BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c9046_g1_i1 len=301 path=[597:0-300]

Length=301
                                                                      Score     E

ref|XP_004301145.1|  PREDICTED: putative ribonuclease H protein A...  81.6    6e-16   
ref|XP_004289445.1|  PREDICTED: putative ribonuclease H protein A...  79.7    8e-15   
ref|XP_009344908.1|  PREDICTED: uncharacterized protein LOC103936764  79.0    2e-14   
ref|XP_004306074.1|  PREDICTED: putative ribonuclease H protein A...  76.6    3e-14   
ref|XP_004309882.1|  PREDICTED: putative ribonuclease H protein A...  73.9    4e-14   
ref|XP_004305757.1|  PREDICTED: putative ribonuclease H protein A...  75.9    5e-14   
ref|XP_008221996.1|  PREDICTED: putative ribonuclease H protein A...  75.5    1e-13   
ref|XP_004300035.1|  PREDICTED: uncharacterized protein LOC101293591  72.8    2e-13   
ref|XP_007023230.1|  Non-LTR retroelement reverse transcriptase       73.6    1e-12   
gb|KHN13238.1|  Putative ribonuclease H protein                       67.8    5e-12   
ref|XP_009101981.1|  PREDICTED: putative ribonuclease H protein A...  71.6    6e-12   
ref|XP_007219945.1|  hypothetical protein PRUPE_ppb019389mg           70.9    8e-12   
ref|XP_007226572.1|  hypothetical protein PRUPE_ppa024162mg           68.6    1e-11   
ref|XP_007039838.1|  RNA-directed DNA polymerase (Reverse transcr...  69.7    2e-11   
ref|XP_008221358.1|  PREDICTED: putative ribonuclease H protein A...  69.7    2e-11   
gb|KFK31801.1|  hypothetical protein AALP_AA6G160600                  68.2    3e-11   
ref|XP_007023195.1|  Non-LTR retroelement reverse transcriptase       69.3    3e-11   
ref|XP_010520746.1|  PREDICTED: putative ribonuclease H protein A...  68.2    5e-11   
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431  68.9    6e-11   
ref|XP_010670869.1|  PREDICTED: uncharacterized protein LOC104887816  67.8    1e-10   
ref|XP_004299997.1|  PREDICTED: putative ribonuclease H protein A...  66.6    1e-10   
dbj|BAE79385.1|  unnamed protein product                              67.4    2e-10   Ipomoea batatas [batate]
dbj|BAE79382.1|  unnamed protein product                              67.4    2e-10   Ipomoea batatas [batate]
ref|XP_009126860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  67.4    2e-10   
gb|AID60103.1|  hypothetical protein                                  66.2    3e-10   
ref|XP_008237302.1|  PREDICTED: putative ribonuclease H protein A...  65.5    3e-10   
ref|XP_008225764.1|  PREDICTED: putative ribonuclease H protein A...  64.7    5e-10   
dbj|BAE79384.1|  unnamed protein product                              65.9    7e-10   Ipomoea batatas [batate]
ref|XP_009144970.1|  PREDICTED: putative ribonuclease H protein A...  64.7    7e-10   
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085  65.5    8e-10   
ref|XP_008228034.1|  PREDICTED: putative ribonuclease H protein A...  64.7    1e-09   
ref|XP_008242678.1|  PREDICTED: putative ribonuclease H protein A...  63.9    1e-09   
emb|CCA66009.1|  hypothetical protein                                 64.7    1e-09   
gb|AAC63844.1|  putative non-LTR retroelement reverse transcriptase   64.7    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006605054.1|  PREDICTED: putative ribonuclease H protein A...  61.6    2e-09   
ref|XP_007220772.1|  hypothetical protein PRUPE_ppa026532mg           62.8    2e-09   
ref|XP_007031938.1|  Ribonuclease H protein                           63.9    2e-09   
ref|XP_008228450.1|  PREDICTED: putative ribonuclease H protein A...  62.4    3e-09   
gb|AAC26674.1|  putative non-LTR retroelement reverse transcriptase   63.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EEC79285.1|  hypothetical protein OsI_20087                        60.8    3e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385  63.5    3e-09   
ref|XP_006574315.1|  PREDICTED: putative ribonuclease H protein A...  59.7    4e-09   
gb|ABE80133.2|  Polynucleotidyl transferase, Ribonuclease H fold      61.2    5e-09   Medicago truncatula
ref|XP_007042183.1|  Ribonuclease H protein                           62.4    6e-09   
ref|XP_006577374.1|  PREDICTED: putative ribonuclease H protein A...  60.5    7e-09   
gb|ABW81175.1|  non-LTR retrotransposon transposase                   62.4    7e-09   Arabidopsis cebennensis
gb|ABD33209.1|  Ribonuclease H                                        60.8    9e-09   Medicago truncatula
gb|AAF23831.1|AC007234_3  F1E22.12                                    62.0    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351723.1|  PREDICTED: putative ribonuclease H protein A...  62.0    1e-08   
gb|KHN30899.1|  Putative ribonuclease H protein                       59.7    1e-08   
ref|XP_007030929.1|  Uncharacterized protein TCM_026608               59.3    1e-08   
gb|AAD37021.1|  putative non-LTR retrolelement reverse transcriptase  61.6    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006584455.1|  PREDICTED: putative ribonuclease H protein A...  58.5    1e-08   
gb|ABD28505.2|  RNA-directed DNA polymerase (Reverse transcriptas...  61.2    2e-08   Medicago truncatula
ref|XP_008367475.1|  PREDICTED: uncharacterized protein LOC103431103  61.6    2e-08   
sp|P0C2F6.1|RNHX1_ARATH  RecName: Full=Putative ribonuclease H pr...  61.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006492639.1|  PREDICTED: putative ribonuclease H protein A...  61.2    2e-08   
ref|XP_009123770.1|  PREDICTED: putative ribonuclease H protein A...  60.8    2e-08   
ref|XP_006480844.1|  PREDICTED: putative ribonuclease H protein A...  60.8    2e-08   
ref|XP_008221992.1|  PREDICTED: uncharacterized protein LOC103321917  60.8    2e-08   
gb|EMT21706.1|  NAC domain-containing protein 78                      60.8    2e-08   
ref|XP_006590133.1|  PREDICTED: uncharacterized protein LOC102666308  58.5    3e-08   
dbj|BAB09815.1|  non-LTR retroelement reverse transcriptase-like      60.5    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008382267.1|  PREDICTED: putative ribonuclease H protein A...  59.7    3e-08   
ref|XP_006575982.1|  PREDICTED: uncharacterized protein LOC102663051  59.3    3e-08   
ref|XP_007212367.1|  hypothetical protein PRUPE_ppa014776mg           58.5    4e-08   
ref|XP_002461212.1|  hypothetical protein SORBIDRAFT_02g042875        60.1    4e-08   Sorghum bicolor [broomcorn]
ref|XP_008223806.1|  PREDICTED: putative ribonuclease H protein A...  58.9    4e-08   
gb|EEE57938.1|  hypothetical protein OsJ_08648                        59.7    4e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74135.1|  hypothetical protein OsI_09205                        59.7    4e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_006469117.1|  PREDICTED: putative ribonuclease H protein A...  59.7    5e-08   
ref|XP_006469101.1|  PREDICTED: putative ribonuclease H protein A...  59.7    5e-08   
ref|XP_002461200.1|  hypothetical protein SORBIDRAFT_02g042745        57.4    6e-08   Sorghum bicolor [broomcorn]
ref|XP_007207072.1|  hypothetical protein PRUPE_ppa026284mg           58.5    7e-08   
ref|XP_006593063.1|  PREDICTED: uncharacterized protein LOC102668081  57.0    7e-08   
ref|XP_002531038.1|  hypothetical protein RCOM_0755060                57.0    8e-08   Ricinus communis
gb|KHN25580.1|  Putative ribonuclease H protein                       56.6    8e-08   
ref|XP_006493637.1|  PREDICTED: putative ribonuclease H protein A...  57.0    1e-07   
ref|XP_006493638.1|  PREDICTED: putative ribonuclease H protein A...  58.2    1e-07   
ref|XP_004959141.1|  PREDICTED: putative ribonuclease H protein A...  58.9    1e-07   
gb|KHN40328.1|  Putative ribonuclease H protein                       55.8    1e-07   
gb|EEC72418.1|  hypothetical protein OsI_05729                        58.5    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002534238.1|  conserved hypothetical protein                   57.0    2e-07   Ricinus communis
ref|XP_006599881.1|  PREDICTED: uncharacterized protein LOC102663605  55.8    2e-07   
ref|XP_002518907.1|  conserved hypothetical protein                   55.8    2e-07   Ricinus communis
ref|XP_002444973.1|  hypothetical protein SORBIDRAFT_07g002160        57.8    2e-07   Sorghum bicolor [broomcorn]
gb|KHN24962.1|  Putative ribonuclease H protein                       55.8    2e-07   
ref|XP_007049342.1|  Ribonuclease H protein                           57.0    2e-07   
ref|XP_008382509.1|  PREDICTED: putative ribonuclease H protein A...  57.0    2e-07   
ref|XP_004295896.1|  PREDICTED: putative ribonuclease H protein A...  56.6    3e-07   
ref|XP_006584399.1|  PREDICTED: putative ribonuclease H protein A...  57.0    3e-07   
ref|XP_009124282.1|  PREDICTED: putative ribonuclease H protein A...  57.8    3e-07   
ref|XP_006573981.1|  PREDICTED: uncharacterized protein LOC102660005  55.8    3e-07   
ref|XP_006595330.1|  PREDICTED: uncharacterized protein LOC102665220  54.7    4e-07   
gb|AEL30350.1|  RNA-directed DNA polymerase                           57.0    4e-07   
ref|XP_007048991.1|  Uncharacterized protein TCM_001997               56.6    5e-07   
ref|XP_006589028.1|  PREDICTED: uncharacterized protein LOC100815879  55.1    6e-07   
ref|XP_002462405.1|  hypothetical protein SORBIDRAFT_02g025125        56.2    6e-07   Sorghum bicolor [broomcorn]
gb|KHN01923.1|  Putative ribonuclease H protein                       55.5    6e-07   
gb|KHN24231.1|  Putative ribonuclease H protein                       55.5    7e-07   
ref|XP_010673168.1|  PREDICTED: uncharacterized protein LOC104889608  56.6    8e-07   
ref|XP_006603537.1|  PREDICTED: uncharacterized protein LOC102663828  55.8    9e-07   
ref|XP_007039706.1|  Non-LTR retroelement reverse transcriptase       55.5    9e-07   
ref|XP_006580409.1|  PREDICTED: putative ribonuclease H protein A...  55.1    1e-06   
ref|XP_002439697.1|  hypothetical protein SORBIDRAFT_09g018530        55.5    1e-06   Sorghum bicolor [broomcorn]
gb|KHN17108.1|  Putative ribonuclease H protein                       54.3    1e-06   
ref|XP_006352585.1|  PREDICTED: uncharacterized protein LOC102588593  54.3    1e-06   
ref|XP_010451544.1|  PREDICTED: uncharacterized protein LOC104733678  56.2    1e-06   
ref|XP_007048802.1|  Uncharacterized protein TCM_001819               55.1    1e-06   
ref|XP_006574178.1|  PREDICTED: putative ribonuclease H protein A...  55.1    1e-06   
ref|XP_006595368.1|  PREDICTED: putative ribonuclease H protein A...  55.1    1e-06   
gb|EEE69227.1|  hypothetical protein OsJ_28461                        54.7    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006476142.1|  PREDICTED: uncharacterized protein LOC102616098  55.5    1e-06   
ref|XP_008233465.1|  PREDICTED: putative ribonuclease H protein A...  55.5    1e-06   
emb|CCA66036.1|  hypothetical protein                                 55.8    2e-06   
gb|EEE54600.1|  hypothetical protein OsJ_01823                        55.1    2e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AEJ07916.1|  putative ZmL1 non-LTR retrotransposon protein         55.1    2e-06   
ref|XP_006576023.1|  PREDICTED: uncharacterized protein LOC102663668  53.1    2e-06   
ref|XP_002454676.1|  hypothetical protein SORBIDRAFT_04g035460        53.9    2e-06   Sorghum bicolor [broomcorn]
ref|XP_007224406.1|  hypothetical protein PRUPE_ppa021713mg           54.7    2e-06   
ref|XP_006574148.1|  PREDICTED: putative ribonuclease H protein A...  53.5    2e-06   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413  55.5    2e-06   
ref|XP_006655090.1|  PREDICTED: uncharacterized protein LOC102699406  55.1    2e-06   
gb|EEE53388.1|  hypothetical protein OsJ_36435                        55.1    2e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KHN27242.1|  Putative ribonuclease H protein                       52.0    2e-06   
ref|XP_002458113.1|  hypothetical protein SORBIDRAFT_03g027125        51.6    2e-06   Sorghum bicolor [broomcorn]
gb|KHN30898.1|  Putative ribonuclease H protein                       53.9    2e-06   
gb|EEC69465.1|  hypothetical protein OsI_38661                        54.7    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_006595284.1|  PREDICTED: uncharacterized protein LOC102670174  53.1    3e-06   
ref|XP_004512849.1|  PREDICTED: uncharacterized protein LOC101502097  52.0    3e-06   
ref|NP_001045511.1|  Os01g0967700                                     53.9    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08213.1|  hypothetical protein OsI_30472                        54.3    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010667870.1|  PREDICTED: uncharacterized protein LOC104884866  53.5    3e-06   
gb|EAZ40645.1|  hypothetical protein OsJ_25114                        54.7    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KHM99058.1|  hypothetical protein glysoja_024358                   52.4    3e-06   
ref|XP_006601639.1|  PREDICTED: putative ribonuclease H protein A...  52.8    3e-06   
ref|XP_009353199.1|  PREDICTED: uncharacterized protein LOC103944460  54.7    3e-06   
ref|XP_009151561.1|  PREDICTED: putative ribonuclease H protein A...  54.7    3e-06   
gb|EEC81662.1|  hypothetical protein OsI_25211                        54.3    3e-06   Oryza sativa Indica Group [Indian rice]
gb|EEE50824.1|  hypothetical protein OsJ_31232                        54.7    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006603448.1|  PREDICTED: uncharacterized protein LOC102670511  51.6    3e-06   
ref|XP_006589934.1|  PREDICTED: uncharacterized protein LOC102669656  52.8    3e-06   
ref|XP_009116295.1|  PREDICTED: putative ribonuclease H protein A...  54.3    4e-06   
ref|XP_009107896.1|  PREDICTED: putative ribonuclease H protein A...  53.9    4e-06   
ref|XP_008222990.1|  PREDICTED: putative ribonuclease H protein A...  53.5    4e-06   
ref|XP_006603340.1|  PREDICTED: putative ribonuclease H protein A...  53.5    4e-06   
ref|XP_006579325.1|  PREDICTED: uncharacterized protein LOC102669832  52.8    4e-06   
gb|EEE69154.1|  hypothetical protein OsJ_28290                        53.9    4e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KHN09049.1|  hypothetical protein glysoja_044341                   51.2    4e-06   
ref|XP_006347119.1|  PREDICTED: putative ribonuclease H protein A...  53.9    4e-06   
gb|ABA97040.1|  retrotransposon protein, putative, unclassified       54.3    4e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AAQ19327.1|  bZIP-like protein                                     54.3    4e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81552.1|  hypothetical protein OsI_24974                        54.3    4e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...  54.3    5e-06   
ref|XP_007048905.1|  Uncharacterized protein TCM_001910               53.5    5e-06   
ref|XP_006577508.1|  PREDICTED: uncharacterized protein LOC102660507  53.1    5e-06   
ref|XP_006337991.1|  PREDICTED: putative ribonuclease H protein A...  53.9    5e-06   
gb|AAP53315.2|  retrotransposon protein, putative, unclassified       54.3    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006603252.1|  PREDICTED: uncharacterized protein LOC102659409  51.2    5e-06   
gb|ABA98491.1|  retrotransposon protein, putative, unclassified       54.3    5e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KHN15989.1|  hypothetical protein glysoja_047403                   52.0    5e-06   
gb|AAM18736.1|AC092548_14  putative reverse transcriptase             54.3    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060259.1|  Os07g0613900                                     54.3    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006585871.1|  PREDICTED: uncharacterized protein LOC102661163  52.0    5e-06   
ref|NP_001066197.2|  Os12g0156200                                     54.3    5e-06   Oryza sativa Japonica Group [Japonica rice]
gb|ABD32189.2|  Polynucleotidyl transferase, Ribonuclease H fold      53.5    5e-06   Medicago truncatula
ref|XP_008342743.1|  PREDICTED: putative ribonuclease H protein A...  53.5    6e-06   
ref|XP_006593887.1|  PREDICTED: uncharacterized protein LOC102670387  52.8    6e-06   
ref|XP_007028365.1|  Uncharacterized protein TCM_024142               52.0    6e-06   
ref|XP_002456315.1|  hypothetical protein SORBIDRAFT_03g033860        53.1    6e-06   Sorghum bicolor [broomcorn]
ref|XP_006580700.1|  PREDICTED: uncharacterized protein LOC102670374  52.4    6e-06   
gb|EEC83100.1|  hypothetical protein OsI_28249                        53.9    6e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010512944.1|  PREDICTED: uncharacterized protein LOC104788863  53.9    6e-06   
ref|XP_006590046.1|  PREDICTED: uncharacterized protein LOC102666665  51.6    6e-06   
gb|EEC84753.1|  hypothetical protein OsI_31756                        53.9    6e-06   Oryza sativa Indica Group [Indian rice]
gb|KHN37115.1|  Putative ribonuclease H protein                       51.6    6e-06   
ref|XP_006467327.1|  PREDICTED: uncharacterized protein LOC102625297  53.1    7e-06   
ref|XP_006493122.1|  PREDICTED: putative ribonuclease H protein A...  53.5    7e-06   
gb|KHN23636.1|  hypothetical protein glysoja_044901                   50.4    7e-06   
gb|AAK39575.1|AC025296_10  putative reverse transcriptase             53.5    7e-06   Oryza sativa [red rice]
ref|XP_006464882.1|  PREDICTED: putative ribonuclease H protein A...  53.5    7e-06   
ref|XP_006577478.1|  PREDICTED: uncharacterized protein LOC102661604  51.2    8e-06   
gb|EMT20940.1|  ABC transporter C family member 10                    53.5    8e-06   
gb|KHN05438.1|  Putative ribonuclease H protein                       52.8    8e-06   
ref|XP_006657175.1|  PREDICTED: putative ribonuclease H protein A...  53.1    8e-06   
ref|XP_002466153.1|  hypothetical protein SORBIDRAFT_01g002325        53.1    8e-06   Sorghum bicolor [broomcorn]
gb|KHN43777.1|  Putative ribonuclease H protein                       52.8    9e-06   
gb|ABN08723.1|  Polynucleotidyl transferase, Ribonuclease H fold      52.4    9e-06   Medicago truncatula
gb|AAS55787.1|  hypothetical protein                                  53.5    9e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006580378.1|  PREDICTED: uncharacterized protein LOC102670245  52.0    9e-06   
ref|XP_006587778.1|  PREDICTED: putative ribonuclease H protein A...  52.4    9e-06   
ref|XP_006591504.1|  PREDICTED: uncharacterized protein LOC102664...  52.0    1e-05   
ref|XP_002438073.1|  hypothetical protein SORBIDRAFT_10g007695        50.8    1e-05   Sorghum bicolor [broomcorn]
gb|ABN06084.1|  Polynucleotidyl transferase, Ribonuclease H fold      52.8    1e-05   Medicago truncatula
ref|XP_006588063.1|  PREDICTED: uncharacterized protein LOC102660652  51.6    1e-05   
ref|XP_004298270.1|  PREDICTED: putative ribonuclease H protein A...  52.4    1e-05   
ref|XP_008375111.1|  PREDICTED: putative ribonuclease H protein A...  52.8    1e-05   
gb|ABO80459.1|  RNA-directed DNA polymerase (Reverse transcriptas...  52.8    1e-05   Medicago truncatula
gb|EEC74955.1|  hypothetical protein OsI_10942                        52.8    1e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001176302.1|  Os11g0106066                                     52.8    1e-05   
ref|XP_002467657.1|  hypothetical protein SORBIDRAFT_01g031750        50.1    1e-05   Sorghum bicolor [broomcorn]
ref|XP_008346916.1|  PREDICTED: putative ribonuclease H protein A...  52.8    1e-05   
gb|EEC67895.1|  hypothetical protein OsI_35569                        52.4    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010671945.1|  PREDICTED: uncharacterized protein LOC104888619  52.4    1e-05   
ref|XP_006588172.1|  PREDICTED: uncharacterized protein LOC102660511  49.7    1e-05   
ref|XP_006605131.1|  PREDICTED: uncharacterized protein LOC102660681  51.2    2e-05   
gb|KHN41452.1|  Putative ribonuclease H protein                       50.4    2e-05   
emb|CAN65543.1|  hypothetical protein VITISV_018575                   50.1    2e-05   Vitis vinifera
ref|XP_010436639.1|  PREDICTED: uncharacterized protein LOC104720434  52.0    2e-05   
gb|EMS63991.1|  Cycloartenol synthase                                 52.4    2e-05   
ref|XP_006603467.1|  PREDICTED: uncharacterized protein LOC102665094  50.8    2e-05   
ref|XP_006606690.1|  PREDICTED: uncharacterized protein LOC102665012  51.6    2e-05   
gb|KHN28359.1|  hypothetical protein glysoja_029620                   50.1    2e-05   
ref|XP_010686132.1|  PREDICTED: uncharacterized protein LOC104900412  52.4    2e-05   
gb|KHN02645.1|  hypothetical protein glysoja_045754                   50.1    2e-05   
ref|XP_006598664.1|  PREDICTED: uncharacterized protein LOC102660905  50.8    2e-05   
ref|XP_006352964.1|  PREDICTED: putative ribonuclease H protein A...  51.6    2e-05   
gb|KHN42568.1|  Putative ribonuclease H protein                       51.6    2e-05   
ref|XP_002449211.1|  hypothetical protein SORBIDRAFT_05g006430        51.6    2e-05   Sorghum bicolor [broomcorn]
ref|XP_006598493.1|  PREDICTED: uncharacterized protein LOC102664555  49.3    2e-05   
emb|CAE02147.1|  OSJNBa0081G05.2                                      52.4    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006579202.1|  PREDICTED: uncharacterized protein LOC102666962  50.8    2e-05   
gb|EEE53976.1|  hypothetical protein OsJ_00596                        52.4    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006603446.1|  PREDICTED: uncharacterized protein LOC102669845  49.3    2e-05   
ref|XP_003621614.1|  DNA-directed RNA polymerase III subunit RPC6     51.6    2e-05   
gb|EEE59920.1|  hypothetical protein OsJ_12548                        52.0    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAS55772.2|  hypothetical protein                                  51.6    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452062.1|  hypothetical protein SORBIDRAFT_04g017846        51.6    2e-05   Sorghum bicolor [broomcorn]
ref|XP_010692615.1|  PREDICTED: uncharacterized protein LOC104905704  52.0    2e-05   
ref|XP_006584370.1|  PREDICTED: putative ribonuclease H protein A...  49.7    2e-05   
gb|KHN02883.1|  Putative ribonuclease H protein                       50.8    3e-05   
ref|XP_006575923.1|  PREDICTED: pyruvate kinase, cytosolic isozym...  51.6    3e-05   
ref|XP_008366111.1|  PREDICTED: putative ribonuclease H protein A...  50.8    3e-05   
ref|XP_007015140.1|  Ribonuclease H protein, putative                 51.2    3e-05   
ref|XP_006355601.1|  PREDICTED: putative ribonuclease H protein A...  51.2    3e-05   
gb|AAK71569.2|AC087852_29  putative reverse transcriptase             52.0    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76169.1|  hypothetical protein OsI_13484                        52.0    3e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_008382787.1|  PREDICTED: putative ribonuclease H protein A...  51.6    3e-05   
ref|XP_006603213.1|  PREDICTED: putative ribonuclease H protein A...  51.2    3e-05   
ref|XP_009334551.1|  PREDICTED: uncharacterized protein LOC103927359  52.0    3e-05   
gb|KHN27164.1|  Putative ribonuclease H protein                       51.2    3e-05   
ref|XP_006589988.1|  PREDICTED: putative ribonuclease H protein A...  51.2    3e-05   
ref|XP_009334552.1|  PREDICTED: uncharacterized protein LOC103927360  52.0    3e-05   
ref|XP_002520623.1|  conserved hypothetical protein                   48.5    3e-05   Ricinus communis
ref|XP_008356060.1|  PREDICTED: uncharacterized protein LOC103419743  51.6    3e-05   
ref|XP_006405618.1|  hypothetical protein EUTSA_v10028075mg           50.8    3e-05   
ref|XP_007015275.1|  Uncharacterized protein TCM_040908               48.5    3e-05   
ref|XP_009375083.1|  PREDICTED: uncharacterized protein LOC103963932  51.6    3e-05   
ref|XP_006579171.1|  PREDICTED: uncharacterized protein LOC102669479  50.8    3e-05   
gb|AAX95132.1|  hypothetical protein                                  50.8    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KHN25562.1|  LINE-1 reverse transcriptase like                     51.6    3e-05   
ref|XP_006579211.1|  PREDICTED: uncharacterized protein LOC102669301  49.7    3e-05   
ref|XP_002454801.1|  hypothetical protein SORBIDRAFT_04g037700        50.8    3e-05   Sorghum bicolor [broomcorn]
ref|XP_008364703.1|  PREDICTED: putative ribonuclease H protein A...  51.6    3e-05   
emb|CCA66050.1|  hypothetical protein                                 51.6    3e-05   
ref|XP_010693629.1|  PREDICTED: uncharacterized protein LOC104906557  50.8    3e-05   
emb|CAN81578.1|  hypothetical protein VITISV_023184                   51.2    4e-05   Vitis vinifera
ref|XP_006350483.1|  PREDICTED: putative ribonuclease H protein A...  50.1    4e-05   
emb|CAN71644.1|  hypothetical protein VITISV_041775                   50.8    4e-05   Vitis vinifera
ref|XP_006574179.1|  PREDICTED: uncharacterized protein LOC102662769  49.7    4e-05   
emb|CAN60939.1|  hypothetical protein VITISV_013257                   50.1    4e-05   Vitis vinifera
gb|KHN48463.1|  Putative ribonuclease H protein                       49.3    4e-05   
ref|XP_006584439.1|  PREDICTED: putative ribonuclease H protein A...  50.8    4e-05   
ref|XP_006576000.1|  PREDICTED: uncharacterized protein LOC102669332  50.1    4e-05   
ref|XP_002466273.1|  hypothetical protein SORBIDRAFT_01g004890        49.7    4e-05   Sorghum bicolor [broomcorn]
ref|XP_003612606.1|  Replication protein A1-like protein              51.2    4e-05   
ref|XP_006579238.1|  PREDICTED: uncharacterized protein LOC102665732  49.7    4e-05   
ref|XP_007033565.1|  Non-LTR retroelement reverse transcriptase-l...  50.4    4e-05   
ref|XP_004301837.1|  PREDICTED: putative ribonuclease H protein A...  50.8    4e-05   
ref|XP_002524334.1|  conserved hypothetical protein                   48.5    5e-05   Ricinus communis
gb|AAX92827.1|  hypothetical protein LOC_Os11g22380                   48.5    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006591700.1|  PREDICTED: uncharacterized protein LOC100787933  49.3    5e-05   
ref|XP_006449044.1|  hypothetical protein CICLE_v10014034mg           51.2    5e-05   
ref|XP_006596665.1|  PREDICTED: uncharacterized protein LOC102669603  48.9    5e-05   
ref|XP_002466618.1|  hypothetical protein SORBIDRAFT_01g011130        50.8    5e-05   Sorghum bicolor [broomcorn]
gb|KHN15506.1|  Putative ribonuclease H protein                       49.7    5e-05   
gb|KHN16322.1|  Putative ribonuclease H protein                       50.1    5e-05   
gb|KHN12532.1|  Putative ribonuclease H protein                       48.1    5e-05   
gb|ABN08698.1|  RNA-directed DNA polymerase ; Ribonuclease H, put...  47.8    5e-05   Medicago truncatula
ref|XP_010431244.1|  PREDICTED: uncharacterized protein LOC104715548  50.1    5e-05   
ref|XP_002443302.1|  hypothetical protein SORBIDRAFT_08g017205        50.4    5e-05   
ref|XP_002518871.1|  conserved hypothetical protein                   50.8    6e-05   
ref|XP_006596829.1|  PREDICTED: uncharacterized protein LOC102663759  49.7    6e-05   
ref|XP_006601645.1|  PREDICTED: uncharacterized protein LOC102665792  49.7    6e-05   
emb|CAN79789.1|  hypothetical protein VITISV_039779                   50.8    6e-05   
ref|XP_008392821.1|  PREDICTED: putative ribonuclease H protein A...  50.4    6e-05   
ref|XP_008355389.1|  PREDICTED: putative ribonuclease H protein A...  50.8    6e-05   
ref|XP_010451493.1|  PREDICTED: uncharacterized protein LOC104733622  50.8    6e-05   
ref|XP_010686853.1|  PREDICTED: uncharacterized protein LOC104901008  48.5    7e-05   
ref|XP_010430908.1|  PREDICTED: uncharacterized protein LOC104715170  49.7    7e-05   
ref|XP_008367240.1|  PREDICTED: putative ribonuclease H protein A...  50.4    7e-05   
ref|XP_006584341.1|  PREDICTED: uncharacterized protein LOC102660885  49.7    7e-05   
ref|XP_006593201.1|  PREDICTED: uncharacterized protein LOC102665828  49.7    7e-05   
ref|XP_010238942.1|  PREDICTED: uncharacterized protein LOC100831270  50.8    7e-05   
ref|XP_006603536.1|  PREDICTED: uncharacterized protein LOC102663701  48.5    7e-05   
gb|ABA94593.2|  retrotransposon protein, putative, unclassified       50.4    7e-05   
ref|XP_006356729.1|  PREDICTED: putative ribonuclease H protein A...  49.7    8e-05   
ref|XP_004292002.1|  PREDICTED: uncharacterized protein LOC101312896  50.4    8e-05   
ref|XP_009363712.1|  PREDICTED: uncharacterized protein LOC103953670  50.4    8e-05   
ref|XP_009148725.1|  PREDICTED: uncharacterized protein LOC103872128  50.4    8e-05   
gb|EEE65549.1|  hypothetical protein OsJ_21022                        48.9    8e-05   
ref|XP_006580761.1|  PREDICTED: uncharacterized protein LOC102665291  47.4    8e-05   
gb|KHN15276.1|  Putative ribonuclease H protein                       48.5    8e-05   
emb|CAN80166.1|  hypothetical protein VITISV_033619                   50.4    9e-05   
ref|XP_010690177.1|  PREDICTED: uncharacterized protein LOC104903764  50.4    9e-05   
ref|XP_004298091.1|  PREDICTED: uncharacterized protein LOC101303799  49.7    9e-05   
ref|XP_004986776.1|  PREDICTED: uncharacterized protein LOC101754607  47.8    9e-05   
emb|CAN74004.1|  hypothetical protein VITISV_006235                   50.4    9e-05   
ref|XP_006584315.1|  PREDICTED: uncharacterized protein LOC102665680  49.3    1e-04   
ref|XP_006588155.1|  PREDICTED: uncharacterized protein LOC102667120  48.1    1e-04   
gb|KHN33900.1|  Putative ribonuclease H protein                       49.7    1e-04   
ref|XP_008380437.1|  PREDICTED: uncharacterized protein LOC103443380  49.3    1e-04   
ref|XP_009150014.1|  PREDICTED: putative ribonuclease H protein A...  49.7    1e-04   
ref|XP_006604944.1|  PREDICTED: uncharacterized protein LOC102662191  48.5    1e-04   
gb|EAY97143.1|  hypothetical protein OsI_19065                        48.9    1e-04   
ref|XP_010424608.1|  PREDICTED: uncharacterized protein LOC104709742  50.1    1e-04   
ref|XP_006601530.1|  PREDICTED: uncharacterized protein LOC102659449  48.9    1e-04   
ref|XP_008340459.1|  PREDICTED: putative ribonuclease H protein A...  49.7    1e-04   
ref|XP_006595287.1|  PREDICTED: putative ribonuclease H protein A...  49.3    1e-04   
ref|XP_010502011.1|  PREDICTED: uncharacterized protein LOC104779357  50.1    1e-04   
gb|KHN14498.1|  Putative ribonuclease H protein                       47.4    1e-04   
gb|KEH19666.1|  hypothetical protein MTR_8g466070                     48.5    1e-04   
gb|ABD28627.2|  RNA-directed DNA polymerase (Reverse transcriptas...  50.1    1e-04   
gb|AAR89884.1|  putative reverse transcriptase                        48.5    1e-04   
ref|XP_006606761.1|  PREDICTED: uncharacterized protein LOC102662556  48.5    1e-04   
gb|EEC80813.1|  hypothetical protein OsI_23383                        48.9    1e-04   
ref|XP_010666820.1|  PREDICTED: uncharacterized protein LOC104883940  50.1    1e-04   
gb|KHN23686.1|  hypothetical protein glysoja_048162                   48.5    1e-04   
gb|KHN09881.1|  hypothetical protein glysoja_034671                   46.6    1e-04   
ref|XP_003606192.1|  3-ketoacyl-CoA synthase                          49.3    1e-04   
ref|XP_010513288.1|  PREDICTED: uncharacterized protein LOC104789255  49.3    1e-04   
emb|CAN62318.1|  hypothetical protein VITISV_026527                   49.7    1e-04   
gb|KHN06120.1|  hypothetical protein glysoja_042389                   47.0    1e-04   
ref|XP_009107782.1|  PREDICTED: putative ribonuclease H protein A...  48.9    1e-04   
gb|EEE59480.1|  hypothetical protein OsJ_11697                        48.5    1e-04   
gb|KHN44109.1|  Putative ribonuclease H protein                       47.8    1e-04   
ref|XP_006354966.1|  PREDICTED: putative ribonuclease H protein A...  48.9    1e-04   
ref|XP_009107779.1|  PREDICTED: putative ribonuclease H protein A...  49.3    1e-04   
emb|CAN75374.1|  hypothetical protein VITISV_029152                   49.3    2e-04   
ref|XP_002447399.1|  hypothetical protein SORBIDRAFT_06g000290        49.7    2e-04   
ref|XP_007203573.1|  hypothetical protein PRUPE_ppb016510mg           48.9    2e-04   
ref|XP_010684219.1|  PREDICTED: putative ribonuclease H protein A...  48.9    2e-04   
gb|EEC68446.1|  hypothetical protein OsI_36656                        48.5    2e-04   
ref|XP_006605038.1|  PREDICTED: putative ribonuclease H protein A...  48.9    2e-04   
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695  49.7    2e-04   
ref|XP_010030447.1|  PREDICTED: uncharacterized protein LOC104420277  49.7    2e-04   
ref|XP_010412448.1|  PREDICTED: uncharacterized protein LOC104698743  49.7    2e-04   
emb|CAN83561.1|  hypothetical protein VITISV_024106                   49.7    2e-04   
gb|ABE80156.1|  Ribonuclease H                                        48.9    2e-04   
ref|XP_002533976.1|  hypothetical protein RCOM_0370700                46.6    2e-04   
ref|XP_008229470.1|  PREDICTED: putative ribonuclease H protein A...  48.1    2e-04   
emb|CAN72177.1|  hypothetical protein VITISV_012537                   48.9    2e-04   
ref|XP_003553268.2|  PREDICTED: putative ribonuclease H protein A...  49.3    2e-04   
ref|XP_009113015.1|  PREDICTED: putative ribonuclease H protein A...  49.3    2e-04   
ref|XP_010451822.1|  PREDICTED: uncharacterized protein LOC104734004  49.3    2e-04   
ref|XP_009124780.1|  PREDICTED: putative ribonuclease H protein A...  48.5    2e-04   
dbj|BAD05496.1|  cyst nematode resistance protein-like protein        47.0    2e-04   
ref|XP_006579097.1|  PREDICTED: uncharacterized protein LOC102659987  47.8    2e-04   
ref|XP_006606772.1|  PREDICTED: uncharacterized protein LOC102665847  48.5    2e-04   
ref|XP_007206579.1|  hypothetical protein PRUPE_ppa020293mg           48.1    2e-04   
ref|XP_010506884.1|  PREDICTED: uncharacterized protein LOC104783422  49.3    2e-04   
ref|XP_009800085.1|  PREDICTED: uncharacterized protein LOC104246050  48.9    2e-04   
ref|XP_010682492.1|  PREDICTED: uncharacterized protein LOC104897331  48.9    2e-04   
gb|KHN43748.1|  Putative ribonuclease H protein                       47.4    2e-04   
ref|XP_002448521.1|  hypothetical protein SORBIDRAFT_06g028350        48.5    2e-04   
emb|CAN80631.1|  hypothetical protein VITISV_026658                   48.9    2e-04   
ref|XP_009123425.1|  PREDICTED: uncharacterized protein LOC103848222  48.9    2e-04   
ref|XP_006596861.1|  PREDICTED: uncharacterized protein LOC102663060  47.4    2e-04   
ref|XP_009113844.1|  PREDICTED: putative ribonuclease H protein A...  48.5    2e-04   
emb|CAN78803.1|  hypothetical protein VITISV_032700                   48.9    2e-04   
emb|CAN75028.1|  hypothetical protein VITISV_026823                   49.3    2e-04   
ref|XP_006596741.1|  PREDICTED: putative ribonuclease H protein A...  48.5    2e-04   
emb|CAN78865.1|  hypothetical protein VITISV_013346                   49.3    2e-04   
emb|CAH66131.1|  OSIGBa0135L04.5                                      48.9    2e-04   
ref|XP_008377029.1|  PREDICTED: putative ribonuclease H protein A...  48.5    2e-04   
ref|XP_009144972.1|  PREDICTED: uncharacterized protein LOC103868645  48.5    3e-04   
ref|XP_008663016.1|  PREDICTED: putative ribonuclease H protein A...  48.5    3e-04   
gb|EEE54019.1|  hypothetical protein OsJ_00679                        47.0    3e-04   
ref|XP_010451766.1|  PREDICTED: uncharacterized protein LOC104733939  48.1    3e-04   
gb|EEE62189.1|  hypothetical protein OsJ_16976                        48.5    3e-04   
ref|XP_009107495.1|  PREDICTED: putative ribonuclease H protein A...  47.8    3e-04   
ref|XP_002452729.1|  hypothetical protein SORBIDRAFT_04g031435        46.6    3e-04   
gb|AAX94970.1|  retrotransposon protein, putative, unclassified       48.5    3e-04   
emb|CAN63495.1|  hypothetical protein VITISV_011670                   48.5    3e-04   
gb|KHN22195.1|  hypothetical protein glysoja_036941                   45.8    3e-04   
ref|XP_010476358.1|  PREDICTED: uncharacterized protein LOC104755638  48.9    3e-04   
gb|EAY96391.1|  hypothetical protein OsI_18290                        48.5    3e-04   
ref|XP_010495441.1|  PREDICTED: uncharacterized protein LOC104772536  48.5    3e-04   
ref|XP_006589881.1|  PREDICTED: uncharacterized protein LOC102665905  48.1    3e-04   
ref|XP_006596789.1|  PREDICTED: putative ribonuclease H protein A...  47.8    3e-04   
ref|XP_006575973.1|  PREDICTED: uncharacterized protein LOC102660814  47.0    3e-04   
dbj|BAG89520.1|  unnamed protein product                              46.6    3e-04   
emb|CAN76273.1|  hypothetical protein VITISV_001057                   48.5    3e-04   
gb|EEC77095.1|  hypothetical protein OsI_15508                        48.5    3e-04   
ref|XP_006606655.1|  PREDICTED: uncharacterized protein LOC102668453  47.4    3e-04   
emb|CAN64031.1|  hypothetical protein VITISV_037889                   48.5    3e-04   
ref|XP_002455739.1|  hypothetical protein SORBIDRAFT_03g023736        47.4    3e-04   
gb|EAZ06970.1|  hypothetical protein OsI_29212                        47.8    3e-04   
ref|XP_006589908.1|  PREDICTED: putative ribonuclease H protein A...  48.1    3e-04   
ref|XP_008364397.1|  PREDICTED: putative ribonuclease H protein A...  47.8    3e-04   
ref|XP_003621136.1|  Pentatricopeptide repeat-containing protein      48.5    3e-04   
ref|XP_010672035.1|  PREDICTED: uncharacterized protein LOC104888701  48.1    3e-04   
ref|XP_006582712.1|  PREDICTED: putative ribonuclease H protein A...  48.1    3e-04   
ref|XP_006577420.1|  PREDICTED: putative ribonuclease H protein A...  48.1    3e-04   
ref|XP_007206481.1|  hypothetical protein PRUPE_ppa018770mg           48.5    4e-04   
gb|EEC70039.1|  hypothetical protein OsI_00625                        48.1    4e-04   
emb|CDX87874.1|  BnaC06g09360D                                        47.4    4e-04   
ref|XP_009114092.1|  PREDICTED: uncharacterized protein LOC103839337  48.5    4e-04   
emb|CCA65997.1|  hypothetical protein                                 48.5    4e-04   
ref|XP_008377038.1|  PREDICTED: putative ribonuclease H protein A...  47.8    4e-04   
ref|XP_007028202.1|  Retrotransposon, unclassified-like protein       47.4    4e-04   
gb|EAZ40370.1|  hypothetical protein OsJ_24816                        48.1    4e-04   
ref|XP_007199601.1|  hypothetical protein PRUPE_ppa023095mg           48.5    4e-04   
ref|XP_008366684.1|  PREDICTED: uncharacterized protein LOC103430323  48.5    4e-04   
ref|XP_006595358.1|  PREDICTED: putative ribonuclease H protein A...  47.8    4e-04   
ref|XP_006586525.1|  PREDICTED: putative ribonuclease H protein A...  47.8    4e-04   
ref|XP_002522646.1|  RNA binding protein, putative                    47.8    4e-04   
ref|XP_006601586.1|  PREDICTED: uncharacterized protein LOC100813209  47.4    4e-04   
ref|XP_009599592.1|  PREDICTED: uncharacterized protein LOC104095219  48.1    4e-04   
ref|XP_002436387.1|  hypothetical protein SORBIDRAFT_10g001650        47.8    4e-04   
ref|XP_006582029.1|  PREDICTED: uncharacterized protein LOC100815...  47.0    4e-04   
ref|XP_002438574.1|  hypothetical protein SORBIDRAFT_10g022100        47.4    4e-04   
ref|XP_008393344.1|  PREDICTED: putative ribonuclease H protein A...  47.8    4e-04   
ref|XP_007010730.1|  Ribonuclease H protein, putative                 47.4    4e-04   
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...  48.1    4e-04   
ref|XP_009128743.1|  PREDICTED: uncharacterized protein LOC103853589  47.8    4e-04   
ref|XP_006606768.1|  PREDICTED: putative ribonuclease H protein A...  47.0    4e-04   
ref|XP_009367701.1|  PREDICTED: uncharacterized protein LOC103957282  48.1    4e-04   
ref|XP_006605152.1|  PREDICTED: uncharacterized protein LOC100795650  47.8    4e-04   
ref|XP_008339024.1|  PREDICTED: putative ribonuclease H protein A...  47.8    5e-04   
ref|XP_006584335.1|  PREDICTED: uncharacterized protein LOC102670391  47.4    5e-04   
ref|XP_006601683.1|  PREDICTED: putative ribonuclease H protein A...  46.6    5e-04   
ref|XP_010481092.1|  PREDICTED: uncharacterized protein LOC104759918  48.1    5e-04   
ref|XP_009140640.1|  PREDICTED: uncharacterized protein LOC103864627  47.8    5e-04   
ref|XP_010463319.1|  PREDICTED: uncharacterized protein LOC104743986  48.1    5e-04   
ref|XP_010495697.1|  PREDICTED: uncharacterized protein LOC104772828  47.8    5e-04   
ref|XP_006591699.1|  PREDICTED: putative ribonuclease H protein A...  47.4    5e-04   
gb|AAV43830.1|  hypothetical protein                                  47.8    5e-04   
emb|CCA66040.1|  hypothetical protein                                 48.1    5e-04   
gb|KHN11339.1|  Putative ribonuclease H protein                       46.6    5e-04   
gb|KHN07226.1|  hypothetical protein glysoja_048963                   45.4    5e-04   
ref|XP_010468192.1|  PREDICTED: uncharacterized protein LOC104748214  47.8    5e-04   
emb|CAN81035.1|  hypothetical protein VITISV_011008                   48.1    5e-04   
ref|XP_010677682.1|  PREDICTED: uncharacterized protein LOC104893281  47.8    5e-04   
ref|XP_004305827.1|  PREDICTED: putative ribonuclease H protein A...  47.8    5e-04   
ref|XP_008351105.1|  PREDICTED: uncharacterized protein LOC103414509  47.8    5e-04   
ref|XP_002439977.1|  hypothetical protein SORBIDRAFT_09g023725        46.6    5e-04   
emb|CAN61375.1|  hypothetical protein VITISV_037805                   48.1    5e-04   
gb|KHN46549.1|  Putative ribonuclease H protein                       47.4    5e-04   
ref|XP_010666804.1|  PREDICTED: uncharacterized protein LOC104883925  47.0    5e-04   
ref|XP_007207070.1|  hypothetical protein PRUPE_ppa026519mg           47.4    5e-04   
gb|EAZ40914.1|  hypothetical protein OsJ_25394                        47.0    6e-04   
emb|CAN66445.1|  hypothetical protein VITISV_003574                   47.8    6e-04   
ref|XP_010261288.1|  PREDICTED: uncharacterized protein LOC104600144  47.4    6e-04   
ref|XP_007008704.1|  Uncharacterized protein TCM_042330               47.8    6e-04   
ref|XP_010666352.1|  PREDICTED: uncharacterized protein LOC104883509  47.8    6e-04   
ref|XP_010670096.1|  PREDICTED: uncharacterized protein LOC104887198  47.8    6e-04   
ref|XP_009119498.1|  PREDICTED: putative ribonuclease H protein A...  47.4    6e-04   
ref|XP_006589936.1|  PREDICTED: uncharacterized protein LOC102670329  47.8    6e-04   
ref|XP_006598622.1|  PREDICTED: putative ribonuclease H protein A...  45.4    6e-04   
ref|XP_010692477.1|  PREDICTED: uncharacterized protein LOC104905588  47.8    6e-04   
ref|XP_010666711.1|  PREDICTED: uncharacterized protein LOC104883845  47.8    7e-04   
gb|EEC83406.1|  hypothetical protein OsI_28856                        47.8    7e-04   
gb|KHN47558.1|  hypothetical protein glysoja_039938                   46.2    7e-04   
ref|XP_006603420.1|  PREDICTED: uncharacterized protein LOC102664738  45.8    7e-04   
ref|XP_010431245.1|  PREDICTED: uncharacterized protein LOC104715550  47.0    7e-04   
gb|ABA99600.2|  retrotransposon protein, putative, unclassified       47.8    7e-04   
ref|XP_010424289.1|  PREDICTED: uncharacterized protein LOC104709359  47.8    7e-04   
emb|CAN83329.1|  hypothetical protein VITISV_034016                   47.0    7e-04   
ref|XP_006593182.1|  PREDICTED: putative ribonuclease H protein A...  46.2    7e-04   
emb|CAN78744.1|  hypothetical protein VITISV_014186                   47.8    7e-04   
emb|CAN60975.1|  hypothetical protein VITISV_018843                   47.4    7e-04   
ref|XP_006605222.1|  PREDICTED: uncharacterized protein LOC102663493  46.2    7e-04   
ref|XP_010094147.1|  hypothetical protein L484_017186                 45.4    7e-04   
ref|XP_002437980.1|  hypothetical protein SORBIDRAFT_10g005830        46.6    7e-04   
ref|XP_002529878.1|  hypothetical protein RCOM_1158570                44.7    7e-04   
ref|XP_006604935.1|  PREDICTED: putative ribonuclease H protein A...  46.2    7e-04   
ref|NP_001175214.1|  Os07g0501200                                     47.4    7e-04   
emb|CAN78776.1|  hypothetical protein VITISV_029750                   47.4    7e-04   
emb|CCA66054.1|  hypothetical protein                                 47.4    8e-04   
ref|XP_004301477.1|  PREDICTED: uncharacterized protein LOC101302844  47.0    8e-04   
gb|EEC77887.1|  hypothetical protein OsI_17181                        47.4    8e-04   
ref|XP_007210987.1|  hypothetical protein PRUPE_ppa021345mg           47.4    8e-04   
emb|CAN69820.1|  hypothetical protein VITISV_025709                   47.4    8e-04   
emb|CAN75589.1|  hypothetical protein VITISV_042880                   47.4    8e-04   
ref|XP_008358487.1|  PREDICTED: putative ribonuclease H protein A...  47.0    8e-04   
ref|XP_006593183.1|  PREDICTED: uncharacterized protein LOC102660447  45.8    8e-04   
ref|XP_008355160.1|  PREDICTED: putative ribonuclease H protein A...  47.0    8e-04   
ref|XP_006588122.1|  PREDICTED: putative ribonuclease H protein A...  46.6    8e-04   
ref|XP_008353829.1|  PREDICTED: putative ribonuclease H protein A...  47.0    8e-04   
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015  47.4    9e-04   
ref|XP_002451167.1|  hypothetical protein SORBIDRAFT_05g025250        46.6    9e-04   
emb|CAN65455.1|  hypothetical protein VITISV_018546                   46.6    9e-04   
ref|XP_010667378.1|  PREDICTED: uncharacterized protein LOC104884431  47.4    9e-04   
gb|ABD28498.2|  Polynucleotidyl transferase, Ribonuclease H fold      46.6    0.001   
ref|XP_009129596.1|  PREDICTED: uncharacterized protein LOC103854414  46.6    0.001   
ref|XP_010687065.1|  PREDICTED: uncharacterized protein LOC104901211  46.6    0.001   
ref|NP_001172748.1|  Os01g0954600                                     45.8    0.001   
ref|XP_004308352.1|  PREDICTED: uncharacterized protein LOC101310171  45.1    0.001   
gb|KHN24681.1|  Putative ribonuclease H protein                       46.2    0.001   



