BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c90342_g1_i1 len=832 path=[810:0-831]

Length=832
                                                                      Score     E

ref|NP_001237173.1|  uncharacterized protein LOC100305565               103   2e-23   
ref|XP_002277769.1|  PREDICTED: protein TIFY 5A                         103   2e-23   Vitis vinifera
ref|XP_003634826.1|  PREDICTED: protein TIFY 5A                         101   2e-23   
ref|XP_002277805.1|  PREDICTED: protein TIFY 5A                         100   1e-22   Vitis vinifera
ref|XP_007025052.1|  Jasmonate-zim-domain protein 8, putative           100   1e-22   
ref|XP_003524863.1|  PREDICTED: protein TIFY 5A-like                    100   2e-22   
emb|CAN73912.1|  hypothetical protein VITISV_026095                   97.8    1e-21   Vitis vinifera
ref|NP_001236696.1|  uncharacterized protein LOC100500349             97.4    2e-21   
ref|XP_003546080.1|  PREDICTED: protein TIFY 5A-like                  95.1    2e-20   
ref|XP_010110946.1|  Protein TIFY 5A                                  94.4    2e-20   
gb|KHG22334.1|  Protein TIFY 5A -like protein                         94.0    3e-20   
ref|XP_002271197.1|  PREDICTED: protein TIFY 5A-like                  91.3    3e-19   Vitis vinifera
emb|CBI30922.3|  unnamed protein product                              91.3    3e-19   
gb|AFL46171.1|  jasmonate ZIM domain protein f                        90.5    6e-19   
ref|XP_010052054.1|  PREDICTED: protein TIFY 5A                       90.9    7e-19   
ref|XP_006346837.1|  PREDICTED: protein TIFY 5A-like                  89.7    9e-19   
ref|XP_009602642.1|  PREDICTED: protein TIFY 5A-like                  89.7    1e-18   
ref|XP_010666717.1|  PREDICTED: protein TIFY 5A                       89.7    1e-18   
ref|XP_009791621.1|  PREDICTED: protein TIFY 5A-like                  89.0    2e-18   
ref|XP_004504911.1|  PREDICTED: protein TIFY 5A-like                  89.7    3e-18   
ref|XP_011004469.1|  PREDICTED: protein TIFY 5A-like isoform X1       88.6    3e-18   
gb|AFK48575.1|  unknown                                               88.6    4e-18   
ref|XP_006346835.1|  PREDICTED: protein TIFY 5A-like                  87.8    4e-18   
ref|XP_004244921.1|  PREDICTED: protein TIFY 5A-like                  88.2    4e-18   
gb|KHG24533.1|  Protein TIFY 5A -like protein                         87.8    5e-18   
ref|XP_002307919.2|  hypothetical protein POPTR_0006s02410g           87.4    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009375343.1|  PREDICTED: protein TIFY 5A-like                  87.0    8e-18   
ref|XP_007217297.1|  hypothetical protein PRUPE_ppa018461mg           86.7    1e-17   
emb|CBI30921.3|  unnamed protein product                              85.9    1e-17   
gb|EYU33377.1|  hypothetical protein MIMGU_mgv1a016361mg              86.3    2e-17   
gb|AFL46174.1|  jasmonate ZIM domain protein j                        86.3    2e-17   
ref|XP_009800006.1|  PREDICTED: protein TIFY 5A-like                  86.3    3e-17   
ref|XP_002277952.1|  PREDICTED: protein TIFY 5A-like                  85.9    4e-17   Vitis vinifera
ref|XP_004244919.1|  PREDICTED: protein TIFY 5A-like                  84.7    4e-17   
gb|KGN49405.1|  hypothetical protein Csa_6G523460                     85.5    5e-17   
ref|XP_010275855.1|  PREDICTED: protein TIFY 5A-like                  85.5    5e-17   
ref|XP_009778558.1|  PREDICTED: protein TIFY 5A-like                  85.1    6e-17   
ref|XP_010244732.1|  PREDICTED: protein TIFY 5A-like                  85.1    7e-17   
gb|KCW73813.1|  hypothetical protein EUGRSUZ_E02416                   84.0    9e-17   
ref|XP_009622676.1|  PREDICTED: protein TIFY 5A-like                  84.3    9e-17   
ref|XP_008229679.1|  PREDICTED: protein TIFY 5A-like isoform X3       83.6    1e-16   
ref|XP_010056897.1|  PREDICTED: protein TIFY 5B-like                  84.0    1e-16   
ref|XP_007147916.1|  hypothetical protein PHAVU_006G165800g           84.3    1e-16   
ref|XP_008229678.1|  PREDICTED: protein TIFY 5A-like isoform X2       83.6    1e-16   
ref|XP_008229677.1|  PREDICTED: protein TIFY 5A-like isoform X1       83.6    1e-16   
emb|CDP17466.1|  unnamed protein product                              83.6    2e-16   
ref|XP_006346840.1|  PREDICTED: protein TIFY 5A-like                  83.2    2e-16   
ref|XP_007212237.1|  hypothetical protein PRUPE_ppa013410mg           83.2    3e-16   
ref|XP_004134648.1|  PREDICTED: protein TIFY 5A-like                  82.8    3e-16   
gb|KDO78202.1|  hypothetical protein CISIN_1g046141mg                 82.4    4e-16   
ref|XP_006467450.1|  PREDICTED: protein TIFY 5A-like                  82.4    4e-16   
ref|XP_004244920.1|  PREDICTED: protein TIFY 5A-like                  82.4    4e-16   
ref|XP_006346841.1|  PREDICTED: protein TIFY 5A-like                  82.4    4e-16   
