicotiana sylvestris]
Length=241

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 8/94 (9%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRSRD----KVLYI  216
            G  F PT+AEL+ +L  F+ G  + S  P  + +D+Y  + PW IF  + D    KV YI
Sbjct  14   GVRFHPTEAELINFLKRFLKGELLPSECPNFQLADIYGDQPPWDIFGANSDHPKEKVRYI  73

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            F   K ++S  +R  RT  +  GTWK Q    PI
Sbjct  74   FTRFK-QTSEHTRVRRTCAN--GTWKGQTGIDPI  104



>ref|XP_008443625.1| PREDICTED: NAC domain-containing protein 18-like [Cucumis melo]
Length=231

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 51/98 (52%), Gaps = 10/98 (10%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKI---FQRSRDKVLYIFA  222
            G  F PT+ +LL YL   + G P      I + DLY G EPW+I   F+    + LY F 
Sbjct  17   GIKFMPTNQQLLHYLRCKIYGQPYFQGA-IFDFDLYGGIEPWEIWRSFEGIDGEDLYFFT  75

Query  223  TLKRRSSSDSRYIRT-----VGDGKGTWKAQDRGKPIY  321
              K RS+++S ++ T     +G   GTW +++   PIY
Sbjct  76   KFK-RSTTNSEHLSTHINHKIGFTNGTWSSKNSATPIY  112



>ref|XP_007019811.1| Uncharacterized protein TCM_036197 [Theobroma cacao]
 gb|EOY17036.1| Uncharacterized protein TCM_036197 [Theobroma cacao]
Length=383

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 52/95 (55%), Gaps = 8/95 (8%)
 Frame = +1

Query  43   IPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIMESDLYNGE--EPWKIFQRSRDKVLY  213
            +P GY F PTD +L L YL+  + G P L +  + + ++Y  +  EPW+IF  +  +  Y
Sbjct  43   VPPGYRFAPTDDQLILHYLSNKIKGEP-LPSEAVTDCEIYGDQDKEPWRIFGMTSSRKFY  101

Query  214  IFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            +F  LK +     R  RT   G+GTWK Q R  P+
Sbjct  102  VFTKLKNKGKG-KRIERTA--GRGTWKGQ-RTDPV  132



>gb|AGL39733.1| NAC transcription factor 077 [Jatropha curcas]
 gb|KDP34518.1| hypothetical protein JCGZ_11068 [Jatropha curcas]
Length=213

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 48/89 (54%), Gaps = 3/89 (3%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYI  216
            ++P GY F+PTD E++  YL L + G  ++     +  DLY  +EPW IF ++  +  Y 
Sbjct  3    NLPVGYRFKPTDGEIISFYLPLKLKGE-IIPHDCFVNCDLYGDKEPWMIFDKNLKETFYA  61

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQD  303
            F  LK+ ++ +   I+    G G W  Q+
Sbjct  62   FTKLKKITTKNGSVIKRTA-GIGNWDCQN  89



>ref|XP_009597084.1| PREDICTED: NAC domain-containing protein 68-like [Nicotiana tomentosiformis]
Length=460

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 50/95 (53%), Gaps = 6/95 (6%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS----RDKVLYIF  219
            G  FRPTD EL+ +L  FV+     S   I    LY  ++PW IF+ +      KV Y F
Sbjct  17   GIRFRPTDEELILFLLKFVSCKN-FSCDHIRVEALYGNKKPWDIFENNFLGEDTKVNYFF  75

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
              LKR  +   R+ R +  G G+WK  D+ KP+++
Sbjct  76   TKLKRTKAGGLRFSRGL-IGGGSWKGLDKRKPVFK  109



>ref|XP_011003330.1| PREDICTED: NAC domain-containing protein 4-like [Populus euphratica]
Length=419

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/91 (42%), Positives = 49/91 (54%), Gaps = 9/91 (10%)
 Frame = +1

Query  46   PDGYIFRPTDAELLG-YLALFVTGN--PVLSTVPIMESDLYNGEEPWKIFQR-----SRD  201
            P GY F PTD EL+G YL   V G   P  +   I + ++Y  EEPW+IF R     S D
Sbjct  9    PPGYKFLPTDEELIGFYLDRKVNGGGLPDEAASLIKDYNIYGEEEPWEIFNRFEGHKSGD  68

Query  202  KVLYIFATLKRRSSSDSRYI-RTVGDGKGTW  291
              LY F TL +++ + +R   R VG   GTW
Sbjct  69   NGLYFFTTLSKKTVNCTRNKNRKVGKNGGTW  99



>ref|XP_008229046.1| PREDICTED: NAC domain-containing protein 18-like [Prunus mume]
Length=155

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 46/87 (53%), Gaps = 3/87 (3%)
 Frame = +1

Query  52   GYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPW-KIFQRSRDKVLYIFAT  225
            G  F P +AELL  YL   V G P LS+  ++E DLY  EE W K+F  + +  LY F  
Sbjct  12   GCRFEPYEAELLAHYLYNKVNGLP-LSSNAVIECDLYGEEEIWRKLFDETGETSLYFFTE  70

Query  226  LKRRSSSDSRYIRTVGDGKGTWKAQDR  306
            LK+++   SR  R    G  TW+ Q  
Sbjct  71   LKKKTGKGSRVERMSSGGCVTWRNQSN  97



>ref|XP_004306296.1| PREDICTED: uncharacterized protein LOC101303446 [Fragaria vesca 
subsp. vesca]
Length=402

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 54/107 (50%), Gaps = 14/107 (13%)
 Frame = +1

Query  31   RQEHIPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIM-ESDLYNGEEPWKIFQ-----  189
            R   +P G  F P + ELL  YL   ++G  V     ++ + DLY  +EPW+I++     
Sbjct  5    RNNQLP-GMRFCPMEDELLLSYLKPMLSGQNVPGRNKVVFDCDLYGQQEPWEIWEAYKTK  63

Query  190  RSRD----KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            R  D    K LY F   K+  S+D R  RTV  G GTWK  D G P+
Sbjct  64   RPNDLRLHKDLYFFTQHKKMKSTDKRIRRTV--GSGTWKGNDSGNPV  108



>gb|AGL39735.1| NAC transcription factor 079 [Jatropha curcas]
 gb|KDP36973.1| hypothetical protein JCGZ_08565 [Jatropha curcas]
Length=335

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (54%), Gaps = 13/99 (13%)
 Frame = +1

Query  52   GYIFRPTDAELLG-YLALFVTG--NPVLSTVPIMESDLYNGEEPWKIFQR------SRDK  204
            GY FRPTD EL+  YL   V G  +P+ + + I + DLY  +EPW I++R        D+
Sbjct  7    GYKFRPTDEELISHYLHRKVNGELSPIENQI-IRDCDLYGQDEPWHIWERFGGLRLEEDE  65

Query  205  VLYIFATLKRRSSSDSRY---IRTVGDGKGTWKAQDRGK  312
             L+ F  LKR+S +++      R VG   G W  +  G+
Sbjct  66   GLFFFTALKRKSPNNTNCKNISRRVGSTDGHWHCETSGR  104



>ref|XP_006437281.1| hypothetical protein CICLE_v10033346mg, partial [Citrus clementina]
 gb|ESR50521.1| hypothetical protein CICLE_v10033346mg, partial [Citrus clementina]
Length=340

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 9/100 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR------SR  198
            +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY  E+P +I+        + 
Sbjct  5    LPHGFQFRPSDEELIEHYLKKKVSGIFIPLAEYFIRDCNLYQ-EKPSEIWDSHGGPFLNA  63

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            D+ LY F  LK++ S  SR  R VG   GTW+ +D GK I
Sbjct  64   DEDLYFFTQLKKKFSKGSRIDRKVGSSGGTWQGEDAGKDI  103



>gb|AGL39734.1| NAC transcription factor 078 [Jatropha curcas]
 gb|KDP46762.1| hypothetical protein JCGZ_06550 [Jatropha curcas]
Length=237

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 50/101 (50%), Gaps = 5/101 (5%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLY--NGEEPWKIFQ-RS  195
            ME   ++P GY FRPTD E++ Y          + + PI + DLY  N +   K+FQ  S
Sbjct  1    MENSHNLPVGYRFRPTDNEIILYYLFNKASGVSIPSNPIKDFDLYDDNDQTMMKVFQDTS  60

Query  196  RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            ++K  Y F  LK++     R  R    G GTWK   + K I
Sbjct  61   QEKNFYFFTKLKKKHGKGMRIQRIT--GLGTWKETQKEKNI  99



>gb|KCW72112.1| hypothetical protein EUGRSUZ_E00551 [Eucalyptus grandis]
Length=269

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = +1

Query  61   FRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLKRR  237
            FRPT+  L   +L    TG P+   + I E DLY+ +EPW+IF  + ++  Y+F TL++ 
Sbjct  7    FRPTNEHLFAHFLQQKATGAPLPPGL-IEECDLYS-QEPWRIFDTTSEQTFYVFTTLRK-  63

Query  238  SSSDSRYIRTVGDGKGTWKAQDRGK  312
              + SR +RT G   GTWK Q   K
Sbjct  64   --NKSRVLRTAGS--GTWKEQHATK  84



>ref|XP_009766553.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=181

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 58/110 (53%), Gaps = 14/110 (13%)
 Frame = +1

Query  25   MERQEHIPDG-YIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQR--  192
            ME+Q  + +G Y FRPTD+E L  L  ++    +  +  I  + D+Y GEEPW+I+    
Sbjct  1    MEQQ--LQEGFYRFRPTDSERLKLLLRYIAKQEMNDSGFITTNIDVYGGEEPWEIYNHGV  58

Query  193  -------SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
                   + D   Y +   K +  S + Y R VG+ KG+WK QD+ K ++
Sbjct  59   PCGNDDDNADSSNYRYFITKLKKKSKAGYNREVGN-KGSWKQQDKAKSVH  107



>gb|KDO36290.1| hypothetical protein CISIN_1g038876mg, partial [Citrus sinensis]
Length=127

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 58/106 (55%), Gaps = 12/106 (11%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            QEH   +P G+ FRP+D EL+  YL    +G  + L+   I + +LY  E+P +I+    
Sbjct  2    QEHRPFLPHGFQFRPSDEELIEHYLKKKDSGIFIPLAEYFIRDCNLYQ-EKPSEIWDSHG  60

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                + D+ LY F  LK++ S  SR  R VG   GTW+ +D GK I
Sbjct  61   GPFLNADEDLYFFTHLKKKFSKGSRIDRKVGSSGGTWQGEDAGKDI  106