>ref|XP_004301145.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=411

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            ++L W     G+ SV SAY  +     G  N  W  +WKL  P K+   +W + H+K++T
Sbjct  44   DKLIWNATANGKFSVKSAYN-SFFDSAGVSNPLWTHLWKLNCPPKLKTFMWYVLHQKILT  102

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            N++R RRGF++ A CP C N +E + H +RDC
Sbjct  103  NVQRVRRGFSTIASCPICKNADETLLHLLRDC  134



>ref|XP_004289445.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=719

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/92 (38%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            ++L W     G+ SV S Y  +     G  N  W  +WKL  P K+   +W + H+K++T
Sbjct  531  DKLIWNATANGKFSVKSTYN-SFFDSAGVSNPLWTHLWKLNCPPKLKTFMWSVLHQKILT  589

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            N++R RRGF++ A CP C N +E + H +RDC
Sbjct  590  NVQRVRRGFSTIASCPICKNADETLLHLLRDC  621



>ref|XP_009344908.1| PREDICTED: uncharacterized protein LOC103936764 [Pyrus x bretschneideri]
Length=1365

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +2

Query  17    EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
             +++ W L  +G  SV +AY ++  G+       W  IWKLK+P K+   LW + H K++T
Sbjct  1002  DKVIWSLTNSGTFSVKTAY-LSLFGDDDIIPWKWNFIWKLKLPPKLVTFLWTIGHGKILT  1060

Query  197   NLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             N++R RRGFT++  CP C N EE + H  R C ++
Sbjct  1061  NVQRARRGFTNNPCCPICPNIEESMDHIFRSCKQS  1095



>ref|XP_004306074.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=407

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            + L W     G+  V SAY  +        N  W  IW++K+P K+   LW   HKKL+T
Sbjct  265  DTLIWGATANGKFFVKSAYN-SLFDMSAPLNPQWNYIWRMKIPPKLKTFLWTFLHKKLLT  323

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            N++R  RGFT+ A CP C + +E   H  RDC
Sbjct  324  NMQRVTRGFTASALCPICQSADESFLHLFRDC  355



>ref|XP_004309882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=152

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            + + WKL   G+ +V SAY         E    W  IWKL+VP K+   LW L H +L+T
Sbjct  27   DTIIWKLSHNGKFTVKSAYHSLFLNSETE-PWPWDFIWKLQVPPKVKIFLWTLIHDRLLT  85