gb|KDP37988.1|  hypothetical protein JCGZ_04631                       83.2    4e-16   
ref|XP_006449712.1|  hypothetical protein CICLE_v10017198mg           82.4    4e-16   
ref|XP_004486286.1|  PREDICTED: protein TIFY 5A-like                  82.4    6e-16   
ref|XP_011012848.1|  PREDICTED: protein TIFY 5A-like                  82.4    6e-16   
gb|EYU33376.1|  hypothetical protein MIMGU_mgv1a016361mg              81.6    9e-16   
ref|XP_008225498.1|  PREDICTED: protein TIFY 5B                       80.9    2e-15   
ref|XP_009377943.1|  PREDICTED: protein TIFY 5A-like                  80.5    2e-15   
gb|KDP37989.1|  hypothetical protein JCGZ_04632                       80.9    2e-15   
ref|XP_002519662.1|  conserved hypothetical protein                   80.5    3e-15   Ricinus communis
ref|XP_006368137.1|  PREDICTED: protein TIFY 5A-like                  79.0    4e-15   
gb|KEH21427.1|  jasmonate zim-domain protein                          78.2    6e-15   
ref|XP_006346836.1|  PREDICTED: protein TIFY 5A-like                  78.6    7e-15   
ref|XP_006346838.1|  PREDICTED: protein TIFY 5A-like                  78.6    7e-15   
ref|XP_008439622.1|  PREDICTED: protein TIFY 5A                       79.0    8e-15   
gb|AET05592.2|  jasmonate zim-domain protein                          78.6    8e-15   
ref|XP_010324845.1|  PREDICTED: protein TIFY 5A-like                  78.2    1e-14   
emb|CAN84091.1|  hypothetical protein VITISV_007759                   78.2    1e-14   Vitis vinifera
ref|XP_008371611.1|  PREDICTED: protein TIFY 5A                       77.8    1e-14   
ref|XP_008371769.1|  PREDICTED: protein TIFY 5A-like                  77.8    1e-14   
gb|AGC73981.1|  jasmonate ZIM-domain protein 8                        77.8    2e-14   
ref|XP_002890853.1|  predicted protein                                77.4    3e-14   
ref|XP_002316712.1|  hypothetical protein POPTR_0011s02260g           77.8    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_002519661.1|  conserved hypothetical protein                   77.4    6e-14   Ricinus communis
ref|XP_004293626.1|  PREDICTED: protein TIFY 5A-like                  76.3    6e-14   
ref|XP_011096584.1|  PREDICTED: protein TIFY 5A                       76.6    7e-14   
ref|XP_008371770.1|  PREDICTED: protein TIFY 5A-like                  75.5    1e-13   
gb|EYU43255.1|  hypothetical protein MIMGU_mgv1a016202mg              75.1    2e-13   
ref|NP_564349.1|  protein TIFY 5A                                     75.1    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009360904.1|  PREDICTED: protein TIFY 5A-like isoform X1       73.9    4e-13   
ref|XP_009360906.1|  PREDICTED: protein TIFY 5A-like isoform X2       72.8    1e-12   
ref|XP_003631116.1|  Protein TIFY 5A                                  71.2    2e-11   
ref|XP_009109614.1|  PREDICTED: protein TIFY 5A-like                  69.3    2e-11   
ref|XP_008356033.1|  PREDICTED: protein TIFY 5A-like                  68.2    2e-11   
emb|CDY51470.1|  BnaC03g59110D                                        68.6    4e-11   
ref|XP_008811927.1|  PREDICTED: protein TIFY 5A-like                  68.9    4e-11   
ref|XP_009397408.1|  PREDICTED: protein TIFY 5A-like                  68.9    5e-11   
ref|XP_009141392.1|  PREDICTED: protein TIFY 5B-like                  68.2    5e-11   
ref|XP_008371615.1|  PREDICTED: protein TIFY 5A-like                  67.4    1e-10   
gb|KGN65527.1|  hypothetical protein Csa_1G435720                     67.4    1e-10   
ref|XP_009417059.1|  PREDICTED: protein TIFY 5A-like                  66.6    2e-10   
emb|CDP06840.1|  unnamed protein product                              65.1    6e-10   
ref|XP_010538254.1|  PREDICTED: protein TIFY 5A                       63.9    2e-09   
ref|XP_002879504.1|  hypothetical protein ARALYDRAFT_482423           64.3    2e-09   
ref|XP_010907301.1|  PREDICTED: protein TIFY 5A-like                  64.3    2e-09   
emb|CDX99884.1|  BnaC05g23060D                                        63.5    3e-09   
ref|XP_008787820.1|  PREDICTED: protein TIFY 5A isoform X1            63.9    3e-09   
ref|XP_006415508.1|  hypothetical protein EUTSA_v10009598mg           63.5    3e-09   
ref|XP_010499533.1|  PREDICTED: protein TIFY 5A                       63.5    4e-09   
ref|XP_008451847.1|  PREDICTED: protein TIFY 5A-like                  63.2    4e-09   
ref|XP_010478391.1|  PREDICTED: protein TIFY 5A-like                  63.2    4e-09   
ref|XP_009628916.1|  PREDICTED: protein TIFY 5A-like                  61.6    4e-09   
ref|XP_009360903.1|  PREDICTED: protein TIFY 5A-like                  62.4    7e-09   
ref|XP_010540587.1|  PREDICTED: protein TIFY 5A-like                  62.8    7e-09   
ref|XP_009389762.1|  PREDICTED: protein TIFY 5A-like                  62.4    1e-08   
ref|XP_004147775.1|  PREDICTED: protein TIFY 5A-like                  61.6    1e-08   