>gb|ACF19791.1| NAC transcription factor [Nicotiana tabacum]
Length=301

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 54/98 (55%), Gaps = 4/98 (4%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF-QRSRDK  204
            ER E +     FRP+D +L+  L  FV G  + +   I+ +D+Y+  EPW++    S  K
Sbjct  35   ERTEPMEKNPQFRPSDTDLIMQLLKFVAGKCLPTEGLIVFADVYSI-EPWQLIGDMSSKK  93

Query  205  VLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              Y    LK++  +D+R+ RT  +  GTW  Q++GK I
Sbjct  94   THYFLTQLKKKKPTDARFNRTTCN--GTWTQQNKGKKI  129



>ref|XP_010058227.1| PREDICTED: NAC domain-containing protein 71-like [Eucalyptus 
grandis]
Length=394

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = +1

Query  61   FRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLKRR  237
            FRPT+  L   +L    TG P+   + I E DLY+ +EPW+IF  + ++  Y+F TL++ 
Sbjct  7    FRPTNEHLFAHFLQQKATGAPLPPGL-IEECDLYS-QEPWRIFDTTSEQTFYVFTTLRK-  63

Query  238  SSSDSRYIRTVGDGKGTWKAQDRGK  312
              + SR +RT   G GTWK Q   K
Sbjct  64   --NKSRVLRTA--GSGTWKEQHATK  84



>ref|XP_009631312.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
 ref|XP_009631313.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
 ref|XP_009631314.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
 ref|XP_009631315.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=232

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 11/105 (10%)
 Frame = +1

Query  37   EHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMES-DLYNGEEPWKIFQR-----SR  198
            E + +G+ FRPTD+E L +L  F+    +  +  I  + D+Y  EEPW+I+       + 
Sbjct  2    EQLQEGFRFRPTDSERLMFLLRFIAKQEMNDSGFITTNIDVYGREEPWEIYNHGVSCGNE  61

Query  199  DKVLYI----FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            D   Y     +   K +  + +R+   VG+ KG+WK QD+GK ++
Sbjct  62   DNADYSSNYRYFITKLKKKNKARHNLEVGN-KGSWKQQDKGKSVH  105



>ref|XP_009342921.1| PREDICTED: uncharacterized protein LOC103934887 [Pyrus x bretschneideri]
Length=435

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 52/105 (50%), Gaps = 13/105 (12%)
 Frame = +1

Query  40   HIPDGYIFRPTDAEL-LGYLALFVTGN--PVLSTVPIMESDLYNGEEPWKIFQRSRDKV-  207
            ++P GY F PTD EL L YL   V G   P     P+ + DLY   EPW I+++ + K  
Sbjct  2    NLPAGYRFCPTDEELILYYLHPKVNGKEVPGQGNSPVFDFDLYGVTEPWDIWEKFKTKRE  61

Query  208  --------LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                    LY F TLK +++  +R  RT+  G   W  ++R   I
Sbjct  62   NDLKLSNDLYFFTTLKLKTTEGTRICRTLPSGS-KWNGENRPSEI  105



>ref|XP_008245899.1| PREDICTED: NAC domain-containing protein 67-like [Prunus mume]
Length=295

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 9/101 (9%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLAL-FVTGNPVLSTVPIMESDLYNGEEPWKI---FQRSR---  198
             +P GY F P++ ELL +  L  V GN     V + + DLY  +EPW+I   F  S    
Sbjct  5    QVPVGYRFTPSEEELLLHYLLPRVNGNDYPKGV-VPDCDLYGTKEPWEIWRDFHHSSPDD  63

Query  199  DKVLYIFATLKRRSSSDSRYIRTVG-DGKGTWKAQDRGKPI  318
             + +Y+F TLK+++ + SR+ RTVG  G G WK +D GK I
Sbjct  64   QEDIYVFTTLKKKTPNGSRFCRTVGAAGTGVWKGEDSGKKI  104



>ref|XP_007213064.1| hypothetical protein PRUPE_ppa020506mg [Prunus persica]
 gb|EMJ14263.1| hypothetical protein PRUPE_ppa020506mg [Prunus persica]
Length=294

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 9/101 (9%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLAL-FVTGNPVLSTVPIMESDLYNGEEPWKI---FQRSR---  198
             +P GY F P++ ELL +  L  V GN     V + + DLY  +EPW+I   F  S    
Sbjct  5    QVPVGYRFTPSEEELLLHYLLPRVNGNDYPKGV-VPDCDLYGTKEPWEIWRDFHHSSPDD  63

Query  199  DKVLYIFATLKRRSSSDSRYIRTVG-DGKGTWKAQDRGKPI  318
             + +Y+F TLK+++ + SR+ RTVG  G G WK +D GK I
Sbjct  64   QEDIYVFTTLKKKTPNGSRFCRTVGVTGTGVWKGEDSGKKI  104



>ref|XP_008226306.1| PREDICTED: NAC domain-containing protein 66-like [Prunus mume]
Length=295

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 9/101 (9%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLAL-FVTGNPVLSTVPIMESDLYNGEEPWKI---FQRSR---  198
             +P GY F P++ ELL +  L  V GN     V + + DLY  +EPW+I   F  S    
Sbjct  5    QVPVGYRFTPSEEELLLHYLLPRVNGNDYPKGV-VPDCDLYGTKEPWEIWRDFHHSSPDD  63

Query  199  DKVLYIFATLKRRSSSDSRYIRTVG-DGKGTWKAQDRGKPI  318
             + +Y+F TLK+++ + SR+ RTVG  G G WK +D GK I
Sbjct  64   QEDIYVFTTLKKKTPNGSRFCRTVGAAGTGVWKGEDSGKKI  104



>ref|XP_009622624.1| PREDICTED: uncharacterized protein LOC104113990 [Nicotiana tomentosiformis]
Length=476

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 33/107 (31%), Positives = 52/107 (49%), Gaps = 11/107 (10%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSR--  198
            M   +++ +GY FRPTD+EL+ +L  FV    +     I   D+Y  +EPW  +      
Sbjct  3    MMELDNLGEGYRFRPTDSELVKFLLRFVAKQELHDNGFIAMYDVYK-QEPWVTYSHGHST  61

Query  199  -------DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                   D  +Y +    R+ +   R+ R VG   GTWK QD+G+ +
Sbjct  62   GGVEDNWDTSIYRYFITPRKKNK-GRFSRIVGKRGGTWKQQDKGRAV  107



>gb|AGL39736.1| NAC transcription factor 080 [Jatropha curcas]
 gb|KDP46133.1| hypothetical protein JCGZ_06644 [Jatropha curcas]
Length=263

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 53/98 (54%), Gaps = 12/98 (12%)
 Frame = +1

Query  52   GYIFRPTDAEL-LGYLALFVTG--NPVLSTVPIMESDLYNGEEPWKIFQR------SRDK  204
            GY F P D EL + YL   +TG  +PVL  + + + DLY  EEPW +++R          
Sbjct  9    GYRFIPNDKELYVDYLYPKITGQLSPVLQRI-VPDCDLYGTEEPWMVWKRFGGDELGGLG  67

Query  205  VLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             LY F  LK+ +   SR  R+V  GKGTW  ++ G P+
Sbjct  68   DLYFFTKLKKTNPRSSRVERSV--GKGTWHGENTGVPL  103



>ref|XP_009602879.1| PREDICTED: NAC domain-containing protein 2-like [Nicotiana tomentosiformis]
Length=334

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 9/97 (9%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQ------RSRDKVL  210
            G+ F PT  E+L YL  FV   P+     +M+ +DLY  +EPW+IF+       + +   
Sbjct  14   GHRFHPTGREVLKYLVGFVRDEPLPFQNELMQVADLYADKEPWQIFEAYDRGNNNNNNTR  73

Query  211  YIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            Y     K+   +  R  RTVG  KGTWK Q++G+ ++
Sbjct  74   YFITPQKKEKPTWKRVSRTVG--KGTWKLQNKGRDVF  108



>gb|AGL39737.1| NAC transcription factor 081 [Jatropha curcas]
 gb|KDP46134.1| hypothetical protein JCGZ_06645 [Jatropha curcas]
Length=264

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 53/98 (54%), Gaps = 12/98 (12%)
 Frame = +1

Query  52   GYIFRPTDAEL-LGYLALFVTG--NPVLSTVPIMESDLYNGEEPWKIFQR------SRDK  204
            GY F P D EL + YL   +TG  +PVL  + + + DLY  EEPW +++R          
Sbjct  9    GYRFIPNDKELYVDYLYPKITGQLSPVLQRI-VPDCDLYGTEEPWMVWKRFGGDELGGLG  67

Query  205  VLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             LY F  LK+ +   SR  R+V  GKGTW  ++ G P+
Sbjct  68   DLYFFTKLKKTNPRSSRVERSV--GKGTWHGENTGVPL  103



>ref|XP_006345191.1| PREDICTED: protein CUP-SHAPED COTYLEDON 1-like [Solanum tuberosum]
Length=275

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 44/85 (52%), Gaps = 4/85 (5%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLST-VPIMESDLYNGEEPWKIFQRS-RDKVLYIFAT  225
            G  F PTD EL+ YL  F  G   L+   PI  +D+Y  + PW+IF  +  +K  Y    
Sbjct  6    GIRFHPTDTELINYLKRFFKGELSLNQQCPIQFADIYGDQPPWEIFGANFEEKFRYFITP  65

Query  226  LKRRSSSDSRYIRTVGDGKGTWKAQ  300
            LK++ +   R+ R     KGTW+ Q
Sbjct  66   LKKQKTEYKRFSRIC--AKGTWQGQ  88



>ref|XP_007224606.1| hypothetical protein PRUPE_ppa026935mg, partial [Prunus persica]
 gb|EMJ25805.1| hypothetical protein PRUPE_ppa026935mg, partial [Prunus persica]
Length=117

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 46/98 (47%), Gaps = 27/98 (28%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR------SRDK  204
            +P G+ FRP+DA LLGY                    L N +EPW I+         + +
Sbjct  9    VPIGFKFRPSDARLLGYY-------------------LLNKKEPWDIWNDLGGKNLGKGE  49

Query  205  VLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             LY F  LK  +   SR  RT+G+  GTWK +DRG  +
Sbjct  50   DLYFFTKLKLVTGKGSRVARTIGN--GTWKGEDRGTTV  85



>ref|XP_009386218.1| PREDICTED: NAC domain-containing protein 78-like [Musa acuminata 
subsp. malaccensis]
Length=631

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 39/106 (37%), Positives = 51/106 (48%), Gaps = 9/106 (8%)
 Frame = +1

