BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c90359_g1_i1 len=221 path=[199:0-220]

Length=221
                                                                      Score     E

ref|XP_002282490.1|  PREDICTED: lysM domain receptor-like kinase 4    92.8    7e-20   Vitis vinifera
ref|XP_009621604.1|  PREDICTED: lysM domain receptor-like kinase 4    90.5    4e-19   
gb|KHN38745.1|  Receptor-like serine/threonine-protein kinase NCRK    90.1    4e-19   
ref|XP_003539201.2|  PREDICTED: protein LYK5-like                     90.5    4e-19   
ref|XP_008385340.1|  PREDICTED: lysM domain receptor-like kinase 4    89.4    1e-18   
ref|XP_009356884.1|  PREDICTED: lysM domain receptor-like kinase 4    88.6    2e-18   
ref|XP_009776977.1|  PREDICTED: lysM domain receptor-like kinase 4    87.0    4e-18   
ref|XP_009779910.1|  PREDICTED: lysM domain receptor-like kinase 4    87.0    5e-18   
ref|XP_009802472.1|  PREDICTED: protein LYK5-like isoform X1          87.0    6e-18   
ref|XP_010109500.1|  Proline-rich receptor-like protein kinase PE...  87.0    6e-18   
ref|XP_006340406.1|  PREDICTED: protein LYK5-like                     85.9    1e-17   
ref|XP_004251402.1|  PREDICTED: lysM domain receptor-like kinase 4    86.3    1e-17   
emb|CAN60025.1|  hypothetical protein VITISV_006908                   85.5    2e-17   Vitis vinifera
ref|XP_007016790.1|  Kinase family protein / peptidoglycan-bindin...  85.5    2e-17   
ref|XP_006424535.1|  hypothetical protein CICLE_v10030184mg           85.5    3e-17   
ref|XP_004506041.1|  PREDICTED: protein LYK5-like                     84.7    4e-17   
ref|XP_008226039.1|  PREDICTED: lysM domain receptor-like kinase 4    84.7    5e-17   
ref|XP_007206854.1|  hypothetical protein PRUPE_ppa027141mg           84.7    5e-17   
gb|KDO73353.1|  hypothetical protein CISIN_1g0082482mg                83.2    1e-16   
ref|XP_002313523.1|  hypothetical protein POPTR_0009s01550g           83.6    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_003606353.1|  Cysteine-rich receptor-like protein kinase       83.2    1e-16   
ref|XP_006488641.1|  PREDICTED: lysM domain receptor-like kinase ...  83.2    1e-16   
ref|XP_011044410.1|  PREDICTED: lysM domain receptor-like kinase 4    82.4    3e-16   
ref|XP_003539774.2|  PREDICTED: lysM domain receptor-like kinase ...  82.0    3e-16   
ref|XP_007132282.1|  hypothetical protein PHAVU_011G081800g           80.9    9e-16   
ref|XP_011090043.1|  PREDICTED: lysM domain receptor-like kinase 4    80.9    9e-16   
dbj|BAI79279.1|  LysM type receptor kinase                            80.5    1e-15   Lotus japonicus
ref|XP_002529416.1|  serine-threonine protein kinase, plant-type,...  80.1    2e-15   Ricinus communis
ref|XP_009802474.1|  PREDICTED: protein LYK5-like isoform X2          77.0    2e-14   
ref|XP_010918712.1|  PREDICTED: lysM domain receptor-like kinase 4    77.4    2e-14   
ref|XP_008775351.1|  PREDICTED: lysM domain receptor-like kinase 4    76.6    3e-14   
ref|XP_004291632.1|  PREDICTED: lysM domain receptor-like kinase ...  76.6    3e-14   
ref|XP_006852391.1|  hypothetical protein AMTR_s00049p00233230        75.1    1e-13   
gb|KCW85763.1|  hypothetical protein EUGRSUZ_B02519                   73.9    3e-13   
ref|XP_010046438.1|  PREDICTED: lysM domain receptor-like kinase 4    73.9    3e-13   
gb|EYU18810.1|  hypothetical protein MIMGU_mgv1a024975mg              68.2    3e-11   
emb|CDP00523.1|  unnamed protein product                              64.7    5e-10   
ref|XP_002276830.3|  PREDICTED: lysM domain receptor-like kinase 4    61.6    5e-09   Vitis vinifera
ref|XP_007037773.1|  Kinase family protein / peptidoglycan-bindin...  61.6    5e-09   
gb|KEH16351.1|  LysM type receptor kinase, putative                   57.4    2e-08   
ref|XP_006849864.1|  hypothetical protein AMTR_s00022p00064170        58.5    6e-08   
ref|XP_011046255.1|  PREDICTED: protein LYK5-like                     56.6    3e-07   
ref|XP_007047053.1|  Serine-threonine protein kinase, plant-type,...  55.8    5e-07   
ref|XP_002321641.2|  hypothetical protein POPTR_0015s09700g           55.1    8e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011099309.1|  PREDICTED: protein LYK5-like                     54.7    1e-06   
gb|EYU44315.1|  hypothetical protein MIMGU_mgv1a002874mg              54.3    2e-06   
ref|XP_011009882.1|  PREDICTED: lysM domain receptor-like kinase 4    53.1    4e-06   
ref|XP_010999981.1|  PREDICTED: lysM domain receptor-like kinase 4    53.1    5e-06   
ref|XP_011083913.1|  PREDICTED: protein LYK5-like                     52.0    1e-05   
ref|XP_010661469.1|  PREDICTED: protein LYK5-like                     48.9    2e-05   
ref|XP_010936173.1|  PREDICTED: lysM domain receptor-like kinase 4    50.8    2e-05   
ref|XP_008813273.1|  PREDICTED: lysM domain receptor-like kinase 4    50.4    3e-05   
ref|XP_006383260.1|  hypothetical protein POPTR_0005s12950g           50.4    3e-05   
gb|KDO55619.1|  hypothetical protein CISIN_1g041830mg                 50.4    4e-05   
ref|XP_006338759.1|  PREDICTED: protein LYK5-like                     50.1    4e-05   
ref|XP_006470034.1|  PREDICTED: protein LYK2-like                     50.1    4e-05   
ref|XP_006447104.1|  hypothetical protein CICLE_v10017541mg           50.1    5e-05   
ref|XP_004157872.1|  PREDICTED: cysteine-rich receptor-like prote...  50.1    5e-05   
ref|XP_004142029.1|  PREDICTED: probable receptor protein kinase ...  50.1    6e-05   
emb|CBI40054.3|  unnamed protein product                              49.7    6e-05   
ref|XP_002263070.1|  PREDICTED: protein LYK2                          49.7    6e-05   Vitis vinifera
ref|XP_009762806.1|  PREDICTED: protein LYK5-like                     49.7    7e-05   
ref|XP_009624778.1|  PREDICTED: protein LYK5-like                     49.7    7e-05   
ref|XP_010665686.1|  PREDICTED: lysM domain receptor-like kinase 4    48.1    1e-04   
ref|XP_010548373.1|  PREDICTED: lysM domain receptor-like kinase 4    48.9    1e-04   
ref|XP_009803781.1|  PREDICTED: protein LYK2                          48.9    1e-04   
ref|XP_003611890.1|  Wall-associated receptor kinase-like protein     48.9    1e-04   
ref|XP_006849862.1|  hypothetical protein AMTR_s00022p00063350        48.9    1e-04   
gb|AAM19130.1|AC103891_10  Putative protein kinase                    48.9    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89155.1|  hypothetical protein OsI_10648                        48.9    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_008441353.1|  PREDICTED: protein LYK2                          48.9    1e-04   
ref|XP_009603047.1|  PREDICTED: protein LYK2                          48.5    2e-04   
ref|XP_006425755.1|  hypothetical protein CICLE_v10027311mg           48.1    2e-04   
ref|XP_002510756.1|  kinase, putative                                 47.8    3e-04   Ricinus communis
ref|XP_009395847.1|  PREDICTED: protein LYK5                          47.8    3e-04   
ref|XP_010913817.1|  PREDICTED: protein LYK5-like                     47.8    3e-04   
gb|EYU44312.1|  hypothetical protein MIMGU_mgv1a025419mg              47.8    3e-04   
ref|XP_004138791.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...  47.4    4e-04   
ref|XP_008440166.1|  PREDICTED: lysM domain receptor-like kinase 4    47.4    4e-04   
dbj|BAI79280.1|  LysM type receptor kinase                            47.4    5e-04   Lotus japonicus
ref|XP_004233647.1|  PREDICTED: protein LYK5-like                     47.0    5e-04   
ref|XP_002510333.1|  serine-threonine protein kinase, plant-type,...  47.0    6e-04   Ricinus communis
gb|KDO79455.1|  hypothetical protein CISIN_1g039626mg                 47.0    6e-04   
ref|XP_006849863.1|  hypothetical protein AMTR_s00022p00063910        46.6    6e-04   
ref|XP_011099273.1|  PREDICTED: lysM domain receptor-like kinase 4    46.6    7e-04   
ref|XP_008652982.1|  PREDICTED: protein LYK5-like                     46.6    7e-04   
gb|ABN50364.2|  LysM-domain containing receptor-like kinase           46.6    8e-04   Sesbania rostrata
ref|XP_010070127.1|  PREDICTED: wall-associated receptor kinase-l...  46.6    8e-04   
ref|XP_008241611.1|  PREDICTED: protein LYK5-like                     46.6    8e-04   
gb|AER51060.1|  Nod-factor receptor 5                                 46.6    8e-04   
gb|AER51050.1|  Nod-factor receptor 5                                 46.6    8e-04   
dbj|BAI79286.1|  LysM type receptor kinase                            46.2    8e-04   Lotus japonicus
dbj|BAI79276.1|  LysM type receptor kinase                            46.2    8e-04   Lotus japonicus