ref|XP_009115185.1|  PREDICTED: protein TIFY 5A-like                  61.6    1e-08   
ref|XP_006295117.1|  hypothetical protein CARUB_v10024191mg           62.0    2e-08   
ref|XP_009790070.1|  PREDICTED: protein TIFY 5A-like                  60.8    2e-08   
emb|CDX84301.1|  BnaC04g10630D                                        60.8    2e-08   
ref|XP_002862641.1|  hypothetical protein ARALYDRAFT_333262           60.8    2e-08   
ref|XP_009418985.1|  PREDICTED: protein TIFY 5A-like                  60.8    3e-08   
ref|XP_006304275.1|  hypothetical protein CARUB_v10010507mg           60.1    4e-08   
ref|XP_010907302.1|  PREDICTED: protein TIFY 5A-like                  60.5    5e-08   
ref|NP_181007.1|  jasmonate-zim-domain protein 7                      60.1    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003593904.1|  Protein TIFY 5A                                  58.5    7e-08   
ref|XP_006605684.1|  PREDICTED: protein TIFY 5A-like                  58.9    1e-07   
ref|XP_009143759.1|  PREDICTED: protein TIFY 5B-like                  58.9    1e-07   
ref|XP_010509733.1|  PREDICTED: protein TIFY 5B-like                  58.9    1e-07   
ref|XP_006304276.1|  hypothetical protein CARUB_v10010507mg           59.7    1e-07   
emb|CDY26288.1|  BnaA09g26390D                                        58.9    2e-07   
ref|XP_010908138.1|  PREDICTED: protein TIFY 5A-like                  58.5    2e-07   
ref|XP_009408785.1|  PREDICTED: protein TIFY 5A                       58.9    2e-07   
ref|XP_009630463.1|  PREDICTED: protein TIFY 5A-like                  57.8    3e-07   
ref|XP_011091963.1|  PREDICTED: protein TIFY 5A-like                  57.8    3e-07   
ref|XP_009406706.1|  PREDICTED: protein TIFY 5A-like                  57.4    6e-07   
ref|XP_007145968.1|  hypothetical protein PHAVU_006G001900g           56.2    7e-07   
ref|XP_009408786.1|  PREDICTED: protein TIFY 5A-like                  57.0    7e-07   
gb|KHN06969.1|  hypothetical protein glysoja_032812                   55.8    7e-07   
ref|XP_010504925.1|  PREDICTED: protein TIFY 5B-like                  56.6    9e-07   
ref|XP_010044866.1|  PREDICTED: protein TIFY 9-like                   57.4    1e-06   
ref|XP_007145967.1|  hypothetical protein PHAVU_006G001900g           55.8    1e-06   
dbj|BAK05553.1|  predicted protein                                    56.2    1e-06   
gb|EMS66242.1|  Protein TIFY 5A                                       55.8    2e-06   
ref|XP_010941162.1|  PREDICTED: protein TIFY 5A-like                  54.7    6e-06   
ref|XP_004486292.1|  PREDICTED: protein TIFY 5A-like                  53.1    8e-06   
ref|XP_010688800.1|  PREDICTED: protein TIFY 5A-like                  53.9    8e-06   
ref|XP_009145396.1|  PREDICTED: uncharacterized protein LOC103869096  53.9    9e-06   
ref|XP_009412023.1|  PREDICTED: protein TIFY 5A-like                  53.9    9e-06   
ref|XP_010549495.1|  PREDICTED: protein TIFY 5A-like                  53.9    1e-05   
ref|XP_006846121.1|  hypothetical protein AMTR_s00012p00148380        53.5    1e-05   
ref|XP_004163015.1|  PREDICTED: protein TIFY 5A-like                  52.8    2e-05   
gb|KHN21823.1|  hypothetical protein glysoja_044061                   52.8    2e-05   
ref|XP_008444384.1|  PREDICTED: protein TIFY 5A-like                  51.6    5e-05   
ref|XP_004149668.1|  PREDICTED: protein TIFY 5A-like                  51.2    6e-05   
ref|XP_006836445.1|  hypothetical protein AMTR_s00092p00170060        51.6    7e-05   
ref|XP_006300003.1|  hypothetical protein CARUB_v10016226mg           50.4    1e-04   
ref|NP_568287.1|  protein TIFY 9                                      51.6    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078200.1|  uncharacterized protein                          50.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885495.1|  hypothetical protein ARALYDRAFT_479741           50.1    1e-04   
emb|CDY37403.1|  BnaC05g30270D                                        50.1    2e-04   
ref|XP_006399812.1|  hypothetical protein EUTSA_v10014724mg           51.2    2e-04   
ref|XP_002297866.1|  hypothetical protein POPTR_0001s13240g           51.2    2e-04   Populus trichocarpa [western balsam poplar]
emb|CDX92936.1|  BnaA03g36580D                                        50.1    2e-04   
ref|XP_006406188.1|  hypothetical protein EUTSA_v10021766mg           49.7    2e-04   
ref|XP_006836619.1|  hypothetical protein AMTR_s00131p00119200        51.6    2e-04   
emb|CDY70721.1|  BnaCnng69490D                                        49.3    3e-04   
emb|CDY24300.1|  BnaC03g42730D                                        48.9    4e-04   
ref|XP_007142558.1|  hypothetical protein PHAVU_008G290900g           48.5    4e-04   
ref|XP_009390857.1|  PREDICTED: protein TIFY 10A-like                 49.7    7e-04   
ref|XP_010495178.1|  PREDICTED: protein TIFY 9-like                   48.5    0.001   