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
            N  R RRG   DA CP+C    E + H  +DCT
Sbjct  86   NKARVRRGLAIDALCPRCNFPLESLDHLFKDCT  118



>ref|XP_004305757.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=395

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 1/91 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            W     G+ SV SAY+ +        N  WK +WKL +P K+   LW + HKKL+TN++R
Sbjct  93   WCSTSNGQFSVKSAYS-SIFYSSDPMNPQWKAMWKLDLPPKLKTFLWTILHKKLLTNVQR  151

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
              RGFTS   CP C + +E + H +RD   A
Sbjct  152  ATRGFTSSPSCPICHSADETLLHLLRDYPRA  182



>ref|XP_008221996.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=545

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/93 (43%), Positives = 53/93 (57%), Gaps = 1/93 (1%)
 Frame = +2

Query  14   IEELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            +++  WK    G  SV S Y I+   EG      W  IWKLK+P KI   LW+L HKKL+
Sbjct  181  LDKRIWKCTPNGDFSVKSVYGISFL-EGNVLPWQWGFIWKLKIPPKIKAFLWLLCHKKLL  239

Query  194  TNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            TN +R++RG  S A CP+C+   E I H +  C
Sbjct  240  TNFQRQKRGLASCAACPRCSYPVETIEHLVSGC  272



>ref|XP_004300035.1| PREDICTED: uncharacterized protein LOC101293591 [Fragaria vesca 
subsp. vesca]
Length=256

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +2

Query  47   GRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFT  226
            G  SV SAY  +       HN  WK IW L +P K+   LW + HKKL+TN++R  R FT
Sbjct  77   GCFSVKSAYN-SVFDFSNSHNCQWKLIWNLDIPPKLKTFLWTMLHKKLLTNVQRVTRRFT  135

Query  227  SDARCPQCANHEEDITHCIRDCTEA  301
             +A CP C + +E + H +R C  +
Sbjct  136  KNATCPICHSADETLLHLLRACPRS  160



>ref|XP_007023230.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY25852.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=1011

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 5/93 (5%)
 Frame = +2

Query  26   YWKLDCTGRCSVSSAY----TIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            YW L   G  ++SS Y    ++A      E+N+ W+ +W L+ P ++   L+   HK+++
Sbjct  680  YWALSPYGYFTISSTYKHLGSLADSTRE-ENNKMWRLVWDLRGPHRVCLFLFFCLHKRIL  738

Query  194  TNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            TN ER RR  +SDA CP C   EE   H +RDC
Sbjct  739  TNAERVRRKMSSDASCPHCYGVEETCLHVLRDC  771



>gb|KHN13238.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=118

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 44/91 (48%), Gaps = 0/91 (0%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            W L   G  S  + + + ++ +    N  W  +WK K P ++   LW + H  L TN  R
Sbjct  1    WTLTANGVFSTKTTFQLISRNKHFIPNFDWNNVWKWKGPERVRFFLWTVLHHGLKTNFRR  60

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            RR GFT D+ C  C    ED  H +RDC  A
Sbjct  61   RRCGFTKDSSCSFCHLQSEDELHILRDCPFA  91



>ref|XP_009101981.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1235

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 2/97 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRT--WKTIWKLKVPRKISNVLWILKHKKL  190
            + + W     G+ SV SAYT  TK      N    ++ +W++ VP +    LW++ H+ +
Sbjct  868  DRMSWSGSNDGQFSVKSAYTFLTKNVVPRQNMEALYRRVWRVAVPERTRVFLWLVSHQVI  927

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            MTN+ER+RR  +  + C  C N +E I H +RDC  A
Sbjct  928  MTNMERKRRHLSDSSVCLLCKNGDETILHVLRDCPAA  964



>ref|XP_007219945.1| hypothetical protein PRUPE_ppb019389mg [Prunus persica]
 gb|EMJ21144.1| hypothetical protein PRUPE_ppb019389mg [Prunus persica]
Length=786

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +2

Query  80   ATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANH  259
            A + E       W+ +W+L++P KI   LWI+ H+KL+TN++R++RG T    CP+C   
Sbjct  563  AVEAEHASVKWDWQFLWRLRLPPKIKTFLWIVCHRKLLTNVQRQKRGLTQAPACPRCDYP  622

Query  260  EEDITHCIRDC  292
             E I H  +DC
Sbjct  623  METIAHLFKDC  633



>ref|XP_007226572.1| hypothetical protein PRUPE_ppa024162mg [Prunus persica]
 gb|EMJ27771.1| hypothetical protein PRUPE_ppa024162mg [Prunus persica]
Length=297

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WK    G  SV SAY +  +G     +  WK +WKLK+P K+    W++   K+++N +R
Sbjct  21   WKFSPNGIFSVKSAYNMLFEGSACS-DVDWKFLWKLKIPPKLHIFFWLIFQGKILSNEQR  79

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             RR  + DA C  C    E I H + DC +A
Sbjct  80   ARRQMSLDASCGSCHWPVESILHILHDCVKA  110



>ref|XP_007039838.1| RNA-directed DNA polymerase (Reverse transcriptase), Polynucleotidyl 
transferase, Ribonuclease H fold-like protein [Theobroma 
cacao]
 gb|EOY24339.1| RNA-directed DNA polymerase (Reverse transcriptase), Polynucleotidyl 
transferase, Ribonuclease H fold-like protein [Theobroma 
cacao]
Length=616

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/92 (37%), Positives = 49/92 (53%), Gaps = 3/92 (3%)
 Frame = +2

Query  26   YWKLDCTGRCSVSSAYTIATKGEG---GEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            YW    +G C+V+S Y +  +      G+ +R W   WK   P++I   L    H KL+T
Sbjct  307  YWASSASGVCTVASTYEVLREDYPNYIGQQSRKWAIAWKWDGPQRIRTFLMQCLHGKLLT  366

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            NLE RRR  +S A C  C+  +E + H +RDC
Sbjct  367  NLECRRRNMSSSATCALCSVSDESVLHLLRDC  398



>ref|XP_008221358.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=877

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 1/88 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            W+    G  SV SAY+     E       W+ IW L +P K+   LWI+ H+KL+TN++R
Sbjct  519  WQFTPNGSFSVKSAYSSFLPTEASV-KWDWQFIWGLLLPPKVKTFLWIVCHQKLLTNVQR  577

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDC  292
            ++RG T    CP+C    + I H  +DC
Sbjct  578  QKRGLTQVPTCPKCDYPMKAIAHLFKDC  605



>gb|KFK31801.1| hypothetical protein AALP_AA6G160600 [Arabis alpina]
Length=373

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHN--RTWKTIWKLKVPRKISNVLWILKHKKL  190
            +++ W  +  G+ +V SAY++ T+      +  R ++ +W L VP ++   +W+  HK L
Sbjct  29   DKISWSGNSDGKFTVKSAYSMLTRNLTLRQDLSRLFQRVWALIVPERVRIFIWLGVHKVL  88

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            MTN+ER+RR  TS   C  C   EE I H + DC
Sbjct  89   MTNVERQRRHLTSSGVCEVCRGSEETIMHILWDC  122



>ref|XP_007023195.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY25817.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=874

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +2

Query  26   YWKLDCTGRCSVSSAYT-IATKGEGG--EHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            YW L  +G  ++SS Y  + +  +    E+N+ W  +W  K P ++   L+   HK+++T
Sbjct  552  YWALSPSGYFTISSTYEHLGSLADSTREENNKMWHLVWDWKGPHRVCLFLFFCLHKRILT  611

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            N ER RR  +SDA CP C   EE   H +RDC
Sbjct  612  NAERVRRKMSSDASCPHCYGVEETCLHVLRDC  643



>ref|XP_010520746.1| PREDICTED: putative ribonuclease H protein At1g65750 [Tarenaya 
hassleriana]
Length=451

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/95 (33%), Positives = 48/95 (51%), Gaps = 0/95 (0%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            + LYW     G+C+V SAY           +  W  IWK   P +I   LW+  + +L+T
Sbjct  309  DRLYWCSSRDGKCTVKSAYNSLLPDNITSSHTIWSVIWKWGDPERIRTFLWLACNNRLLT  368

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            N+ R +R  +S  +CP     +E + H +RDC+ A
Sbjct  369  NMARFKRNLSSSGQCPLGCPSDESVLHVLRDCSVA  403



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = +2

Query  17    EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRT--WKTIWKLKVPRKISNVLWILKHKKL  190
             + + W     G  SV SAY + TK E    N    +  +W++ VP ++   LW++ H+ +
Sbjct  1467  DRMSWGGSKDGLFSVKSAYALLTKDEKPRPNMNAFYDRVWRVIVPERVRVFLWLVSHQVI  1526

Query  191   MTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             MTN+ER+RR  + +  C  C +  E I H +RDC  +
Sbjct  1527  MTNMERKRRHLSDNGMCQLCKSGNETILHTLRDCPAS  1563



>ref|XP_010670869.1| PREDICTED: uncharacterized protein LOC104887816 [Beta vulgaris 
subsp. vulgaris]
Length=1295

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 47/93 (51%), Gaps = 0/93 (0%)
 Frame = +2

Query  23    LYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
             LYW  D  G+ S+ SA  I  K      ++ W  +WK  V +++   +W++ H +L+ N 
Sbjct  954   LYWDGDPKGKFSIKSAIRIIRKESTEFQDQLWNLVWKASVQQRVRAFMWLVCHDRLLGNA  1013

Query  203   ERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
              R +R  T D +C  C +  E   H +RDC  A
Sbjct  1014  NRFKRNLTDDPKCFVCGDFVESTLHILRDCPAA  1046



>ref|XP_004299997.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=448

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = +2

Query  2    EETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKH  181
            E++  ++L WK    G  SV SAY I++       +  WK +WKL    K+    W + H
Sbjct  78   EDSGNDQLIWKATSNGVFSVKSAY-ISSFDMAEPQHHYWKVVWKLNCLPKLKTFFWTVLH  136

Query  182  KKLMTNLERRRRGFTSDARCPQCANHEEDI  271
            KK++TN++R RR FT+ A CP C + +E +
Sbjct  137  KKILTNVQRVRRRFTTSAVCPICNSADESL  166



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  23    LYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
             L W    TG  +VSSAY++    +G + +  W  IW+     KI   +W +    LM N+
Sbjct  1008  LSWPHSTTGMVTVSSAYSLIAGHDGDDRSHDW--IWRATCTEKIKLFMWKIVKNGLMVNV  1065

Query  203   ERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             ER+RRG    A CP C   +E + H  R C
Sbjct  1066  ERKRRGLADAASCPVCGEEDETLDHLFRRC  1095



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +2

Query  23    LYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
             L W    TG  +VSSAY++    +G + +  W  IW+     KI   +W +    LM N+
Sbjct  1008  LSWPHSTTGMVTVSSAYSLIAGHDGDDRSHDW--IWRATCTEKIKLFMWKIVKNGLMVNV  1065

Query  203   ERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             ER+RRG    A CP C   +E + H  R C
Sbjct  1066  ERKRRGLADAASCPVCGEEDETLDHLFRRC  1095



>ref|XP_009126860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851737 
[Brassica rapa]
Length=1638

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/97 (32%), Positives = 51/97 (53%), Gaps = 2/97 (2%)
 Frame = +2

Query  17    EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRT--WKTIWKLKVPRKISNVLWILKHKKL  190
             + + W     G  SV +AY   TK      N    +  +W++  P ++   LW++ H+ +
Sbjct  1431  DRMSWGEAKDGLFSVKAAYAFLTKDAVPRPNMEDLYSRVWRVTAPERVRVFLWLVTHQVI  1490

Query  191   MTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             MTN+ER+RR  + +  CP C + +E I H +RDC  A
Sbjct  1491  MTNMERKRRHISENGTCPLCKSGDETILHVLRDCPAA  1527



>gb|AID60103.1| hypothetical protein [Brassica napus]
Length=620

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/97 (32%), Positives = 51/97 (53%), Gaps = 2/97 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRT--WKTIWKLKVPRKISNVLWILKHKKL  190
            + + W     G  SV +AY   TK      N    +  +W++  P ++   LW++ H+ +
Sbjct  253  DRMSWGEAKDGLFSVKAAYAFLTKDAVPRPNMEDLYSRVWRVTAPERVRVFLWLVTHQVI  312

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            MTN+ER+RR  + +  CP C + +E I H +RDC  A
Sbjct  313  MTNMERKRRHISENGTCPLCKSGDETILHVLRDCPAA  349



>ref|XP_008237302.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=394

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WK    G  SV SAY +  +G     +  W  +WKL++P K+    W++   K+++N +R
Sbjct  33   WKFSSNGIFSVKSAYNMVFEGSTCS-DVAWTFLWKLRIPPKLHIFFWLVFQGKILSNEQR  91

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             RR  + DA C  C    E I H +RDC +A
Sbjct  92   VRRQLSLDASCGSCHWPMESILHILRDCVKA  122



>ref|XP_008225764.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=346

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 47/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WK    G  SV SAY++   G     +  WK++W L VP K+   +W+    K+++N +R
Sbjct  83   WKGSTNGDFSVKSAYSLFFGG-CSTPDSCWKSLWSLNVPPKLQYFMWLASQGKILSNDQR  141

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             RR   SD  C  C+   E + H +RDC  A
Sbjct  142  VRRQLASDPSCGFCSWPTETVLHILRDCERA  172



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 43/88 (49%), Gaps = 2/88 (2%)
 Frame = +2

Query  29    WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
             W    TG  +VSSAY++    +G   +  W  IW+     KI   +W +    LM N+ER
Sbjct  1542  WPHSTTGMVTVSSAYSLIAGHDGDGRSHDW--IWRATCTEKIKLFMWKIVKNGLMVNVER  1599

Query  209   RRRGFTSDARCPQCANHEEDITHCIRDC  292
             +RRG    A CP C   +E + H  R C
Sbjct  1600  KRRGLADAASCPVCGEEDETLDHLFRRC  1627



>ref|XP_009144970.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=448

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNR--TWKTIWKLKVPRKISNVLWILKHKKL  190
            + + W     G  +V SAYT  T+      N    ++ +W +  P ++   LW++ H+ +
Sbjct  81   DRMSWGESKDGLFTVKSAYTFLTRNTVPRPNMEALYRRVWSVINPERVRVFLWLVTHQVI  140

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            MTN+ER+RR  + ++ CP C   +E I H +R+C  A
Sbjct  141  MTNMERKRRHLSENSVCPLCKGGDETILHVLRECPAA  177



>ref|XP_006490008.1| PREDICTED: uncharacterized protein LOC102624085 [Citrus sinensis]
Length=1635

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/95 (34%), Positives = 42/95 (44%), Gaps = 0/95 (0%)
 Frame = +2

Query  17    EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
             +  +W     G  SV SAY +     G   +  W  +W  K P  I   LW+L H +L T
Sbjct  1454  DSFFWGASSNGNFSVKSAYELLDDPIGNGDHSFWCLVWSWKGPHSIRVFLWLLLHGRLKT  1513

Query  197   NLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
               E  RR      +C +C    EDI H +RDC  A
Sbjct  1514  KKELNRRHLIDSTQCDRCGGPVEDILHTLRDCVTA  1548



>ref|XP_008228034.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=751

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WK    G  SV SAY++   G     +  WK++W L VP K+   +W+    K+++N +R
Sbjct  539  WKGSTNGDFSVKSAYSLFFGG-CSTPDSCWKSLWSLNVPPKLQYFMWLASQGKILSNDQR  597

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDC  292
             RR   SD  C  C+   E + H +RDC
Sbjct  598  VRRQLASDPSCGFCSWPTETVLHILRDC  625



>ref|XP_008242678.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=390

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 47/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WK    G  SV SAY++   G     +  WK++W L VP K+   +W+    K+++N +R
Sbjct  83   WKGSTNGDFSVKSAYSLFFGG-CSTPDSCWKSLWSLNVPPKLQYFMWLASQGKILSNDQR  141

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             RR   SD  C  C+   E + H +RDC  A
Sbjct  142  VRRQLASDPSCGFCSWPTETVLHILRDCERA  172



>emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1378

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 2/102 (2%)
 Frame = +2

Query  2     EETFIEELYWKLDCTGRCSVSSAYTIATKGE--GGEHNRTWKTIWKLKVPRKISNVLWIL  175
             +E  I+++YW    +G  ++ SA  I    E    + +  W  +WK+  P+++   +W+ 
Sbjct  1004  DEEAIDDIYWNGSPSGGFTIGSAMNITRNAELANMDAHPKWSAVWKIPTPQRVRFFIWLA  1063

Query  176   KHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                +LMTN  R  R  T D RC  C   EE+  H +R C  A
Sbjct  1064  IQDRLMTNSNRFLRRLTDDPRCLVCGEVEENTDHILRRCPVA  1105



>gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1231

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHN--RTWKTIWKLKVPRKISNVLWILKHKKL  190
            +E+ WK    G  +V SAY++     G   N    +  IWKL  P ++   +W++    +
Sbjct  868  DEISWKGTQDGAFTVRSAYSLLQGDVGDRPNMGSFFNRIWKLITPERVRVFIWLVSQNVI  927

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            MTN+ER RR  + +A C  C   EE I H +RDC
Sbjct  928  MTNVERVRRHLSENAICSVCNGAEETILHVLRDC  961



>ref|XP_006605054.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=204

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 52/96 (54%), Gaps = 6/96 (6%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTW--KTIWKLKVPRKISNVLWILKHKKL  190
            +E  WK   TG+ SV SAY +  KG   E +  W  K +WK++VP KI+   W L  ++L
Sbjct  43   DEWIWKTYPTGQYSVRSAYNML-KGVDVEEDNVWVFKELWKIRVPTKITIFAWKLLKERL  101

Query  191  M--TNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
               TNL RRRR   +D  CP C N EE+  H    C
Sbjct  102  QTKTNL-RRRRVAINDTLCPFCGNSEENEAHVFLTC  136



>ref|XP_007220772.1| hypothetical protein PRUPE_ppa026532mg [Prunus persica]
 gb|EMJ21971.1| hypothetical protein PRUPE_ppa026532mg [Prunus persica]
Length=334

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WK    G  S  SAY +A   E    + +W  IW +K P KI   LW+L+  KL+TN +R
Sbjct  104  WKRTTNGSFSAKSAY-MANCQESSSMDVSWAFIWNIKAPPKIKYFLWLLQQDKLLTNYQR  162

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDC  292
             +R  T  A    C    E+ TH IR+C
Sbjct  163  VKRKMTMTANFDICGVPMENATHIIRNC  190



>ref|XP_007031938.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOY02864.1| Ribonuclease H protein [Theobroma cacao]
Length=660

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/95 (33%), Positives = 49/95 (52%), Gaps = 3/95 (3%)
 Frame = +2

Query  26   YWKLDCTGRCSVSSAYTIATKGEGGEHNR---TWKTIWKLKVPRKISNVLWILKHKKLMT  196
            YW    +G+ +V+S Y    +       R    W+  WK +  +++   L+   H +L+T
Sbjct  292  YWGESASGQFTVASVYDYLRQLSSPAKARPSGIWQGAWKWQGSQRVRTFLFQCLHGRLLT  351

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            N ER  R  T+D+ CPQC   +E +TH +RDC  A
Sbjct  352  NRERLHRQLTTDSLCPQCRMEDETVTHVLRDCMVA  386



>ref|XP_008228450.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=318

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/83 (40%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            W+    G+ SV ++Y+     EG   N  W  IWKL V  K+   LW+L HKKL+TN +R
Sbjct  203  WQATSNGQFSVKTSYSTFYLDEGSV-NWKWDFIWKLHVSPKVKTFLWLLCHKKLLTNAQR  261

Query  209  RRRGFTSDARCPQCANHEEDITH  277
             +R  T+ A CP+C    E   H
Sbjct  262  LKRKLTNAAVCPRCDCPLESCDH  284



>gb|AAC26674.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=970

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 49/95 (52%), Gaps = 4/95 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEH---NRTWKTIWKLKVPRKISNVLWILKHKK  187
            +EL WK    G  +V SAY +  K E  E        K IWKL  P ++   +W++ H  
Sbjct  609  DELSWKGTQNGDFTVRSAYEL-LKPEAEERPLIGSFLKQIWKLVAPERVRVFIWLVSHMV  667

Query  188  LMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            +MTN+ER RR  +  A C  C   +E I H +RDC
Sbjct  668  IMTNVERVRRHLSDIATCSVCNGADESILHVLRDC  702



>gb|EEC79285.1| hypothetical protein OsI_20087 [Oryza sativa Indica Group]
 gb|EEC79286.1| hypothetical protein OsI_20088 [Oryza sativa Indica Group]
Length=216

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 43/103 (42%), Gaps = 15/103 (15%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATK---------GEGGEHNRT------WKTIWKLKVPRKISNV  163
            W  D  G  SV SAY +A +           G   N +      W+ IW ++VP KI   
Sbjct  64   WHFDSKGLFSVKSAYKLAVQIREKEKCRDASGSSLNTSHADTLQWEKIWNMEVPNKIKMF  123

Query  164  LWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            +W L H  L      RRRG  SD  CP C   +ED  H    C
Sbjct  124  VWRLAHNSLPVRCNIRRRGMESDNLCPMCNRFDEDCGHLFLKC  166



>ref|XP_010689711.1| PREDICTED: uncharacterized protein LOC104903385 [Beta vulgaris 
subsp. vulgaris]
Length=1533

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/95 (35%), Positives = 45/95 (47%), Gaps = 0/95 (0%)
 Frame = +2

Query  17    EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
             ++L W     G  SV +AY +   G   + +R W  IW L+V  K+ + LW +    L  
Sbjct  1181  DKLTWAYSKDGLYSVKTAYMLGKGGNLEDFHRVWGLIWSLEVSPKVRHFLWRVCTNSLPV  1240

Query  197   NLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                 +RR  T D  CP+CA  EE   H   DCT A
Sbjct  1241  RAALKRRHLTDDDSCPRCACGEESAQHVFFDCTHA  1275



>ref|XP_006574315.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=130

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 1/91 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WK    G  +V SA + A        +  +K IWK + P +I  +LW + +K ++TN  R
Sbjct  34   WKYTANGEFTVKSA-SCAISSIDEVIDLLFKGIWKWQGPERIKILLWKMANKGILTNQAR  92

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             RRG T  A  P C  ++E I+HC+RD   A
Sbjct  93   LRRGMTDTALFPICNKNDESISHCLRDLKYA  123



>gb|ABE80133.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=282

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 49/98 (50%), Gaps = 7/98 (7%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTI---ATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKK  187
            + + W    T + +V SAY +    +   GGE    WKT+W  K P +I   +W+  + +
Sbjct  25   DTIGWGGTNTLQFTVQSAYNLQQETSFAVGGE----WKTLWNWKGPHRIQTFIWLAANGR  80

Query  188  LMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            ++TN  R + G      CP CA  +E I H +RDC  A
Sbjct  81   ILTNYRRSKWGVGISPTCPCCAREDETIIHVLRDCVHA  118



>ref|XP_007042183.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOX98014.1| Ribonuclease H protein [Theobroma cacao]
Length=528

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/95 (32%), Positives = 50/95 (53%), Gaps = 3/95 (3%)
 Frame = +2

Query  26   YWKLDCTGRCSVSSAYTIATKGEGGEHNR---TWKTIWKLKVPRKISNVLWILKHKKLMT  196
            YW    +G+ +++SAY    +       R    W+  WK +  +++   L+   H +L+T
Sbjct  76   YWGKSASGQFTIASAYDYLRQLSSPTKARPSGIWQGAWKWQGSQRVRTFLFQCLHGRLLT  135

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            N +R  R  T+D+ CPQC   +E +TH +RDC  A
Sbjct  136  NRKRLHRQLTADSLCPQCRMEDETVTHVLRDCMVA  170



>ref|XP_006577374.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=271

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 51/95 (54%), Gaps = 4/95 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTW--KTIWKLKVPRKISNVLWILKHKKL  190
            +E  WK + +G+ SV SAY +  KG   E +  W  + +WK++VP KI+   W L  ++L
Sbjct  65   DEWIWKTEPSGQYSVRSAYNM-LKGVDVEEDNVWMFEELWKIRVPTKITIFAWRLLKERL  123

Query  191  MTNLE-RRRRGFTSDARCPQCANHEEDITHCIRDC  292
             T    RRRR   SD  CP C N EE+  H    C
Sbjct  124  QTKTSLRRRRVAISDTLCPFCGNSEENEAHVFFIC  158



>gb|ABW81175.1| non-LTR retrotransposon transposase [Arabidopsis cebennensis]
Length=799

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/94 (32%), Positives = 49/94 (52%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEG--GEHNRTWKTIWKLKVPRKISNVLWILKHKKL  190
            + L W     G+ +V SAY+   K      + +R +  +WK+  P ++   LW+  H+ +
Sbjct  432  DRLSWGESLDGKFTVKSAYSSLMKDNTPRSDLSRMYDRVWKVIAPERVKIFLWLGVHQVI  491

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            MTN+ER+RR  +    C  C   +E I H +RDC
Sbjct  492  MTNMERQRRHLSDTGICQVCKGGDETIIHILRDC  525



>gb|ABD33209.1| Ribonuclease H [Medicago truncatula]
Length=302

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 28/91 (31%), Positives = 47/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            W+   T +  V SAY +  + +    +  WK +W+ + P +I   +W++ H +++TN  R
Sbjct  50   WRGTSTHQFIVKSAYNLLVRDQS-TVDGDWKMLWEWRGPHRIQTFMWLVAHGRILTNYRR  108

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             R G    A  P C N +E + H +RDC  A
Sbjct  109  SRWGTGVSATWPCCGNADETVLHVLRDCRPA  139



>gb|AAF23831.1|AC007234_3 F1E22.12 [Arabidopsis thaliana]
Length=1055

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/94 (33%), Positives = 49/94 (52%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRT--WKTIWKLKVPRKISNVLWILKHKKL  190
            + L WK    G+ SV SAY + T  E    N    +  +WK++VP ++   LW++ ++ +
Sbjct  362  DRLSWKFSQDGQFSVRSAYEMLTVDEVPRPNMASFFNCLWKVRVPERVKTFLWLVGNQAV  421

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            MT  ER RR  ++   C  C    E + H +RDC
Sbjct  422  MTEEERHRRHLSASNVCQVCKGGVESMLHVLRDC  455