>ref|XP_002282490.1| PREDICTED: lysM domain receptor-like kinase 4 [Vitis vinifera]
Length=605

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+ S SE+L PG+ VLIP+ CSCSG FF ANFSYT    TTF  IAC VFEGL+KP TL
Sbjct  79   NNLPSPSEVLMPGKGVLIPINCSCSGQFFEANFSYTVPRTTTFSDIACGVFEGLLKPHTL  138

Query  185  AEENPSKVS  211
             E NPS+V+
Sbjct  139  GEANPSQVN  147



>ref|XP_009621604.1| PREDICTED: lysM domain receptor-like kinase 4 [Nicotiana tomentosiformis]
Length=620

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NNVTS S+ILE GREV++P+QCSC G FF AN SY    NT F  +AC VFEGLVK +T+
Sbjct  80   NNVTSSSQILEIGREVIVPIQCSCLGKFFQANISYHAPTNTKFDDVACGVFEGLVKSITI  139

Query  185  AEENPSK  205
             EEN SK
Sbjct  140  LEENISK  146



>gb|KHN38745.1| Receptor-like serine/threonine-protein kinase NCRK [Glycine soja]
Length=561

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    RNNVTSGS--EILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKP  175
            +NN+TS S  ++L+ G+EVLIPV CSCSGG+F A+ SY  L+NTT+  IAC VFEGL+K 
Sbjct  9    KNNLTSSSLFDVLKQGKEVLIPVNCSCSGGYFQASLSYKVLDNTTYSEIACGVFEGLLKH  68

Query  176  VTLAEENPSK  205
            +TLAEEN S+
Sbjct  69   LTLAEENLSQ  78



>ref|XP_003539201.2| PREDICTED: protein LYK5-like [Glycine max]
Length=630

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    RNNVTSGS--EILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKP  175
            +NN+TS S  ++L+ G+EVLIPV CSCSGG+F A+ SY  L+NTT+  IAC VFEGL+K 
Sbjct  78   KNNLTSSSLFDVLKQGKEVLIPVNCSCSGGYFQASLSYKVLDNTTYSEIACGVFEGLLKH  137

Query  176  VTLAEENPSK  205
            +TLAEEN S+
Sbjct  138  LTLAEENLSQ  147



>ref|XP_008385340.1| PREDICTED: lysM domain receptor-like kinase 4 [Malus domestica]
Length=615

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+TS SE L+ GREV+IP++CSCSG +F A+FSYT L+NT++  +AC VFEGL+K  TL
Sbjct  79   NNLTSPSEELKAGREVIIPIKCSCSGQYFQASFSYTVLQNTSYSEVACGVFEGLLKSFTL  138

Query  185  AEENPSK  205
             EEN S+
Sbjct  139  KEENMSQ  145



>ref|XP_009356884.1| PREDICTED: lysM domain receptor-like kinase 4 [Pyrus x bretschneideri]
Length=615

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+TS SE L+ GREV+IP++CSCSG +F A+FSYT L+NT++  +AC VFEGL+K  TL
Sbjct  79   NNLTSPSEELKSGREVIIPIKCSCSGQYFQASFSYTVLQNTSYSEVACGVFEGLLKSFTL  138

Query  185  AEENPSK  205
             EEN S+
Sbjct  139  REENMSQ  145



>ref|XP_009776977.1| PREDICTED: lysM domain receptor-like kinase 4 [Nicotiana sylvestris]
Length=521

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NNVTS S+ILE GREV++P+QCSC G  F AN SY    NT F  +AC VFEGLVK +TL
Sbjct  80   NNVTSSSQILEIGREVIVPIQCSCLGESFQANISYHSPTNTKFDDVACGVFEGLVKSITL  139

Query  185  AEENPSK  205
             EEN SK
Sbjct  140  LEENISK  146



>ref|XP_009779910.1| PREDICTED: lysM domain receptor-like kinase 4, partial [Nicotiana 
sylvestris]
Length=562

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NNVTS S+ILE GREV++P+QCSC G  F AN SY    NT F  +AC VFEGLVK +TL
Sbjct  121  NNVTSSSQILEIGREVIVPIQCSCLGESFQANISYHSPTNTKFDDVACGVFEGLVKSITL  180

Query  185  AEENPSK  205
             EEN SK
Sbjct  181  LEENISK  187



>ref|XP_009802472.1| PREDICTED: protein LYK5-like isoform X1 [Nicotiana sylvestris]
Length=584

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NNVTS S+ILE GREV++P+QCSC G  F AN SY    NT F  +AC VFEGLVK +TL
Sbjct  41   NNVTSSSQILEIGREVIVPIQCSCLGESFQANISYHSPTNTKFDDVACGVFEGLVKSITL  100

Query  185  AEENPSK  205
             EEN SK
Sbjct  101  LEENISK  107



>ref|XP_010109500.1| Proline-rich receptor-like protein kinase PERK10 [Morus notabilis]
 gb|EXC22911.1| Proline-rich receptor-like protein kinase PERK10 [Morus notabilis]
Length=619