>ref|NP_001237173.1| uncharacterized protein LOC100305565 [Glycine max]
 gb|ACU13309.1| unknown [Glycine max]
 gb|KHN12457.1| Protein TIFY 5A [Glycine soja]
Length=150

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 90/138 (65%), Gaps = 6/138 (4%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MR+NCNLEL L P S S    + + + +   Q   + H  ++  + Q  LTIFYDGKI  
Sbjct  1    MRKNCNLELRLFPPSLSDLRPMMEAEVSERPQQQVAHHQQQQQPQPQHPLTIFYDGKISV  60

Query  438  SDVTEIQARAIILLASQERTKKT---TRSLASSPLLLQK--QLYSPN-ALSMKGSLQRFL  277
            SDVTE+QAR+I++LA++E  K+    T S  SSP+LLQ    +YSP   LSMK SLQRFL
Sbjct  61   SDVTELQARSILMLANKEMEKRVMTPTGSEPSSPILLQSPHNMYSPGTGLSMKRSLQRFL  120

Query  276  QKRKNRVQSTSPYHR*FI  223
            QKRKNRVQ TSPYH   I
Sbjct  121  QKRKNRVQETSPYHHELI  138



>ref|XP_002277769.1| PREDICTED: protein TIFY 5A [Vitis vinifera]
 emb|CAN62787.1| hypothetical protein VITISV_033493 [Vitis vinifera]
 emb|CBI30919.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 90/135 (67%), Gaps = 17/135 (13%)
 Frame = -2

Query  615  RRNCNLElslspsssssgpsiSQEDYNAVQQ----LPTSDHsseesrrqqqQLTIFYDGK  448
            RRNCNLEL L P            DY++ Q     +  +   S + ++QQQQLTIFY+G+
Sbjct  3    RRNCNLELRLLPP---------NTDYSSPQHHHNMMMETGRGSPQEQQQQQQLTIFYNGR  53