>ref|XP_008351723.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=678

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
            + WK    G  SV SAY +A+  +    + +W  IWKLK+P ++ + LW+  H +L+ N 
Sbjct  464  IIWKHSNDGNFSVKSAY-LASIDDEDFVDWSWSDIWKLKLPPRVLHFLWLTLHGRLLCNE  522

Query  203  ERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +R +R  T ++ C  C    E I H +R C  A
Sbjct  523  QRAKRXITDNSYCDFCDGCVESIDHILRRCDRA  555



>gb|KHN30899.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=249

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 51/95 (54%), Gaps = 4/95 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTW--KTIWKLKVPRKISNVLWILKHKKL  190
            +E  WK + TG+ SV+SAY +   G   E +  W  + +WK++VP KI+   W L  ++L
Sbjct  70   DEWIWKAEPTGQYSVTSAYNMLN-GVDVEEDNGWMFEELWKIRVPTKITIFAWRLLKERL  128

Query  191  MTNLE-RRRRGFTSDARCPQCANHEEDITHCIRDC  292
             T    RRRR   +D  CP C N EE+  H    C
Sbjct  129  QTKANLRRRRVAINDPLCPFCGNSEENEAHVFLTC  163



>ref|XP_007030929.1| Uncharacterized protein TCM_026608 [Theobroma cacao]
 gb|EOY11431.1| Uncharacterized protein TCM_026608 [Theobroma cacao]
Length=212

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 47/92 (51%), Gaps = 3/92 (3%)
 Frame = +2

Query  26   YWKLDCTGRCSVSSAYTIATKGEGGEHNR---TWKTIWKLKVPRKISNVLWILKHKKLMT  196
            +W L  +G+ +V+SAY    K E    N    TW+  W+   P +I   L    H +L+ 
Sbjct  3    HWALPSSGQFTVASAYEYLRKQETLHLNSISGTWQWAWRWNGPERIRMFLLQCLHNRLLA  62

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            N ER RR  ++D  C QC   EE + H +RDC
Sbjct  63   NQERLRRHLSNDLICRQCNLEEESMLHALRDC  94



>gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis 
thaliana]
Length=732

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/94 (30%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHN--RTWKTIWKLKVPRKISNVLWILKHKKL  190
            + + W     GR  VS+ Y+  T+ E    +  R +  +W +  P ++   LW++  + +
Sbjct  530  DRISWGESQDGRFKVSTTYSFLTRDEAPRQDMKRFFDRVWSVTAPERVRLFLWLVAQQAI  589

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            MTN ER RR  ++   C  C   +E I H +RDC
Sbjct  590  MTNQERHRRHLSTTTICQVCKGAKESIIHVLRDC  623



>ref|XP_006584455.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=170

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 46/92 (50%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEH-NRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            W+ D +   +V S Y +  K    E+ +  +  +WK+KVP K+S  +W L   +L T + 
Sbjct  49   WREDASAAYTVGSTYKMLMKDHNDENQDGAFNALWKVKVPSKVSFFVWRLIKDRLPTRVN  108

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
              RR    +D  CP C N EED TH     T+
Sbjct  109  LHRRNVEINDPTCPFCTNQEEDATHVFLAATK  140



>gb|ABD28505.2| RNA-directed DNA polymerase (Reverse transcriptase); Polynucleotidyl 
transferase, Ribonuclease H fold [Medicago truncatula]
Length=729

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 49/98 (50%), Gaps = 7/98 (7%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGE---GGEHNRTWKTIWKLKVPRKISNVLWILKHKK  187
            + + W    T + +V SAY +  +     GG+    WKT+W  K P +I   +W+  H +
Sbjct  432  DTIGWGGTNTLKFTVQSAYNLQQENPFAVGGD----WKTLWNWKGPHRIQTFIWLAAHGR  487

Query  188  LMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            ++TN  R + G      CP CA  +E + H +RDC  +
Sbjct  488  ILTNYRRSKWGVGISPTCPCCAREDETVIHVLRDCVHS  525



>ref|XP_008367475.1| PREDICTED: uncharacterized protein LOC103431103 [Malus domestica]
Length=1108

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 50/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
            + WK    G  SV SAY +A+  +    + +W  IWKLK+P ++ + LW+  H +L+ N 
Sbjct  862  IIWKHSNDGNFSVKSAY-LASIDDEDFVDWSWSDIWKLKLPPRVLHFLWLTLHGRLLCNE  920

Query  203  ERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +R +R  T ++ C  C    E I H +R C  A
Sbjct  921  QRAKRXITDNSYCDFCDGCVESIDHILRRCDRA  953



>sp|P0C2F6.1|RNHX1_ARATH RecName: Full=Putative ribonuclease H protein At1g65750 [Arabidopsis 
thaliana]
Length=620

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/94 (33%), Positives = 49/94 (52%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRT--WKTIWKLKVPRKISNVLWILKHKKL  190
            + L WK    G+ SV SAY + T  E    N    +  +WK++VP ++   LW++ ++ +
Sbjct  253  DRLSWKFSQDGQFSVRSAYEMLTVDEVPRPNMASFFNCLWKVRVPERVKTFLWLVGNQAV  312

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            MT  ER RR  ++   C  C    E + H +RDC
Sbjct  313  MTEEERHRRHLSASNVCQVCKGGVESMLHVLRDC  346



>ref|XP_006492639.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=569

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 42/92 (46%), Gaps = 0/92 (0%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            + L+W    +GR +  SAY   +       +R W+ +W  K P+ +   LW + H +L T
Sbjct  140  DSLFWAHSKSGRFTTHSAYLALSNDTPMHDDRLWRMVWNWKGPQSVRIFLWQVFHDRLKT  199

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
              E  RR       C +C    ED  H +RDC
Sbjct  200  KAELARRHIPVSTSCDRCGAVNEDAMHVLRDC  231



>ref|XP_009123770.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=532

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/94 (31%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGG--EHNRTWKTIWKLKVPRKISNVLWILKHKKL  190
            + L W     G+ +V SAYT+ T+ E    +    ++++W++  P ++   LW++ ++ +
Sbjct  196  DRLAWGQTPNGQFTVKSAYTLLTRDENPRPQMGSFFRSMWRVVAPERVRMFLWLVANQAI  255

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            MTN ER RR  +    C  C    E I H +RDC
Sbjct  256  MTNAERHRRHLSGTDLCQVCRGGIETIIHVLRDC  289



>ref|XP_006480844.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=768

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 0/93 (0%)
 Frame = +2

Query  14   IEELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            ++++YW     G  +V SAY +  +  G E +  WK  W  K P+ I   +W++ H +L 
Sbjct  433  VDQVYWAASPQGDFTVKSAYDLLDQSRGQERDSYWKIAWSWKGPQSIKIFIWLVLHNRLK  492

Query  194  TNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            T  E   R    +  C +C    E+  H + DC
Sbjct  493  TRAELATRRLNIEPSCERCGAGLENTIHVLHDC  525



>ref|XP_008221992.1| PREDICTED: uncharacterized protein LOC103321917 [Prunus mume]
Length=658

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/88 (32%), Positives = 48/88 (55%), Gaps = 1/88 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            W L   G  SV SAY ++   +       W  +WKL +P+K+   +W++ H K++TN++R
Sbjct  409  WGLSNYGSFSVKSAY-LSLFDDADFEPWPWDFLWKLCLPQKLRTFVWLIGHGKILTNVQR  467

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDC  292
             +R  T++  C +C +  E + H  R C
Sbjct  468  EKRLMTTNLNCQKCLSIPETMDHVFRGC  495



>gb|EMT21706.1| NAC domain-containing protein 78 [Aegilops tauschii]
Length=1032

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/101 (31%), Positives = 42/101 (42%), Gaps = 13/101 (13%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGG-------------EHNRTWKTIWKLKVPRKISNVLW  169
            W  D  G  SV SAY + T+                 + ++ WK  W L +P  I   LW
Sbjct  725  WHFDTKGLFSVKSAYHLGTRLRDASKDTDASSSTVVPQASQRWKRFWSLSLPPNIRMFLW  784

Query  170  ILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             L HK L+  +  +R+    D RCP C   +ED  H    C
Sbjct  785  RLSHKSLLLRMNIKRKHVDLDTRCPMCLRLDEDGGHLFLKC  825



>ref|XP_006590133.1| PREDICTED: uncharacterized protein LOC102666308 [Glycine max]
Length=248

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 49/97 (51%), Gaps = 4/97 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGE--GGEHNRTWKTIWKLKVPRKISNVLWILKHKKL  190
            +  +WK D  G+ S  SAY +   GE  G      +K +WKLK+P K +   W L    L
Sbjct  45   DSWWWKPDPGGKFSSKSAYRMLW-GELTGTNQEAAFKDLWKLKIPPKAAVFAWRLIKDCL  103

Query  191  MTNLE-RRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
             T L   +R+   SD  CP C NHEED  H   +C++
Sbjct  104  PTKLNLSKRQVVLSDTMCPFCCNHEEDAAHLFFNCSK  140



>dbj|BAB09815.1| non-LTR retroelement reverse transcriptase-like [Arabidopsis 
thaliana]
Length=676

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/94 (32%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEH--NRTWKTIWKLKVPRKISNVLWILKHKKL  190
            +++ W     GR +VSSAY I +  E  +   +R +  +W++ VP +    LW++ ++ +
Sbjct  309  DKMSWVGTENGRFTVSSAYLIQSVDEISKQCMSRFFDRVWRVMVPERARIFLWLVGNQVV  368

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            +TN ER RR       CP C    E + H +RDC
Sbjct  369  LTNAERVRRHMADSDVCPLCKGASESLIHVLRDC  402



>ref|XP_008382267.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=377

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +2

Query  14   IEELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            ++++ W+    G  +V  AY +    E    +  W  IW++ VP K+   LW++   +L+
Sbjct  159  MDKIIWRCASNGVFTVKLAYNLFFDEEDLP-DSCWDFIWRVNVPPKLKVFLWLMSKGRLL  217

Query  194  TNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +N +R RR  TSD+ C  C    E I H  +DC+ A
Sbjct  218  SNEQRVRRQLTSDSSCMTCCGPIESIAHIFKDCSRA  253



>ref|XP_006575982.1| PREDICTED: uncharacterized protein LOC102663051 [Glycine max]
Length=308

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 49/97 (51%), Gaps = 2/97 (2%)
 Frame = +2

Query  8    TFIEELYWKLDCTGRCSVSSAYTI-ATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHK  184
            T ++ L WK+D +G  S  SAY I    G     +R +K IW LK+P +     W +   
Sbjct  128  TSMDSLIWKVDPSGAYSTKSAYNILKNDGRSVNDDRAFKIIWNLKIPPRAIAFCWRIFRN  187

Query  185  KLMTNLERRRRGFTSDA-RCPQCANHEEDITHCIRDC  292
            +L T    R+R  T  + RCP C + EEDI H +  C
Sbjct  188  RLPTKANLRKRHITLPSYRCPLCDSEEEDIGHIMFSC  224



>ref|XP_007212367.1| hypothetical protein PRUPE_ppa014776mg [Prunus persica]
 gb|EMJ13566.1| hypothetical protein PRUPE_ppa014776mg [Prunus persica]
Length=262

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WK    G  SV S+Y  A   +    + +W  IW LK   KI   LW+L   +L++N +R
Sbjct  104  WKHTSNGSFSVKSSYR-ANYQDFSNMDLSWAFIWTLKASPKIKYFLWLLHQDRLLSNEQR  162

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             R+  T  A C  C  H E++   IR+C  A
Sbjct  163  VRQRMTLHANCDICGAHVENMDRIIRNCLMA  193



>ref|XP_002461212.1| hypothetical protein SORBIDRAFT_02g042875 [Sorghum bicolor]
 gb|EER97733.1| hypothetical protein SORBIDRAFT_02g042875 [Sorghum bicolor]
Length=518

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 45/108 (42%), Gaps = 16/108 (15%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTI----------ATKGEGGEH------NRTWKTIWKLKVPRKI  154
            + W  D  G  SV SAY +            KGE          +R WK IW L+ P KI
Sbjct  145  IAWHYDPKGIFSVKSAYHVLEGVEEQKRQVQKGETSRQGACTSEDRLWKDIWHLQCPPKI  204

Query  155  SNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
               +W + H  L   +  +RR    D RCP C   +ED  HC   C +
Sbjct  205  KQFIWRVAHNSLAMKMNIKRRHVDLDTRCPVCLRLDEDGGHCFLKCKQ  252



>ref|XP_008223806.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=296

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = +2

Query  98   GEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITH  277
            G  +  WK IWKLK+P KI   LW++   K+++N +  R  F  D  C  C  H E   H
Sbjct  48   GGWSGWWKVIWKLKLPPKILFFLWLVYEGKIISNEQYTRMLFIGDPACCICDWHTESTLH  107

Query  278  CIRDCTEA  301
             +RDCT A
Sbjct  108  ILRDCTRA  115



>gb|EEE57938.1| hypothetical protein OsJ_08648 [Oryza sativa Japonica Group]
Length=521

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 44/105 (42%), Gaps = 16/105 (15%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTI---------------ATKGEGGEHNRTWKTIWKLKVPRKIS  157
            L W  D  G  SV SAY +                + GE G+ +  WK +WKL VP KI 
Sbjct  109  LAWHFDARGCFSVKSAYKVQREMERRASRNGCPGVSNGESGDDD-FWKKLWKLGVPGKIK  167

Query  158  NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            + LW + H  L        RG   D RC  C  + ED  H +  C
Sbjct  168  HFLWRMCHNTLALRANLHHRGMDVDTRCVMCGQYNEDAGHLLFKC  212



>gb|EEC74135.1| hypothetical protein OsI_09205 [Oryza sativa Indica Group]
Length=521

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 44/105 (42%), Gaps = 16/105 (15%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTI---------------ATKGEGGEHNRTWKTIWKLKVPRKIS  157
            L W  D  G  SV SAY +                + GE G+ +  WK +WKL VP KI 
Sbjct  109  LAWHFDARGCFSVKSAYKVQREMERRASRNGCPGVSNGESGDDD-FWKKLWKLGVPGKIK  167

Query  158  NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            + LW + H  L        RG   D RC  C  + ED  H +  C
Sbjct  168  HFLWRMCHNTLALRANLHHRGMDVDTRCVMCGQYNEDAGHLLFKC  212



>ref|XP_006469117.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=491

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 41/92 (45%), Gaps = 0/92 (0%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            ++ +W     G  SV SAY   TK E G  +  W   WK K P ++   +W+  H +L T
Sbjct  243  DKFFWANSQRGDFSVKSAYMAITKNEIGIEHSRWNIAWKWKGPPRVQTFIWLALHDRLKT  302

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
              E  RR    D  C  C    E   H +RDC
Sbjct  303  KAEIGRRHIHIDWTCDHCGVASETTLHVLRDC  334



>ref|XP_006469101.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=684

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 0/93 (0%)
 Frame = +2

Query  14   IEELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            +++L+W+ +  G  +V SAY    + +  +    WK  W  K P+ +   LW   H KL 
Sbjct  347  VDKLFWRYEPRGNFTVRSAYEALCQLDSNDTGTAWKLAWTWKGPQAVRIFLWQALHAKLK  406

Query  194  TNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            T  E  RR       C +C    ED+ H +RDC
Sbjct  407  TKEELSRRHIPISIGCERCGAPIEDVIHVLRDC  439



>ref|XP_002461200.1| hypothetical protein SORBIDRAFT_02g042745 [Sorghum bicolor]
 gb|EER97721.1| hypothetical protein SORBIDRAFT_02g042745 [Sorghum bicolor]
Length=230

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 41/93 (44%), Gaps = 2/93 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            +   WK    G  S SSAY     G  G     +   WK  VP K+    W+  H +L T
Sbjct  36   DRFVWKWTADGSYSASSAYRAFFLGRVGMEGVMFA--WKAMVPSKMKFFFWLALHGRLWT  93

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
               RRR G  ++A C  C+ H+E + H +  C 
Sbjct  94   AERRRRHGLRAEAACALCSQHDETVDHLLIACV  126



>ref|XP_007207072.1| hypothetical protein PRUPE_ppa026284mg, partial [Prunus persica]
 gb|EMJ08271.1| hypothetical protein PRUPE_ppa026284mg, partial [Prunus persica]
Length=349

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +2

Query  125  IWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +WK+  P K+ + LW + H+KL+TN  R   G + DA CP+C+   ED+ H  R+C+E+
Sbjct  115  LWKINAPPKVLHFLWKVCHRKLLTNSHRIHIGLSFDASCPRCSCICEDLNHLFRNCSES  173



>ref|XP_006593063.1| PREDICTED: uncharacterized protein LOC102668081 [Glycine max]
Length=223

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 49/95 (52%), Gaps = 2/95 (2%)
 Frame = +2

Query  20   ELYWKLDCTGRCSVSSAYTIATK-GEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            E  WK   +G+ +V SAY + T+    GE +R ++ +W LKV  K++   W L   +L T
Sbjct  21   EWVWKEYQSGKFTVQSAYKLLTREAVEGERDRAFEELWNLKVLSKVAVFAWRLLRDRLPT  80

Query  197  NLERRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
             +   RR    +D  CP C N EED  H    C++
Sbjct  81   KVNLYRRQVEVADTSCPFCGNMEEDAGHLFFHCSK  115



>ref|XP_002531038.1| hypothetical protein RCOM_0755060 [Ricinus communis]
 gb|EEF31355.1| hypothetical protein RCOM_0755060 [Ricinus communis]
Length=216

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 43/91 (47%), Gaps = 0/91 (0%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            +++ W     G  S  S Y           N  W+ IWK K P+ + + LW+  H++L+T
Sbjct  47   DQVVWNHSANGIHSSKSVYERIRNVMSSSSNGIWEKIWKWKGPQGVRSTLWLTSHERLVT  106

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRD  289
            +    +R       CP+C  HEED  H IRD
Sbjct  107  SSLCVKRLILPSLVCPRCYEHEEDTLHAIRD  137



>gb|KHN25580.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=175

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 49/97 (51%), Gaps = 4/97 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAY-TIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            + L WK D TG  S  SAY  ++ +       R ++ IWKLK+P K +   W L   +L 
Sbjct  5    DTLLWKADPTGIYSTRSAYRLLSNQNTSASDGRNFQLIWKLKIPPKAAIFTWRLIKDRLP  64

Query  194  T--NLERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
            T  NL+RR  G   ++ CP C   +E+  H    CT+
Sbjct  65   TRANLQRRNVGL-QESICPLCHEEQEEAGHLFFHCTQ  100



>ref|XP_006493637.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=246

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 0/95 (0%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            + +YW    +   + +SAY   +K E       W+ +W+ + P+ I   LW++   +L T
Sbjct  138  DYMYWAYSKSEDFTTNSAYRALSKMEVHNEESFWRILWQWRGPQHIKTFLWVVGQNRLKT  197

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
              E  RR    D  C +C    E+  H +RDC  A
Sbjct  198  KAELFRRHIVDDMSCAKCGCVVENTLHVLRDCPSA  232



>ref|XP_006493638.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=360

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 0/95 (0%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            + +YW    +   + +SAY   +K E       W+ +W+ + P++I   LW++   +L T
Sbjct  252  DYMYWAYSKSEDFTTNSAYRALSKMEVHNEESFWRILWQWRGPQRIKTFLWVVGQNRLKT  311

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
              E  RR    D  C +C    E+  H +RDC  A
Sbjct  312  KAELFRRHIVDDMSCAKCGCVVENTLHVLRDCPSA  346



>ref|XP_004959141.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Setaria 
italica]
Length=950

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 47/107 (44%), Gaps = 17/107 (16%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIAT----------KGEG------GEH-NRTWKTIWKLKVPRK  151
            + W  D  G  SV SAY +            +GE       G+H  + WK +WKL  P K
Sbjct  576  IAWHHDRKGMFSVRSAYHMLVDEERRQRKYQQGESSVCCREGDHETQKWKKLWKLPCPPK  635

Query  152  ISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            + + +W L H  L      +RRG   D RCP C   +ED  HC   C
Sbjct  636  VRHFIWRLAHNSLPLKQNIKRRGVFLDTRCPVCMRFDEDGGHCFLKC  682



>gb|KHN40328.1| Putative ribonuclease H protein [Glycine soja]
Length=175

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 41/88 (47%), Gaps = 2/88 (2%)
 Frame = +2

Query  44   TGRCSVSSAYT--IATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRR  217
            +G  +  SAY   I            W  +WKL+ P  I +  W++    L TN  R +R
Sbjct  59   SGIFTAKSAYEWWIHEPANHSNFPGDWNWVWKLQTPENIKHFTWLILQNSLPTNFFRTKR  118

Query  218  GFTSDARCPQCANHEEDITHCIRDCTEA  301
              + D  C +C   +E I H +RDC+EA
Sbjct  119  HISFDPFCCRCGLEDESIIHLLRDCSEA  146



>gb|EEC72418.1| hypothetical protein OsI_05729 [Oryza sativa Indica Group]
Length=1067

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/108 (31%), Positives = 49/108 (45%), Gaps = 11/108 (10%)
 Frame = +2

Query  2    EETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEH--------NRTWKTIWKLKVPRKIS  157
            +E FI    W  D  GR SV SAY +A   +  E         +R W  IWK +VP+K+ 
Sbjct  553  DEDFIA---WHPDLHGRFSVRSAYYLALNLKNQEDTGPSNMAGDRRWDLIWKCEVPQKVR  609

Query  158  NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +  W +    L T   + +R     A C  C +  ED  H +  C+++
Sbjct  610  SFAWKVATDSLATMANKTKRKLERIATCGVCGSETEDTQHALLRCSQS  657



>ref|XP_002534238.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28145.1| conserved hypothetical protein [Ricinus communis]
Length=307

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +2

Query  116  WKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
            W+ +WK   P+ I   LW++  +KL+TN+E  +R  T+D  C +C+   ED+ H +RDC 
Sbjct  71   WRYVWKWDSPQGIRMFLWLVVWEKLLTNVECHKRHLTNDTSCARCSAANEDVLHALRDCP  130

Query  296  EA  301
            + 
Sbjct  131  KV  132



>ref|XP_006599881.1| PREDICTED: uncharacterized protein LOC102663605 [Glycine max]
Length=214

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 47/95 (49%), Gaps = 8/95 (8%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATKGEGGEH----NRTWKTIWKLKVPRKISNVLWILKHKKL  190
            L+WK D  G  S  SAY +    +G  H    +    T+WKLK+P K+S   W L   +L
Sbjct  22   LWWKPDPNGLFSTRSAYKVL---QGAHHSVSQDNVLNTMWKLKIPPKVSAFSWRLLKNRL  78

Query  191  MTNLERRRRGFTSDA-RCPQCANHEEDITHCIRDC  292
             +    R+R  T  +  CP C + EE I H I +C
Sbjct  79   PSRDNLRKRQVTMPSYSCPLCDHEEESINHLIFNC  113



>ref|XP_002518907.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43440.1| conserved hypothetical protein [Ricinus communis]
Length=210

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 34/65 (52%), Gaps = 0/65 (0%)
 Frame = +2

Query  107  NRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIR  286
            N  W  IWK + P+K+ + LW+L H KL TN    +R     A C  C   EED  H IR
Sbjct  90   NIVWDRIWKWQGPQKVHSTLWLLAHDKLSTNKLCSQRAIIPLAICMHCNQSEEDSLHAIR  149

Query  287  DCTEA  301
            DC  A
Sbjct  150  DCPFA  154



>ref|XP_002444973.1| hypothetical protein SORBIDRAFT_07g002160 [Sorghum bicolor]
 gb|EES14468.1| hypothetical protein SORBIDRAFT_07g002160 [Sorghum bicolor]
Length=469

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 40/107 (37%), Gaps = 15/107 (14%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATK----------GEGGEH-----NRTWKTIWKLKVPRK  151
            + L W  D  G  SV SAY + T           GE         N  W  IWKL  P K
Sbjct  164  DTLAWHYDPKGDFSVKSAYHVLTDMKELSKRRQIGEASASLISPCNNNWHKIWKLHCPPK  223

Query  152  ISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            +    W   H  L   +   RRG   D RCP C    ED  HC   C
Sbjct  224  VKLFFWRFTHNSLPLRMNILRRGMDIDTRCPVCWRLNEDGGHCFLRC  270



>gb|KHN24962.1| Putative ribonuclease H protein [Glycine soja]
Length=213

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 45/93 (48%), Gaps = 4/93 (4%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNR--TWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
            WK D  G  S  SAY +  +GE  E N    +  +WKL++  K S   W L   +L T  
Sbjct  2    WKPDPNGHYSTKSAYNL-LQGETAEENLDGAFADLWKLRISTKTSIFAWRLIRDRLPTKS  60

Query  203  ERRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
              RRR    SD  CP C N EED  H   +CT+
Sbjct  61   NLRRRHVEVSDLMCPFCRNKEEDAVHLFFNCTK  93



>ref|XP_007049342.1| Ribonuclease H protein [Theobroma cacao]
 gb|EOX93499.1| Ribonuclease H protein [Theobroma cacao]
Length=369

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  116  WKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
            W+  WK + P+++   L+   H +L+TN ER RR  T D+  PQC   +E +TH +RDC 
Sbjct  234  WQGAWKWQGPQRVRTFLFQCLHGRLLTNRERLRRRLTIDSLSPQCKMEDETMTHVLRDCM  293

Query  296  EA  301
             A
Sbjct  294  VA  295



>ref|XP_008382509.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=350

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 2/93 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            +++ W L  +G  SV +AY ++   +       W  IWKLK+P K+   LW + + K++T
Sbjct  45   DKIIWSLTNSGTLSVKTAY-LSLFSDDDIIPWKWNFIWKLKLPPKLVTFLWTIGYGKMLT  103

Query  197  NLER-RRRGFTSDARCPQCANHEEDITHCIRDC  292
            N++R ++    +D  CP C   EE + H  R C
Sbjct  104  NVQRAKKXXLQNDPCCPICPTVEESMDHIFRYC  136



>ref|XP_004295896.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=312

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 37/74 (50%), Gaps = 1/74 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            W     G+ SV  AY  +        N  W  +W   +P K+   LW L HKKL+TN++R
Sbjct  45   WNSTSNGQFSVKCAYN-SLFDLSEPVNPQWSALWNFDLPPKLKTFLWTLLHKKLLTNVQR  103