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +2

Query  5    NNVTSGSEILEPG-REVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVT  181
            NN+TS SE+L+P  REVL+P+ CSCSG +F ANFSYT  + T+   IAC VFEGLVK  T
Sbjct  82   NNLTSPSELLQPAAREVLVPIVCSCSGQYFQANFSYTISDTTSMSEIACGVFEGLVKLPT  141

Query  182  LAEENPS  202
            LAEENPS
Sbjct  142  LAEENPS  148



>ref|XP_006340406.1| PREDICTED: protein LYK5-like [Solanum tuberosum]
Length=551

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NNV+S S+ILE GREV+IP+QCSC G FF AN SY    NT F  +AC VFEGLVK VTL
Sbjct  2    NNVSSSSQILEIGREVIIPIQCSCLGEFFQANVSYITPTNTKFNDVACGVFEGLVKSVTL  61

Query  185  AEEN  196
             +EN
Sbjct  62   FQEN  65



>ref|XP_004251402.1| PREDICTED: lysM domain receptor-like kinase 4 [Solanum lycopersicum]
Length=636

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NNVTS S+ILE GREV+IP+ CSC G FF AN +Y    NT F  +AC VFEGLVK VTL
Sbjct  87   NNVTSSSQILEIGREVIIPIHCSCPGEFFQANVTYITPTNTNFNDVACGVFEGLVKSVTL  146

Query  185  AEEN  196
             +EN
Sbjct  147  VQEN  150



>emb|CAN60025.1| hypothetical protein VITISV_006908 [Vitis vinifera]
Length=501

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+ S SE+L PG+ VLIP+ CSCSG  F ANFSY     T F  IAC VFEGL+KP TL
Sbjct  83   NNLPSPSEVLMPGKGVLIPINCSCSGQXFEANFSYXVPRTTXFSXIACGVFEGLLKPHTL  142

Query  185  AEENPSKVS  211
             E NPS+V+
Sbjct  143  GEANPSQVN  151



>ref|XP_007016790.1| Kinase family protein / peptidoglycan-binding LysM domain-containing 
protein, putative [Theobroma cacao]
 gb|EOY34409.1| Kinase family protein / peptidoglycan-binding LysM domain-containing 
protein, putative [Theobroma cacao]
Length=636

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+TS SE+L+PGREVL+P+ C CSG +F A  SY   E T+   IAC +FEGL+K +TL
Sbjct  87   NNITSASEVLKPGREVLVPINCRCSGEYFRARLSYIVPERTSIEEIACGIFEGLLKSLTL  146

Query  185  AEENPSK  205
             ++NPS+
Sbjct  147  LQDNPSQ  153



>ref|XP_006424535.1| hypothetical protein CICLE_v10030184mg [Citrus clementina]
 gb|ESR37775.1| hypothetical protein CICLE_v10030184mg [Citrus clementina]
Length=611

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+TS S++L PGREVLIP+ CSCSG FF ANFSY    +TT+  IAC VFE L+K  TL
Sbjct  84   NNLTSPSKMLPPGREVLIPINCSCSGQFFQANFSYVVPGSTTYSDIACSVFESLLKSRTL  143

Query  185  AEEN  196
             EEN
Sbjct  144  GEEN  147



>ref|XP_004506041.1| PREDICTED: protein LYK5-like [Cicer arietinum]
Length=606

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLEN-TTFGSIACEVFEGLVKPVT  181
            NN+TS S++L+ G+EVLIPV+C+CSG F+    +Y  LE  TTF +IACEVFEGLVK +T
Sbjct  92   NNLTSSSQVLKQGKEVLIPVECTCSGQFYQTKVTYKVLETATTFSNIACEVFEGLVKNLT  151

Query  182  LAEEN  196
            LAEEN
Sbjct  152  LAEEN  156



>ref|XP_008226039.1| PREDICTED: lysM domain receptor-like kinase 4 [Prunus mume]
Length=615

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+TS SE L  GREVLIP+ CSCSG +F A+FSY   ENT++  IAC VFEGL+K  T 
Sbjct  79   NNLTSPSEALRAGREVLIPIDCSCSGQYFQASFSYMVSENTSYSEIACGVFEGLLKSFTF  138

Query  185  AEENPSK  205
             EEN S+
Sbjct  139  REENLSQ  145



>ref|XP_007206854.1| hypothetical protein PRUPE_ppa027141mg [Prunus persica]
 gb|EMJ08053.1| hypothetical protein PRUPE_ppa027141mg [Prunus persica]
Length=615

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+TS SE L  GREVLIP+ CSCSG +F A+FSY   ENT++  IAC VFEGL+K  T 
Sbjct  79   NNLTSPSEALRAGREVLIPIDCSCSGQYFQASFSYMVSENTSYSEIACGVFEGLLKSFTF  138

Query  185  AEENPSK  205
             EEN S+
Sbjct  139  REENLSQ  145



>gb|KDO73353.1| hypothetical protein CISIN_1g0082482mg, partial [Citrus sinensis]
Length=471

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+TS S++L PGREVLIP+ CSCSG FF  NFSY    +TT+  IAC VFE L+K  TL
Sbjct  84   NNLTSPSKMLPPGREVLIPINCSCSGQFFQVNFSYAFSGSTTYSDIACSVFESLLKSRTL  143

Query  185  AEEN  196
             EEN
Sbjct  144  REEN  147



>ref|XP_002313523.1| hypothetical protein POPTR_0009s01550g [Populus trichocarpa]
 gb|EEE87478.1| hypothetical protein POPTR_0009s01550g [Populus trichocarpa]
Length=622

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 2/69 (3%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTT--FGSIACEVFEGLVKPV  178
            NN+ S  ++LEPGREVL+P++CSC G FF A F+YT  EN+T     IAC +FEGL KP 
Sbjct  80   NNLKSQLKVLEPGREVLVPIKCSCLGQFFQATFNYTVPENSTVELSDIACRIFEGLAKPG  139

Query  179  TLAEENPSK  205
            TL EEN S+
Sbjct  140  TLVEENASE  148



>ref|XP_003606353.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES88550.1| LysM-domain receptor-like kinase [Medicago truncatula]
Length=603

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 55/68 (81%), Gaps = 1/68 (1%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLE-NTTFGSIACEVFEGLVKPVT  181
            NN+TS S+IL+ G+EVLIP++C+CS  F+ A  SY  LE +TTF +IACEVFEGL+K VT
Sbjct  92   NNLTSSSQILKQGKEVLIPIECTCSNQFYQAKLSYKNLESSTTFSNIACEVFEGLLKHVT  151

Query  182  LAEENPSK  205
            L+++N ++
Sbjct  152  LSDQNENQ  159



>ref|XP_006488641.1| PREDICTED: lysM domain receptor-like kinase 4-like [Citrus sinensis]
Length=611

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+TS S++L PGREVLIP+ CSCSG FF  NFSY    +TT+  IAC VFE L+K  TL
Sbjct  84   NNLTSPSKMLPPGREVLIPINCSCSGQFFQVNFSYAFSGSTTYSDIACSVFESLLKSRTL  143

Query  185  AEEN  196
             EEN
Sbjct  144  REEN  147



>ref|XP_011044410.1| PREDICTED: lysM domain receptor-like kinase 4 [Populus euphratica]
Length=622

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 2/69 (3%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTT--FGSIACEVFEGLVKPV  178
            NN+ S  ++LEPGREVL+P++CSC G FF A F+YT  EN+T     IAC +FEGL KP 
Sbjct  80   NNLKSQLKVLEPGREVLVPIKCSCLGQFFQATFNYTVPENSTIDLSDIACRIFEGLAKPG  139