Query  447  IVSSDVTEIQARAIILLAS---QERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQRFL  277
            I   DVTE+QARAI+LLAS   +E+T+  T S A+SP L   QLYS   LSMK SLQRFL
Sbjct  54   ICVCDVTELQARAILLLASREMEEKTRTPTASDATSPSL-HSQLYSATGLSMKRSLQRFL  112

Query  276  QKRKNRVQSTSPYHR  232
            QKRKNR+++TSPYHR
Sbjct  113  QKRKNRMEATSPYHR  127



>ref|XP_003634826.1| PREDICTED: protein TIFY 5A [Vitis vinifera]
 emb|CBI18787.3| unnamed protein product [Vitis vinifera]
Length=98

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS---QERTKKTTRSLASSPLLLQKQLYSPNALSM  301
            LTIFY+G+I   DVTE+QARAI+L AS   +E+T+  T S A SP L   Q+YSP  LSM
Sbjct  17   LTIFYNGRICVCDVTELQARAILLFASREMEEKTRTPTASDAISPSL-HSQIYSPTGLSM  75

Query  300  KGSLQRFLQKRKNRVQSTSPYHR  232
            K SLQRFLQKRKNR+++TSPYHR
Sbjct  76   KRSLQRFLQKRKNRMEATSPYHR  98



>ref|XP_002277805.1| PREDICTED: protein TIFY 5A [Vitis vinifera]
 emb|CBI30920.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL--LQKQLYSPNALSMK  298
            LTIFY+G+I   DVTE+QARAI+ LAS+E  +KT    AS  +   L  QLYSP  LSMK
Sbjct  46   LTIFYNGRICVCDVTELQARAILQLASREMEEKTRTPTASDAISSSLHSQLYSPTGLSMK  105

Query  297  GSLQRFLQKRKNRVQSTSPYHR  232
             SLQRFLQKRKNR+++TSPYHR
Sbjct  106  RSLQRFLQKRKNRMEATSPYHR  127



>ref|XP_007025052.1| Jasmonate-zim-domain protein 8, putative [Theobroma cacao]
 gb|EOY27674.1| Jasmonate-zim-domain protein 8, putative [Theobroma cacao]
Length=121

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 89/134 (66%), Gaps = 19/134 (14%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L PSS S G     E+ +   Q             QQQQLTIFY+G++  
Sbjct  1    MRRNCNLELRLLPSSYSGGHHDMMEESSESPQ------------NQQQQLTIFYNGRVCV  48

Query  438  SDVTEIQARAIILLASQERTKKTTR-----SLASSPLLLQKQLYSPN-ALSMKGSLQRFL  277
             DVTE+QARAI++LA++E  ++ T      S+ +SP L Q QLYSPN  ++MK SLQRFL
Sbjct  49   CDVTELQARAILMLANRETDERITTPTGSGSVPASPTL-QSQLYSPNTGMTMKRSLQRFL  107

Query  276  QKRKNRVQSTSPYH  235
            QKRKNR+Q+TSPYH
Sbjct  108  QKRKNRIQATSPYH  121



>ref|XP_003524863.1| PREDICTED: protein TIFY 5A-like [Glycine max]
 gb|KHN46074.1| Protein TIFY 5A [Glycine soja]
Length=134

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 7/85 (8%)
 Frame = -2

Query  468  TIFYDGKIVSSDVTEIQARAIILLASQE---RTKKTTRSLASSPLLLQ---KQLYSPN-A  310
            TIFYDGKI  SDVTE+QAR+I++LA++E   R    T S  SSP+LLQ     +YSP+  
Sbjct  49   TIFYDGKICVSDVTELQARSILMLANKETERRVMTPTGSEPSSPILLQSPHNNMYSPSTG  108

Query  309  LSMKGSLQRFLQKRKNRVQSTSPYH  235
            LSMK SLQRFLQKRKNRVQ TSPYH
Sbjct  109  LSMKRSLQRFLQKRKNRVQETSPYH  133



>emb|CAN73912.1| hypothetical protein VITISV_026095 [Vitis vinifera]
Length=127

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL--LQKQLYSPNALSMK  298
            LTIFY+G+I    VTE+QARAI+ LAS+E  +KT    AS  +   L  QLYSP  LSMK
Sbjct  46   LTIFYNGRICVCXVTELQARAILQLASREMEEKTRTPTASDAISSSLHSQLYSPTGLSMK  105

Query  297  GSLQRFLQKRKNRVQSTSPYHR  232
             SLQRFLQKRKNR+++TSPYHR
Sbjct  106  RSLQRFLQKRKNRMEATSPYHR  127



>ref|NP_001236696.1| uncharacterized protein LOC100500349 [Glycine max]
 gb|ACU15403.1| unknown [Glycine max]
 gb|KHN47333.1| Protein TIFY 5A [Glycine soja]
Length=138