Query  209  RRRGFTSDARCPQC  250
              RGF S+  CP C
Sbjct  104  VTRGFASNPACPIC  117



>ref|XP_006584399.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=470

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 42/88 (48%), Gaps = 1/88 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            W  +  G   V+S Y      +    +  W  IWK+K P +I   +W + H++L+TN   
Sbjct  109  WTGNKLGEYFVASGYNQVNGFQNLSQSHIWNKIWKIKAPERIKVFIWQVTHERLLTNSCI  168

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDC  292
              RG    A C  C   EE+I H +RDC
Sbjct  169  AHRG-NGQASCHHCVILEENILHVLRDC  195



>ref|XP_009124282.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1011

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/94 (30%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTW--KTIWKLKVPRKISNVLWILKHKKL  190
            + L W     G+ +V SAY + T+ +    N  +  + +W +  P ++   LW++ ++ +
Sbjct  644  DRLAWSQTNNGQFTVKSAYALITRDDAPRPNMEYLFRRMWHVVAPERVRMFLWLVGNQAI  703

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            MTN ER RR  +    C  C    E I H +RDC
Sbjct  704  MTNAERYRRHLSGTDVCQVCKGGIETILHVLRDC  737



>ref|XP_006573981.1| PREDICTED: uncharacterized protein LOC102660005 [Glycine max]
Length=266

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 46/92 (50%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGE-GGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK D +G  S  SAY +  +   G   +RT+  +W LK+P K     W L   +L T   
Sbjct  69   WKADPSGNYSTKSAYRLLMEATTGAVEDRTFVELWNLKIPLKAIVFTWRLIKDRLPTRTN  128

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
             R R    +D+RCP C + +ED TH    CT+
Sbjct  129  LRTRQVELNDSRCPLCNSPDEDATHLFFYCTK  160



>ref|XP_006595330.1| PREDICTED: uncharacterized protein LOC102665220 [Glycine max]
Length=206

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 49/93 (53%), Gaps = 4/93 (4%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATK-GEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKL--MTN  199
            WK D +G  S  S Y +  +   G E +R    +W LK+P K +   W L   +L   TN
Sbjct  69   WKADPSGNYSTKSEYRLLMEVTTGAEEDRNLVELWNLKIPLKQTVFAWRLIKDQLPTWTN  128

Query  200  LERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
            L R R+   +D+RCP C + +ED+TH    CT+
Sbjct  129  L-RTRQVELNDSRCPLCNSLDEDVTHLFFYCTK  160



>gb|AEL30350.1| RNA-directed DNA polymerase [Arachis hypogaea]
Length=673

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 37/69 (54%), Gaps = 0/69 (0%)
 Frame = +2

Query  95   GGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDIT  274
            G E    W  +W   VP K   + W+   + L T   R RRG +S  RCP+C + +E + 
Sbjct  359  GWEERENWLWLWCQLVPEKHKFLAWLCLKEALPTASFRFRRGMSSSDRCPRCLSSQESVI  418

Query  275  HCIRDCTEA  301
            HCIRDC +A
Sbjct  419  HCIRDCPKA  427



>ref|XP_007048991.1| Uncharacterized protein TCM_001997 [Theobroma cacao]
 gb|EOX93148.1| Uncharacterized protein TCM_001997 [Theobroma cacao]
Length=523

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
            +YW+L  +G  SV +AY +  + E    +  W  +W+L  PRK+   LW L H  L    
Sbjct  360  VYWRLTSSGIFSVKTAYDVQMEKETPTES-FWDQLWRLPSPRKVRVFLWRLIHDSLPIAD  418

Query  203  ERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                R   S   C +C    EDI H ++DC  A
Sbjct  419  WLISRNLGSSTTCFRCGACMEDILHALKDCRSA  451



>ref|XP_006589028.1| PREDICTED: uncharacterized protein LOC100815879 [Glycine max]
Length=252

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHN-RTWKTIWKLKVPRKISNVLWILKHKKLM  193
            ++  W+ D +GR SV SAY++  +    E     +K +WKLKVP K++   W L + +L 
Sbjct  45   DQWVWEADLSGRYSVKSAYSVLRQDVLEEAPAEEFKELWKLKVPSKVAMFAWRLLNDRLP  104

Query  194  TNLERRRRGF-TSDARCPQCANHEEDITHCIRDCTEA  301
            T    RR+    +D  CP C++ EE  +H    C++ 
Sbjct  105  TKDNWRRKQVELNDYLCPFCSSVEESASHLFFHCSKV  141



>ref|XP_002462405.1| hypothetical protein SORBIDRAFT_02g025125 [Sorghum bicolor]
 gb|EER98926.1| hypothetical protein SORBIDRAFT_02g025125 [Sorghum bicolor]
Length=457

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 35/100 (35%), Positives = 44/100 (44%), Gaps = 9/100 (9%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGE---------GGEHNRTWKTIWKLKVPRKISNVLWILKH  181
            W+ +  G  SV SAY +  KG          GG  N  W  IWKLKVP K+    W + H
Sbjct  139  WEPEKHGVYSVKSAYRLIDKGRTNGGHQEAVGGSGNSCWSEIWKLKVPPKVKVFWWRVLH  198

Query  182  KKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            + L T L   R+     A C  C    E I H + +C  A
Sbjct  199  EFLPTRLALHRKHIEPIANCDACGADSESIQHVLMECQIA  238



>gb|KHN01923.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=302

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIA-TKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            + + WK D  G  S  SAY +       G+H+R +K +WKLK+P +     W L   +L 
Sbjct  112  DSMLWKADPIGIYSTKSAYRLLLPTNRPGQHSRNFKILWKLKIPPRAELFSWRLFRDRLP  171

Query  194  T--NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            T  NL RR      D  CP C NH+E+  H    C
Sbjct  172  TRANLLRRHVAL-QDIMCPLCGNHQEEAGHLFFHC  205



>gb|KHN24231.1| Putative ribonuclease H protein [Glycine soja]
Length=317

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +2

Query  47   GRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFT  226
            G  S+ SAY     G   + +  +  IW  K P ++  +LW + ++ L+TN  R  R   
Sbjct  111  GLFSIKSAYR-KVAGFSNDKDLLFNLIWSWKGPERMRILLWKIANEGLLTNKSRVTRAMA  169

Query  227  SDARCPQCANHEEDITHCIRDC  292
              + CP+C    E I HC+RDC
Sbjct  170  ESSECPRCHLQPESILHCLRDC  191



>ref|XP_010673168.1| PREDICTED: uncharacterized protein LOC104889608 [Beta vulgaris 
subsp. vulgaris]
Length=1712

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/94 (31%), Positives = 43/94 (46%), Gaps = 0/94 (0%)
 Frame = +2

Query  17    EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
             + + W     GR SV +AY +         +R W TIW L+V  K+ + LW +    L  
Sbjct  1360  DRVAWAFTKDGRYSVKTAYMVGKSRNLDLFHRAWVTIWGLQVSPKVRHFLWKICSNSLPV  1419

Query  197   NLERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
                 + R  TSD  CP C    E I+H +  C++
Sbjct  1420  RAILKHRHITSDDTCPLCLEGPETISHALLHCSK  1453



>ref|XP_006603537.1| PREDICTED: uncharacterized protein LOC102663828 [Glycine max]
Length=523

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 33/95 (35%), Positives = 45/95 (47%), Gaps = 4/95 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIA-TKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            + + WK D  G     SAY +       G+H+R +K +WKLK+P +     W L   +L 
Sbjct  393  DSMLWKADPIGIYYTKSAYRLLLPTNRPGQHSRNFKILWKLKIPPRAELFSWRLFRDRLP  452

Query  194  T--NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            T  NL RR      D  CP C NH+E+  H    C
Sbjct  453  TRANLLRRHVAL-QDIMCPLCGNHQEEAGHLFFYC  486



>ref|XP_007039706.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
 gb|EOY24207.1| Non-LTR retroelement reverse transcriptase [Theobroma cacao]
Length=391

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 48/93 (52%), Gaps = 5/93 (5%)
 Frame = +2

Query  26   YWKLDCTGRCSVSSAY----TIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            YW L  +   ++SS Y    ++A      ++N+ W+ +W  + P ++   L+   HK+++
Sbjct  54   YWALSPSRYFTISSTYEHLWSLADSTRE-DNNKMWRLVWDWRGPHRVCLFLFFCLHKRIL  112

Query  194  TNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            TN E  R   +SDA CP     +E   H +RDC
Sbjct  113  TNAEGVRHKMSSDASCPHYYGAKETCLHVLRDC  145



>ref|XP_006580409.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=309

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 47/93 (51%), Gaps = 4/93 (4%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNR--TWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
            WK D  G  S  +AY +  +GE  E N    ++ +WKL++P K S   W L   +L T  
Sbjct  110  WKPDPNGHYSTKNAYNL-LQGEIAEENLDGAFEDLWKLRIPAKASIFAWRLIRDRLPTKS  168

Query  203  ERRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
              RRR    +D  CP C N EED +H   +C +
Sbjct  169  NLRRRHVEVNDLVCPFCRNKEEDASHLFFNCIK  201



>ref|XP_002439697.1| hypothetical protein SORBIDRAFT_09g018530 [Sorghum bicolor]
 gb|EES18127.1| hypothetical protein SORBIDRAFT_09g018530 [Sorghum bicolor]
Length=381

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/109 (27%), Positives = 46/109 (42%), Gaps = 15/109 (14%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAY----------TIATKGEGGEH-----NRTWKTIWKLKVPRK  151
            + + W  +  G  SV SAY           +  +GE   H      + WK +W +  P K
Sbjct  5    DSVAWHFNKKGVFSVKSAYHVLEDEAESKLVRQRGESSRHLLDSRQQMWKKLWGVPGPPK  64

Query  152  ISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
            I   +W + H  L   +  + +  + D RCP C  ++ED  HC   C +
Sbjct  65   IKQCVWRVAHNSLAHKMNIKSKKISLDTRCPVCLRYDEDGAHCFFKCKD  113



>gb|KHN17108.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=242

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 46/92 (50%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEH-NRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK D +G+ +  S Y +      GE+ +  +  +WKLK+P K +   W L   +L T   
Sbjct  91   WKPDPSGQYTTKSVYDLLLGESLGENRDGGFSELWKLKIPAKSAVFAWTLIRDRLPTKSN  150

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
             RRR    +D  CP C N EED  H   +C++
Sbjct  151  LRRRQVEVNDMLCPFCRNKEEDAAHLFFNCSK  182



>ref|XP_006352585.1| PREDICTED: uncharacterized protein LOC102588593 [Solanum tuberosum]
Length=255

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 41/91 (45%), Gaps = 0/91 (0%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WK+   G  SV S Y      +  E    WK IWK+K+P K+S   W+   K  +T+   
Sbjct  63   WKMHKKGIFSVKSCYWSLNSNQAMEMEWPWKLIWKIKIPHKVSGFTWLAIRKACLTHEVI  122

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +RRG    +RC  C    E  +H    C  A
Sbjct  123  QRRGIQICSRCFMCGEEAEVNSHLFLHCRTA  153



>ref|XP_010451544.1| PREDICTED: uncharacterized protein LOC104733678, partial [Camelina 
sativa]
Length=1201

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +2

Query  125  IWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            IW   VP ++   LW++ H+ LM N+ER+RR     + C  C   EE I H +RDC
Sbjct  521  IWGAVVPERVRIFLWLVGHQVLMVNVERQRRHLCDSSICTVCKGGEESILHILRDC  576



>ref|XP_007048802.1| Uncharacterized protein TCM_001819 [Theobroma cacao]
 gb|EOX92959.1| Uncharacterized protein TCM_001819 [Theobroma cacao]
Length=374

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 45/91 (49%), Gaps = 9/91 (10%)
 Frame = +2

Query  56   SVSSAYTIAT---------KGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            S S  YTIAT              E +  W+  WK + P+++   L    H +++TN ER
Sbjct  208  SSSGQYTIATVYNYLRNISSSTAVELSGIWQDAWKWQEPQRLRTFLVQCLHGRILTNRER  267

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +RR  TSD+ C  C   +E + H +RDC  A
Sbjct  268  QRRRLTSDSVCLHCKMEDETVIHVLRDCMVA  298



>ref|XP_006574178.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=393

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIA-TKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            + + WK D  G  S  SAY +       G+H+R +K +WKLK+P +     W L   +L 
Sbjct  191  DSMLWKADPIGIYSTKSAYRLLLPTNRPGQHSRNFKILWKLKIPPRAELFSWRLFRDRLP  250

Query  194  T--NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            T  NL RR      D  CP C NH+E+  H    C
Sbjct  251  TRANLLRRHVAL-QDIMCPLCGNHQEEAGHLFFHC  284



>ref|XP_006595368.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=420

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 4/94 (4%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIAT-KGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT-  196
            L W+ D TG  S  SAY++    G     +  ++++W LK+P + S   W L   +L T 
Sbjct  220  LEWRADSTGSYSTKSAYSLLMGDGTSAAEDSVYRSLWNLKIPPRASAFSWRLLKNRLPTK  279

Query  197  -NLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
             NL RR+    SD RCP C   EE + H +  C+
Sbjct  280  PNLRRRQVDLPSD-RCPLCDVEEETVGHIMFSCS  312



>gb|EEE69227.1| hypothetical protein OsJ_28461 [Oryza sativa Japonica Group]
Length=314

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 41/106 (39%), Gaps = 15/106 (14%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATK----GEG-----------GEHNRTWKTIWKLKVPRKISNV  163
            W+ D  G  SV SAY +A +    G G           G H   W  IW+ KV  K+   
Sbjct  115  WRYDPKGVFSVKSAYKVAVRKRDMGSGRDASSSSGSVYGTHTFDWLKIWRCKVAHKVQMF  174

Query  164  LWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +W   H  L       R+G   D  CP C   +ED  H    C  A
Sbjct  175  VWWFTHNSLAVRCNLARKGVEIDKICPVCKRFDEDNGHLFFKCKNA  220



>ref|XP_006476142.1| PREDICTED: uncharacterized protein LOC102616098 [Citrus sinensis]
Length=510

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 43/92 (47%), Gaps = 0/92 (0%)
 Frame = +2

Query  26   YWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            YW  +  G  +V S Y I         +  W+ +WKLKVP K+ + +W      L T   
Sbjct  166  YWSANSRGLFTVRSCYKILAYLSEPPSSNVWQKVWKLKVPAKVKHFIWCAVVNVLPTADN  225

Query  206  RRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             RR      + CP C  ++E + HC+ +C+ A
Sbjct  226  LRRCQVEVPSVCPICNAYDEIVAHCLVNCSFA  257



>ref|XP_008233465.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=547

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/91 (33%), Positives = 47/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WK    G  SV +AY +  KG     + ++ ++WKLK+P K+    W+    K+++N +R
Sbjct  183  WKGTANGVFSVKTAYNLFFKGPSWP-DYSFSSLWKLKIPLKLQIFAWLTAQGKILSNEQR  241

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             RR    +A C  C    E   H +RDC +A
Sbjct  242  VRRQLIFNASCGVCEWPIETTLHILRDCYKA  272



>emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1369

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 46/103 (45%), Gaps = 8/103 (8%)
 Frame = +2

Query  17    EELYWKLDCTGRCSVSSAY---TIATKGEG-----GEHNRTWKTIWKLKVPRKISNVLWI  172
             ++  W +   G+ +V SAY    +  +  G     G + + W+ IWK K+P K+    W 
Sbjct  1010  DQWMWMMSKNGQFTVRSAYYHELLEDRKTGPSTSRGPNLKLWQKIWKAKIPPKVKLFSWK  1069

Query  173   LKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
               H  L      R+RG   D  CP+C   EE   H I  C E+
Sbjct  1070  AIHNGLAVYTNMRKRGMNIDGACPRCGEKEETTEHLIWGCDES  1112



>gb|EEE54600.1| hypothetical protein OsJ_01823 [Oryza sativa Japonica Group]
Length=639

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 43/105 (41%), Gaps = 16/105 (15%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTI---------------ATKGEGGEHNRTWKTIWKLKVPRKIS  157
            L W  D  G  +V SAY +                +  E G+ +  WK +WKL VP KI 
Sbjct  197  LAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDD-FWKKLWKLGVPGKIK  255

Query  158  NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            + LW + H  L      + RG   D RC  C  + ED  H    C
Sbjct  256  HFLWRMCHNTLALRANLQHRGMDVDTRCVMCGRYNEDAGHLFFKC  300



>gb|AEJ07916.1| putative ZmL1 non-LTR retrotransposon protein [Zea mays]
Length=472

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 43/109 (39%), Gaps = 12/109 (11%)
 Frame = +2

Query  2    EETFIEELYWKLDCTGRCSVSSAYTIATK------------GEGGEHNRTWKTIWKLKVP  145
            +E   + L W  D  G  SV SAY +A++               G     WK+IW + V 
Sbjct  101  QEGMEDTLAWHGDPKGNFSVKSAYALASRRRDHHNNADASSSISGRGENVWKSIWNVNVT  160

Query  146  RKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             KI   LW L H      +   RRG   +  CP C   +ED  H    C
Sbjct  161  NKIKMFLWRLAHNSHPVRVNIARRGIKIETLCPMCFRLDEDGGHLFLKC  209



>ref|XP_006576023.1| PREDICTED: uncharacterized protein LOC102663668 [Glycine max]
Length=222

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 45/92 (49%), Gaps = 2/92 (2%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATKGEGGEH-NRTWKTIWKLKVPRKISNVLWILKHKKLMTN  199
            L WK+D  G  S  SAY +  +     + +R  K IW LK+P + S   W L   +L T 
Sbjct  22   LCWKVDPNGMHSTKSAYKVLQETHNNANEDRASKIIWSLKIPPRASAFSWRLFKNRLPTR  81

Query  200  LE-RRRRGFTSDARCPQCANHEEDITHCIRDC  292
               RRR+       CP C + EE ++H + +C
Sbjct  82   ANLRRRQVILPSYNCPLCESEEESVSHLMFNC  113



>ref|XP_002454676.1| hypothetical protein SORBIDRAFT_04g035460 [Sorghum bicolor]
 gb|EES07652.1| hypothetical protein SORBIDRAFT_04g035460 [Sorghum bicolor]
Length=276

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 45/108 (42%), Gaps = 15/108 (14%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAY----------TIATKGEG-----GEHNRTWKTIWKLKVPRKIS  157
            + W     G  SV SAY           +  +GE      G   + WK +W++  P KI 
Sbjct  7    VAWHFVRKGVFSVKSAYHVLEDEAESKLVRQRGESSSQSLGSRKQMWKKLWRVPRPPKIK  66

Query  158  NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
              +W + H  L   +  + +  + D RCP C  ++ED  HC   C E 
Sbjct  67   QCVWRVAHNSLAHKMNIKSKKISLDTRCPVCLKYDEDGAHCFFKCKEV  114



>ref|XP_007224406.1| hypothetical protein PRUPE_ppa021713mg, partial [Prunus persica]
 gb|EMJ25605.1| hypothetical protein PRUPE_ppa021713mg, partial [Prunus persica]
Length=406

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/107 (32%), Positives = 45/107 (42%), Gaps = 13/107 (12%)
 Frame = +2

Query  11   FIEELYWKLDCTGRCSVSSAYTI-----ATKGEGGEHNRTWKT--------IWKLKVPRK  151
            F+E+  W L C   C   +   +     A     G     W+         IW L VP K
Sbjct  138  FLEDGVWDLPCLRECLPETIVQMILCVHAGLPSSGNDKCIWRHTGNGSFTFIWNLPVPPK  197

Query  152  ISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            I   LW + H KL+TN++R+RRG T    C +C    E I H    C
Sbjct  198  IKTFLWTVCHGKLLTNVQRQRRGLTQVPACSRCNYPMETIAHLFMYC  244



>ref|XP_006574148.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=247

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 43/93 (46%), Gaps = 4/93 (4%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIA-TKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT-  196
            L W  D  G CS  SAY +   +      +  +KTIWKL++P + S   W +   +L T 
Sbjct  47   LSWGADPAGYCSAKSAYNLLKAEASSNSEDNNYKTIWKLQIPPRASAFSWRIFKNRLPTR  106

Query  197  -NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             NL RR     S   CP C   EE + H +  C
Sbjct  107  DNLRRRHVELPS-YNCPLCDQEEETVGHIMYSC  138



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 44/103 (43%), Gaps = 7/103 (7%)
 Frame = +2

Query  14    IEELYWKLDCTGRCSVSSAYTIATK-------GEGGEHNRTWKTIWKLKVPRKISNVLWI  172
             ++E+ W  D  G  SV S Y IA K          G +++ WK +W +++P K+   +W 
Sbjct  975   VDEMMWHYDKHGEYSVKSGYQIALKLKAPDEPSNSGSNSKRWKAVWSMELPEKMKIFMWR  1034

Query  173   LKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                  L T     +R    D  C  C    E + H + DC  A
Sbjct  1035  AARNLLPTAENLWKRKCLKDPICQGCNREVETVRHALLDCKAA  1077



>ref|XP_006655090.1| PREDICTED: uncharacterized protein LOC102699406 [Oryza brachyantha]
Length=1170

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/100 (33%), Positives = 44/100 (44%), Gaps = 9/100 (9%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEH---------NRTWKTIWKLKVPRKISNVLWILKH  181
            W L+  G  SV SAY I    +  E          N  W  IWK+KVP K+    W + H
Sbjct  869  WALERHGHYSVRSAYKIQYVKKQQEKEPNVASSSANDVWGRIWKVKVPPKVQVFWWRVMH  928

Query  182  KKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            + L +    RRR       C +C   EE + H + +CT A
Sbjct  929  EFLPSRQILRRRHLERLVNCERCGADEESVLHVVAECTLA  968



>gb|EEE53388.1| hypothetical protein OsJ_36435 [Oryza sativa Japonica Group]
Length=740

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 42/102 (41%), Gaps = 11/102 (11%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGE-----------HNRTWKTIWKLKVPRKISNVLWIL  175
            W  + TG  SV SAY IA   +                R W+ IW L+ P K+    W L
Sbjct  445  WHYERTGVYSVRSAYRIALSCQASSTAGSSSSSPSGERRIWRNIWNLQAPPKVKIFAWRL  504

Query  176  KHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                L T   R+ R   SD+ C  C   EED  H +  CT A
Sbjct  505  ARDCLATQRNRKSRKLVSDSTCRTCGGEEEDGFHAVISCTRA  546



>gb|KHN27242.1| Putative ribonuclease H protein [Glycine soja]
Length=140

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/98 (26%), Positives = 45/98 (46%), Gaps = 0/98 (0%)
 Frame = +2

Query  5    ETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHK  184
            E  ++ + WK    G  ++ SAY +    +       +K + +   P +I   LW + H+
Sbjct  7    EAGLDTIAWKGTADGSFTLKSAYGVVCDLQVTSDINLFKLVHRWPGPERIRMFLWKISHE  66

Query  185  KLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
             ++TN +R R G + +  C  C    E + H  RDC +
Sbjct  67   SILTNAKRMRIGMSVNDACSACQAEAEALLHLFRDCND  104



>ref|XP_002458113.1| hypothetical protein SORBIDRAFT_03g027125 [Sorghum bicolor]
 gb|EES03233.1| hypothetical protein SORBIDRAFT_03g027125 [Sorghum bicolor]
Length=99

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 44/97 (45%), Gaps = 6/97 (6%)
 Frame = +2

Query  11   FIEELYWKLDCTGRCSVSS-----AYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWIL  175
             +  ++W+ D     S+ +      +  ++   GG+  + W  IWK++ P ++ + LW L
Sbjct  1    MVRAIFWEEDVPKILSIPNRSSRNDWAASSSHNGGDPEKVWCMIWKMQAPSRLKHFLWRL  60

Query  176  KHKKLMTNLERRRRG-FTSDARCPQCANHEEDITHCI  283
             H  L  +L  +RRG    D RC  C    ED  H  
Sbjct  61   AHNSLALHLNLKRRGILVDDDRCIMCNRLGEDGAHLF  97



>gb|KHN30898.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=337

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 45/87 (52%), Gaps = 3/87 (3%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNR--TWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
            W+ +  G+ +  SAY +  +GE  E N    +  +WKL++P K +   W L   +L T L
Sbjct  242  WRAEPNGQYTTRSAYLL-MQGEATEENSDGVFTELWKLQIPAKAAIFAWRLIKDRLPTKL  300

Query  203  ERRRRGFTSDARCPQCANHEEDITHCI  283
              RR+   SD  CP C N EED +H  
Sbjct  301  NLRRQIQLSDHLCPFCRNMEEDASHLF  327



>gb|EEC69465.1| hypothetical protein OsI_38661 [Oryza sativa Indica Group]
Length=725

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 42/102 (41%), Gaps = 11/102 (11%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGE-----------HNRTWKTIWKLKVPRKISNVLWIL  175
            W  + TG  SV SAY IA   +                R W+ IW L+ P K+    W L
Sbjct  430  WHYERTGVYSVRSAYRIALSCQASSTAGSSSSSPSGERRIWRNIWNLQAPPKVKIFAWRL  489

Query  176  KHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                L T   R+ R   SD+ C  C   EED  H +  CT A
Sbjct  490  ARDCLATQRNRKSRKLVSDSTCRTCGGEEEDGFHAVISCTRA  531



>ref|XP_006595284.1| PREDICTED: uncharacterized protein LOC102670174 [Glycine max]
Length=247

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHN-RTWKTIWKLKVPRKISNVLWILKHKKLM  193
            + + WK + TG  S  SAY I         + R +K IWK+K+P + +   W L   +L 
Sbjct  45   DNMMWKAESTGVYSTKSAYRIMLNTNASATDVRNFKLIWKMKIPPRATVFTWRLLKDRLP  104

Query  194  T--NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            T  NL RR   F  D  CP C   +E++ H   +C
Sbjct  105  TKGNLLRRNVIF-QDVGCPLCGQVQEEVGHLFLNC  138



>ref|XP_004512849.1| PREDICTED: uncharacterized protein LOC101502097 [Cicer arietinum]
Length=152

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 45/83 (54%), Gaps = 3/83 (4%)
 Frame = +2

Query  50   RCSVSSAYT-IATKGEGGE--HNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRG  220
            + S+ S Y  +A + E  E  H+  +   W+  V   I + +W L H K++TN+ER+RR 
Sbjct  40   QFSLKSTYDFLANQVEDSENKHDFMFLKAWEWSVLNNIRSFIWKLDHGKILTNMERKRRN  99