Query  179  TLAEENPSK  205
            TL EEN S+
Sbjct  140  TLFEENTSE  148



>ref|XP_003539774.2| PREDICTED: lysM domain receptor-like kinase 4-like [Glycine max]
Length=640

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    RNNVTSGS--EILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKP  175
            +NN+T  S  + L+ G+EVLIPV C+CSGG+F A+ SY  L NTT+  IAC VFEGL+K 
Sbjct  88   KNNLTPLSLFDELKQGKEVLIPVNCTCSGGYFQASLSYKVLNNTTYSEIACGVFEGLLKH  147

Query  176  VTLAEENPSK  205
            +TLAEEN S+
Sbjct  148  LTLAEENISQ  157



>ref|XP_007132282.1| hypothetical protein PHAVU_011G081800g [Phaseolus vulgaris]
 gb|ESW04276.1| hypothetical protein PHAVU_011G081800g [Phaseolus vulgaris]
Length=630

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    RNNVTSGS--EILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKP  175
            +NN+TS S   +L+ G+EVLIPV C+CSG ++  + SY  L+NTTF  IAC VFEGL+  
Sbjct  85   KNNLTSSSLSRVLKQGKEVLIPVNCTCSGTYYQTSLSYKVLDNTTFSEIACGVFEGLLSR  144

Query  176  VTLAEENPSK  205
            +TLAEEN S+
Sbjct  145  LTLAEENLSQ  154



>ref|XP_011090043.1| PREDICTED: lysM domain receptor-like kinase 4 [Sesamum indicum]
Length=603

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            +NV++ S++LE G EVL+P  CSCSG F  ANF+Y   EN     IAC VFEGLVK +TL
Sbjct  80   HNVSASSQVLETGHEVLVPALCSCSGEFSQANFTYRVTENAALSEIACGVFEGLVKSITL  139

Query  185  AEEN  196
            AEEN
Sbjct  140  AEEN  143



>dbj|BAI79279.1| LysM type receptor kinase [Lotus japonicus]
 dbj|BAI79290.1| LysM type receptor kinase [Lotus japonicus]
Length=603

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+ S SEIL+ G+EVLIPV C+CSG F+ A+ SY   E TTF  I+C VFE L+K +T+
Sbjct  85   NNLISSSEILKQGKEVLIPVDCTCSGEFYQASLSYKVPEITTFSEISCGVFEALLKQLTM  144

Query  185  AEENPSK  205
            AEEN S+
Sbjct  145  AEENLSQ  151



>ref|XP_002529416.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF32942.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=607

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN++  SEILE GREVL+PV CSC G FF  + SY   + TT   IAC +FEGLVK  TL
Sbjct  79   NNLSFPSEILEQGREVLVPVTCSCIGTFFQVSISYKVPDKTTLSEIACSLFEGLVKLHTL  138

Query  185  AEENPSK  205
             EENPS+
Sbjct  139  IEENPSE  145



>ref|XP_009802474.1| PREDICTED: protein LYK5-like isoform X2 [Nicotiana sylvestris]
Length=554

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  26   EILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEENPSK  205
            +ILE GREV++P+QCSC G  F AN SY    NT F  +AC VFEGLVK +TL EEN SK
Sbjct  18   QILEIGREVIVPIQCSCLGESFQANISYHSPTNTKFDDVACGVFEGLVKSITLLEENISK  77



>ref|XP_010918712.1| PREDICTED: lysM domain receptor-like kinase 4 [Elaeis guineensis]
Length=612

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+TS S+ILE  +EV+IP+ CSCSG FF +N SY   ++ TF  I+CEVFEGLVK  TL
Sbjct  80   NNLTSPSQILEKDQEVVIPIHCSCSGSFFQSNVSYLIPKDATFTKISCEVFEGLVKFHTL  139

Query  185  AEE  193
             E+
Sbjct  140  VED  142



>ref|XP_008775351.1| PREDICTED: lysM domain receptor-like kinase 4 [Phoenix dactylifera]
Length=602

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+TS S ILE    VL+P+ CSCSG FF +N SY+  E+ TF  I+CEVF GLVK  TL
Sbjct  80   NNLTSPSRILEKDWAVLVPINCSCSGNFFRSNVSYSIPEDATFTKISCEVFGGLVKLHTL  139

Query  185  AEENPS  202
             +E+PS
Sbjct  140  VKEHPS  145



>ref|XP_004291632.1| PREDICTED: lysM domain receptor-like kinase 4-like [Fragaria 
vesca subsp. vesca]
Length=621

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NNVT+   +L+ GREVLIP+ CSCSG +F A+ SY   + T++  IAC VFEGL+K  TL
Sbjct  79   NNVTAPFVVLQSGREVLIPINCSCSGQYFEASLSYMVSKVTSYSEIACGVFEGLLKSSTL  138

Query  185  AEEN  196
            AEEN
Sbjct  139  AEEN  142



>ref|XP_006852391.1| hypothetical protein AMTR_s00049p00233230 [Amborella trichopoda]
 gb|ERN13858.1| hypothetical protein AMTR_s00049p00233230 [Amborella trichopoda]
Length=618

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+T   + L+ GREVLIPV CSCSG ++ +NFSY   +   +  IAC +FEGL K ++L
Sbjct  83   NNITEPLQTLDAGREVLIPVICSCSGQYYQSNFSYITSDGDDYSHIACGIFEGLSKTLSL  142

Query  185  AEENP  199
             E+NP
Sbjct  143  LEQNP  147



>gb|KCW85763.1| hypothetical protein EUGRSUZ_B02519, partial [Eucalyptus grandis]
Length=573

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N V S +E L+PGREVL+P+QC C+G FF  N +Y    +T F  IAC VFEGLVK  TL
Sbjct  43   NGVGSPTENLQPGREVLVPIQCYCAGTFFQKNATYPVGGSTNFSEIACGVFEGLVKLATL  102

Query  185  AEEN  196
             E+N
Sbjct  103  VEDN  106



>ref|XP_010046438.1| PREDICTED: lysM domain receptor-like kinase 4 [Eucalyptus grandis]
Length=615

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N V S +E L+PGREVL+P+QC C+G FF  N +Y    +T F  IAC VFEGLVK  TL
Sbjct  79   NGVGSPTENLQPGREVLVPIQCYCAGTFFQKNATYPVGGSTNFSEIACGVFEGLVKLATL  138

Query  185  AEEN  196
             E+N
Sbjct  139  VEDN  142



>gb|EYU18810.1| hypothetical protein MIMGU_mgv1a024975mg, partial [Erythranthe 
guttata]
Length=536

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +2

Query  8    NVTSGSEILEPGREVLIPVQCSCSGGFFS-ANFSY--TPLENTTFGSIACEVFEGLVKPV  178
            +V+  +++L PG E+++P+QCSCS   FS ANF+Y  +  ENTT  +++C+VFEGLVK +
Sbjct  70   HVSFPTQLLRPGHEIVVPIQCSCSMRNFSHANFTYEVSERENTTLTTVSCDVFEGLVKSI  129

Query  179  TLAEEN  196
            TL E N
Sbjct  130  TLYEVN  135



>emb|CDP00523.1| unnamed protein product [Coffea canephora]
Length=624

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N ++S  + LEPG EVL+P+ CSC   F+ AN +Y    + T  +++C VFEGL+K +TL
Sbjct  80   NAISSSFQNLEPGMEVLVPIVCSCIEQFYEANVNYIFPGSMTLENVSCGVFEGLLKSITL  139