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 6/85 (7%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS---QERTKKTTRSLASSPLLLQ--KQLYSPN-A  310
            LTIFYDG I  +DVTE+QA++I+LLA+   +ER +  T S  SSP ++Q   QLYSP   
Sbjct  53   LTIFYDGNICVADVTELQAKSILLLANRKLEERVRTPTGSEPSSPAVMQSNNQLYSPGTG  112

Query  309  LSMKGSLQRFLQKRKNRVQSTSPYH  235
            LSM+ SLQRFLQKRKNRVQ  SPYH
Sbjct  113  LSMRKSLQRFLQKRKNRVQEASPYH  137



>ref|XP_003546080.1| PREDICTED: protein TIFY 5A-like [Glycine max]
Length=133

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 87/133 (65%), Gaps = 8/133 (6%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL+L P S S  P +   +  A +  P  +      + QQQ LTIFYDGKI  
Sbjct  1    MRRNCNLELALFPPSDSGPPMVDNVEEEASEISPMQN--LFHRQEQQQPLTIFYDGKICV  58

Query  438  SDVTEIQARAIILLAS---QERTKKTTRSLASSPLLLQ--KQLYSPN-ALSMKGSLQRFL  277
            +DVTE+QA++I++LA+   +ER +  T S  SSP ++Q   QLYSP    SM+ SLQRFL
Sbjct  59   ADVTELQAKSILMLANRKLEERVRTPTGSEPSSPTVMQSNNQLYSPGTGPSMRKSLQRFL  118

Query  276  QKRKNRVQSTSPY  238
            QKR+NRVQ  SPY
Sbjct  119  QKRRNRVQEASPY  131



>ref|XP_010110946.1| Protein TIFY 5A [Morus notabilis]
 gb|EXC29332.1| Protein TIFY 5A [Morus notabilis]
Length=124

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 80/130 (62%), Gaps = 7/130 (5%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLELSL P+SS+   S    D +  Q+               Q LTIFY+GKI  
Sbjct  1    MRRNCNLELSLLPTSSAYFSSSG-TDSDHQQRTEKLISHESSPNTSNQPLTIFYNGKICV  59

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPN-ALSMKGSLQRFLQKRKN  262
             DVT+ QARAI+LLAS E  ++       +P  +Q  +YSP  ALSMK SLQRFLQKRKN
Sbjct  60   CDVTDFQARAILLLASGEMEER-----VKTPTSMQSPVYSPTPALSMKRSLQRFLQKRKN  114

Query  261  RVQSTSPYHR  232
            R Q+ SPYHR
Sbjct  115  RAQAVSPYHR  124



>gb|KHG22334.1| Protein TIFY 5A -like protein [Gossypium arboreum]
Length=119

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 83/131 (63%), Gaps = 15/131 (11%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L PSS  S      E+              E    QQQQLTIFY+G++  
Sbjct  1    MRRNCNLELRLLPSSYPSDSHDMMEE------------RIESPETQQQQLTIFYNGRVCV  48

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSPL--LLQKQLYSPN-ALSMKGSLQRFLQKR  268
            SDVTE+QA+AI++LA++ER ++        P+   L+ Q+  PN ALSMK SLQRFLQKR
Sbjct  49   SDVTELQAKAILMLANRERDERMKSPTGWEPVSPTLKSQVKCPNTALSMKRSLQRFLQKR  108

Query  267  KNRVQSTSPYH  235
            K R+Q+TSPYH
Sbjct  109  KTRIQATSPYH  119



>ref|XP_002271197.1| PREDICTED: protein TIFY 5A-like [Vitis vinifera]
Length=121

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQE-RTKKTTRSLAS--SPLLLQKQLYSPNALSM  301
            LTIFYDG++   +VTE+QARAIIL AS+E  TK  T S  +  SP L Q QLYSP  LSM
Sbjct  40   LTIFYDGRVCVCEVTELQARAIILTASREVETKTPTASDVTMVSPSL-QSQLYSPTGLSM  98

Query  300  KGSLQRFLQKRKNRVQSTSPY  238
            K SL+ FLQKRKNR+++TSPY
Sbjct  99   KRSLRSFLQKRKNRIEATSPY  119



>emb|CBI30922.3| unnamed protein product [Vitis vinifera]
Length=130

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQE-RTKKTTRSLAS--SPLLLQKQLYSPNALSM  301
            LTIFYDG++   +VTE+QARAIIL AS+E  TK  T S  +  SP L Q QLYSP  LSM
Sbjct  49   LTIFYDGRVCVCEVTELQARAIILTASREVETKTPTASDVTMVSPSL-QSQLYSPTGLSM  107