Query  16   IIAMERQEHIPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR  192
            +I       +  G+ F PTD EL+GY L   + G P L    I E DLY  E PW +  R
Sbjct  1    MIGASSSAALAPGFRFHPTDEELVGYYLQRKICGRP-LRVDAIAEVDLYKCE-PWDLPGR  58

Query  193  SR----DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            SR    D   Y F+ L R+ S+ SR  R    G G WK   + +P+
Sbjct  59   SRIQSRDLEWYFFSALDRKYSNRSRTNRAT--GHGFWKMTGKDRPV  102



>ref|XP_009628603.1| PREDICTED: NAC transcription factor 29-like [Nicotiana tomentosiformis]
 ref|XP_009628604.1| PREDICTED: NAC transcription factor 29-like [Nicotiana tomentosiformis]
 ref|XP_009628605.1| PREDICTED: NAC transcription factor 29-like [Nicotiana tomentosiformis]
 ref|XP_009628606.1| PREDICTED: NAC transcription factor 29-like [Nicotiana tomentosiformis]
 ref|XP_009628607.1| PREDICTED: NAC transcription factor 29-like [Nicotiana tomentosiformis]
Length=301

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 4/98 (4%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF-QRSRDK  204
            ER E +     FRP+D +L+  L  FV G  + +   I+  D+Y+  EPW++    S  K
Sbjct  35   ERTEPMEKNPQFRPSDTDLIMQLLKFVAGKCLPTEGLIVFVDVYSI-EPWQLIGDMSSKK  93

Query  205  VLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              Y    LK++  +D+R+ RT  +  GTW  Q++GK I
Sbjct  94   THYFLTQLKKKKPTDARFNRTTCN--GTWTQQNKGKKI  129



>ref|XP_007010693.1| Uncharacterized protein TCM_044619 [Theobroma cacao]
 gb|EOY19503.1| Uncharacterized protein TCM_044619 [Theobroma cacao]
Length=145

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 8/69 (12%)
 Frame = +1

Query  139  IMESDLYNGEEPWKIF------QRSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQ  300
            I + DLY  +EPW+I+          D+ LY F  LK++S + SR  R+VG   GTW  +
Sbjct  11   IKDFDLYGEKEPWEIWDLYGGCNLQSDEDLYFFTKLKKKSQNSSRINRSVG--MGTWMGE  68

Query  301  DRGKPIYRY  327
            D GKPIY +
Sbjct  69   DSGKPIYSH  77



>ref|XP_006437301.1| hypothetical protein CICLE_v10033744mg [Citrus clementina]
 gb|ESR50541.1| hypothetical protein CICLE_v10033744mg [Citrus clementina]
Length=327

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 55/101 (54%), Gaps = 14/101 (14%)
 Frame = +1

Query  34   QEH---IPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDL--YNGEEPWKIFQRS  195
            QEH   +P G+ FRP+D EL+  YL   V+G      +P+ E  +  Y+   P+     +
Sbjct  2    QEHRPFLPHGFQFRPSDEELIEHYLKKKVSG----IFIPLAEYFIRDYSHGGPF----LN  53

Query  196  RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             D+ LY F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  54   ADEDLYFFTQLKKKSSKGSRIDRKVGSSGGTWQGEDAGKDI  94



>ref|XP_002321355.2| hypothetical protein POPTR_0015s00520g [Populus trichocarpa]
 gb|EEF05482.2| hypothetical protein POPTR_0015s00520g [Populus trichocarpa]
Length=418

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/91 (40%), Positives = 48/91 (53%), Gaps = 8/91 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLG-YLALFVTGN-PVLSTVPIMESDLYNGEEPWKIFQR-----SRD  201
            +P GY F PTD EL+G YL   V G  P        + ++Y  EEPW+IF R     S D
Sbjct  8    LPPGYKFLPTDEELIGFYLDRKVNGGLPAEYASLFKDYNIYGEEEPWEIFDRFEGHKSGD  67

Query  202  KVLYIFATLKRRSSSDSRYI-RTVGDGKGTW  291
              LY F TL +++ + ++   R VG   GTW
Sbjct  68   NGLYFFTTLSKKTVNCTKNKNRKVGKNGGTW  98



>emb|CDM85525.1| unnamed protein product [Triticum aestivum]
Length=347

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 50/98 (51%), Gaps = 12/98 (12%)
 Frame = +1

Query  52   GYIFRPTDAELLG-YLALFVTGNPVLSTVP--IMESDLYN--------GEEPWKIFQRSR  198
            G+ F PTD EL+  YL   ++G P+ +       E+D+Y         G  P     +  
Sbjct  86   GFAFCPTDRELVSFYLRPRISGQPLPNAAKHYFHEADVYATDPASLVAGRLPGPAKAQGE  145

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGK  312
             K  Y F+ +K RS+ DSR  R VG GKGTWK Q+RG 
Sbjct  146  SKNWYFFSLVKPRSAQDSRKCRIVGGGKGTWK-QERGN  182



>ref|XP_010312399.1| PREDICTED: uncharacterized protein LOC104644424 [Solanum lycopersicum]
Length=349

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 35/90 (39%), Positives = 51/90 (57%), Gaps = 8/90 (9%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFV-TGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATL  228
            G  FRPTD +L+ YL  FV + N V   +   E  LY  ++PW++ + S     Y F  L
Sbjct  11   GVRFRPTDEQLIRYLIKFVVSKNYVCKDIEFEE--LYGSKKPWELLEDS-SGTKYFFTKL  67

Query  229  KRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            K+R   D+R+ RT+  G G+WK + +GK I
Sbjct  68   KKR---DTRFSRTLVGG-GSWKGKSKGKSI  93



>ref|XP_002529768.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32634.1| conserved hypothetical protein [Ricinus communis]
Length=316

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 55/101 (54%), Gaps = 12/101 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIM---ESDLYNGEEPWKIF-QRSRDKV-  207
            +P G  F PTD EL+       T N  LS V  M     DLY  +EPW+++ Q S++++ 
Sbjct  8    LPTGCRFSPTDEELVAMYLFKKTKNLNLSDVENMIVPVCDLYGDKEPWELWDQFSQNQLF  67

Query  208  ----LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                LY F  LK++  S SR  R V  GKGTW  +++ +P+
Sbjct  68   TNGDLYFFTELKKKPKS-SRISRRV--GKGTWHGENKREPV  105



>ref|XP_006495082.1| PREDICTED: NAC domain-containing protein 7-like, partial [Citrus 
sinensis]
Length=155

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 9/96 (9%)
 Frame = +1

Query  55   YIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR------SRDKVL  210
            + FRP+D EL+  YL   V+G  + L+   I + +LY  E+P +I+        + D+ L
Sbjct  1    FQFRPSDEELIEHYLKKKVSGIFIPLAEYFIRDCNLYE-EKPSEIWDSHGGPFLNADEDL  59

Query  211  YIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            Y F  LK++SS  SR  R VG   GTW+ +D GK I
Sbjct  60   YFFTQLKKKSSKGSRIDRKVGSSCGTWQGEDAGKDI  95



>ref|XP_010058232.1| PREDICTED: NAC domain-containing protein 68-like [Eucalyptus 
grandis]
Length=312

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 45/84 (54%), Gaps = 5/84 (6%)
 Frame = +1

Query  52   GYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATL  228
            G+ F+PTD EL   YL   +    +     I + D+Y G +PWKIF + R    Y+F  L
Sbjct  7    GFCFQPTDQELFSDYLMRRLNEELLPDPNLIRDCDVYGGGDPWKIFDKDRGGKFYVFTVL  66

Query  229  KRRSSSDSRYIRTVGDGKGTWKAQ  300
            K+++   SR  RT   G G+WK +
Sbjct  67   KKKNR--SRVDRTA--GSGSWKEE  86



>ref|XP_002308850.2| hypothetical protein POPTR_0006s02930g [Populus trichocarpa]
 gb|EEE92373.2| hypothetical protein POPTR_0006s02930g [Populus trichocarpa]
Length=417

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 8/88 (9%)
 Frame = +1

Query  52   GYIFRPTDAELLGY-LALFVTGN-PVLSTVPIMESDLYNGEEPWKIF-----QRSRDKVL  210
            GY F PT+ +L+ Y L   V G  P  +   I + +L+ GEEPW+IF      +  D VL
Sbjct  11   GYRFCPTEEQLICYYLYQKVRGGLPSEAATMIKDYNLHGGEEPWEIFNKLAGHKEGDNVL  70

Query  211  YIFATLKRRS-SSDSRYIRTVGDGKGTW  291
            Y F TL +++ +   R  RTVG   GTW
Sbjct  71   YFFTTLGKKTLNCAKRMSRTVGTNGGTW  98



>ref|XP_008226297.1| PREDICTED: NAC domain-containing protein 68-like [Prunus mume]
Length=336

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 57/101 (56%), Gaps = 9/101 (9%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLAL-FVTGNPVLSTVPIMESDLYNGEEPWKI---FQRSR---  198
             +P GY F P++ ELL +  L  V GN     V + + DLY  +EPW I   F  S    
Sbjct  5    QVPVGYRFTPSEEELLLHYLLPRVNGNDYPKGV-VPDCDLYGTKEPWDIWRDFHHSSADD  63

Query  199  DKVLYIFATLKRRSSSDSRYIRTVG-DGKGTWKAQDRGKPI  318
             + +Y+F TLK+++ + SR+ RTVG  G G WK +D GK I
Sbjct  64   QEDIYVFTTLKKKTPNGSRFCRTVGAAGTGGWKGEDSGKKI  104



>gb|ACF19786.1| NAC transcription factor [Nicotiana tabacum]
Length=265

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 48/98 (49%), Gaps = 7/98 (7%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRSRD----KV  207
             P G  F PTD E+L YL  FV   P+     +M+ +DLY  +EPW+IF+   D    K 
Sbjct  7    CPMGNRFHPTDREVLKYLIGFVRDEPLPCQNELMQQTDLYADKEPWQIFEAYDDHGTNKT  66

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
             Y     K+   +     RTV   KG WK Q +G  ++
Sbjct  67   RYFITPQKKEKPTWKSVPRTV--EKGAWKPQSKGLEVF  102



>ref|XP_009598748.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=265

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 48/98 (49%), Gaps = 7/98 (7%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRSRD----KV  207
             P G  F PTD E+L YL  FV   P+     +M+ +DLY  +EPW+IF+   D    K 
Sbjct  7    CPMGNRFHPTDREVLKYLIGFVRDEPLPCQNELMQQTDLYADKEPWQIFEAYDDHGTNKT  66