Query  185  AEENPS  202
             E NPS
Sbjct  140  IEANPS  145



>ref|XP_002276830.3| PREDICTED: lysM domain receptor-like kinase 4 [Vitis vinifera]
Length=619

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N V + S  L PG+E++IPV CSC   F  A F Y    + +   IAC VFEGLVK  +L
Sbjct  85   NMVEANSSNLRPGQEIIIPVTCSCPDRFSEAMFIYNCSHSDSLLIIACTVFEGLVKAQSL  144

Query  185  AEENPS  202
             EENP 
Sbjct  145  IEENPD  150



>ref|XP_007037773.1| Kinase family protein / peptidoglycan-binding LysM domain-containing 
protein, putative [Theobroma cacao]
 gb|EOY22274.1| Kinase family protein / peptidoglycan-binding LysM domain-containing 
protein, putative [Theobroma cacao]
Length=534

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +2

Query  5    NNVTSG-SEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVT  181
            N++T   S  L+ GRE++IPVQCSC+  F  A F Y      +F S+AC VF+GL+K  +
Sbjct  83   NHMTDADSSNLKLGREIIIPVQCSCALTFSKAIFMYHFSSTDSFASVACGVFQGLLKAQS  142

Query  182  LAEENPS  202
            L E+NP 
Sbjct  143  LKEDNPD  149



>gb|KEH16351.1| LysM type receptor kinase, putative [Medicago truncatula]
Length=145

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTT  130
            NN+TS S+IL+ G+EVLIP++C+CS  F+ A  SY  LE+TT
Sbjct  91   NNLTSSSQILKQGKEVLIPIECTCSNQFYQAKLSYKVLESTT  132



>ref|XP_006849864.1| hypothetical protein AMTR_s00022p00064170 [Amborella trichopoda]
 gb|ERN11445.1| hypothetical protein AMTR_s00022p00064170 [Amborella trichopoda]
Length=667

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N++ + SE+LE  + +LIP++C CSGGFFSA    T +++ TF SIA  + EGL     +
Sbjct  100  NDLPANSELLERDQPLLIPLECRCSGGFFSAQTVKTTVKDDTFSSIAASL-EGLTTCKAI  158

Query  185  AEENPSKVSW  214
             E NP    W
Sbjct  159  TESNPKLSPW  168



>ref|XP_011046255.1| PREDICTED: protein LYK5-like [Populus euphratica]
Length=518

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  41   GREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEEN  196
            G++++IP+ C C GGF    F Y   +  +F S++C+VFEGLVK  +L EEN
Sbjct  13   GQDIIIPITCHCLGGFSKFIFMYNMSKQDSFASVSCKVFEGLVKVQSLIEEN  64



>ref|XP_007047053.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
 gb|EOX91210.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
Length=634

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 2/65 (3%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSY-TPLENTTFGSIACEVFEGLVKPVT  181
            NN+ S S IL P +EV++PV CSCSG ++ AN SY  P  + T+ SIA   ++GL    +
Sbjct  103  NNI-SLSTILPPNKEVIVPVNCSCSGQYYQANTSYIIPSMHDTYFSIANNTYQGLSTCKS  161

Query  182  LAEEN  196
            L +EN
Sbjct  162  LLQEN  166



>ref|XP_002321641.2| hypothetical protein POPTR_0015s09700g [Populus trichocarpa]
 gb|EEF05768.2| hypothetical protein POPTR_0015s09700g [Populus trichocarpa]
Length=467

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  41   GREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEEN  196
            G++++IP+ C C GGF    F Y   +  +F S+AC++F GLVK  +L EEN
Sbjct  98   GQDIIIPITCHCLGGFSKFIFMYNMSKQDSFASVACKIFAGLVKVQSLIEEN  149



>ref|XP_011099309.1| PREDICTED: protein LYK5-like [Sesamum indicum]
Length=566

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  8    NVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLA  187
            N  S S +L P   V++PV CSCSG ++ AN SY   +  T+ +IA + ++GL     L 
Sbjct  37   NDISSSAVLPPDVAVIVPVTCSCSGQYYQANTSYVRHDVDTYFTIANDTYQGLTTCNALE  96

Query  188  EENP  199
             ENP
Sbjct  97   RENP  100



>gb|EYU44315.1| hypothetical protein MIMGU_mgv1a002874mg [Erythranthe guttata]
Length=629

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = +2

Query  2    RNNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYT--PLENTTFGSIACEVFEGLVKP  175
            R N  S S IL P + V+IPV CSCSG ++ AN SY   P +N T+ +IA E +EGL   
Sbjct  93   RLNNVSTSTILPPEKNVIIPVTCSCSGQYYQANTSYISRPADN-TYLTIANETYEGLTTC  151

Query  176  VTLAEENP  199
              L   NP
Sbjct  152  DALMRVNP  159



>ref|XP_011009882.1| PREDICTED: lysM domain receptor-like kinase 4 [Populus euphratica]
Length=624

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +2

Query  2    RNNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYT-PLENTTFGSIACEVFEGLVKPV  178
            R N  S S +    REV++PV CSCSG ++ AN SYT P    T+ +IA   +EGL    
Sbjct  86   RINNFSSSAVFRTDREVIVPVLCSCSGKYYQANTSYTIPSNYDTYFTIANYTYEGLATCS  145

Query  179  TLAEEN  196
            +L  EN
Sbjct  146  SLIHEN  151



>ref|XP_010999981.1| PREDICTED: lysM domain receptor-like kinase 4 [Populus euphratica]
Length=624

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +2

Query  2    RNNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYT-PLENTTFGSIACEVFEGLVKPV  178
            R N  S S +    REV++PV CSCSG ++ AN SYT P    T+ +IA   +EGL    
Sbjct  86   RINNFSSSAVFRTDREVIVPVLCSCSGKYYQANTSYTIPSNYDTYFTIANYTYEGLATCS  145

Query  179  TLAEEN  196
            +L  EN
Sbjct  146  SLIHEN  151



>ref|XP_011083913.1| PREDICTED: protein LYK5-like [Sesamum indicum]
Length=617

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSY-TPLENTTFGSIACEVFEGLVKPVT  181
            NN+TS + +   GR+V++PV CSCSG ++ A+ +Y  P+E+ T+  IA   F+GL    +
Sbjct  88   NNITSFT-VFPEGRKVIVPVNCSCSGQYYQASTTYQVPIEHQTYYIIANSTFQGLTTCTS  146

Query  182  LAEEN  196
            L   N
Sbjct  147  LIHAN  151



>ref|XP_010661469.1| PREDICTED: protein LYK5-like [Vitis vinifera]
Length=168

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +2

Query  44   REVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEENPSKVS  211
            R +++PV CSCSG F+  N SYT   + T+ SIA  + +GL     L  +NPS  S
Sbjct  8    RSLIVPVNCSCSGDFYQYNASYTVNASDTYFSIANNICQGLTNCQALKAQNPSHNS  63



>ref|XP_010936173.1| PREDICTED: lysM domain receptor-like kinase 4 [Elaeis guineensis]
Length=574

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    RNNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVT  181
            R N  S S+     +EV+IPV CSC G ++ AN SY   +  T+ S+A  V++GL     
Sbjct  87   RINDVSVSDSFPTNKEVIIPVNCSCPGQYYQANTSYVIDDVDTYYSLATGVYQGLSSCNA  146

Query  182  LAEENP  199
            L  ENP
Sbjct  147  LVGENP  152



>ref|XP_008813273.1| PREDICTED: lysM domain receptor-like kinase 4 [Phoenix dactylifera]
Length=620