Query  300  KGSLQRFLQKRKNRVQSTSPY  238
            K SL+ FLQKRKNR+++TSPY
Sbjct  108  KRSLRSFLQKRKNRIEATSPY  128



>gb|AFL46171.1| jasmonate ZIM domain protein f [Nicotiana attenuata]
Length=123

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 81/128 (63%), Gaps = 6/128 (5%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L P   S  P    +D          D+   E ++QQQ LTIFY+GK+V 
Sbjct  1    MRRNCNLELRLVPPCVSVSP----KDCTTTPYFSMRDNQGTEEKQQQQ-LTIFYNGKVVV  55

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQRFLQKRKNR  259
            SD TE+QA+AII LAS+E T++ T++ +         L +   LSMK SLQRFLQKRKNR
Sbjct  56   SDATELQAKAIIYLASRE-TEENTKTSSPISESSSPLLQTQTGLSMKKSLQRFLQKRKNR  114

Query  258  VQSTSPYH  235
            +Q TSPYH
Sbjct  115  IQETSPYH  122



>ref|XP_010052054.1| PREDICTED: protein TIFY 5A [Eucalyptus grandis]
 gb|KCW75911.1| hypothetical protein EUGRSUZ_D00289 [Eucalyptus grandis]
Length=138

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (73%), Gaps = 12/91 (13%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS---QERTKKT-TRSLASSPLL--------LQKQ  328
            LTIFYDGK+ +S VTE+QARAIILLA+   +ER+ KT T S  S+P +        LQ Q
Sbjct  45   LTIFYDGKVCASTVTELQARAIILLANREMEERSSKTPTGSEPSTPSVRSQPSTPNLQAQ  104

Query  327  LYSPNALSMKGSLQRFLQKRKNRVQSTSPYH  235
            +YS   LSMK SLQRFLQKR++R Q+TSPY+
Sbjct  105  VYSSTGLSMKRSLQRFLQKRQHRSQATSPYY  135



>ref|XP_006346837.1| PREDICTED: protein TIFY 5A-like [Solanum tuberosum]
Length=108

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 75/128 (59%), Gaps = 21/128 (16%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL+LS SS S      + +    QQL                 TIFY+GK V 
Sbjct  1    MRRNCNLELTLSLSSFSPIREDQEFENKKSQQL-----------------TIFYNGKFVD  43

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQRFLQKRKNR  259
            SDVT++QA+AII LAS+   +KT +    S   LQ Q      L MK SLQRFLQKRKNR
Sbjct  44   SDVTQLQAKAIIYLASRGMEEKTNKMSQPSSPSLQPQ----TGLFMKRSLQRFLQKRKNR  99

Query  258  VQSTSPYH  235
            +Q+TSPYH
Sbjct  100  IQTTSPYH  107



>ref|XP_009602642.1| PREDICTED: protein TIFY 5A-like [Nicotiana tomentosiformis]
 gb|AGU37283.1| jasmonate ZIM-domain protein 12a [Nicotiana tabacum]
Length=121

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 83/132 (63%), Gaps = 16/132 (12%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L P   S  P    +D       P     + +S  ++QQLTIFY+GK+V 
Sbjct  1    MRRNCNLELRLVPPCVSFSP----KDCTTT---PYFSMRNNQSTEEKQQLTIFYNGKVVV  53

Query  438  SDVTEIQARAIILLASQERTKKTTR----SLASSPLLLQKQLYSPNALSMKGSLQRFLQK  271
            SD TE+QA+AII LAS+E  + T      S ASSP LLQ Q      LSMK SLQ FLQK
Sbjct  54   SDATELQAKAIIYLASREMEENTKTSSPISEASSP-LLQTQ----TGLSMKRSLQGFLQK  108

Query  270  RKNRVQSTSPYH  235
            RKNR+Q+TSPYH
Sbjct  109  RKNRIQATSPYH  120



>ref|XP_010666717.1| PREDICTED: protein TIFY 5A [Beta vulgaris subsp. vulgaris]
Length=123

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 64/86 (74%), Gaps = 6/86 (7%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTK--KTTRSLAS----SPLLLQKQLYSPNA  310
            +TIFY+G+I   DVTE+QAR+II LAS+ +T   K+  S+      SP +  ++LY+ N 
Sbjct  38   MTIFYNGRICVCDVTELQARSIITLASKSKTSEVKSRTSIGGGDHISPTVQCQELYTQNG  97

Query  309  LSMKGSLQRFLQKRKNRVQSTSPYHR  232
            LSMK SL++FL+KRK+R+Q+TSPYHR
Sbjct  98   LSMKKSLRQFLEKRKHRIQATSPYHR  123