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
             Y     K+   +     RTV   KG WK Q +G  ++
Sbjct  67   RYFITPQKKEKPTWKSVPRTV--EKGAWKPQSKGLEVF  102



>ref|XP_010046032.1| PREDICTED: NAC domain-containing protein 2-like [Eucalyptus grandis]
 gb|KCW84815.1| hypothetical protein EUGRSUZ_B01624 [Eucalyptus grandis]
Length=127

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = +1

Query  61   FRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLKRR  237
            FRPTD  L   YL     G P+   + I E DL N +EPW+IF  + ++  Y+F TL++ 
Sbjct  7    FRPTDEHLFTHYLQQKAMGAPLPPGL-IEECDL-NSQEPWRIFDTTLEQTFYVFTTLRK-  63

Query  238  SSSDSRYIRTVGDGKGTWKAQDRGK  312
              + SR +RT G    TWK Q   K
Sbjct  64   --TKSRVLRTAGS--ETWKEQHATK  84



>ref|XP_004309935.1| PREDICTED: uncharacterized protein LOC101306295 [Fragaria vesca 
subsp. vesca]
Length=507

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 19/101 (19%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPVLSTVPIMES------DLYNGEEPWKIFQRS-----R  198
            G  F P+D EL+G+  LF+  NP  ++VP M S      D+Y   EPW I++ +      
Sbjct  9    GLRFHPSDQELIGHF-LFIKNNP--NSVPEMRSSFLREFDMYGEVEPWTIWEANGGPLLD  65

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
            D+ L+ F  LK+  +  +R I     G GTW   +  KP+Y
Sbjct  66   DQDLFFFTRLKKHKNRINRRI-----GSGTWSQGENYKPVY  101



>ref|XP_006280728.1| hypothetical protein CARUB_v10026697mg [Capsella rubella]
 gb|EOA13626.1| hypothetical protein CARUB_v10026697mg [Capsella rubella]
Length=349

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 36/104 (35%), Positives = 47/104 (45%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----  189
            ME   HIP GY F PTD EL+ Y        P +    I + DLY   EPW I +     
Sbjct  1    MESLSHIPPGYRFHPTDEELVDYYLKNKVAYPGMQVDVIKDVDLYK-IEPWDIQELCGRG  59

Query  190  RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               ++  Y F+   ++  + +R  R    G G WKA  R K IY
Sbjct  60   TGEEREWYFFSHKDKKYPTGTRTNRAT--GSGFWKATGRDKAIY  101



>gb|KCW79922.1| hypothetical protein EUGRSUZ_C01264 [Eucalyptus grandis]
Length=135

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 47/87 (54%), Gaps = 10/87 (11%)
 Frame = +1

Query  61   FRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRD--KVLYIFATLK  231
            +RPTD  L+  YL   V G P L    I E DLY+ +EPWKIF  + +  +  Y+F  L 
Sbjct  7    YRPTDECLITDYLQPKVMGKP-LPLGQIDECDLYS-QEPWKIFNTTLELKQTFYVFTELT  64

Query  232  RRSSSDSRYIRTVGDGKGTWKAQDRGK  312
            +  S +SR +     G GTWK Q R K
Sbjct  65   KMGSRNSRTV-----GSGTWKGQHRTK  86



>ref|XP_009130209.1| PREDICTED: NAC domain-containing protein 7-like [Brassica rapa]
 ref|XP_009130210.1| PREDICTED: NAC domain-containing protein 7-like [Brassica rapa]
 ref|XP_009130211.1| PREDICTED: NAC domain-containing protein 7-like [Brassica rapa]
Length=364

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 36/104 (35%), Positives = 47/104 (45%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----  189
            ME   HIP GY F PTD EL+ Y        P +    I + DLY   EPW I +     
Sbjct  1    MESLTHIPPGYRFHPTDEELVDYYLKKKVAFPGMQVDVIKDVDLYK-IEPWDIQELCGRG  59

Query  190  RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               ++  Y F+   ++  + +R  R    G G WKA  R K IY
Sbjct  60   TGEEREWYFFSHKDKKYPTGTRTNRAT--GSGFWKATGRDKAIY  101



>ref|XP_002525963.1| transcription factor, putative [Ricinus communis]
 gb|EEF36387.1| transcription factor, putative [Ricinus communis]
Length=375

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 6/93 (6%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIF  219
            +P G  F PTD EL+ Y L+  + G P+   + I+E D+Y  + PW+I    + +  Y F
Sbjct  9    LPPGIRFNPTDDELISYYLSNKIKGIPLPLNL-IVECDIYGDKPPWEICHGRKQEECYFF  67

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             TLK+  +S +R  RT   G+  W+  + GK +
Sbjct  68   TTLKK--ASKNRVARTAAGGE--WRGNNSGKEV  96



>emb|CDY30716.1| BnaA02g33380D [Brassica napus]
Length=361

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 36/104 (35%), Positives = 47/104 (45%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----  189
            ME   HIP GY F PTD EL+ Y        P +    I + DLY   EPW I +     
Sbjct  1    MESLTHIPPGYRFHPTDEELVDYYLKKKVAFPGMQVDVIKDVDLYK-IEPWDIQELCGRG  59

Query  190  RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               ++  Y F+   ++  + +R  R    G G WKA  R K IY
Sbjct  60   TREEREWYFFSHKDKKYPTGTRTNRAT--GSGFWKATGRDKAIY  101



>ref|XP_006394405.1| hypothetical protein EUTSA_v10004488mg [Eutrema salsugineum]
 gb|ESQ31691.1| hypothetical protein EUTSA_v10004488mg [Eutrema salsugineum]
Length=355

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 36/104 (35%), Positives = 47/104 (45%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----  189
            ME   HIP GY F PTD EL+ Y        P +    I + DLY   EPW I +     
Sbjct  1    MESLSHIPPGYRFHPTDEELVDYYLKKKVAFPGMQVDVIKDVDLYK-IEPWDIQELCGRG  59

Query  190  RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               ++  Y F+   ++  + +R  R    G G WKA  R K IY
Sbjct  60   TGEEREWYFFSHKDKKYPTGTRTNRAT--GSGFWKATGRDKAIY  101



>gb|KCW70814.1| hypothetical protein EUGRSUZ_F03963 [Eucalyptus grandis]
Length=136

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 45/86 (52%), Gaps = 8/86 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIF  219
            +P GY F P+D E+  Y LA  V G+ V     I E D+Y  +EPWK F  + +K  Y+F
Sbjct  5    LPLGYRFCPSDEEVFSYCLAPKVQGHVVFPEF-IREFDVYE-KEPWKFFNENAEKSFYVF  62

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKA  297
              LK +    SR  RT G   G WK 
Sbjct  63   TKLKMKK---SRVERTAGS--GYWKG  83



>gb|ABO36626.1| hypothetical protein LYC_68t000011 [Solanum lycopersicum]
 gb|ABO36634.1| hypothetical protein SUNLYC_67t000004 [Solanum lycopersicum]
Length=327

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 51/90 (57%), Gaps = 8/90 (9%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFV-TGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATL  228
            G  FRPTD +L+ YL  FV + N V   +   E  LY  ++PW++ + S     Y F  L
Sbjct  11   GVRFRPTDEQLIRYLIKFVVSKNYVCKDIEFEE--LYGSKKPWELLEDSSG-TKYFFTKL  67

Query  229  KRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            K+R   D+R+ RT+  G G+WK + +GK I
Sbjct  68   KKR---DTRFSRTLVGG-GSWKGKSKGKSI  93



>ref|XP_006430488.1| hypothetical protein CICLE_v10013622mg, partial [Citrus clementina]
 gb|ESR43728.1| hypothetical protein CICLE_v10013622mg, partial [Citrus clementina]
Length=184

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 56/104 (54%), Gaps = 18/104 (17%)
 Frame = +1

Query  43   IPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIME-----SDLYNGEEPWKIFQR----  192
            +P G  F+P+D +L L YL   ++G P     P ++      +LY  +EPW+I+++    
Sbjct  5    LPLGCKFQPSDGQLVLFYLFNKISGTPA----PFLDDFVRTENLYGNKEPWQIWRQFGGH  60

Query  193  --SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                 + LY F  LK++S + SR  R VG   GTW+ +D GK +
Sbjct  61   DLEDGEDLYFFTHLKKKSVNSSRIDRRVGT--GTWQGEDVGKAV  102



>ref|XP_002525549.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36808.1| conserved hypothetical protein [Ricinus communis]
Length=320

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 42/86 (49%), Gaps = 4/86 (5%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFA  222
            +P GY F+P+  EL+            L    + E DLY  +EPW IF +   +  Y+F 
Sbjct  12   LPPGYRFQPSVEELINVFLRKKLNGETLPHDTLFEVDLYGDKEPWMIFNKDLQQTFYVFT  71

Query  223  TLKRRSSSDSRYIRTVGDGKGTWKAQ  300
             LK  + S SR  RT   G GTW+ Q
Sbjct  72   HLK--NISGSRIKRTA--GCGTWEGQ  93



>ref|XP_006492969.1| PREDICTED: uncharacterized protein LOC102614024, partial [Citrus 
sinensis]
Length=507

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 13/100 (13%)
 Frame = +1

Query  52   GYIFRPTDAELLG-YLALFVTGNPVL----STVPIMESDLYNGEEP---WKIF---QRSR  198
            G  F PT+ ELL  YL   ++ NP L      +P+ + DLY   EP   W ++   Q   
Sbjct  6    GLRFYPTEQELLEFYLLHKISENPNLYQAGDDIPVKDCDLYGPHEPNLIWDLYGGDQLMA  65

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             + LY F  LK+ S   SR+ R +  G G W+ +D  KP+
Sbjct  66   GQALYFFTQLKKASPKGSRFNRKI--GFGAWQGEDGAKPV  103



>gb|KDO57427.1| hypothetical protein CISIN_1g045647mg, partial [Citrus sinensis]
Length=218

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 58/104 (56%), Gaps = 18/104 (17%)
 Frame = +1

Query  43   IPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIME-----SDLYNGEEPWKIFQR--SR  198
            +P G  F+P+D +L L YL   ++G P     P ++      +LY  +EPW+I+++   R
Sbjct  8    LPLGCKFQPSDEQLVLFYLFNKISGTPA----PFLDDFVRTENLYGNKEPWQIWRQFGVR  63

Query  199  D----KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            D    + LY F  LK++S + SR  R V  G GTW+ +D GK +
Sbjct  64   DLEDGEDLYFFTRLKKKSVNGSRIDRRV--GTGTWQGEDAGKAV  105



>ref|XP_009623547.1| PREDICTED: NAC transcription factor 25-like [Nicotiana tomentosiformis]
Length=284