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    RNNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVT  181
            R N  S S+     +E ++PV CSCSG ++ AN SY   +  T+ S+A  V++GL     
Sbjct  87   RLNNVSVSDSFPTNKEAIVPVNCSCSGRYYQANASYVVGDVDTYYSLATGVYQGLSSCSA  146

Query  182  LAEENP  199
            L  ENP
Sbjct  147  LMGENP  152



>ref|XP_006383260.1| hypothetical protein POPTR_0005s12950g [Populus trichocarpa]
 gb|ERP61057.1| hypothetical protein POPTR_0005s12950g [Populus trichocarpa]
Length=624

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +2

Query  2    RNNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYT-PLENTTFGSIACEVFEGLVKPV  178
            R N  S S +    +EV++PV CSCSG ++ AN SYT P    T+ +IA   +EGL    
Sbjct  86   RINNFSSSAVFPTDKEVIVPVLCSCSGKYYQANTSYTIPSNYDTYFTIANYTYEGLATCS  145

Query  179  TLAEEN  196
            +L  EN
Sbjct  146  SLIHEN  151



>gb|KDO55619.1| hypothetical protein CISIN_1g041830mg, partial [Citrus sinensis]
Length=600

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCS--GGFFSANFSYTPLENTTFGSIACEVFEGLVKPV  178
            N  ++ +E L   + +LIP+ C C+  GGFF A+ + T ++  +F SIA +  EGL    
Sbjct  93   NGFSADTEFLPKDQPLLIPIDCKCNNNGGFFQADLTKTTIKGESFYSIA-QSLEGLTTCG  151

Query  179  TLAEENPSKVSWD  217
             + E NPS   WD
Sbjct  152  AIKERNPSVSPWD  164



>ref|XP_006338759.1| PREDICTED: protein LYK5-like [Solanum tuberosum]
Length=616

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYT-PLENTTFGSIACEVFEGLVKPVT  181
            NN+ S S+IL+  +EV++PV CSCSG ++ A+ SY  P +  T+  IA   ++GL     
Sbjct  89   NNI-SRSKILDQNQEVIVPVNCSCSGQYYQADTSYVIPSKFDTYFRIATTTYQGLSTCSA  147

Query  182  LAEEN  196
            L  EN
Sbjct  148  LMHEN  152



>ref|XP_006470034.1| PREDICTED: protein LYK2-like [Citrus sinensis]
Length=659

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCS--GGFFSANFSYTPLENTTFGSIACEVFEGLVKPV  178
            N  ++ +E L   + +LIP+ C C+  GGFF A+ + T ++  +F SIA +  EGL    
Sbjct  57   NGFSADTEFLPKDQPLLIPIDCKCNNNGGFFQADLTKTTIKGESFYSIA-QSLEGLTTCG  115

Query  179  TLAEENPSKVSWD  217
             + E NPS   WD
Sbjct  116  AIKERNPSVSPWD  128



>ref|XP_006447104.1| hypothetical protein CICLE_v10017541mg [Citrus clementina]
 gb|ESR60344.1| hypothetical protein CICLE_v10017541mg [Citrus clementina]
Length=672

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCS--GGFFSANFSYTPLENTTFGSIACEVFEGLVKPV  178
            N  ++ +E L   + +LIP+ C C+  GGFF A+ + T ++  +F SIA +  EGL    
Sbjct  70   NGFSADTEFLPKDQPLLIPIDCKCNNNGGFFQADLTKTTIKGESFYSIA-QSLEGLTTCG  128

Query  179  TLAEENPSKVSWD  217
             + E NPS   WD
Sbjct  129  AIKERNPSVSPWD  141



>ref|XP_004157872.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Cucumis sativus]
Length=610

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    RNNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVT  181
            R N  + S    P + VL+P  CSCSG FF +N S+T     ++  IA E  +GL    +
Sbjct  86   RVNSVNASATFPPDKLVLVPTTCSCSGQFFQSNVSFTTRTGDSYFVIANETLQGLSTCQS  145

Query  182  LAEENPS  202
            L  +NP+
Sbjct  146  LISQNPN  152



>ref|XP_004142029.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 gb|KGN48454.1| hypothetical protein Csa_6G487750 [Cucumis sativus]
Length=639

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    RNNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVT  181
            R N  + S    P + VL+P  CSCSG FF +N S+T     ++  IA E  +GL    +
Sbjct  86   RVNSVNASATFPPDKLVLVPTTCSCSGQFFQSNVSFTTRTGDSYFVIANETLQGLSTCQS  145

Query  182  LAEENPS  202
            L  +NP+
Sbjct  146  LISQNPN  152



>emb|CBI40054.3| unnamed protein product [Vitis vinifera]
Length=672

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (53%), Gaps = 1/70 (1%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N  ++ +E+L     +LIP++C C  GFF A  + T +E  +F  IA E  EGL     +
Sbjct  85   NGFSADTELLPYNLPLLIPIECKCKAGFFQAELTKTTIEGESFFGIA-ESLEGLTTCKAI  143

Query  185  AEENPSKVSW  214
             E NPS   W
Sbjct  144  RERNPSIQPW  153



>ref|XP_002263070.1| PREDICTED: protein LYK2 [Vitis vinifera]
 ref|XP_010660781.1| PREDICTED: protein LYK2 [Vitis vinifera]
 ref|XP_010660783.1| PREDICTED: protein LYK2 [Vitis vinifera]
 ref|XP_010660784.1| PREDICTED: protein LYK2 [Vitis vinifera]
Length=675

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (53%), Gaps = 1/70 (1%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N  ++ +E+L     +LIP++C C  GFF A  + T +E  +F  IA E  EGL     +
Sbjct  85   NGFSADTELLPYNLPLLIPIECKCKAGFFQAELTKTTIEGESFFGIA-ESLEGLTTCKAI  143

Query  185  AEENPSKVSW  214
             E NPS   W
Sbjct  144  RERNPSIQPW  153



>ref|XP_009762806.1| PREDICTED: protein LYK5-like [Nicotiana sylvestris]
Length=616

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYT-PLENTTFGSIACEVFEGLVKPVT  181
            NN+ S SEIL+  +E+++PV CSCSG ++ A  SY  P +  T+ +IA   ++GL     
Sbjct  89   NNI-SRSEILDQNKELIVPVNCSCSGQYYQAVTSYVIPSKYDTYFTIANNTYQGLSTCNA  147

Query  182  LAEEN  196
            L  EN
Sbjct  148  LVHEN  152



>ref|XP_009624778.1| PREDICTED: protein LYK5-like [Nicotiana tomentosiformis]
Length=616

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYT-PLENTTFGSIACEVFEGLVKPVT  181
            NN+ S SEIL+  +E+++PV CSCSG ++ A  SY  P +  T+ +IA   ++GL     
Sbjct  89   NNI-SRSEILDQNKELIVPVNCSCSGQYYQAVTSYVIPSKYDTYFTIANNTYQGLSTCNA  147

Query  182  LAEEN  196
            L  EN
Sbjct  148  LVHEN  152



>ref|XP_010665686.1| PREDICTED: lysM domain receptor-like kinase 4 [Beta vulgaris 
subsp. vulgaris]
Length=255

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGL  166
            NN TSG+  LE   EV++PV CSC+G F+ AN ++       +  I  ++F+GL
Sbjct  52   NNNTSGNMTLETNHEVIVPVMCSCTGMFYQANTTHVVQATENYYLIVNDIFQGL  105



>ref|XP_010548373.1| PREDICTED: lysM domain receptor-like kinase 4 [Tarenaya hassleriana]
Length=641