Query  221  FTSDARCPQCANHEEDITHCIRD  289
             TSD  CP+  +  E I H + D
Sbjct  100  MTSDDTCPRYKSSLESIMHILCD  122



>ref|NP_001045511.1| Os01g0967700 [Oryza sativa Japonica Group]
 dbj|BAF07425.1| Os01g0967700, partial [Oryza sativa Japonica Group]
Length=343

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 43/103 (42%), Gaps = 15/103 (15%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTI--------ATKGEGG-------EHNRTWKTIWKLKVPRKISNV  163
            W  D  G  SV SAY +        A K EGG       + N  W  IW L+   K+   
Sbjct  62   WHFDTRGMYSVKSAYHVLEDQRERSAKKQEGGSSSGAVNQRNFEWDKIWSLQCIPKVKQF  121

Query  164  LWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            +W L H  L   L  +RR   ++  CP C   +E+  HC   C
Sbjct  122  IWRLAHNSLPLKLNIKRRVPDAETLCPVCKRFDENGGHCFLQC  164



>gb|EAZ08213.1| hypothetical protein OsI_30472 [Oryza sativa Indica Group]
Length=398

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 41/106 (39%), Gaps = 15/106 (14%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATK----GEG-----------GEHNRTWKTIWKLKVPRKISNV  163
            W+ D  G  SV SAY +A +    G G           G H   W  IW+ KV  K+   
Sbjct  199  WRYDPKGVFSVKSAYKVAVRKRDMGSGRDASSSSGSVYGTHTFDWLKIWRCKVAHKVQMF  258

Query  164  LWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +W   H  L       R+G   D  CP C   +ED  H    C  A
Sbjct  259  VWWFTHNSLAVRCNLARKGVEIDKICPVCKRFDEDNGHLFFKCKNA  304



>ref|XP_010667870.1| PREDICTED: uncharacterized protein LOC104884866 [Beta vulgaris 
subsp. vulgaris]
Length=259

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 32/63 (51%), Gaps = 0/63 (0%)
 Frame = +2

Query  104  HNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCI  283
            +N  WK +W+ KV  K+    W L H  L  N    RRG   D +CP+C + EE + H +
Sbjct  146  NNGVWKKVWRAKVAPKVKLFGWKLLHNGLPVNDNLARRGVIIDKQCPRCGDGEESVEHLL  205

Query  284  RDC  292
              C
Sbjct  206  MQC  208



>gb|EAZ40645.1| hypothetical protein OsJ_25114 [Oryza sativa Japonica Group]
Length=560

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 14/100 (14%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATKGE--------------GGEHNRTWKTIWKLKVPRKISN  160
            L W  D  G  SV SAY +   GE                E    WK +WK+++P K+ +
Sbjct  239  LAWHYDEKGLFSVKSAYKVQRDGELQRRKRGSAGLSNGSTEREMYWKKVWKMQLPGKVKH  298

Query  161  VLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHC  280
             +W   H  L   +  ++RG   D+RC  C    ED  H 
Sbjct  299  FIWRFSHNILALRVNLQQRGMDLDSRCIICNRMNEDAGHL  338



>gb|KHM99058.1| hypothetical protein glysoja_024358, partial [Glycine soja]
Length=205

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 42/92 (46%), Gaps = 2/92 (2%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATKG-EGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTN  199
            + WK +  G  S  SAY++  K  + G      K IW L +P + +  +W L   +L T 
Sbjct  14   IVWKAESNGVYSTKSAYSLMLKSNDSGSQAGISKLIWNLNIPPRAAIFMWRLLKDRLPTK  73

Query  200  LERRRRGF-TSDARCPQCANHEEDITHCIRDC  292
                RR     DA CP C   +ED+ H   +C
Sbjct  74   RNLLRRNVDIQDAVCPLCGQGQEDVGHLFFNC  105



>ref|XP_006601639.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=221

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 51/97 (53%), Gaps = 4/97 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGE-GGEHNRTWKTIWKLKVPRKISNVLWILKHKKL-  190
            ++  W  D +G+ +  SAY +   G   G H+R ++ +WK+KVP K +   W L   +L 
Sbjct  20   DDWVWTADSSGQYTAKSAYRMMMGGATDGTHDRDFEELWKMKVPTKFAVFAWRLLRDRLP  79

Query  191  -MTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
              TNL RR+    +D  CP C + +++  H    CT+
Sbjct  80   TKTNLHRRQVE-INDRTCPFCRSAKKEAGHLFFHCTK  115



>ref|XP_009353199.1| PREDICTED: uncharacterized protein LOC103944460 [Pyrus x bretschneideri]
Length=1429

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 38/106 (36%), Positives = 49/106 (46%), Gaps = 15/106 (14%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAY------TIATKGEGGEHNRT-----WKTIWKLKVPRKISNV  163
            + L W L   G  SV S Y      ++A + +     R      WK IWKL+VP K+ + 
Sbjct  869  DRLIWALSKNGTYSVKSGYRWLQGRSLARRDKRRPSVRGVPMAFWKGIWKLEVPPKLRHF  928

Query  164  LWILKHKKLMTN--LERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
            LW+  H  L T   L RRR   TS   CP C  H+E I H    C+
Sbjct  929  LWLTMHNCLPTREALYRRRSSLTST--CPICCCHDETIEHIFLSCS  972



>ref|XP_009151561.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1204

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/94 (29%), Positives = 48/94 (51%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEG--GEHNRTWKTIWKLKVPRKISNVLWILKHKKL  190
            + L W     G+ +V +AY + T+      +    +K++W++  P ++   LW++ ++ +
Sbjct  837  DRLAWGEVPNGQFTVKTAYDLITRDNTPRQQMENLFKSMWRVVAPERVRVFLWLVGNQAI  896

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            MTN ER RR  +    C  C    E I H +RDC
Sbjct  897  MTNAERYRRHLSGTDVCQVCKGGVETILHVLRDC  930



>gb|EEC81662.1| hypothetical protein OsI_25211 [Oryza sativa Indica Group]
Length=561

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 42/105 (40%), Gaps = 16/105 (15%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTI---------------ATKGEGGEHNRTWKTIWKLKVPRKIS  157
            L W  D  G  +V SAY +                +  E G+ +  WK +WKL VP KI 
Sbjct  197  LAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDD-FWKKLWKLGVPGKIK  255

Query  158  NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            + LW + H  L        RG   D RC  C  + ED  H    C
Sbjct  256  HFLWRMCHNTLALRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKC  300



>gb|EEE50824.1| hypothetical protein OsJ_31232 [Oryza sativa Japonica Group]
Length=1594

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 43/105 (41%), Gaps = 16/105 (15%)
 Frame = +2

Query  23    LYWKLDCTGRCSVSSAYTI---------------ATKGEGGEHNRTWKTIWKLKVPRKIS  157
             L W  D  G  +V SAY +                +  E G+ +  WK +WKL VP KI 
Sbjct  1230  LAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDD-FWKKLWKLGVPGKIK  1288

Query  158   NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             + LW + H  L      + RG   D RC  C  + ED  H    C
Sbjct  1289  HFLWRMCHNTLALRANLQHRGMDVDTRCVMCGRYNEDAGHLFFKC  1333



>ref|XP_006603448.1| PREDICTED: uncharacterized protein LOC102670511 [Glycine max]
Length=151

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 45/92 (49%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIAT-KGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK +  G  S  SAY +     E G  +  +K +WKLK+P K S     L   +L+T   
Sbjct  49   WKPESNGYYSSRSAYILLQGNSEEGNMDDIFKDLWKLKIPAKASIFAGRLIRDRLLTKSN  108

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
             R+R    +D+ CP C   EE  +H   DC++
Sbjct  109  MRKRQIDINDSLCPFCGIKEETASHLFFDCSK  140



>ref|XP_006589934.1| PREDICTED: uncharacterized protein LOC102669656 [Glycine max]
Length=247

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (48%), Gaps = 4/94 (4%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATK-GEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT-  196
            L W++D TG  S  SAY +    G     +   + +W LK+P + S   W +   +L T 
Sbjct  47   LSWRVDPTGSYSTKSAYNLLMDDGSSDNEDSASRIMWNLKIPPRASAFSWRIFKNRLPTK  106

Query  197  -NLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
             NL RR+    S  RCP C   EE + H +  CT
Sbjct  107  ANLRRRQVDLPS-YRCPLCDVEEESVGHVMFSCT  139



>ref|XP_009116295.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=782

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 46/94 (49%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTW--KTIWKLKVPRKISNVLWILKHKKL  190
            + L W     G+ +V SAY + T+ +    N  +  + +W +  P ++   LW++ ++ +
Sbjct  415  DRLAWSQTKNGQLTVKSAYALITRDDAPRPNMEYLFRRMWHVVPPERVKMFLWLVGNQAI  474

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            MTN ER R   +    C  C    E I H +RDC
Sbjct  475  MTNAERYRWHLSGTDVCQVCKGGIETILHVLRDC  508



>ref|XP_009107896.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=416

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/94 (27%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHN--RTWKTIWKLKVPRKISNVLWILKHKKL  190
            + L W     G+ +V +AY +  + +         +K++W++  P ++   LW++ ++ +
Sbjct  49   DRLAWGETPNGQFTVKTAYELIRRDDTSRQQMESLFKSVWRVVAPERVRVFLWLVGNQAI  108

Query  191  MTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            +TN ER RR  +    C  C    E I H +RDC
Sbjct  109  ITNAERYRRHLSGTDVCQICKGGVETILHVLRDC  142



>ref|XP_008222990.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=346

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +2

Query  116  WKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
            W  +WKL++P K+    W++   K+++N +R RR  + DA C  C    E I H +R+C 
Sbjct  13   WTFLWKLRIPPKLHIFFWLVFQGKILSNEQRVRRQLSLDASCGSCHWPMESILHILRNCV  72

Query  296  EA  301
            +A
Sbjct  73   KA  74



>ref|XP_006603340.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=350

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 33/95 (35%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = +2

Query  14   IEELYWKLDCTGRCSVSSAYT-IATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKL  190
            ++E  W  D T + S  SAY  I    +GG+H    K +W++K+P KIS   W L   +L
Sbjct  171  LDEWEWLGDQTRKYSTRSAYNLILEASKGGQHQDWCKELWRIKIPSKISIFAWRLIEDRL  230

Query  191  MTNLERRRRGFT-SDARCPQCANHEEDITHCIRDC  292
             T +   RR     D RCP C    E+ +H    C
Sbjct  231  PTRMNLHRRQVQLQDLRCPFCREAVEEASHLFFHC  265



>ref|XP_006579325.1| PREDICTED: uncharacterized protein LOC102669832 [Glycine max]
Length=248

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 47/92 (51%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEH-NRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK + +G+ S  SAY +  +   G++ +   + +WKLK+P K     W L   +L T   
Sbjct  49   WKPETSGQYSTRSAYHLLQEATAGDNPDEALEDLWKLKIPAKALIFAWRLIKDRLPTKAN  108

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
             RRR    +D  CP C + EE+ +H   DC +
Sbjct  109  LRRRQIQMNDTICPFCRSKEEEASHLFFDCPK  140



>gb|EEE69154.1| hypothetical protein OsJ_28290 [Oryza sativa Japonica Group]
Length=615

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 42/105 (40%), Gaps = 15/105 (14%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTI---------------ATKGEGGEHNRTWKTIWKLKVPRKIS  157
            L W  D  G  SV SAY +               ++ G+       W+ IWKL    K+ 
Sbjct  457  LAWHFDNRGIFSVKSAYHVLEDERRRHKPKQDGASSSGQTNMEKLCWQQIWKLPYLPKVK  516

Query  158  NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            + +W L H  L   +  ++RG   D RCP C    ED  H    C
Sbjct  517  HFIWHLAHNSLPFRMSIQKRGMQIDTRCPVCHRQNEDGGHYFLKC  561



>gb|KHN09049.1| hypothetical protein glysoja_044341, partial [Glycine soja]
Length=123

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 4/93 (4%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEG-GEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT--N  199
            W    +G  S  SAY +  +G      ++ +  +WKLK+P KI+   W L   +L T  N
Sbjct  6    WTGHPSGIYSAQSAYLMLREGGSTASKDQAYVELWKLKIPSKIAIFAWRLFQDRLPTKSN  65

Query  200  LERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
            L RR+   T D  CP C   EE+ +H    C++
Sbjct  66   LLRRQLQLT-DVSCPFCGGMEEEASHLFFHCSK  97



>ref|XP_006347119.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum 
tuberosum]
Length=450

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (47%), Gaps = 0/96 (0%)
 Frame = +2

Query  5    ETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHK  184
            + + + L+WK +  G   V SAY +  +         WK +WK ++P K+S  +W+L  +
Sbjct  251  QAYEDMLWWKGNNRGEFKVHSAYRLMDESSQQSPIWPWKQVWKCRIPHKVSCFIWLLAKE  310

Query  185  KLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
              +T     +RG T  +RC  C    E + H    C
Sbjct  311  AALTQDNVMKRGITLCSRCFLCGETLETVNHLFLHC  346



>gb|ABA97040.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1913

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 45/109 (41%), Gaps = 12/109 (11%)
 Frame = +2

Query  2     EETFIEELYWKLDCTGRCSVSSAYTIA---------TKGEGGEHNRTWKTIWKLKVPRKI  154
             EE F   L W  D  G+ SV SAY +A         +   G    + W  IWK  VP+K+
Sbjct  1572  EEDF---LSWHPDRLGQFSVRSAYKLAISLDYADESSSSSGQNPQKIWDLIWKCNVPQKV  1628

Query  155   SNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                 W   +  L     +++R       C  C N  ED++H +  C  A
Sbjct  1629  KVFCWRAANNCLANQENKKKRNLERSEICCICGNETEDVSHALSRCPHA  1677



>gb|AAQ19327.1| bZIP-like protein [Oryza sativa Japonica Group]
Length=2367

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 47/109 (43%), Gaps = 12/109 (11%)
 Frame = +2

Query  2     EETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEH---------NRTWKTIWKLKVPRKI  154
             EE FI    W  D  G  SV SAY +A +    E          N+ W+ IWK KVP+K+
Sbjct  1731  EEDFIA---WHPDKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKV  1787

Query  155   SNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                 W +    L T + +++R       C  C    ED  H +  C +A
Sbjct  1788  KIFAWRVASNCLATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQA  1836



>gb|EEC81552.1| hypothetical protein OsI_24974 [Oryza sativa Indica Group]
Length=1015

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 45/109 (41%), Gaps = 12/109 (11%)
 Frame = +2

Query  2    EETFIEELYWKLDCTGRCSVSSAYTIA---------TKGEGGEHNRTWKTIWKLKVPRKI  154
            EE F   L W  D  G+ SV SAY +A         +   G    + W  IWK  VP+K+
Sbjct  830  EEDF---LAWHPDRLGQFSVRSAYKLAISLDYADESSSSSGQNPQKIWDLIWKCNVPQKV  886

Query  155  SNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                W   +  L     +++R       C  C N  ED++H +  C  A
Sbjct  887  KVFCWRAANNCLANQENKKKRNLERSEICCICGNETEDVSHALSRCPHA  935



>ref|XP_006493121.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=968

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 7/99 (7%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATK-------GEGGEHNRTWKTIWKLKVPRKISNVLWIL  175
            +++ W  D  G  SV S Y +A +           E N +W +IW L++P K+   +W  
Sbjct  613  DQVLWHYDKKGNYSVKSGYQLALQMKFPNRPSSSKEDNNSWNSIWYLQIPEKVKIFMWRA  672

Query  176  KHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             +  L T+    +R       C +C +H E I H + DC
Sbjct  673  TNDLLPTSENLWKRRILQTPWCQRCRSHRETIFHSLFDC  711



>ref|XP_007048905.1| Uncharacterized protein TCM_001910 [Theobroma cacao]
 gb|EOX93062.1| Uncharacterized protein TCM_001910 [Theobroma cacao]
Length=421

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 3/90 (3%)
 Frame = +2

Query  26   YWKLDCTGRCSVSSAYTIATKGEG---GEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            YW    + +  V+SAY    K       + +  W+  WK +  +++   L+   H +L+T
Sbjct  244  YWGESASSQFMVASAYDYLRKLSSPTKAKPSGIWQGAWKWQGSQRVRTFLFQCLHGRLLT  303

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIR  286
            N ER  R FT+D+ CPQC   +E +TH  R
Sbjct  304  NRERLCRQFTTDSLCPQCRMEDETVTHVER  333



>ref|XP_006577508.1| PREDICTED: uncharacterized protein LOC102660507 [Glycine max]
Length=293

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTW-KTIWKLKVPRKISNVLWILKHKKLM  193
            +E  W  D T + S  SAY +  +   G  ++ W K +W++K+P KIS   W L   +L 
Sbjct  90   DEWEWLGDQTRKYSTRSAYNLILEASKGGQHQDWCKELWRIKIPSKISVFAWRLIEDRLP  149

Query  194  TNLERRRRGFT-SDARCPQCANHEEDITHCIRDCT  295
            T +   RR     D RCP C    E+ +H    C 
Sbjct  150  TRMNLHRRQVQLQDLRCPFCREAVEETSHLFFHCV  184



>ref|XP_006337991.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum 
tuberosum]
Length=556

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (47%), Gaps = 0/96 (0%)
 Frame = +2

Query  5    ETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHK  184
            + + + L+WK +  G   V SAY +  +         WK +WK ++P K+S  +W+L  +
Sbjct  357  QAYEDMLWWKGNNRGEFKVHSAYRLMDESSQQSPIWPWKQVWKCRIPHKVSCFIWLLAKE  416

Query  185  KLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
              +T     +RG T  +RC  C    E + H    C
Sbjct  417  AALTQDNVMKRGITLCSRCFLCGETLETVNHLFLHC  452



>gb|AAP53315.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1505

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 42/105 (40%), Gaps = 16/105 (15%)
 Frame = +2

Query  23    LYWKLDCTGRCSVSSAYTI---------------ATKGEGGEHNRTWKTIWKLKVPRKIS  157
             L W  D  G  +V SAY +                +  E G+ +  WK +WKL VP KI 
Sbjct  1198  LAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDD-FWKKLWKLGVPGKIK  1256

Query  158   NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             + LW + H  L        RG   D RC  C  + ED  H    C
Sbjct  1257  HFLWRMCHNTLALRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKC  1301



>ref|XP_006603252.1| PREDICTED: uncharacterized protein LOC102659409 [Glycine max]
Length=134

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 49/95 (52%), Gaps = 4/95 (4%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATKG-EGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT-  196
            L+WK D  G  S  SAY +  +       +  +K +W+LK+P ++S   W L   +L T 
Sbjct  22   LWWKPDSNGLFSTKSAYKVLQEAHNNASGDNAFKIMWRLKIPPRVSAFSWRLLKNRLPTR  81

Query  197  -NLERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
             NL +R+    S + CP C + EE + H + + ++
Sbjct  82   DNLIKRQVTLPSYS-CPLCEHEEESVNHLMFNYSK  115



>gb|ABA98491.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1621

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 42/105 (40%), Gaps = 16/105 (15%)
 Frame = +2

Query  23    LYWKLDCTGRCSVSSAYTI---------------ATKGEGGEHNRTWKTIWKLKVPRKIS  157
             L W  D  G  +V SAY +                +  E G+ +  WK +WKL VP KI 
Sbjct  1257  LAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDD-FWKKLWKLGVPGKIK  1315

Query  158   NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             + LW + H  L        RG   D RC  C  + ED  H    C
Sbjct  1316  HFLWRMCHNTLALRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKC  1360



>gb|KHN15989.1| hypothetical protein glysoja_047403, partial [Glycine soja]
Length=205

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 44/92 (48%), Gaps = 2/92 (2%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATKGEGGE-HNRTWKTIWKLKVPRKISNVLWILKHKKLMTN  199
            L+WK D  G  S +SAY +  +    +  +     +WKLK+P K+S   W L   +L T 
Sbjct  14   LWWKPDTNGVFSTNSAYKVLQEAHHSDSEDNVLNIMWKLKIPPKVSAFSWRLFKNRLPTR  73

Query  200  LERRRRGFT-SDARCPQCANHEEDITHCIRDC  292
               R+   T     CP C + EE I H + +C
Sbjct  74   DNLRKTQVTLPSYSCPLCDHEEESIYHLMFNC  105



>gb|AAM18736.1|AC092548_14 putative reverse transcriptase [Oryza sativa Japonica Group]
Length=1509

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 42/105 (40%), Gaps = 16/105 (15%)
 Frame = +2

Query  23    LYWKLDCTGRCSVSSAYTI---------------ATKGEGGEHNRTWKTIWKLKVPRKIS  157
             L W  D  G  +V SAY +                +  E G+ +  WK +WKL VP KI 
Sbjct  1202  LAWHFDARGCFTVKSAYKVQREMERRASRNGCPGVSNWESGDDD-FWKKLWKLGVPGKIK  1260

Query  158   NVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             + LW + H  L        RG   D RC  C  + ED  H    C
Sbjct  1261  HFLWRMCHNTLALRANLHHRGMDVDTRCVMCGRYNEDAGHLFFKC  1305



>ref|NP_001060259.1| Os07g0613900 [Oryza sativa Japonica Group]
 dbj|BAF22173.1| Os07g0613900 [Oryza sativa Japonica Group]
Length=1453

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 42/99 (42%), Gaps = 14/99 (14%)
 Frame = +2

Query  23    LYWKLDCTGRCSVSSAYTIATKGE--------------GGEHNRTWKTIWKLKVPRKISN  160
             L W  D  G  SV SAY +   GE                E    WK +WK+++P K+ +
Sbjct  1132  LAWHYDEKGLFSVKSAYKVQRDGELQRRKRGSAGLSNGSTEREMYWKKVWKMQLPGKVKH  1191

Query  161   VLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITH  277
              +W   H  L   +  ++RG   D+RC  C    ED  H
Sbjct  1192  FIWRFSHNILALRVNLQQRGMDLDSRCIICNRMNEDAGH  1230



>ref|XP_006585871.1| PREDICTED: uncharacterized protein LOC102661163 [Glycine max]
Length=228

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 50/97 (52%), Gaps = 2/97 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATK-GEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            +E  WK D +G+ +V SAY + T+    GE +  ++ +W L VP K++     L   KL 
Sbjct  89   DEWEWKADQSGQYTVQSAYKLMTREAIEGERDPGFEELWNLTVPIKVAVFALRLLGDKLP  148

Query  194  TNLERRRRGF-TSDARCPQCANHEEDITHCIRDCTEA  301
            T +   +R    +D RCP C N EE+  H     T++
Sbjct  149  TKVNLYKRQVEVADRRCPFCGNMEEEAGHLFFTTTKS  185



>ref|NP_001066197.2| Os12g0156200 [Oryza sativa Japonica Group]
 gb|ABA96496.2| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29216.2| Os12g0156200 [Oryza sativa Japonica Group]
Length=1764

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 47/109 (43%), Gaps = 12/109 (11%)
 Frame = +2

Query  2     EETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEH---------NRTWKTIWKLKVPRKI  154
             EE FI    W  D  G  SV SAY +A +    E          N+ W+ IWK KVP+K+
Sbjct  1128  EEDFIA---WHPDKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKV  1184

Query  155   SNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                 W +    L T + +++R       C  C    ED  H +  C +A
Sbjct  1185  KIFAWRVASNCLATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQA  1233



>gb|ABD32189.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=612

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 31/97 (32%), Positives = 44/97 (45%), Gaps = 4/97 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATK----GEGGEHNRTWKTIWKLKVPRKISNVLWILKHK  184
            + + WK +  G+ SV SAYT+  +             W  IW+LKVP KI N +W +   
Sbjct  224  DRIIWKAENDGKYSVRSAYTLCVEELIDTSFLRRPGYWSDIWRLKVPPKIKNFMWRVCRG  283

Query  185  KLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
             L T  + R +G      C  C+   ED+ H    CT
Sbjct  284  VLPTRNKLRDKGVQCPEACVNCSTTSEDVKHLFCVCT  320



>ref|XP_008342743.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=577

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 42/93 (45%), Gaps = 13/93 (14%)
 Frame = +2

Query  26   YWKLDC----TGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            +WK  C    TGR   SS+Y+I        H++ WK IWKL  P KI N +W   H+ L 
Sbjct  192  HWKKACSMPFTGR-GTSSSYSI--------HSKVWKAIWKLATPPKIRNFMWRALHRALA  242

Query  194  TNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            T      R  +    CP C   EE + H    C
Sbjct  243  TMDVLFIRRCSPSPLCPICHAQEESVEHLFFLC  275



>ref|XP_006593887.1| PREDICTED: uncharacterized protein LOC102670387 [Glycine max]
Length=308

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 32/92 (35%), Positives = 47/92 (51%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIAT-KGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK +  G  S  SAY +     E G  + T+K +WKLK+P K S   W L   +L T   
Sbjct  110  WKPESNGYYSSKSAYILLQGNSEEGNMDDTFKDLWKLKIPAKASIFAWRLIRDRLPTKSN  169

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
             R+R    +D+ CP C+  EE  +H   +C++
Sbjct  170  LRKRQIDINDSLCPLCSIKEETASHLFFECSK  201



>ref|XP_007028365.1| Uncharacterized protein TCM_024142 [Theobroma cacao]
 gb|EOY08867.1| Uncharacterized protein TCM_024142 [Theobroma cacao]
Length=216

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  149  KISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +I   L++  HKK++T+ ER  + F  D RCP C  +EE I HC+R+C  A
Sbjct  119  RIRTFLFLYSHKKILTHQERVCKNFAIDPRCPTCQVNEESILHCLRECLAA  169



>ref|XP_002456315.1| hypothetical protein SORBIDRAFT_03g033860 [Sorghum bicolor]
 gb|EES01435.1| hypothetical protein SORBIDRAFT_03g033860 [Sorghum bicolor]
Length=397

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 33/111 (30%), Positives = 46/111 (41%), Gaps = 20/111 (18%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTI-----------------ATKGEGGEHNRTWKTIWKLKVPRK  151
            L W  D  G  SV SAY +                 ++ G+G E  + W+ IW ++ P +
Sbjct  27   LAWHYDPKGLFSVKSAYRVCCDDQNRRSKNDWAASSSSNGDGNE--KVWRLIWDMQAPSR  84

Query  152  ISNVLWILKHKKLMTNLERRRRGF-TSDARCPQCANHEEDITHCIRDCTEA  301
            + + LW L H  L   L  + RG    D RC  C    ED  H    C +A
Sbjct  85   LKHFLWRLAHNSLALRLNLKHRGVQVEDDRCIMCNRLGEDGAHLFLKCKQA  135