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = +1

Query  67   PTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIF-QRSRDKVLYIFATLKRRSS  243
            P+D +L+  L  FV G  + +   I  +D+Y+ E PW++    S  K  Y    LK++  
Sbjct  18   PSDTDLIMQLLKFVAGKCLPTEGLIGFADIYSNE-PWQLIGDLSSKKTHYFLTQLKKKKP  76

Query  244  SDSRYIRTVGDGKGTWKAQDRGKPI  318
            +D+R+ RT G+  GTW  Q++GK I
Sbjct  77   TDARFNRTTGN--GTWTQQNKGKKI  99



>ref|XP_002864789.1| hypothetical protein ARALYDRAFT_332471 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41048.1| hypothetical protein ARALYDRAFT_332471 [Arabidopsis lyrata subsp. 
lyrata]
Length=349

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 36/104 (35%), Positives = 47/104 (45%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----  189
            ME   HIP GY F PTD EL+ Y        P +    I + DLY   EPW I +     
Sbjct  1    MESLVHIPPGYRFHPTDEELVDYYLKNKVAFPGMQVDVIKDVDLYK-IEPWDIQELCGRG  59

Query  190  RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               ++  Y F+   ++  + +R  R    G G WKA  R K IY
Sbjct  60   TGEEREWYFFSHKDKKYPTGTRTNRAT--GSGFWKATGRDKAIY  101



>ref|XP_009628610.1| PREDICTED: uncharacterized protein LOC104118924 [Nicotiana tomentosiformis]
Length=126

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 22/100 (22%)
 Frame = +1

Query  49   DGYIFRPTDAELLGYLALFVTGNPVL-STVPIMESDLYNGEEPWKIFQRS--------RD  201
            +G+ FRPTD+E L +L  FV G  +  S       D+Y  +EPW+I+             
Sbjct  10   EGFRFRPTDSEGLMFLLRFVVGQEMHDSGFTTTNVDVYGKQEPWEIYDNGVPCGDDEDST  69

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               Y    LKR++             KGTWK  ++GKP++
Sbjct  70   SYRYFITKLKRKN-------------KGTWKQDNKGKPVH  96



>ref|XP_002513765.1| transcription factor, putative [Ricinus communis]
 gb|EEF48348.1| transcription factor, putative [Ricinus communis]
Length=363

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 44/105 (42%), Positives = 54/105 (51%), Gaps = 9/105 (9%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVL-STVPIMESDLYNGEEPWKIF-----  186
            M   E +  G  FRP D ELL Y       N  L +  P+ + DLY   EPW+I+     
Sbjct  1    MTALETMQVGVRFRPLDEELLMYYLSHKINNLSLPNPCPVKDCDLYGKNEPWEIWDYFGG  60

Query  187  QRSRD-KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            Q   D + LY F  LKR+SSS SR +RTV  G GTW     GKP+
Sbjct  61   QNLMDVEFLYFFTQLKRKSSSSSRILRTV--GTGTWHGDTSGKPV  103



>ref|XP_009616658.1| PREDICTED: protein ATAF2-like [Nicotiana tomentosiformis]
Length=319

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 58/108 (54%), Gaps = 7/108 (6%)
 Frame = +1

Query  4    VLRAIIAMERQEHIPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWK  180
            +++ ++  ++Q  +P G+ F PTD EL+  YL     G P+  ++ I E DLY   +PW+
Sbjct  1    MIKGVLRNQQQLELPAGFRFHPTDDELVQHYLCRKCAGQPISVSI-IAEIDLYKF-DPWQ  58

Query  181  IFQRSR--DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            + +++   +K  Y F+   R+  + SR  R    G G WKA    KP+
Sbjct  59   LPEKALHGEKEWYFFSPRDRKYPNGSRPNRAA--GTGYWKATGADKPV  104



>ref|XP_004306365.1| PREDICTED: protein FEZ-like [Fragaria vesca subsp. vesca]
Length=350

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 10/99 (10%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIM---ESDLYNGEEPWKI---FQRSRD  201
            +P G+ F P D EL+ Y L   V G   +S  P +   E D+Y GEEPW+I   F+R  +
Sbjct  5    MPKGFRFHPKDYELVNYYLYGKVNGEESVSPPPYLKLPEVDIY-GEEPWEIWERFERQDE  63

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            + LY FA  ++ +    R  R      GTW   +R +P+
Sbjct  64   ESLYFFAIHRKLNPKGKRIDRRT--NLGTWSEGERSRPV  100



>ref|XP_010050567.1| PREDICTED: NAC domain-containing protein 67-like [Eucalyptus 
grandis]
Length=328

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 47/87 (54%), Gaps = 10/87 (11%)
 Frame = +1

Query  61   FRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRD--KVLYIFATLK  231
            +RPTD  L+  YL   V G P L    I E DLY+ +EPWKIF  + +  +  Y+F  L 
Sbjct  7    YRPTDECLITDYLQPKVMGKP-LPLGQIDECDLYS-QEPWKIFNTTLELKQTFYVFTELT  64

Query  232  RRSSSDSRYIRTVGDGKGTWKAQDRGK  312
            +  S +SR +     G GTWK Q R K
Sbjct  65   KMGSRNSRTV-----GSGTWKGQHRTK  86



>gb|KDO61599.1| hypothetical protein CISIN_1g045641mg, partial [Citrus sinensis]
Length=528

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 52/91 (57%), Gaps = 6/91 (7%)
 Frame = +1

Query  43   IPDGY--IFRPTDAELL-GYLALFVTGNPVLSTVPIMES-DLYNGEEPWKI-FQRSRDKV  207
            +P G+   F PTD +++  YL   V GNP+ S   I++  DLY+  + WK  F+   + +
Sbjct  8    LPSGFKIAFVPTDEQIIRDYLFNKVYGNPLPSDEAIVDHCDLYDESDDWKKHFEERGENI  67

Query  208  LYIFATLKRRSSSDSRYIRTVGDGKGTWKAQ  300
            LY F  LK++S + S+  RT   G  TWK+Q
Sbjct  68   LYFFTPLKKKSENGSKIDRTTKCG-ATWKSQ  97



>ref|XP_010039251.1| PREDICTED: NAC transcription factor ONAC010-like [Eucalyptus 
grandis]
Length=238

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 46/86 (53%), Gaps = 8/86 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIF  219
            +P GY F P+D E+  Y LA  V G+ V     I E D+Y  +EPWK F  + +K LY+F
Sbjct  5    LPLGYRFCPSDEEVFSYCLAPKVQGHVVFPEF-IREFDVYE-KEPWKFFNENAEKSLYVF  62

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKA  297
              LK +    SR  RT   G G WK 
Sbjct  63   TKLKMKK---SRVERTA--GSGYWKG  83



>ref|XP_010039248.1| PREDICTED: NAC domain-containing protein 19-like [Eucalyptus 
grandis]
Length=281

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 46/86 (53%), Gaps = 8/86 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIF  219
            +P GY F P+D E+  Y LA  V G+ V     I E D+Y  +EPWK F  + +K LY+F
Sbjct  5    LPLGYRFCPSDEEVFSYCLAPKVQGHVVFPEF-IREFDVYE-KEPWKFFNENAEKSLYVF  62

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKA  297
              LK +    SR  RT   G G WK 
Sbjct  63   TKLKMKK---SRVERTA--GSGYWKG  83



>ref|XP_008459335.1| PREDICTED: NAC domain-containing protein 100-like isoform X2 
[Cucumis melo]
Length=335

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 5/101 (5%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSR--D  201
            E+Q  +P G+ F PTD EL+ +       NP  S++ I  +DL N  EPW +  R++  +
Sbjct  31   EQQIDLPPGFRFHPTDEELITHYLSPKVLNPNFSSIAIGHADL-NKSEPWDLPGRAKMGE  89

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
            K  Y F    R+  +  R  R      G WKA  + K I+R
Sbjct  90   KEWYFFCVKDRKYPTGLRTNRAT--DSGYWKATGKDKEIFR  128



>ref|XP_009387227.1| PREDICTED: NAC domain-containing protein 68-like, partial [Musa 
acuminata subsp. malaccensis]
Length=124

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 46/89 (52%), Gaps = 4/89 (4%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRD  201
            ME  + +P GY F PT  ELL  YLA +V G P L    +  +D+Y G EPW +    R 
Sbjct  1    MEPIDLVPSGYRFLPTAEELLVDYLANWVAGAP-LPGRAVAFADVY-GTEPWNLLGSDRQ  58

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGT  288
            +  Y FA  K ++S  SR  R  G G  T
Sbjct  59   EG-YFFAERKPKNSGGSRVDRKAGSGSWT  86



>gb|KDO38203.1| hypothetical protein CISIN_1g042765mg, partial [Citrus sinensis]
Length=296

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 9/100 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR------SR  198
            +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY   +P +I+        + 
Sbjct  30   LPHGFQFRPSDEELIEHYLKKKVSGILIPLAEYFIRDCNLYE-TKPSEIWDSHGGPFFNI  88

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            D+ LY F  LK++SS  SR  R V    G W+ +D GK I
Sbjct  89   DEDLYFFTQLKKKSSKGSRIDRKVSSSSGAWQWEDAGKDI  128



>gb|KCW70813.1| hypothetical protein EUGRSUZ_F03962 [Eucalyptus grandis]
Length=141

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 6/80 (8%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIF  219
            +P GY F P+D + + Y LA  V G  V     I E D+Y  +EPWK F ++ ++ LY+F
Sbjct  5    LPIGYRFCPSDEQAISYCLAPKVKGEVVFPEF-IHEFDVYE-KEPWKFFDKNAEESLYVF  62

Query  220  ATLKRRSSSDSRYIRTVGDG  279
              LK +    SR  RT G G
Sbjct  63   TKLKMKK---SRVERTAGSG  79



>ref|XP_010477985.1| PREDICTED: NAC domain-containing protein 7-like, partial [Camelina 
sativa]
Length=343

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 47/104 (45%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----  189
            ME   HIP GY F PTD EL+ Y        P +    I + DLY   EPW I +     
Sbjct  1    MESLSHIPPGYRFHPTDEELVDYYLKNKVAFPGMQVDVIKDVDLYK-IEPWDIQELCGRG  59

Query  190  RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               ++  Y F+   ++  + +R  R    G G WKA  R K IY
Sbjct  60   TGEEREWYFFSHKDKKYPTGTRTNRAT--GSGFWKATGRDKAIY  101



>ref|XP_006341872.1| PREDICTED: NAC domain-containing protein 2-like [Solanum tuberosum]
Length=237