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  8    NVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLA  187
            N  S S+   P ++V++PV CSCSG +  AN SYT  +  ++  +A +  +GL     + 
Sbjct  89   NAVSESDTFSPDKQVIVPVSCSCSGDYSQANISYTVQQGDSYFIVANDTLQGLSTCQAME  148

Query  188  EEN  196
            ++N
Sbjct  149  KQN  151



>ref|XP_009803781.1| PREDICTED: protein LYK2 [Nicotiana sylvestris]
Length=667

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N  +S +E L   + +LIP+ C C GGFF A  + T ++  +F SIA +  EGL     +
Sbjct  83   NGFSSDTEFLTIDQPLLIPLDCKCVGGFFEAELTKTTIKGESFNSIA-QSLEGLTTCKAI  141

Query  185  AEENPS  202
             E+NP+
Sbjct  142  KEKNPN  147



>ref|XP_003611890.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES94848.1| LysM-domain receptor-like kinase [Medicago truncatula]
Length=637

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 33/63 (52%), Gaps = 0/63 (0%)
 Frame = +2

Query  8    NVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLA  187
            N  S +E  E  + V++PV CSCSG ++ AN SY      T+  +A   FEGL     L 
Sbjct  94   NSVSLNETFETNKMVIVPVNCSCSGNYYQANTSYVFQNTDTYFIVANNTFEGLSTCQALM  153

Query  188  EEN  196
             EN
Sbjct  154  HEN  156



>ref|XP_006849862.1| hypothetical protein AMTR_s00022p00063350 [Amborella trichopoda]
 gb|ERN11443.1| hypothetical protein AMTR_s00022p00063350 [Amborella trichopoda]
Length=667

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N +T  S IL     V++P+ CSCSG F+  N SY   ++ T+ +IA   +EGL     L
Sbjct  102  NGLTDTSTILTDSL-VIVPLNCSCSGSFYQHNTSYIIKQHDTYLTIANNTYEGLTTCEAL  160

Query  185  AEENP  199
             ++NP
Sbjct  161  IQQNP  165



>gb|AAM19130.1|AC103891_10 Putative protein kinase [Oryza sativa Japonica Group]
 gb|ABF94815.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ26175.1| hypothetical protein OsJ_10042 [Oryza sativa Japonica Group]
Length=624

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N +T+   +L PG+ +L+PV+C C+G    AN +Y      TF  +A   FE L   V +
Sbjct  75   NKLTTEDGVLLPGQPLLVPVKCGCTGARSFANVTYPIRPRDTFFGLAVTAFENLTDFVLV  134

Query  185  AEENPS  202
             E NP+
Sbjct  135  EELNPA  140



>gb|EAY89155.1| hypothetical protein OsI_10648 [Oryza sativa Indica Group]
Length=624

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N +T+   +L PG+ +L+PV+C C+G    AN +Y      TF  +A   FE L   V +
Sbjct  75   NKLTTEDGVLLPGQPLLVPVKCGCTGARSFANVTYPIRPRDTFFGLAVTAFENLTDFVLV  134

Query  185  AEENPS  202
             E NP+
Sbjct  135  EELNPA  140



>ref|XP_008441353.1| PREDICTED: protein LYK2 [Cucumis melo]
Length=684

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N  ++ +E L   + +LIP++C C+G FF A  + T ++  +F SIA E  EGL     +
Sbjct  85   NGFSADTEFLPKNQPLLIPIECKCNGSFFIAELTKTSIKGESFYSIA-ESLEGLTTCKAI  143

Query  185  AEENPSKVSW  214
             E+NP    W
Sbjct  144  KEKNPGVSPW  153



>ref|XP_009603047.1| PREDICTED: protein LYK2 [Nicotiana tomentosiformis]
Length=668

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N  ++ +E L   + +LIP+ C C GGFF A  + T ++  +F SIA +  EGL     +
Sbjct  83   NGFSADTEFLTIDQPLLIPLDCKCVGGFFEAELTKTTIKGESFYSIA-QSLEGLTTCKAI  141

Query  185  AEENPSKVSWD  217
             E+NP+   +D
Sbjct  142  KEKNPNITPFD  152



>ref|XP_006425755.1| hypothetical protein CICLE_v10027311mg [Citrus clementina]
 ref|XP_006466748.1| PREDICTED: lysM domain receptor-like kinase 4-like [Citrus sinensis]
 gb|ESR38995.1| hypothetical protein CICLE_v10027311mg [Citrus clementina]
Length=632

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +2

Query  8    NVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLA  187
            N  S +  LE  R V++PV CSCSG ++ +N +YT     T+  IA   F+GL     L 
Sbjct  93   NSVSETATLETNRLVIVPVNCSCSGQYYQSNTTYTIQNGDTYLFIANNTFQGLSTCQALE  152

Query  188  EENPS  202
            ++N S
Sbjct  153  DQNGS  157



>ref|XP_002510756.1| kinase, putative [Ricinus communis]
 gb|EEF52943.1| kinase, putative [Ricinus communis]
Length=634

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 2/67 (3%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGG-FFSANFSYT-PLENTTFGSIACEVFEGLVKPV  178
            NN++S    + P  ++ IPV CSC GG F+  N SYT    + T+ S+A + ++GL    
Sbjct  93   NNISSDVSSIPPQSQLFIPVNCSCFGGQFYQHNASYTLKFSSETYFSVANDTYQGLSTCQ  152

Query  179  TLAEENP  199
             L  +NP
Sbjct  153  ALMSQNP  159



>ref|XP_009395847.1| PREDICTED: protein LYK5 [Musa acuminata subsp. malaccensis]
Length=658

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  50   VLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEENP  199
            VL+PV CSCSGG++  N SYT     T+  +A + ++GL     L  +NP
Sbjct  105  VLVPVPCSCSGGYYQHNVSYTLTSRDTYFIVANDTYQGLSTCQALIAQNP  154



>ref|XP_010913817.1| PREDICTED: protein LYK5-like [Elaeis guineensis]
Length=639

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  50   VLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEENP  199
            VL+PV CSCSG ++  N SYT   N  + S+A   ++GL     LA +NP
Sbjct  107  VLVPVACSCSGEYYQHNASYTVKYNDIYFSVANNTYQGLSTCQALAAQNP  156



>gb|EYU44312.1| hypothetical protein MIMGU_mgv1a025419mg, partial [Erythranthe 
guttata]
Length=654

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = +2

Query  17   SGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEEN  196
            + + + E  R VLIPV CSCSG  +  N SY   ++ T+  IA   F+GL    +L  +N
Sbjct  109  TNTAVFEADRMVLIPVTCSCSGEHYQVNASYVVRQDDTYFGIANATFQGLSTCQSLETQN  168



>ref|XP_004138791.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
 ref|XP_004158590.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
 gb|KGN63179.1| hypothetical protein Csa_2G406770 [Cucumis sativus]
Length=684

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N  ++ ++ L   + +LIP++C C+G FF A  + T ++  +F SIA E  EGL     +
Sbjct  85   NGFSADTKFLPKNQPLLIPIECKCNGSFFLAELTKTSIKGESFYSIA-ESLEGLTTCKAI  143

Query  185  AEENPSKVSW  214
             E+NP    W
Sbjct  144  KEKNPGVSPW  153



>ref|XP_008440166.1| PREDICTED: lysM domain receptor-like kinase 4 [Cucumis melo]
Length=640