>ref|XP_006580700.1| PREDICTED: uncharacterized protein LOC102670374 [Glycine max]
Length=247

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 46/97 (47%), Gaps = 4/97 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATK-GEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            + L W+ D TG  S  SAY + +         R+++ IWKL +P K +   W L   +L 
Sbjct  45   DSLLWRADPTGMYSTRSAYRLLSNLNSAASDGRSFQLIWKLNIPPKAAIFTWRLLKDRLP  104

Query  194  T--NLERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
            T  NL RR  G   +  CP C   +E+  H    C++
Sbjct  105  TRANLHRRNVGL-QEVTCPLCHVEQEEAGHLFFHCSQ  140



>gb|EEC83100.1| hypothetical protein OsI_28249 [Oryza sativa Indica Group]
Length=1300

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 9/100 (9%)
 Frame = +2

Query  29    WKLDCTGRCSVSSAYTIA---------TKGEGGEHNRTWKTIWKLKVPRKISNVLWILKH  181
             W  D  GR SV SAY +A         +   G E ++ W  +W   VP+K+   +W    
Sbjct  925   WHSDKLGRFSVRSAYHLALSLSNVVASSSSSGQELSKAWNQLWSCHVPQKVRIFIWRAAS  984

Query  182   KKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
               L T + ++++     + C  C   EED+ H +  C  A
Sbjct  985   NSLATMVNKKKKRLEHCSMCSICGTEEEDVAHALCRCPHA  1024



>ref|XP_010512944.1| PREDICTED: uncharacterized protein LOC104788863 [Camelina sativa]
Length=876

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 5/100 (5%)
 Frame = +2

Query  14   IEELYWKLDCTGRCSVSSAYTIATKG--EGGEHNRT--WKTIWKLKVPRKISNVLWILKH  181
            +++  W    +G+ SV S Y +AT+G  E  E + T   K +WK K+ RKI + LW +  
Sbjct  517  VDDYVWSYTKSGQYSVRSGYALATQGIQEVLEPSITPLKKQVWKAKISRKIKHFLWQVLS  576

Query  182  KKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
              L  N     R   +D  CP+C   EE I H + +C  A
Sbjct  577  GALAANGRLAERHSGTDKSCPRCG-EEESINHLLFECPPA  615



>ref|XP_006590046.1| PREDICTED: uncharacterized protein LOC102666665 [Glycine max]
Length=215

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 4/92 (4%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAY-TIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT--N  199
            WK D +G  S  S Y  I  +  G +H   +  +WKLK+P K     W +   +L T  N
Sbjct  24   WKHDSSGHYSKKSGYDLIRREVAGADHTSDFVELWKLKIPAKSVVFAWRIIRDRLPTKSN  83

Query  200  LERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
            L RRR+   +D  CP C   EE+ TH    C+
Sbjct  84   L-RRRQVMLTDTLCPFCRTEEEEATHLFFSCS  114



>gb|EEC84753.1| hypothetical protein OsI_31756 [Oryza sativa Indica Group]
Length=1350

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 9/100 (9%)
 Frame = +2

Query  29    WKLDCTGRCSVSSAYTIA---------TKGEGGEHNRTWKTIWKLKVPRKISNVLWILKH  181
             W  D  GR SV SAY++A         +     + ++ W  +WK  VP+K+    W +  
Sbjct  1202  WHPDRLGRFSVRSAYSLAVSLASENAFSASSAVDRSKAWNMLWKCNVPQKVKIFAWKVAL  1261

Query  182   KKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
               L T + ++RR   +   C  C   EED  H +  C  A
Sbjct  1262  DCLATMVNKKRRKLEATDVCAICGTEEEDSAHALCRCPHA  1301



>gb|KHN37115.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=200

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 42/90 (47%), Gaps = 2/90 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEG-GEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            W+ D +G  +V SAY +  +    G  +  +  +WKLKVP K +   W L   +L T + 
Sbjct  11   WRGDPSGHYTVQSAYNLLREATADGIQDSVYHELWKLKVPLKCTIFAWRLLRDRLPTKIN  70

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDC  292
              RR    SD  CP C N  ED  H    C
Sbjct  71   LHRRQVEVSDTSCPLCRNAVEDAGHLFFHC  100



>ref|XP_006467327.1| PREDICTED: uncharacterized protein LOC102625297 [Citrus sinensis]
Length=412

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/92 (32%), Positives = 39/92 (42%), Gaps = 0/92 (0%)
 Frame = +2

Query  26   YWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            YW  D  G  SV S Y +      G     W+ +W  KVP K+ N +W   H  L T L 
Sbjct  140  YWMADSRGCYSVRSCYKVLNPITPGSLADVWRKLWNSKVPNKVKNFIWRAAHNVLPTALN  199

Query  206  RRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
               +     A C  C  +EE + H +  C+ A
Sbjct  200  LISKRVDVPAMCSVCNAYEETVLHSLVACSFA  231



>ref|XP_006493122.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=765

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 7/99 (7%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATK-------GEGGEHNRTWKTIWKLKVPRKISNVLWIL  175
            +++ W  D  G  SV S Y +A +           E N +W +IW L++P K+   +W  
Sbjct  410  DQVLWHYDKKGNYSVKSGYQLALQMKFPNRPSSSKEDNNSWNSIWYLQIPEKVKIFMWRA  469

Query  176  KHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             +  L T+    +R       C +C +H E I H + DC
Sbjct  470  TNDLLPTSENLWKRRILQTPWCQRCRSHRETIFHSLFDC  508



>gb|KHN23636.1| hypothetical protein glysoja_044901, partial [Glycine soja]
Length=139

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 2/93 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKG-EGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK   +G  S ++AY    +   G   + ++  +WKLK+P K     W L   +L T L 
Sbjct  41   WKQHSSGIYSTNTAYKFLMEEIRGDPVDGSFVFLWKLKIPPKAKIFTWRLIKDRLPTKLN  100

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDCTEA  301
             R R    +D  CP C N EED  H   +C++ 
Sbjct  101  LRGRQVEITDPMCPLCNNSEEDAAHLFFNCSKV  133



>gb|AAK39575.1|AC025296_10 putative reverse transcriptase [Oryza sativa Japonica Group]
 gb|AAP54636.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=791

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 47/109 (43%), Gaps = 12/109 (11%)
 Frame = +2

Query  2    EETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEH---------NRTWKTIWKLKVPRKI  154
            EE FI    W  D  G  SV SAY +A +    E          N+ W+ IWK KVP+K+
Sbjct  407  EEDFIA---WHPDKNGMFSVRSAYRLAAQLVNIEESSSSGTNNINKAWEMIWKCKVPQKV  463

Query  155  SNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                W +    L T + +++R       C  C    ED  H +  C +A
Sbjct  464  KIFAWRVASNCLATMVNKKKRKLEQSDMCQICDRENEDDAHALCRCIQA  512



>ref|XP_006464882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=769

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 7/99 (7%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATK-------GEGGEHNRTWKTIWKLKVPRKISNVLWIL  175
            +++ W  D  G  SV S Y +A +           E N +W +IW L++P K+   +W  
Sbjct  410  DQVLWHYDKKGNYSVKSGYQLALQMKFPNRPSSSKEDNNSWNSIWYLQIPEKVKIFMWRA  469

Query  176  KHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             +  L T+    +R       C +C +H E I H + DC
Sbjct  470  TNDLLPTSENLWKRRILQTPWCQRCRSHRETIFHSLFDC  508



>ref|XP_006577478.1| PREDICTED: uncharacterized protein LOC102661604 [Glycine max]
Length=189

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 43/94 (46%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAY-TIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            + + WK D +G  S  SAY  + T        R ++T+WKLK+P +     W L   +L 
Sbjct  23   DTMVWKADPSGFYSTKSAYRLLMTFNRPIPERRIFQTLWKLKIPPRAGVFSWRLIKDRLP  82

Query  194  TNLERRRRGF-TSDARCPQCANHEEDITHCIRDC  292
            T     RR     D  CP C + +E+  H   +C
Sbjct  83   TRANLLRRNVPIQDTMCPLCGSQQEEAGHLFFNC  116



>gb|EMT20940.1| ABC transporter C family member 10 [Aegilops tauschii]
Length=2212

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 33/111 (30%), Positives = 44/111 (40%), Gaps = 15/111 (14%)
 Frame = +2

Query  5    ETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEHN------------RTWKTIWKLKVPR  148
            E FI    W  + +G  SV SAY +A   +    +            + W  +WK  VP 
Sbjct  269  EDFIA---WHFERSGVFSVRSAYRLAVNDKEANRDLGQSSTAPTGERKIWSVLWKANVPP  325

Query  149  KISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            KI N  W L  + L     R +RG      C  C    ED  H +  CT+A
Sbjct  326  KIRNFGWRLATESLRVQTSRHKRGLELFPTCSICGMEPEDGYHAVMRCTKA  376



>gb|KHN05438.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=431

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query  14   IEELYWKLDCTGRCSVSSAYTIATKG-EGGEHNRTWKTIWKLKVPRKISNVLWILKHKKL  190
            ++   WK D  G  S  S Y +   G      N  +  +W LK+P K +   W L   +L
Sbjct  231  VDTWMWKPDPRGYYSTKSGYDMIWGGLMEANQNSDFVDLWSLKIPAKAAVFAWRLIRDRL  290

Query  191  MTNLE-RRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
             T L  RRR+   +D  CP C N EE+  H    C++
Sbjct  291  PTKLNLRRRQVMVNDMLCPFCRNKEEEAAHLFFSCSK  327



>ref|XP_006657175.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Oryza 
brachyantha]
Length=523

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 2/93 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            +EL WKL   G  +V SAY++         +   + IW+ K P ++   +W+    +++T
Sbjct  335  DELIWKLTAHGHFTVGSAYSLFFISR--MQSEVGQLIWRSKAPGRVKFFIWLAVRGRVLT  392

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
            +    +RG+T   RC  C  H+ED  H    CT
Sbjct  393  SNNLCKRGWTHQDRCVLCNAHQEDGHHLFLGCT  425



>ref|XP_002466153.1| hypothetical protein SORBIDRAFT_01g002325 [Sorghum bicolor]
 gb|EER93151.1| hypothetical protein SORBIDRAFT_01g002325 [Sorghum bicolor]
Length=763

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 41/96 (43%), Gaps = 10/96 (10%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKG----EGGEHNRTWKTIWKLKVPRKISNVLWILKHK  184
            +   WK    G  S SSAY     G    EG          WK  +P K+    W+  H 
Sbjct  567  DRFIWKWTADGSYSASSAYRAFFMGRMEMEGA------MLAWKAMIPPKMKFFFWLALHG  620

Query  185  KLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            +L T   RRR G  ++A C  C+ H+E I H +  C
Sbjct  621  RLWTAERRRRHGLQAEAACALCSQHDETIDHLLIAC  656



>gb|KHN43777.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=413

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 43/90 (48%), Gaps = 2/90 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTW-KTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            W  D +   S  SAY +  +   G     W K +WK+K+PRKI+  +W L   +L T + 
Sbjct  250  WLGDQSRNYSTRSAYNLVLEASTGGQQEEWCKELWKIKIPRKITVFVWRLIKDRLPTRMN  309

Query  206  RRRRGFT-SDARCPQCANHEEDITHCIRDC  292
              RR     D RCP C   EE+ +H    C
Sbjct  310  LHRRQVQLQDLRCPFCREAEEEASHLFFHC  339



>gb|ABN08723.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=355

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIAT----KGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            WK   TG  +V SAY I +      +   +N +W  IW L +P ++   LW L H  L T
Sbjct  82   WKTTTTGNYTVKSAYRICSDLLHPHDSAHNNSSWMNIWNLNIPHRVRAFLWRLAHNCLPT  141

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             +    RG   +  C    N  E  TH    C +A
Sbjct  142  RVNLNARGIQCEESCVMFENFAECHTHLFFVCAKA  176



>gb|AAS55787.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAV32224.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1936

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 12/109 (11%)
 Frame = +2

Query  2     EETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEH---------NRTWKTIWKLKVPRKI  154
             EE FI    W  D TGR SV SAY +A +     +         N++W+ IWK  VP+K+
Sbjct  1637  EEDFIA---WHPDKTGRFSVRSAYKLALQLADMNNCSSSSSSRLNKSWELIWKCNVPQKV  1693

Query  155   SNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                 W +    L T   +++R       C  C   +ED  H +  C  A
Sbjct  1694  RIFAWRVASNSLATMENKKKRNLERFDVCGICDREKEDAGHALCRCVHA  1742



>ref|XP_006580378.1| PREDICTED: uncharacterized protein LOC102670245 [Glycine max]
 gb|KHN17441.1| Putative ribonuclease H protein [Glycine soja]
Length=278

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNR--TWKTIWKLKVPRKISNVLWILKHKKL  190
            ++  WK D +G+ +  SAY +   GE  E  +   ++ +WKLK+P KI+   W L   +L
Sbjct  72   DQWVWKADPSGQYTAKSAYGVLW-GEMFEEQQDGVFEELWKLKLPSKITIFAWRLIRDRL  130

Query  191  MTNLERRRRGF-TSDARCPQCANHEEDITHCIRDCT  295
             T    RR+     D RCP C + EE   H    C+
Sbjct  131  PTRSNLRRKQIEVDDPRCPFCRSAEESAAHLFFHCS  166



>ref|XP_006587778.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=381

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 43/90 (48%), Gaps = 2/90 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEG-GEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            W+ D +G  +  SAY +  +    G H+  +  +WKLKVP K +   W L   +L T + 
Sbjct  207  WRGDPSGHYTAQSAYKLLREASAEGIHDTAYHELWKLKVPLKYAIFGWRLIRDRLPTKIN  266

Query  206  -RRRRGFTSDARCPQCANHEEDITHCIRDC  292
              RR+   SD  CP C N  ED  H    C
Sbjct  267  LHRRQVAVSDTSCPLCRNEVEDAGHLFFHC  296



>ref|XP_006591504.1| PREDICTED: uncharacterized protein LOC102664765 isoform X1 [Glycine 
max]
Length=263

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = +2

Query  47   GRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFT  226
            GR ++ S Y  +   + G+ N  +K +W+   P +   +LW    + L+TN  R ++G +
Sbjct  58   GRFTLESTYA-SISSQSGQANPLFKVVWRWSGPERTRILLWKTAQQALVTNDFRAKKGMS  116

Query  227  SDARCPQCANHEEDITHCIRDCTEA  301
                C  C    E+  HC RDC  A
Sbjct  117  LSNACHVCDVASENAVHCFRDCPHA  141



>ref|XP_002438073.1| hypothetical protein SORBIDRAFT_10g007695 [Sorghum bicolor]
 gb|EER89440.1| hypothetical protein SORBIDRAFT_10g007695 [Sorghum bicolor]
Length=191

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 35/89 (39%), Gaps = 2/89 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            WKL   G+ S SSAY     G         K +WK   P K+    W+  H +L T   R
Sbjct  3    WKLTSDGQYSSSSAYRAFFAGSTTLLGA--KELWKTNAPSKVKFFFWLALHGRLWTAARR  60

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCT  295
             R G    A C  C   +E   H +  C 
Sbjct  61   ARHGLQQTASCSLCGQQDETSDHLLLSCV  89



>gb|ABN06084.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=519

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/97 (32%), Positives = 44/97 (45%), Gaps = 4/97 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATK----GEGGEHNRTWKTIWKLKVPRKISNVLWILKHK  184
            + + WK +  G+ SV SAYT+  +             W  IW+LKVP KI N +W +   
Sbjct  131  DRIIWKAENDGKYSVRSAYTLCVEELIDTSFLRRPGYWSDIWRLKVPPKIKNFMWRVCRG  190

Query  185  KLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
             L T  + R +G      C  C+   ED+ H    CT
Sbjct  191  VLPTRNKLRDKGVQCPEACVNCSTTSEDVKHLFCVCT  227



>ref|XP_006588063.1| PREDICTED: uncharacterized protein LOC102660652 [Glycine max]
Length=240

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAY--TIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKL  190
            + + WK D +G  S  SAY   + T  +  E N  +KTIW L +P +     W L   +L
Sbjct  38   DTMLWKADSSGVYSTKSAYRLLLTTNSQLPEPN-IYKTIWNLNIPSRAVVFSWRLIKDRL  96

Query  191  MTNLERRRRG-FTSDARCPQCANHEEDITHCIRDC  292
             T     RR  F  D  CP C  ++E+  H   +C
Sbjct  97   HTRYNLLRRNVFIPDQVCPLCGYYQEEAGHLFFNC  131



>ref|XP_004298270.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=393

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 44/108 (41%), Gaps = 20/108 (19%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIAT----------------KGEGGEHNRTWKTIWKLKVPR  148
            ++L+W  D  G   V S Y I                   G GG     WK IW+  VP 
Sbjct  6    DKLFWHYDKHGVYQVKSGYHITRITDQTVGCASSSGTVGPGSGG----CWKKIWQANVPP  61

Query  149  KISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            K+ + +W L  + + T     RR F +D RC  C N  E   H  RDC
Sbjct  62   KVRSFIWRLCLEVIPTRAALSRRLFITDVRCIFCGNEVETGLHLFRDC  109



>ref|XP_008375111.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=922

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 45/103 (44%), Gaps = 11/103 (11%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAY------TIATKGEGGEHNRT-----WKTIWKLKVPRKISNV  163
            + L W     GR SV S Y      ++  +     H R+     WK +WK++VP KI + 
Sbjct  615  DRLIWAASKNGRYSVKSGYRWIQSRSLCLRDSRLPHARSVPEELWKCLWKIEVPPKIRHF  674

Query  164  LWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            LW   H  L TN+   +R  ++   CP C   +E   H    C
Sbjct  675  LWSSLHNALATNMNLFKRXASNSPICPICLCDDESTVHIFLLC  717



>gb|ABO80459.1| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease 
H [Medicago truncatula]
Length=869

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/95 (31%), Positives = 44/95 (46%), Gaps = 2/95 (2%)
 Frame = +2

Query  14   IEELY-WKLDCTGRCSVSSAYTIATKGEGGEHN-RTWKTIWKLKVPRKISNVLWILKHKK  187
            IE+++ W  +  G  S  S Y       G ++N  +W  I K K+  K   ++W+  H  
Sbjct  515  IEDVFIWPHNKNGTYSAKSGYQWLLSLSGNDNNTHSWSWILKKKISEKYKFLIWLACHDS  574

Query  188  LMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            L T      R   + A C +C   +E + HCIRDC
Sbjct  575  LPTAALLHHRQIIASATCARCGVSDESVFHCIRDC  609



>gb|EEC74955.1| hypothetical protein OsI_10942 [Oryza sativa Indica Group]
Length=961

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/104 (31%), Positives = 43/104 (41%), Gaps = 14/104 (13%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIA-------------TKGEGGEHNRTWKTIWKLKVPRKISNVLW  169
            W  D +G  +V SAY +A             +    GE    WK IW  +VP+K+    W
Sbjct  744  WHYDKSGIFTVRSAYKVALDALLRSDNTGESSSAPNGERT-LWKNIWNTQVPQKVRIFAW  802

Query  170  ILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
             L    L T  +++RR       C  C   EED  H    CT+A
Sbjct  803  RLARDCLATQAKKKRRNIVKSPVCEICGKCEEDGFHATVACTKA  846



>ref|NP_001176302.1| Os11g0106066 [Oryza sativa Japonica Group]
 gb|ABA91072.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 dbj|BAH95030.1| Os11g0106066 [Oryza sativa Japonica Group]
Length=1690

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 49/109 (45%), Gaps = 12/109 (11%)
 Frame = +2

Query  2     EETFIEELYWKLDCTGRCSVSSAYTIATKGEGGE--------HNR-TWKTIWKLKVPRKI  154
             EE F   L W  D +GR SV SAY +A +    E        H+R +W  IWK K+P+KI
Sbjct  1485  EEDF---LAWHPDKSGRFSVRSAYNLACRLANTEGSSSSFALHSRKSWDLIWKCKLPQKI  1541

Query  155   SNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                 W +    L T   +R+R   +   C  C    E+  H +  C  A
Sbjct  1542  KIFAWKVASNCLATMDNKRKRKLVNSDICIICNREVENSVHALFKCPRA  1590



>ref|XP_002467657.1| hypothetical protein SORBIDRAFT_01g031750 [Sorghum bicolor]
 gb|EER94655.1| hypothetical protein SORBIDRAFT_01g031750 [Sorghum bicolor]
Length=170

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 29/62 (47%), Gaps = 0/62 (0%)
 Frame = +2

Query  116  WKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
            W+ IW L  P+K+++ LW L H  L      RRRG   +  C  C   +ED  H    C 
Sbjct  7    WRNIWNLNCPKKMTHFLWRLGHNSLALRTNLRRRGMGINPSCVMCGRFDEDGAHLFFKCK  66

Query  296  EA  301
            E 
Sbjct  67   EV  68



>ref|XP_008346916.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1007

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 45/103 (44%), Gaps = 11/103 (11%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAY------TIATKGEGGEHNRT-----WKTIWKLKVPRKISNV  163
            + L W     GR SV S Y      ++  +     H R+     WK +WK++VP KI + 
Sbjct  615  DRLIWAASKNGRYSVKSGYRWIQSRSLCLRDSRLPHARSVPEELWKCLWKIEVPPKIRHF  674

Query  164  LWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            LW   H  L T +   +RG ++   CP C   +E   H    C
Sbjct  675  LWSSLHNALATKVNLFKRGASNSPICPICLCDDESTVHIFLLC  717



>gb|EEC67895.1| hypothetical protein OsI_35569 [Oryza sativa Indica Group]
Length=724

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 0/79 (0%)
 Frame = +2

Query  62   SSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARC  241
            +S  T A+   G + ++ WK +WKL  P K+ + +W L H  +   +  +RRG   D +C
Sbjct  470  NSRRTPASSSGGAQSDQVWKRLWKLNCPNKMKHFMWRLGHDAIALRMTLKRRGMDIDTKC  529

Query  242  PQCANHEEDITHCIRDCTE  298
                  +ED +H    C E
Sbjct  530  LISNRMDEDGSHFFFKCKE  548



>ref|XP_010671945.1| PREDICTED: uncharacterized protein LOC104888619 [Beta vulgaris 
subsp. vulgaris]
Length=734

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 38/92 (41%), Gaps = 0/92 (0%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            + L W     G  S  +AY +   G     +  W  IW +++P K  + LW L    L T
Sbjct  383  DSLTWAYSKDGLYSTKTAYMLGKGGNLENLHEVWMDIWSMEIPPKAKHFLWRLCSDTLPT  442

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
                + R    D  CP CA  +E  TH +  C
Sbjct  443  RALLKHRHMLEDEACPWCATADETSTHALVQC  474



>ref|XP_006588172.1| PREDICTED: uncharacterized protein LOC102660511 [Glycine max]
Length=150

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 44/92 (48%), Gaps = 4/92 (4%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGE--GGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
            W  D +G  SV SAY +  +G    G  +R ++ +W+LK+P K +   W L   +L T +
Sbjct  49   WMADPSGSYSVQSAYKV-MRGPVVDGIKDRAFEELWQLKIPTKYAVFAWRLLRDRLPTRI  107

Query  203  ERRRRGF-TSDARCPQCANHEEDITHCIRDCT  295
               RR     D  CP C+  EE+  H    C 
Sbjct  108  NLHRRQIDILDRHCPFCSREEEEAGHLFFHCN  139



>ref|XP_006605131.1| PREDICTED: uncharacterized protein LOC102660681 [Glycine max]
Length=247

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 42/92 (46%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGE-HNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK D  G  S  SAY +  +G      +R    +W LK+P + S   W L   +L T   
Sbjct  49   WKSDPNGLYSTKSAYKVLQEGHASAIEDRVLNIMWSLKIPPRASAFSWRLFKNRLPTRDN  108

Query  206  RRRRGFTSDA-RCPQCANHEEDITHCIRDCTE  298
             RRR  + D   CP C   EE + H   +C++
Sbjct  109  LRRRQVSLDTYSCPLCDLEEEYVNHLFFNCSK  140



>gb|KHN41452.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=194

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 42/91 (46%), Gaps = 4/91 (4%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEG-GEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT--N  199
            WK + +G  S  SAY +       G     +K IWKLKVP + +   W L   +L T  N
Sbjct  98   WKAESSGVYSTKSAYRLMLNNNASGSDVSIFKLIWKLKVPPRAAVFTWRLLKDRLPTKGN  157

Query  200  LERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            L  RR     D  CP C   +E++ H   +C
Sbjct  158  L-LRRNVLLQDEGCPLCGQEQEEVGHLFFNC  187



>emb|CAN65543.1| hypothetical protein VITISV_018575 [Vitis vinifera]
Length=185

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 2/95 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            + + WK    G  SV S +              W+ IW   VP K+    W     K++T
Sbjct  37   DRMVWKESKDGIFSVKSCFNSLDHSSAVPF--PWRIIWSTFVPTKVGFFAWEASWGKVLT  94

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
              + +RRG+    RCP C + EE I H +  C++A
Sbjct  95   QDQLKRRGWNLANRCPLCCDEEETINHILIHCSKA  129



>ref|XP_010436639.1| PREDICTED: uncharacterized protein LOC104720434 [Camelina sativa]
Length=398

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = +2

Query  116  WKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            W  +W + V  ++   LW++ ++ +MTN ER RR  +  + C  C   EE I H +RDC
Sbjct  244  WSRVWNVMVLERVRAFLWLVDNQAIMTNSERFRRHLSDSSLCTVCKWGEETILHILRDC  302



>gb|EMS63991.1| Cycloartenol synthase [Triticum urartu]
Length=809

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 11/107 (10%)
 Frame = +2

Query  5    ETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEHNRT-----------WKTIWKLKVPRK  151
            + F +E  W  D  G  SV S Y +  + +   ++R            W+ IW++  P K
Sbjct  622  DDFEDEWAWHYDSKGNFSVKSVYIMQCEQQKITNSRPEGEVWSCSSFRWQRIWRVGCPPK  681

Query  152  ISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            I + LW L +  L      +R G  +D  CP C   ++D  H    C
Sbjct  682  IEHFLWRLAYNSLPHGWSIQRHGIDADTLCPMCGRFKKDGAHTFLKC  728



>ref|XP_006603467.1| PREDICTED: uncharacterized protein LOC102665094 [Glycine max]
Length=247