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 8/101 (8%)
 Frame = +1

Query  19   IAMERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIME-SDLYNGEEPWKIFQRS  195
            +A  R +H   G+ F P+  EL+ +L    + +   ST P ++  D++   EPW+I    
Sbjct  1    MASSRSKH-SLGFRFHPSYKELINHLK--DSCSMEFSTSPCIKLKDVFGDLEPWQIIDG-  56

Query  196  RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             +K  Y    LK+ ++S+ R+ RTVG   GTW  Q  G PI
Sbjct  57   -EKTCYFLTRLKKFNNSNKRFSRTVGS--GTWSGQTSGIPI  94



>ref|XP_010444086.1| PREDICTED: NAC domain-containing protein 7-like [Camelina sativa]
Length=344

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 47/104 (45%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----  189
            ME   HIP GY F PTD EL+ Y        P +    I + DLY   EPW I +     
Sbjct  1    MESLSHIPPGYRFHPTDEELVDYYLKNKVAFPGMQVDVIKDVDLYK-IEPWDIQELCGRG  59

Query  190  RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               ++  Y F+   ++  + +R  R    G G WKA  R K IY
Sbjct  60   TGEEREWYFFSHKDKKYPTGTRTNRAT--GSGFWKATGRDKAIY  101



>ref|XP_010042159.1| PREDICTED: NAC domain-containing protein 55-like [Eucalyptus 
grandis]
Length=125

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 6/80 (8%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIF  219
            +P GY F P+D + + Y LA  V G  V     I E D+Y  +EPWK F ++ ++ LY+F
Sbjct  5    LPIGYRFCPSDEQAISYCLAPKVKGEVVFPEF-IHEFDVYE-KEPWKFFDKNAEESLYVF  62

Query  220  ATLKRRSSSDSRYIRTVGDG  279
              LK +    SR  RT G G
Sbjct  63   TKLKMKK---SRVERTAGSG  79



>ref|XP_010483951.1| PREDICTED: NAC domain-containing protein 7-like [Camelina sativa]
 ref|XP_010483952.1| PREDICTED: NAC domain-containing protein 7-like [Camelina sativa]
Length=342

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 47/104 (45%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----  189
            ME   HIP GY F PTD EL+ Y        P +    I + DLY   EPW I +     
Sbjct  1    MESLSHIPPGYRFHPTDEELVDYYLKNKVAFPGMQVDVIKDVDLYK-IEPWDIQELCGRG  59

Query  190  RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               ++  Y F+   ++  + +R  R    G G WKA  R K IY
Sbjct  60   TGEEREWYFFSHKDKKYPTGTRTNRAT--GSGFWKATGRDKAIY  101



>ref|XP_009418629.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 50/96 (52%), Gaps = 9/96 (9%)
 Frame = +1

Query  52   GYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR----SRDKVLYI  216
            G+ F PTD EL+G YL   V+G P+   V I E DL    EPW++  R    SRD   Y 
Sbjct  24   GFRFHPTDEELVGYYLKRKVSGRPLRIDV-IAEVDLCKC-EPWELPGRSRLQSRDLEWYF  81

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
            F  + R+  + SR  R     +G WK   + +P++R
Sbjct  82   FCPVDRKYPNRSRTNRAT--ARGYWKTTGKDRPVHR  115



>ref|XP_009418630.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 50/96 (52%), Gaps = 9/96 (9%)
 Frame = +1

Query  52   GYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR----SRDKVLYI  216
            G+ F PTD EL+G YL   V+G P+   V I E DL    EPW++  R    SRD   Y 
Sbjct  24   GFRFHPTDEELVGYYLKRKVSGRPLRIDV-IAEVDLCKC-EPWELPGRSRLQSRDLEWYF  81

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
            F  + R+  + SR  R     +G WK   + +P++R
Sbjct  82   FCPVDRKYPNRSRTNRAT--ARGYWKTTGKDRPVHR  115



>ref|XP_007212407.1| hypothetical protein PRUPE_ppa016426mg, partial [Prunus persica]
 gb|EMJ13606.1| hypothetical protein PRUPE_ppa016426mg, partial [Prunus persica]
Length=128

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (49%), Gaps = 21/119 (18%)
 Frame = +1

Query  7    LRAIIAMERQEHIPD--------GYIFRPTDAEL-LGYLALFVTGNPVLSTVPIMESDLY  159
            +RA+ A  R  H           GY FRP++ +L L YL   + G      V + + +LY
Sbjct  9    VRAVSACRRVRHSSSLKCPYNIVGYKFRPSEEKLFLHYLLPRLNGEDYPKGV-VPDCNLY  67

Query  160  NGEEPWKI---FQRSR---DKVLYIFATLKRRSSSDSRYIRTVGDGK-----GTWKAQD  303
              +EPW+I   F  S     + +Y+F TL +++ + SR+ RTVG        G WK ++
Sbjct  68   GTKEPWEIWRDFHHSSPDDQEDIYVFTTLNKKTPNGSRFCRTVGAATIWRKYGEWKGRE  126



>ref|XP_003548767.1| PREDICTED: NAC domain-containing protein 100 [Glycine max]
 gb|KHN46796.1| NAC domain-containing protein 100 [Glycine soja]
Length=407

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 5/96 (5%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSR--DKVLYI  216
            +P G+ F PTD E++ Y       N + S + I E+DL N  EPW + ++++  +K  Y 
Sbjct  16   LPPGFRFHPTDEEIITYYLTEKVKNSIFSAIAIGEADL-NKCEPWDLPKKAKIGEKEWYF  74

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
            F    R+  +  R  R      G WKA  + K IY+
Sbjct  75   FCQKDRKYPTGMRTNRAT--ESGYWKATGKDKEIYK  108



>ref|XP_009372720.1| PREDICTED: NAC domain-containing protein 2-like [Pyrus x bretschneideri]
Length=449

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 47/105 (45%), Gaps = 9/105 (9%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS--  195
            M   +  P GY F P D EL+GY L     G P      I E DLY   E   I+  +  
Sbjct  1    MAHSDTFPVGYKFHPRDDELVGYYLYNKFRGTPFRDENVIPEIDLYGSMEARDIWNNNGG  60

Query  196  ----RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                +D+ LY F  LK    + SR  RT+  G GTWK +  G  +
Sbjct  61   QNLEKDEDLYFFTKLKPAKGTGSRVARTI--GSGTWKGETAGAKV  103



>ref|XP_009418258.1| PREDICTED: uncharacterized protein LOC103998499 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 48/96 (50%), Gaps = 9/96 (9%)
 Frame = +1

Query  52   GYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ----RSRDKVLYI  216
            G+ F PTD EL+ Y L   V G P L    + E DLY  E PW +      RSRD   Y 
Sbjct  28   GFRFHPTDEELVSYYLKRKVCGRP-LRNDAVAEVDLYRCE-PWDLPGLSRIRSRDLEWYF  85

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
            F+ L R+ S+ SR  R     +G WK   + +P+ R
Sbjct  86   FSPLDRKYSNRSRTNRAT--PQGYWKTTGKDRPVCR  119



>ref|XP_009397818.1| PREDICTED: uncharacterized protein LOC103982574 [Musa acuminata 
subsp. malaccensis]
Length=456

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRD  201
            ME  + +P GY F PT  ELL  YLA +V G P L    +  +D+Y G EPW +    R 
Sbjct  1    MEPIDLVPSGYRFLPTAEELLVDYLANWVAGAP-LPGRAVAFADVY-GTEPWNLLGSDRQ  58

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGT-WKAQDRGKPI  318
            +  Y FA  K ++S  SR  R  G G  T +K Q+  K +
Sbjct  59   EG-YFFAERKPKNSGGSRVDRKAGSGSWTLYKKQETVKSM  97



>ref|XP_006430448.1| hypothetical protein CICLE_v10013879mg [Citrus clementina]
 gb|ESR43688.1| hypothetical protein CICLE_v10013879mg [Citrus clementina]
Length=470

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 13/108 (12%)
 Frame = +1

Query  25   MER-QEHIPDGYIFRPTDAELLGYLALF--VTGNPVLSTVPIMESD-LYNGEEPWKIFQR  192
            MER +  +P G  F+P+D ELL    LF  ++G P      ++ ++ LY  +EPW+I+++
Sbjct  1    MERTRPPLPLGCKFQPSD-ELLVQFYLFNKISGTPAPFVDDLVRTENLYGFKEPWQIWRQ  59

Query  193  ------SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                     + LY F  LK++S + SR  R V  G GTW+ +D GK +
Sbjct  60   FGGPDLEDGEDLYFFTPLKKKSVNGSRIDRRV--GTGTWQGEDAGKAV  105



>ref|NP_201044.1| NAC-domain transcription factor [Arabidopsis thaliana]
 dbj|BAA97202.1| NAM (no apical meristem)-like protein [Arabidopsis thaliana]
 gb|AAY78878.1| no apical meristem family protein [Arabidopsis thaliana]
 gb|ABH04617.1| At5g62380 [Arabidopsis thaliana]
 gb|AED97602.1| NAC-domain transcription factor [Arabidopsis thaliana]
Length=348

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 47/104 (45%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----  189
            ME   HIP GY F PTD EL+ Y        P +    I + DLY   EPW I +     
Sbjct  1    MESLAHIPPGYRFHPTDEELVDYYLKNKVAFPGMQVDVIKDVDLYK-IEPWDIQELCGRG  59

Query  190  RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
               ++  Y F+   ++  + +R  R    G G WKA  R K IY
Sbjct  60   TGEEREWYFFSHKDKKYPTGTRTNRAT--GSGFWKATGRDKAIY  101



>ref|XP_009786309.1| PREDICTED: NAC domain-containing protein 2-like [Nicotiana sylvestris]
Length=311

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 57/108 (53%), Gaps = 7/108 (6%)
 Frame = +1

Query  4    VLRAIIAMERQEHIPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWK  180
            +++ +   ++Q  +P G+ F PTD EL+  YL     G P+  ++ I E DLY   +PW+
Sbjct  1    MIKGVHRNQQQLELPAGFRFHPTDEELVQHYLCRKCAGQPISVSI-IAEIDLYKF-DPWQ  58

Query  181  IFQRSR--DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            + +++   +K  Y F+   R+  + SR  R    G G WKA    KP+
Sbjct  59   LPEKALHGEKEWYFFSPRDRKYPNGSRPNRAA--GAGYWKATGADKPV  104



>ref|XP_002529750.1| hypothetical protein RCOM_0574280 [Ricinus communis]
 gb|EEF32616.1| hypothetical protein RCOM_0574280 [Ricinus communis]
Length=390