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    RNNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVT  181
            R N  + S    P + VL+P  CSCSG F  +N S+T     ++ +IA E  +GL    +
Sbjct  86   RVNSVNASATFPPEKLVLVPTTCSCSGLFLQSNVSFTTRTGDSYFAIANETLQGLSTCQS  145

Query  182  LAEENPS  202
            L  +NP+
Sbjct  146  LISQNPN  152



>dbj|BAI79280.1| LysM type receptor kinase [Lotus japonicus]
Length=672

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (51%), Gaps = 1/71 (1%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N  ++ +E L     +LIP+ C C G FF A  + T ++  +F SIA E  EGL     +
Sbjct  88   NGFSAETEFLPQNHPLLIPIDCRCKGEFFQAELTKTTIKGESFYSIA-ESLEGLTTCKAI  146

Query  185  AEENPSKVSWD  217
             E NP    W+
Sbjct  147  RENNPDVSPWN  157



>ref|XP_004233647.1| PREDICTED: protein LYK5-like [Solanum lycopersicum]
Length=616

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYT-PLENTTFGSIACEVFEGLVKPVT  181
            NN+ S  +IL+  +EV++PV CSCSG ++ A+ SY  P +  T+  IA   ++GL     
Sbjct  89   NNI-SRFKILDQNQEVIVPVNCSCSGQYYQADTSYVIPSKYDTYFRIATSTYQGLSTCSA  147

Query  182  LAEEN  196
            +  EN
Sbjct  148  VMHEN  152



>ref|XP_002510333.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF52520.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=637

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NNVT  SE     +EV++PV CSC G ++ AN S+    + ++ +IA + +EGL    +L
Sbjct  88   NNVTGLSE-FPLNKEVIVPVSCSCLGQYYQANTSFQVASDHSYFTIASQTYEGLSTCASL  146

Query  185  AEEN  196
             + N
Sbjct  147  KKAN  150



>gb|KDO79455.1| hypothetical protein CISIN_1g039626mg [Citrus sinensis]
Length=628

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +2

Query  32   LEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEENPS  202
            LE  R V++PV CSCSG ++ +N +YT     T+  IA   F+GL     L ++N S
Sbjct  97   LETNRLVIVPVNCSCSGQYYQSNTTYTIQNGDTYLFIANNTFQGLSTCQALEDQNGS  153



>ref|XP_006849863.1| hypothetical protein AMTR_s00022p00063910 [Amborella trichopoda]
 gb|ERN11444.1| hypothetical protein AMTR_s00022p00063910 [Amborella trichopoda]
Length=650

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  50   VLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEENPS  202
            V++PV CSCSG F+  N SY   E   + +IA   +EGL     L ++NP+
Sbjct  98   VIVPVNCSCSGSFYQHNASYIIKEGDIYLTIANNTYEGLTTCDALIKQNPN  148



>ref|XP_011099273.1| PREDICTED: lysM domain receptor-like kinase 4 [Sesamum indicum]
Length=646

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = +2

Query  29   ILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEENPS  202
            + +  R VL+PV CSCSG  +  N SY   +  T+  IA   F+GL    TL  EN +
Sbjct  97   LFDTNRMVLVPVTCSCSGEHYQVNASYVVQQGDTYFMIANNTFQGLSTCQTLQAENDT  154



>ref|XP_008652982.1| PREDICTED: protein LYK5-like [Zea mays]
 tpg|DAA44181.1| TPA: putative lysM-domain receptor-like protein kinase family 
protein [Zea mays]
Length=636

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            N ++S   +L+PG+ +L+PV+C C+G +  AN +Y   +  TF ++A   +E L +   +
Sbjct  82   NGLSSEDGVLQPGQPLLVPVRCGCAGAWSFANVTYPIRQGDTFYNLAKASYENLTEYHLI  141

Query  185  AEENP  199
               NP
Sbjct  142  QNLNP  146



>gb|ABN50364.2| LysM-domain containing receptor-like kinase [Sesbania rostrata]
Length=630

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 0/63 (0%)
 Frame = +2

Query  8    NVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLA  187
            N  S ++  +  + VL+PV CSC+G ++ AN SY      T+  IA   FEGL     L 
Sbjct  90   NSVSLNDTFDTNKLVLVPVNCSCAGQYYQANTSYVFQNTDTYLLIANNTFEGLSTCQALM  149

Query  188  EEN  196
             EN
Sbjct  150  HEN  152



>ref|XP_010070127.1| PREDICTED: wall-associated receptor kinase-like 9 [Eucalyptus 
grandis]
 gb|KCW58723.1| hypothetical protein EUGRSUZ_H01369 [Eucalyptus grandis]
Length=664

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTL  184
            NN+ S +E +  G  V++PV C C+G  +S   SYT +++ T+ ++A   F+GL+    L
Sbjct  90   NNIKSTAEEIPYGNLVIVPVPCHCTGTIYSHQASYTVVKDDTYYNLANITFQGLIFCRAL  149

Query  185  AEEN  196
             ++N
Sbjct  150  NDQN  153



>ref|XP_008241611.1| PREDICTED: protein LYK5-like [Prunus mume]
Length=636

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = +2

Query  5    NNVTSGSEILEPGREVLIPVQCSCSGGFFSANFSY-TPLENTTFGSIACEVFEGLVKPVT  181
            NN++  + +L   +EV++PV CSCSG ++ A  SY  P  + T+ +IA + ++ +     
Sbjct  88   NNISDHTLVLPQNKEVIVPVVCSCSGEYYEAKASYLIPSIDDTYYTIATDTYQSMSTCNA  147

Query  182  LAEEN  196
            L  EN
Sbjct  148  LMHEN  152



>gb|AER51060.1| Nod-factor receptor 5, partial [Lotus corniculatus]
Length=588

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = +2

Query  8    NVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLA  187
            N+ +G + L PG+ +LIPV C C+G   SAN SY   +  ++  +A  ++E L     + 
Sbjct  81   NIDAGKDKLVPGQVLLIPVTCGCAGNHSSANTSYQIQKGDSYDFVATTLYENLTNWNIVQ  140

Query  188  EENP  199
              NP
Sbjct  141  ASNP  144



>gb|AER51050.1| Nod-factor receptor 5, partial [Lotus corniculatus]
Length=588

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = +2

Query  8    NVTSGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLA  187
            N+ +G + L PG+ +LIPV C C+G   SAN SY   +  ++  +A  ++E L     + 
Sbjct  81   NIDAGKDKLVPGQVLLIPVTCGCAGNHSSANTSYQIQKGDSYDFVATTLYENLTNWNIVQ  140

Query  188  EENP  199
              NP
Sbjct  141  ASNP  144



>dbj|BAI79286.1| LysM type receptor kinase [Lotus japonicus]
Length=633

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +2

Query  17   SGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEEN  196
            S +   E  + V++PVQCSC+G ++ AN SY      T  SIA   FEGL     L  EN
Sbjct  96   SQNTTFETNKLVIVPVQCSCAGEYYQANTSYAFQNTDTPFSIANNTFEGLTTCQALMHEN  155



>dbj|BAI79276.1| LysM type receptor kinase [Lotus japonicus]
Length=633

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +2

Query  17   SGSEILEPGREVLIPVQCSCSGGFFSANFSYTPLENTTFGSIACEVFEGLVKPVTLAEEN  196
            S +   E  + V++PVQCSC+G ++ AN SY      T  SIA   FEGL     L  EN
Sbjct  96   SQNTTFETNKLVIVPVQCSCAGEYYQANTSYAFQNTDTPFSIANNTFEGLTTCQALMHEN  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507827886552