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 42/87 (48%), Gaps = 2/87 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGE-HNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK D  G  S  SAY +  +    +  +   K++WKLK+P K+S   W     +L T   
Sbjct  49   WKPDTNGIFSTKSAYKVLQESHHSDSEDNVLKSMWKLKIPPKVSAFSWRFFKNRLPTRDN  108

Query  206  RRRRGFT-SDARCPQCANHEEDITHCI  283
             R+R  T S   CP C + EE I H +
Sbjct  109  LRKRQVTMSSYSCPLCDHEEESIYHLM  135



>ref|XP_006606690.1| PREDICTED: uncharacterized protein LOC102665012 [Glycine max]
Length=327

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 44/90 (49%), Gaps = 2/90 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTI-ATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            W  D  G  S  +AY +   +  GG     ++ +WKLK+P +I+   W L   +L T   
Sbjct  127  WSRDPAGHYSTRTAYNLLGEEVAGGRQEDCFEKLWKLKIPARIAVFAWRLIRDRLPTRQN  186

Query  206  RRRRGFT-SDARCPQCANHEEDITHCIRDC  292
             RRR    +D +CP C N EED ++    C
Sbjct  187  LRRRQVQITDLQCPFCKNSEEDASYLFFHC  216



>gb|KHN28359.1| hypothetical protein glysoja_029620 [Glycine soja]
Length=190

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 39/91 (43%), Gaps = 0/91 (0%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            W+        V + Y      E   +   ++ IW+ +  ++   +LW +    L TN  R
Sbjct  100  WRSSSYRNFKVKNVYHCVANLENSPNTMLFRIIWRWEGAKRSRVLLWKMAKGALATNEAR  159

Query  209  RRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            R  GFT    CP C N +E   HC+RD   A
Sbjct  160  REMGFTESWSCPMCENEKETTFHCMRDFQHA  190



>ref|XP_010686132.1| PREDICTED: uncharacterized protein LOC104900412 [Beta vulgaris 
subsp. vulgaris]
Length=1114

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 0/92 (0%)
 Frame = +2

Query  17    EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
             ++L W     G  SV +AY + T G   + +R W  +W L V  K+ + LW      L  
Sbjct  974   DDLTWAYAKDGNYSVKTAYMLGTGGNLDDFHRVWNILWSLNVSPKVRHFLWRACTSSLPV  1033

Query  197   NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
                 +RR    +A CP CA  +E   H    C
Sbjct  1034  RKVLQRRHLIDEAGCPCCAREDETQLHLFYRC  1065



>gb|KHN02645.1| hypothetical protein glysoja_045754, partial [Glycine soja]
Length=193

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATK-GEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT--N  199
            W+ D TG  S  SAY + +         R+++ IWKL +P K +   W L   +L T  N
Sbjct  1    WRADPTGMYSTRSAYRLLSNLNSAASDGRSFQLIWKLNIPPKAAIFTWRLLKDRLPTRAN  60

Query  200  LERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
            L RR  G   +  CP C   +E+  H    C++
Sbjct  61   LHRRNVGL-QEVTCPLCHVEQEEAGHLFFHCSQ  92



>ref|XP_006598664.1| PREDICTED: uncharacterized protein LOC102660905 [Glycine max]
Length=250

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 49/97 (51%), Gaps = 4/97 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEG-GEHNRTWKTIWKLKVPRKISNVLWILKHKKL-  190
            ++  W LD +G+ +  SAY +   G   G  +R ++ +WK+KVP K +   W L   +L 
Sbjct  45   DDWVWTLDPSGQYTAKSAYRMMMGGATHGTQDRDFEELWKMKVPTKFAVFAWRLLRDRLP  104

Query  191  -MTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTE  298
              TNL+ R+     D  C  C N EE+  H    CT+
Sbjct  105  SKTNLQGRQVE-IDDRTCLFCKNAEEEAGHLFFHCTK  140



>ref|XP_006352964.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum 
tuberosum]
Length=323

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (46%), Gaps = 0/92 (0%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            + L+WK    G   V +AY +  +         W+ IWK ++P K+S  +W+L  +  +T
Sbjct  128  DALWWKGSSKGIFKVGAAYRLMEQPSQQIPIWPWRQIWKGRIPYKVSCFIWLLAKEAALT  187

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
                 +RG T  +RC  C    E + H    C
Sbjct  188  QDNVMKRGITLCSRCFLCGETSETVNHLFLHC  219



>gb|KHN42568.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=375

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/92 (35%), Positives = 44/92 (48%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATK-GEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK D +G  S  SAY +  +   G E +     +W LK+P K +   W L   +L T   
Sbjct  210  WKADPSGNYSTKSAYRLLMEVTTGAEEDTNLMELWNLKIPLKQTVFAWRLIKDRLPTRTN  269

Query  206  RRRRGFT-SDARCPQCANHEEDITHCIRDCTE  298
             R R    +D+RCP C   +ED TH    CT+
Sbjct  270  LRTRQVELNDSRCPLCNRLDEDATHLFFHCTK  301



>ref|XP_002449211.1| hypothetical protein SORBIDRAFT_05g006430 [Sorghum bicolor]
 gb|EES08199.1| hypothetical protein SORBIDRAFT_05g006430 [Sorghum bicolor]
Length=375

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 45/110 (41%), Gaps = 20/110 (18%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTI-----------------ATKGEGGEHNRTWKTIWKLKVPRK  151
            L W  D  G  SV SAY +                 ++ G+G E  + W+ IW ++ P +
Sbjct  5    LAWHYDPKGLFSVKSAYRVFCDDQNRRSKNDWAASSSSNGDGTE--KVWRLIWDMQAPSR  62

Query  152  ISNVLWILKHKKLMTNLERRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
            + + LW L H  L   L  + RG    D RC  C    ED  H    C +
Sbjct  63   LKHFLWRLAHNSLALRLNLKHRGVQVEDDRCIMCNIQGEDGAHLFLKCKQ  112



>ref|XP_006598493.1| PREDICTED: uncharacterized protein LOC102664555 [Glycine max]
Length=146

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 49/101 (49%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    EETFIEELYWKLDCTGRCSVSSAYTIATKGEGGE-HNRTWKTIWKLKVPRKISNVLWILK  178
            + + ++ L W+ D +G  S  SAY +  + + G   +   K IW LK+P       W L 
Sbjct  15   QHSSLDILTWRADPSGIYSTKSAYKLLKEADSGAIEDSASKIIWNLKIPPTAIAFSWRLF  74

Query  179  HKKLMT--NLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
              KL T  NL RR+    S + CP C + EE  +H +  CT
Sbjct  75   KNKLPTRANLRRRQVDMPSYS-CPLCESKEEISSHVMFTCT  114



>emb|CAE02147.1| OSJNBa0081G05.2 [Oryza sativa Japonica Group]
 emb|CAH66305.1| OSIGBa0135K14.2 [Oryza sativa Indica Group]
 emb|CAH66320.1| OSIGBa0150M16.3 [Oryza sativa Indica Group]
Length=1711

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 12/109 (11%)
 Frame = +2

Query  2     EETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEH---------NRTWKTIWKLKVPRKI  154
             EE FI    W  D TGR SV SAY +A +     +         N++W+ IWK  VP+K+
Sbjct  1481  EEDFIA---WHPDKTGRFSVRSAYKLALQLADMNNCSSSSSSRLNKSWELIWKCNVPQKV  1537

Query  155   SNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                 W +    L T   +++R       C  C   +ED  H +  C  A
Sbjct  1538  RIFAWRVASNSLATMENKKKRNLERFDVCGICDREKEDAGHALCCCVHA  1586



>ref|XP_006579202.1| PREDICTED: uncharacterized protein LOC102666962 [Glycine max]
Length=270

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 45/95 (47%), Gaps = 4/95 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHN-RTWKTIWKLKVPRKISNVLWILKHKKLM  193
            + + WK++ TG  S SSAY +           R +K IW + +P + +   W L   +L 
Sbjct  73   DTMVWKVESTGVYSTSSAYRLMLNINASASTVRIFKLIWNMNIPPRAAIFTWRLLKDRLP  132

Query  194  T--NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            T  NL  RR   T DA CP C   +E+  H   +C
Sbjct  133  TKGNL-LRRNVITQDADCPLCGQVQEEAGHLFFNC  166



>gb|EEE53976.1| hypothetical protein OsJ_00596 [Oryza sativa Japonica Group]
Length=1066

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 45/112 (40%), Gaps = 15/112 (13%)
 Frame = +2

Query  2    EETFIEELYWKLDCTGRCSVSSAYTIATKGE------------GGEHNRTWKTIWKLKVP  145
            EE FI    W  D  G  +V SAY +A + +            G    + WK IW ++VP
Sbjct  779  EEDFIA---WHYDKVGMFTVFSAYKLALQAQIRADEEVAQCSNGDGDRKLWKNIWNVQVP  835

Query  146  RKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +KI    W +    L T   + RR       C  C    ED  H    CT+A
Sbjct  836  QKIRIFAWRVSRDCLATQHNKHRRQIVQKPNCEICGAEVEDAFHATVACTKA  887



>ref|XP_006603446.1| PREDICTED: uncharacterized protein LOC102669845 [Glycine max]
Length=151

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 44/92 (48%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIAT-KGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK +  G  S  SAY +     E G  +  +K +WKLK+P K S     L   +L T   
Sbjct  49   WKPESNGYYSSRSAYILLQGNSEEGNMDDIFKDLWKLKIPAKASIFAGRLIRDRLPTKSN  108

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
             R R    +D+ CP C+  EE  +H   DC++
Sbjct  109  MRERKIDINDSLCPFCSIKEETASHLFFDCSK  140



>ref|XP_003621614.1| DNA-directed RNA polymerase III subunit RPC6 [Medicago truncatula]
Length=456

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 0/62 (0%)
 Frame = +2

Query  107  NRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIR  286
            ++ WK IWKL +P ++ N +W L    + T    RRRG   D  CP C + +E   H   
Sbjct  257  DKLWKLIWKLPLPTRVRNFMWKLARNIIPTRCNLRRRGVVLDTVCPLCFDADESSNHRFM  316

Query  287  DC  292
             C
Sbjct  317  AC  318



>gb|EEE59920.1| hypothetical protein OsJ_12548 [Oryza sativa Japonica Group]
Length=1076

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 45/94 (48%), Gaps = 6/94 (6%)
 Frame = +2

Query  20   ELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTN  199
            +L W L  +G+  V S+ + AT GE     + W  +W  KV  K+   +W L   KL T 
Sbjct  712  KLAWNL--SGKGVVQSSSSTATSGE----RKIWSRVWNAKVQAKVKIFIWKLAQDKLPTW  765

Query  200  LERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
              +RRR    +  CP C    E+  H   +CT+A
Sbjct  766  ENKRRRKIEMNGTCPVCGTKGENSYHATVECTKA  799



>gb|AAS55772.2| hypothetical protein [Oryza sativa Japonica Group]
Length=493

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 2/100 (2%)
 Frame = +2

Query  2    EETFIEELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKH  181
            +E   + + W+    G  S +SAY I   G G + NR+    WK KV  K     W++ H
Sbjct  303  QEGIDDAIAWRWTPNGSYSANSAYRIQFVG-GIQDNRS-DFFWKAKVENKCKFFGWLMIH  360

Query  182  KKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
            +K++T  + + RG+ +   CP C    E  TH + +C  A
Sbjct  361  RKILTADKLQLRGWDNSHICPLCGVEPETATHLLMECAFA  400



>ref|XP_002452062.1| hypothetical protein SORBIDRAFT_04g017846 [Sorghum bicolor]
 gb|EES05038.1| hypothetical protein SORBIDRAFT_04g017846 [Sorghum bicolor]
Length=397

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 42/93 (45%), Gaps = 16/93 (17%)
 Frame = +2

Query  5    ETFIEELYWKLDCTGRCSVSSAYTIATK---------GEGGEHNR----TWKTIWKLKVP  145
            E FI    W  +  G  SV SAY +A K         G+ G  +R     WK+IW+LK P
Sbjct  308  ENFIS---WHFEKLGIFSVKSAYRVARKMVINSNTANGQQGSTSRGVDSVWKSIWRLKCP  364

Query  146  RKISNVLWILKHKKLMTNLERRRRGFTSDARCP  244
             K+ + LW   H      +   RRG T   RCP
Sbjct  365  NKLKHFLWRFGHNSHPLRINLVRRGMTIPTRCP  397



>ref|XP_010692615.1| PREDICTED: uncharacterized protein LOC104905704 [Beta vulgaris 
subsp. vulgaris]
Length=1052

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 40/100 (40%), Gaps = 8/100 (8%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGG--------EHNRTWKTIWKLKVPRKISNVLWI  172
            + LYW L  +G  S  + Y    + +          E  R + T+W L +  K    +W 
Sbjct  694  DSLYWPLTKSGAYSTKTGYAFICQQQQNDICSMTSPEQKRFFTTLWSLNIMPKWKLFIWK  753

Query  173  LKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            L H  L TN    RRG   D  CP C   +E + H    C
Sbjct  754  LWHNSLATNSNLLRRGIGGDGLCPICLYEDETLGHLFCRC  793



>ref|XP_006584370.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=195

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 42/92 (46%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKT-IWKLKVPRKISNVLWILKHKKLMTNLE  205
            W  D +G CS  SAY +  +   G     W   +WK K+P KI+   W L   +L     
Sbjct  48   WLGDPSGNCSTRSAYNLMWEEITGGQKEDWSVELWKTKIPSKIAVFAWRLCRGRLPIKEN  107

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
             RRR    +D  CP C+   ED +H    CT+
Sbjct  108  LRRRHLEINDMLCPFCSGVVEDESHLFIHCTK  139



>gb|KHN02883.1| Putative ribonuclease H protein [Glycine soja]
Length=313

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = +2

Query  107  NRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIR  286
            N +W  +W +K+P+ I   LW+  HK L T      R  +S+  C +C+N  E + H +R
Sbjct  102  NNSW--MWLMKIPQNIKFFLWLTSHKSLPTKFFLVYRHLSSNPFCCRCSNQVESVLHLLR  159

Query  287  DCTEA  301
            DC +A
Sbjct  160  DCDKA  164



>ref|XP_006575923.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Glycine max]
Length=574

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 46/92 (50%), Gaps = 2/92 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNR-TWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WK D +G  S  +AY    K    E++   +  +WKLK+P KI+   W L + +L T   
Sbjct  24   WKADTSGHYSAKTAYQTLRKDISQENDDGAFGELWKLKIPTKIAAFAWRLINDRLPTRTN  83

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRDCTE  298
             R+R    +D+ CP C+  EE   H    C++
Sbjct  84   LRKRHIEVTDSSCPFCSLVEETAGHIFFQCSK  115



>ref|XP_008366111.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=272

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = +2

Query  116  WKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            WK IWKL+ P KI N +W   H+ ++T     +R  +    CP C +H+E I H    C
Sbjct  118  WKIIWKLEAPLKIRNFMWRTMHEAIVTMANLYQRQSSPSLLCPICKSHDESIEHMFLKC  176



>ref|XP_007015140.1| Ribonuclease H protein, putative [Theobroma cacao]
 gb|EOY32759.1| Ribonuclease H protein, putative [Theobroma cacao]
Length=337

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLER  208
            W     G  +V+SAY  + +   G ++  WKTIWKL   RK+   +W + H  L T    
Sbjct  186  WIFTSNGEFTVNSAYK-SQQVSTGANSSFWKTIWKLPCSRKVCLFIWRVLHNSLPTGNWL  244

Query  209  RRRGFTSDARCPQCANHEEDITHCI  283
             RR  +    CP+   HEE I H +
Sbjct  245  SRRNMSGLGLCPRYELHEETILHAM  269



>ref|XP_006355601.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum 
tuberosum]
Length=399

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (46%), Gaps = 0/92 (0%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMT  196
            + L+WK    G   V +AY +  +         W+ IWK ++P K+S  +W+L  +  +T
Sbjct  204  DALWWKGSSKGIFKVGAAYRLMEQPSQQIPIWPWRQIWKGRIPYKVSCFIWLLAKEAALT  263

Query  197  NLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
                 +RG T  +RC  C    E + H    C
Sbjct  264  QDNVMKRGITLCSRCFLCGETSETVNHLFLHC  295



>gb|AAK71569.2|AC087852_29 putative reverse transcriptase [Oryza sativa Japonica Group]
Length=1833

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 45/94 (48%), Gaps = 6/94 (6%)
 Frame = +2

Query  20    ELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTN  199
             +L W L  +G+  V S+ + AT GE     + W  +W  KV  K+   +W L   KL T 
Sbjct  931   KLAWNL--SGKGVVQSSSSTATSGE----RKIWSRVWNAKVQAKVKIFIWKLAQDKLPTW  984

Query  200   LERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
               +RRR    +  CP C    E+  H   +CT+A
Sbjct  985   ENKRRRKIEMNGTCPVCGTKGENSYHATVECTKA  1018



>gb|EEC76169.1| hypothetical protein OsI_13484 [Oryza sativa Indica Group]
Length=1874

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 45/94 (48%), Gaps = 6/94 (6%)
 Frame = +2

Query  20   ELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTN  199
            +L W L  +G+  V S+ + AT GE     + W  +W  KV  K+   +W L   KL T 
Sbjct  906  KLAWNL--SGKGVVQSSSSTATSGE----RKIWSRVWNAKVQAKVKIFIWKLAQDKLPTW  959

Query  200  LERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
              +RRR    +  CP C    E+  H   +CT+A
Sbjct  960  ENKRRRKIEMNGTCPVCGTKGENSYHATVECTKA  993



>ref|XP_008382787.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=801

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = +2

Query  116  WKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
            WK IWKL+VP K+ + LW+  H  L T     RR  +    CP C +H+E I H    C
Sbjct  470  WKAIWKLEVPPKLRHFLWLTLHNCLPTCEALFRRRSSLSXTCPXCLSHDETIEHLFFTC  528



>ref|XP_006603213.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=375

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 45/94 (48%), Gaps = 2/94 (2%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYT-IATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
            +E  W  D T + S  SAY  I    +GG+H    K +W++K+P KIS   W L   +L 
Sbjct  172  DEWEWLGDQTRKYSTRSAYNLILEASKGGQHQDWCKELWRIKIPSKISVFAWRLIEDRLP  231

Query  194  TNLERRRRGFT-SDARCPQCANHEEDITHCIRDC  292
            T +   RR     D RCP C    E+ +H    C
Sbjct  232  TRMNLHRRQVQLQDLRCPFCREAVEEASHLFFHC  265



>ref|XP_009334551.1| PREDICTED: uncharacterized protein LOC103927359 [Pyrus x bretschneideri]
Length=1270

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +2

Query  116  WKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
            WK IWKL+VP K+ + LW+  H  L T     RR  +  + CP C  H+E I H    C+
Sbjct  939  WKGIWKLEVPPKLRHFLWLTVHNCLPTRDALFRRRSSQTSTCPICCCHDETIEHIFLSCS  998



>gb|KHN27164.1| Putative ribonuclease H protein, partial [Glycine soja]
Length=363

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 45/96 (47%), Gaps = 2/96 (2%)
 Frame = +2

Query  14   IEELYWKLDCTGRCSVSSAYTI-ATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKL  190
            ++ L W++D +G  S  SAY +    G     +  +K IW LK+P +     W +   +L
Sbjct  184  LDSLIWRVDPSGAYSTKSAYNLFKNDGSSDNEDSAFKIIWNLKIPPRAIAFSWRIFKNRL  243

Query  191  MTNLERRRRGFTSDA-RCPQCANHEEDITHCIRDCT  295
             T    RRR     + RCP C   EE + H +  CT
Sbjct  244  PTKANLRRRQVELPSYRCPLCDLKEESVGHIMFSCT  279



>ref|XP_006589988.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Glycine 
max]
Length=400

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = +2

Query  14   IEELYWKLDCTGRCSVSSAYTIATKGEGGEHNR--TWKTIWKLKVPRKISNVLWILKHKK  187
            ++ L W++D +G  S  SAY +  KGEG   N     K IW LK+P +     W +   +
Sbjct  197  LDSLIWRVDPSGAYSTKSAYNL-LKGEGSFDNEDSVSKIIWNLKIPPRAIAFSWRIFKNR  255

Query  188  LMTNLERRRRGFTSDA-RCPQCANHEEDITHCIRDCT  295
            L T    RRR     + RCP C   EE + H +  CT
Sbjct  256  LPTKANLRRRQVELPSYRCPLCDLKEESVGHIMFSCT  292



>ref|XP_009334552.1| PREDICTED: uncharacterized protein LOC103927360 [Pyrus x bretschneideri]
Length=1270

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +2

Query  116  WKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
            WK IWKL+VP K+ + LW+  H  L T     RR  +  + CP C  H+E I H    C+
Sbjct  939  WKGIWKLEVPPKLRHFLWLTVHNCLPTRDALFRRRSSQTSTCPICCCHDETIEHIFLSCS  998



>ref|XP_002520623.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41759.1| conserved hypothetical protein [Ricinus communis]
Length=102

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 37/83 (45%), Gaps = 0/83 (0%)
 Frame = +2

Query  23   LYWKLDCTGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNL  202
            +YW  D  GRCSV S Y ++   E   ++  W+ +W+LK+  K+ N  W      L T  
Sbjct  1    MYWGFDDMGRCSVKSCYRLSRGEEDISYSGFWQKLWRLKLQAKVLNFFWRACSGCLPTAD  60

Query  203  ERRRRGFTSDARCPQCANHEEDI  271
                   +    CP C N  E I
Sbjct  61   RLLTMKVSVPEICPVCMNGRESI  83



>ref|XP_008356060.1| PREDICTED: uncharacterized protein LOC103419743 [Malus domestica]
Length=1341

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 41/93 (44%), Gaps = 13/93 (14%)
 Frame = +2

Query  26    YWKLDC----TGRCSVSSAYTIATKGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLM  193
             +WK  C    TGR   SS+Y I        H++ WK IWKL  P KI N +W   H+ L 
Sbjct  1010  HWKKACSMPFTGR-GTSSSYLI--------HSKVWKAIWKLATPPKIRNFMWRALHRALA  1060

Query  194   TNLERRRRGFTSDARCPQCANHEEDITHCIRDC  292
             T      R  +    CP C   EE + H    C
Sbjct  1061  TMDVLFIRRCSPSPLCPICHAQEESVEHLFFLC  1093



>ref|XP_006405618.1| hypothetical protein EUTSA_v10028075mg [Eutrema salsugineum]
 gb|ESQ47071.1| hypothetical protein EUTSA_v10028075mg [Eutrema salsugineum]
Length=343

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/98 (34%), Positives = 43/98 (44%), Gaps = 4/98 (4%)
 Frame = +2

Query  17   EELYWKLDCTGRCSVSSAYTIATKGEGGEHNRTW---KTIWKLKVPRKISNVLWILKHKK  187
            + L W     G+ SV S Y ++      E  R +   K IWKL+   K+   LW    + 
Sbjct  25   DRLVWLPQKNGKYSVRSGYGLSVSETIPERQRNFNWQKNIWKLQTVPKVKQFLWRAVVEA  84

Query  188  LMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCTEA  301
                +E  RRG   D  C  C N  E ITH +RDC  A
Sbjct  85   FPVGVELVRRGIQVDFACKICGN-PETITHVLRDCQLA  121



>ref|XP_007015275.1| Uncharacterized protein TCM_040908 [Theobroma cacao]
 gb|EOY32894.1| Uncharacterized protein TCM_040908 [Theobroma cacao]
Length=106

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 39/84 (46%), Gaps = 5/84 (6%)
 Frame = +2

Query  56   SVSSAYTIATKGEG-----GEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRG  220
            S+ S +T+    E        H   W+ +WKL    K+   +W L H+ L T      RG
Sbjct  3    SILSMFTVKFAYEMQLENHPPHTICWRKVWKLHASNKVRMFIWRLLHESLPTVSWLANRG  62

Query  221  FTSDARCPQCANHEEDITHCIRDC  292
             ++ +    C  HEE++ H +RDC
Sbjct  63   LSTSSASSFCGAHEENLVHALRDC  86



>ref|XP_009375083.1| PREDICTED: uncharacterized protein LOC103963932 [Pyrus x bretschneideri]
Length=1815

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +2

Query  116   WKTIWKLKVPRKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEEDITHCIRDCT  295
             WK IWKL+VP K+ + LW+  H  L T     RR  +  + CP C  H+E I H    C+
Sbjct  1484  WKGIWKLEVPPKLRHFLWLTVHNCLPTRDALFRRRSSQTSTCPICCCHDETIEHIFLSCS  1543



>ref|XP_006579171.1| PREDICTED: uncharacterized protein LOC102669479 [Glycine max]
Length=308

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/89 (36%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +2

Query  29   WKLDCTGRCSVSSAYTIAT-KGEGGEHNRTWKTIWKLKVPRKISNVLWILKHKKLMTNLE  205
            WKL+  G  S  SAY +     E G  +  +K +WKLK+P K S   W L   +L T   
Sbjct  110  WKLESNGYYSSRSAYILLQGNSEEGNMDDIFKDLWKLKIPAKASIFAWRLIRDRLSTKSN  169

Query  206  RRRRGF-TSDARCPQCANHEEDITHCIRD  289
             R+R    +D+ CP C+  EE  +H   D
Sbjct  170  MRKRQIDINDSLCPFCSIKEETASHLFFD  198



>gb|AAX95132.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAX96361.1| hypothetical protein LOC_Os11g08530 [Oryza sativa Japonica Group]
 gb|ABA91835.1| expressed protein [Oryza sativa Japonica Group]
Length=371

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 35/101 (35%), Positives = 41/101 (41%), Gaps = 15/101 (15%)
 Frame = +2

Query  11   FIEELYWKLDCTGRCSVSSAY-TIATKGE--------------GGEHNRTWKTIWKLKVP  145
            F +   W  D  GR SV SAY T+  + E               G     W  IW L  P
Sbjct  46   FEDTAAWHFDPRGRFSVKSAYHTLEDQRERLSLRQVGESSSVSSGVAKLEWGRIWSLHYP  105

Query  146  RKISNVLWILKHKKLMTNLERRRRGFTSDARCPQCANHEED  268
             K+ + LW L H  L   L   RRG   D RCP C   +ED
Sbjct  106  PKVKHFLWRLAHNSLPLRLNIDRRGLEVDTRCPVCLWMDED  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519196836054