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 52/105 (50%), Gaps = 15/105 (14%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLS-----TVPIMESDLYNGEEPWKIFQR-----  192
            +P GYIF P+D  L+ Y       +  LS     TVP+   DLY  +EPW+++       
Sbjct  235  LPPGYIFHPSDKVLVSYYLFHKVKHMKLSEVDNRTVPV--CDLYGDKEPWELWDEFAQNL  292

Query  193  -SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
               D  LY F  LK +     R +RTVG+ KGTW+ +   +  +R
Sbjct  293  LFTDGDLYFFTQLKGKPRI-PRILRTVGN-KGTWQGESSKEIAFR  335



>ref|XP_009412871.1| PREDICTED: NAC domain-containing protein 68-like [Musa acuminata 
subsp. malaccensis]
Length=169

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFA  222
            +P G+ F+P+D EL+ YL  ++   P LS   + E+D+Y+ +EP  +  R R++  Y F 
Sbjct  2    LPPGFTFQPSDQELVVYLCEWIHHMP-LSCNAVEEADVYS-QEPEALL-RGRERA-YFFT  57

Query  223  TLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            TL R SSS  R  R  G+G         G P+
Sbjct  58   TL-RTSSSGLRVQRQAGNGTWMLNTSKTGTPV  88



>ref|XP_006430447.1| hypothetical protein CICLE_v10013691mg [Citrus clementina]
 gb|ESR43687.1| hypothetical protein CICLE_v10013691mg [Citrus clementina]
Length=468

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 13/108 (12%)
 Frame = +1

Query  25   MER-QEHIPDGYIFRPTDAELLGYLALF--VTGNPVLSTVPIMESD-LYNGEEPWKIFQR  192
            MER +  +P G  F+P+D ELL    LF  ++G P      ++ ++ LY  +EPW+I+++
Sbjct  1    MERTRPPLPLGCKFQPSD-ELLVQFYLFNKISGTPAPFVDDLVRTENLYGFKEPWQIWRQ  59

Query  193  ------SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
                     + LY F  LK++S + SR  R V  G GTW+ +D GK +
Sbjct  60   FGGPDLEDGEDLYFFTPLKKKSVNGSRIDRRV--GTGTWQGEDAGKAV  105



>ref|XP_006478541.1| PREDICTED: uncharacterized protein LOC102614734 [Citrus sinensis]
Length=414

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 9/100 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELL-GYLALFVTGNPV-LSTVPIMESDLYNGEEPWKIFQR------SR  198
            +P G+ FRP+D EL+  YL   V+G  + L+   I + +LY   +P +I+        + 
Sbjct  148  LPHGFQFRPSDEELIEHYLKKKVSGILIPLAEYFIRDCNLYE-TKPSEIWDSHGGPFFNI  206

Query  199  DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            D+ LY F  LK++SS  SR  R V    G W+ +D GK I
Sbjct  207  DEDLYFFTQLKKKSSKGSRIDRKVSSSSGAWQWEDAGKDI  246



>ref|XP_010042381.1| PREDICTED: NAC domain-containing protein 55-like [Eucalyptus 
grandis]
Length=230

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 6/80 (8%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIF  219
            +P GY F P+D + + Y LA  V G+ V     I E D+Y  +EPWK F ++ ++ LY+F
Sbjct  5    LPIGYRFCPSDEQAISYCLAPKVKGDVVFPEC-IHEFDVYE-KEPWKFFDKNAEESLYVF  62

Query  220  ATLKRRSSSDSRYIRTVGDG  279
              LK +    SR  RT G G
Sbjct  63   TKLKMKK---SRVERTAGSG  79



>ref|XP_008229554.1| PREDICTED: NAC domain-containing protein 43-like [Prunus mume]
Length=187

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 54/103 (52%), Gaps = 12/103 (12%)
 Frame = +1

Query  43   IPDGYIFRPTDAE-LLGYLALFVTGNPVLSTVPIM-ESDLYNGE--EPWKIFQRSR----  198
            +P GY F P++ E LL YL   V G  V     ++ + +LY+ +  + W  FQ +R    
Sbjct  11   VPPGYHFYPSEEELLLYYLRPKVNGEEVPGENHVVFDFNLYSDQPRKIWDHFQTTRQNDL  70

Query  199  --DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
                 LY F  L+ ++++ SR  RT G   GTWK +D GK IY
Sbjct  71   KMSNDLYFFTELQTKTTNGSRVSRTAGG--GTWKGEDGGKKIY  111



>ref|XP_008227085.1| PREDICTED: NAC domain-containing protein 72-like [Prunus mume]
Length=363

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 49/97 (51%), Gaps = 14/97 (14%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR------SRD  201
            +P G+ F P D++LLG YL   V+G P+   VP +  +LY   EPWKI++          
Sbjct  8    LPVGFYFHPKDSDLLGYYLHNKVSGKPMKYEVPKI--NLYGTSEPWKIWKDFGGDGLEIG  65

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGK  312
            + LY F TLK + +  SR       G G W  ++  K
Sbjct  66   EDLYFFTTLKTKGTRVSRKA-----GNGCWHGENSAK  97



>ref|XP_010317371.1| PREDICTED: uncharacterized protein LOC104646072 [Solanum lycopersicum]
Length=106

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 5/87 (6%)
 Frame = +1

Query  70   TDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLKRR-SSS  246
            TD +L+  L  FVTG     +V I   DLY   +P +IF  +     ++F  LK++ + S
Sbjct  6    TDEQLMLSLLKFVTG----VSVQIQFVDLYGNNKPSRIFDTATATEYHVFTRLKKKKTGS  61

Query  247  DSRYIRTVGDGKGTWKAQDRGKPIYRY  327
               + R +  G G+WK  D  KP+Y +
Sbjct  62   GKNFNRGIVGGGGSWKGIDNSKPVYDW  88



>gb|KDO37819.1| hypothetical protein CISIN_1g043513mg [Citrus sinensis]
Length=406

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 12/104 (12%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLGYLALF--VTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            ER   +P G  F P++ +L+ Y  LF  ++G P       + + DLY+ EEPW I+++  
Sbjct  3    ERSRILPVGCKFLPSEEQLVHYY-LFNKISGIPTPFVEYFVKDVDLYDYEEPWDIWKQFG  61

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGK  312
                   + LY F  LK++S + SR  R V  G G W+ +D G+
Sbjct  62   GPNLEDGEDLYFFTNLKKKSINGSRINRKV--GSGAWQGEDAGE  103



>ref|XP_009799422.1| PREDICTED: uncharacterized protein LOC104245505 [Nicotiana sylvestris]
Length=144

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 43/76 (57%), Gaps = 3/76 (4%)
 Frame = +1

Query  94   LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIFATLKRRSSSDSRYIRTVG  273
            L  FV G  + +   I  +D+Y+ +EPW++   S  K  Y    LK++   D+R+ RT G
Sbjct  3    LLKFVAGKCLPTEGLIDFADVYS-KEPWQLIGDSSKKTHYFLTQLKKKKPIDARFNRTTG  61

Query  274  DGKGTWKAQDRGKPIY  321
            +  GTW  Q++GK I+
Sbjct  62   N--GTWTQQNKGKEIF  75



>ref|XP_006482375.1| PREDICTED: uncharacterized protein LOC102620925 [Citrus sinensis]
Length=407

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 12/104 (12%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAELLGYLALF--VTGNPV-LSTVPIMESDLYNGEEPWKIFQR--  192
            ER   +P G  F P++ +L+ Y  LF  ++G P       + + DLY+ EEPW I+++  
Sbjct  4    ERSRILPVGCKFLPSEEQLVHYY-LFNKISGIPTPFVEYFVKDVDLYDYEEPWDIWKQFG  62

Query  193  ----SRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGK  312
                   + LY F  LK++S + SR  R V  G G W+ +D G+
Sbjct  63   GPNLEDGEDLYFFTNLKKKSINGSRINRKV--GSGAWQGEDAGE  104



>gb|KHG13515.1| NAC domain-containing protein [Gossypium arboreum]
Length=327

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (49%), Gaps = 8/109 (7%)
 Frame = +1

Query  13   AIIAMERQEHI---PDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKI  183
            AI+  +RQ+ +   P G+ F PTD E++ +  L    N   S   I E+DL N  EPW +
Sbjct  4    AIVVNQRQQELMELPPGFRFHPTDEEIITHYLLEKVMNSNFSAAAIGEADL-NKSEPWDL  62

Query  184  FQRSR--DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
              +++  +K  Y F    R+  +  R  R      G WKA  + K I++
Sbjct  63   PDKAKMGEKEWYFFCQRDRKYPTGMRTNRAT--QAGYWKATGKDKEIFK  109



>gb|ACI15343.1| NAC domain protein NAC6 [Gossypium hirsutum]
 gb|ACI15352.1| NAC domain protein NAC6 [Gossypium hirsutum]
Length=327

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (49%), Gaps = 8/109 (7%)
 Frame = +1

Query  13   AIIAMERQEHI---PDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKI  183
            AI+  +RQ+ +   P G+ F PTD E++ +  L    N   S   I E+DL N  EPW +
Sbjct  4    AIVVNQRQQELMELPPGFRFHPTDEEIITHYLLEKVMNSNFSAAAIGEADL-NKSEPWDL  62

Query  184  FQRSR--DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
              +++  +K  Y F    R+  +  R  R      G WKA  + K I++
Sbjct  63   PDKAKMGEKEWYFFCQRDRKYPTGMRTNRAT--QAGYWKATGKDKEIFK  109



>ref|XP_010065056.1| PREDICTED: NAC domain-containing protein 19-like [Eucalyptus 
grandis]
Length=282

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 45/86 (52%), Gaps = 8/86 (9%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIF  219
            +P GY F P+D E+  Y LA  V G+ V     I E D+Y  +EPWK F  + +K  Y+F
Sbjct  5    LPLGYRFCPSDEEVFSYCLAPKVQGHVVFPEF-IREFDVYE-KEPWKFFNENAEKSFYVF  62

Query  220  ATLKRRSSSDSRYIRTVGDGKGTWKA  297
              LK +    SR  RT   G G WK 
Sbjct  63   TKLKMKK---SRVERTA--GSGYWKG  83



>ref|XP_002967532.1| hypothetical protein SELMODRAFT_408624 [Selaginella moellendorffii]
 gb|EFJ32131.1| hypothetical protein SELMODRAFT_408624 [Selaginella moellendorffii]
Length=376

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (49%), Gaps = 10/111 (9%)
 Frame = +1

Query  7    LRAIIAMERQEHIPDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKI  183
            + + I +     +P G+ F PTD EL+G YLA  V  + +   V I E DLY   EPW +
Sbjct  1    MSSSIQLSGTSSVPPGFRFHPTDEELVGYYLAKKVAASKIDLDV-IREIDLYK-LEPWDL  58

Query  184  FQRSR-----DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
             +R R         Y F+   ++  + +R  R    G G WKA  R KPI+
Sbjct  59   QERCRIGSAEQHEWYFFSHKDKKYPTGTRTNRAT--GAGFWKATGRDKPIF  107



>ref|XP_002960173.1| hypothetical protein SELMODRAFT_402243 [Selaginella moellendorffii]
 gb|EFJ37712.1| hypothetical protein SELMODRAFT_402243 [Selaginella moellendorffii]
Length=387

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (49%), Gaps = 10/111 (9%)
 Frame = +1

Query  7    LRAIIAMERQEHIPDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIMESDLYNGEEPWKI  183
            + + I +     +P G+ F PTD EL+G YLA  V  + +   V I E DLY   EPW +
Sbjct  1    MSSSIQLSGTSSVPPGFRFHPTDEELVGYYLAKKVAASKIDLDV-IREIDLYK-LEPWDL  58

Query  184  FQRSR-----DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
             +R R         Y F+   ++  + +R  R    G G WKA  R KPI+
Sbjct  59   QERCRIGSAEQHEWYFFSHKDKKYPTGTRTNRAT--GAGFWKATGRDKPIF  107



>ref|XP_006655336.1| PREDICTED: NAC domain-containing protein 48-like [Oryza brachyantha]
Length=190

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 54/102 (53%), Gaps = 10/102 (10%)
 Frame = +1

Query  28   ERQE-HIPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIM-ESDLYNGEEPWKIFQRSR  198
            ERQE  +P G+ F PTD EL + YL     G PV   VPI+ E DLY   +PW++ + + 
Sbjct  12   ERQELQLPPGFRFHPTDEELVVHYLCRRCAGLPV--AVPIIAEVDLYK-YDPWQLPRMAL  68

Query  199  --DKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              +K  Y F+   R+  + SR  R  G   G WKA    KP+
Sbjct  69   YGEKEWYFFSPRDRKYPNGSRPNRAAGS--GYWKATGADKPV  108



>gb|AFW65457.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=174

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 48/95 (51%), Gaps = 5/95 (5%)
 Frame = +1

Query  40   HIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS--RDKVLY  213
             +P G+ F PTD EL+ Y  L   G   L+   I E DLY   +PW++ +++   +K  Y
Sbjct  8    QLPPGFRFHPTDDELVMYYLLRKCGGLPLAAPVIAEVDLYK-FDPWQLPEKAFGGEKEWY  66

Query  214  IFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             F+   R+  + SR  R    G G WKA    KP+
Sbjct  67   FFSPRDRKYPNGSRPNRAA--GTGYWKATGADKPV  99



>ref|NP_001136644.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
 gb|ACF82328.1| unknown [Zea mays]
 gb|AFW78053.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
 gb|AIB05447.1| NAC transcription factor, partial [Zea mays]
Length=339

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 57/110 (52%), Gaps = 9/110 (8%)
 Frame = +1

Query  1    QVLRAIIAMERQEHIPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIM-ESDLYNGEEP  174
            +V  A  A  ++  +P G+ F PTD EL + YL     G P+  +VPI+ E DLY   +P
Sbjct  8    RVPAAAAAQSQELQLPPGFRFHPTDEELVVHYLCRRCAGLPI--SVPIIAEVDLYK-HDP  64

Query  175  WKIFQRS--RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            W++ + +   +K  Y F+   R+  + SR  R    G G WKA    KP+
Sbjct  65   WQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAA--GAGYWKATGADKPV  112



>ref|XP_007137751.1| hypothetical protein PHAVU_009G1528000g, partial [Phaseolus vulgaris]
 gb|ESW09745.1| hypothetical protein PHAVU_009G1528000g, partial [Phaseolus vulgaris]
Length=175

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 9/102 (9%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLG-YLALFVTGNPVLSTVPIM-ESDLYNGEEPWKIFQRS-  195
            M+ +  +P G+ F PTD EL+  YL     G P+  +VPI+ E DLY   +PW++ +   
Sbjct  1    MKGELELPPGFRFHPTDDELVNHYLCRKCAGQPI--SVPIIKEVDLYK-FDPWQLPEMGF  57

Query  196  -RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
              +K  Y F+   R+  + SR  R  G   G WKA    KPI
Sbjct  58   YGEKEWYFFSPRDRKYPNGSRPNRAAGS--GYWKATGADKPI  97



>ref|XP_006384228.1| hypothetical protein POPTR_0004s10700g [Populus trichocarpa]
 gb|ERP62025.1| hypothetical protein POPTR_0004s10700g [Populus trichocarpa]
Length=365

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 4/92 (4%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPV-LSTVPIMESDLYNGE--EPWKIFQRSRDKVLYIFA  222
            GY F PTD EL+ +       NP+ +++ P+ + D+Y  +  + W  F R + + ++ F 
Sbjct  12   GYRFSPTDQELVQFYLYPKVTNPLFITSAPVRDCDIYAYQPLQIWNAFHRLQGEDVFFFT  71

Query  223  TLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             LK++S + S   R +  G  TW  +D  + I
Sbjct  72   NLKKKSPT-SHVTRKIAGGPATWHREDTDRAI  102



>ref|XP_002305976.2| hypothetical protein POPTR_0004s10720g [Populus trichocarpa]
 gb|EEE86487.2| hypothetical protein POPTR_0004s10720g [Populus trichocarpa]
Length=317

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 4/92 (4%)
 Frame = +1

Query  52   GYIFRPTDAELLGYLALFVTGNPV-LSTVPIMESDLYNGE--EPWKIFQRSRDKVLYIFA  222
            GY F PTD EL+ +       NP+ +++ P+ + D+Y  +  + W  F R + + ++ F 
Sbjct  12   GYRFSPTDQELVQFYLYPKVTNPLFITSAPVRDCDIYAYQPLQIWNAFHRLQGEDVFFFT  71

Query  223  TLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             LK++S + S   R +  G  TW  +D  + I
Sbjct  72   NLKKKSPT-SHVTRKIAGGPATWHREDTDRAI  102



>emb|CDX87246.1| BnaC09g05610D [Brassica napus]
Length=336

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 46/104 (44%), Gaps = 8/104 (8%)
 Frame = +1

Query  25   MERQEHIPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQ-----  189
            ME   HIP GY F PTD EL+ Y        P +    I + DLY   EPW I +     
Sbjct  1    MESLSHIPPGYRFHPTDEELVDYYLKNKVAFPEMQVDVIKDVDLYKI-EPWDIQELCGRG  59

Query  190  RSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIY  321
                +  Y F+   ++  + +R  R    G G WKA  R K IY
Sbjct  60   AGEKREWYFFSYKDKKYPTGTRTNRAT--GSGFWKATGRDKAIY  101



>dbj|BAG15877.1| nam-like protein [Bruguiera gymnorhiza]
Length=296

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 5/96 (5%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQR--SRDKVLYI  216
            +P G+ F PTD EL+ +  L   G   ++   I E DLY   +PW++ ++  S +K  Y 
Sbjct  8    LPPGFRFHPTDEELVNHYLLRKCGGQPIAVPIIAEIDLYKF-DPWQLPEKAVSGEKEWYF  66

Query  217  FATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPIYR  324
            F+   R+  + SR  R    G G WKA    KPI R
Sbjct  67   FSPRDRKYPNGSRPNRAA--GTGYWKATGADKPIGR  100



>ref|XP_004231183.2| PREDICTED: uncharacterized protein LOC101262060, partial [Solanum 
lycopersicum]
Length=253

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 1/56 (2%)
 Frame = +1

Query  151  DLYNGEEPWKIFQRSRDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            DLY  +EPW+I + S     Y    LK+  S  +R+ R VG+G GTWK QD  K +
Sbjct  49   DLYAEKEPWEILEGSNTNTGYFITPLKKEKSHHTRFKRIVGEG-GTWKIQDPAKKV  103



>ref|XP_006359319.1| PREDICTED: NAC domain-containing protein 2-like [Solanum tuberosum]
Length=303

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 53/99 (54%), Gaps = 7/99 (7%)
 Frame = +1

Query  31   RQEHIPDGYIFRPTDAELL-GYLALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRS--RD  201
            +Q  +P G+ F PTD EL+  YL     G P+ +++ I E DLY   +PW++ +++   +
Sbjct  9    QQLELPAGFRFHPTDDELVQHYLCRKCAGQPIAASI-ITEIDLYKF-DPWQLPEKALYGE  66

Query  202  KVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
            K  Y F+   R+  + SR  R    G G WKA    KP+
Sbjct  67   KEWYFFSPRDRKYPNGSRPNRAA--GTGYWKATGADKPV  103



>gb|AEQ61905.1| NAC domain-containing protein 1 [Salvia miltiorrhiza]
Length=292

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 55/101 (54%), Gaps = 9/101 (9%)
 Frame = +1

Query  28   ERQEHIPDGYIFRPTDAEL-LGYLALFVTGNPVLSTVPIM-ESDLYNGEEPWKIFQRS--  195
            E+Q ++P G+ F PTD EL + YL     G P+  +VPI+ E DLY   +PW++ + +  
Sbjct  5    EQQLNLPAGFRFHPTDDELVVHYLCRKCAGQPI--SVPIVAEIDLYKF-DPWQLPEMALY  61

Query  196  RDKVLYIFATLKRRSSSDSRYIRTVGDGKGTWKAQDRGKPI  318
             +K  Y F+   R+  + SR  R    G G WKA    KP+
Sbjct  62   GEKEWYFFSPRDRKYPNGSRPNRAA--GTGYWKATGADKPV  100



>ref|XP_010039246.1| PREDICTED: uncharacterized protein LOC104427938 [Eucalyptus grandis]
Length=440

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 6/80 (8%)
 Frame = +1

Query  43   IPDGYIFRPTDAELLGY-LALFVTGNPVLSTVPIMESDLYNGEEPWKIFQRSRDKVLYIF  219
            +P GY F P+D + + Y LA  V G+ V   + I E D+Y  +EPWK F ++ ++ LY+F
Sbjct  5    LPIGYRFCPSDEQAISYCLAPKVKGDVVFPEL-IHEFDVYE-KEPWKFFDKNAEESLYVF  62

Query  220  ATLKRRSSSDSRYIRTVGDG  279
              LK +    SR  RT G G
Sbjct  63   TKLKMKK---SRVERTAGSG  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508176617088