>ref|XP_009791621.1| PREDICTED: protein TIFY 5A-like [Nicotiana sylvestris]
Length=125

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 63/83 (76%), Gaps = 9/83 (11%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS---QERTKKTTR-SLASSPLLLQKQLYSPNALS  304
            LTIFY+GK+V SD TE+QA+AII LAS   +E TK +++ S ASSP LLQ Q      LS
Sbjct  47   LTIFYNGKVVVSDATELQAKAIIYLASREMEENTKTSSQISEASSP-LLQPQ----TGLS  101

Query  303  MKGSLQRFLQKRKNRVQSTSPYH  235
            MK SLQ FLQKRKNR+Q+TSPYH
Sbjct  102  MKRSLQGFLQKRKNRIQATSPYH  124



>ref|XP_004504911.1| PREDICTED: protein TIFY 5A-like [Cicer arietinum]
Length=156

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 61/90 (68%), Gaps = 11/90 (12%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKK--TTRSLASSPLLL-------QKQLYS  319
            LTI YDGK+   D TEIQA++I++LA++E  ++  T RS  SSP LL          LY+
Sbjct  40   LTIVYDGKVCVCDATEIQAKSILMLANKEMEERVRTPRSEPSSPTLLVSSHSHYHNHLYT  99

Query  318  P--NALSMKGSLQRFLQKRKNRVQSTSPYH  235
            P   +LSMK SLQRFLQKRKNR+Q  SPYH
Sbjct  100  PAGTSLSMKKSLQRFLQKRKNRIQEASPYH  129



>ref|XP_011004469.1| PREDICTED: protein TIFY 5A-like isoform X1 [Populus euphratica]
Length=121

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLAS-SPLLLQKQLYSPNALSMKG  295
            LTIFY+G+I   DVTE QARAII LAS+E  +++  + ++ +P  L  QLYSP  LS+K 
Sbjct  41   LTIFYNGRISVCDVTEFQARAIIWLASREEEERSNTARSNQAPKPLHSQLYSPPGLSLKR  100

Query  294  SLQRFLQKRKNRVQSTSPY  238
            SLQRFLQKRK R ++ SPY
Sbjct  101  SLQRFLQKRKKRAEAISPY  119



>gb|AFK48575.1| unknown [Medicago truncatula]
 gb|AES64155.2| jasmonate zim-domain protein [Medicago truncatula]
Length=134

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 86/137 (63%), Gaps = 13/137 (9%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSD-HsseesrrqqqQLTIFYDGKIV  442
            MRRNCNLEL L P  +SS      +++  V++    D + S   + Q Q LTIFYDGK+ 
Sbjct  1    MRRNCNLELCLFPPYNSSN----HQNHPMVEEEEEEDSNESTPMQNQHQPLTIFYDGKMC  56

Query  441  SSDVTEIQARAIILLAS----QERTKKTTRSLASSPLLL---QKQLYSPN-ALSMKGSLQ  286
             +DVTE+QA++I++LA+    QE+      S  S+P  +     QLYSP   LSMK SLQ
Sbjct  57   VTDVTELQAKSILMLANRIKVQEKVMTPIGSEPSTPTTIVQSPHQLYSPGPGLSMKRSLQ  116

Query  285  RFLQKRKNRVQSTSPYH  235
            RFLQKRKNRVQ  SPY+
Sbjct  117  RFLQKRKNRVQEASPYY  133



>ref|XP_006346835.1| PREDICTED: protein TIFY 5A-like [Solanum tuberosum]
Length=116

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 82/134 (61%), Gaps = 25/134 (19%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRR CNLEL L P +       ++E  +  ++              QQQLTIFYDGK+V 
Sbjct  1    MRRKCNLELRLVPPAPYFDSMGNKESIDEEKE--------------QQQLTIFYDGKVVV  46

Query  438  SDVTEIQARAIILLASQERTKKTTRSLAS-----SPLLLQKQLYSPNALSMKGSLQRFLQ  274
            SD TE+QA+AII LAS+E  K+ T++L+S     SPLL      S   +SMK SLQRFLQ
Sbjct  47   SDATEVQAKAIIHLASRE-MKENTKTLSSLSEPPSPLL-----QSQTEVSMKKSLQRFLQ  100

Query  273  KRKNRVQSTSPYHR  232
            KRK+R Q+ SPYH+
Sbjct  101  KRKSRTQAISPYHQ  114



>ref|XP_004244921.1| PREDICTED: protein TIFY 5A-like [Solanum lycopersicum]
Length=127

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 83/134 (62%), Gaps = 14/134 (10%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLP-TSDHsseesrrqqqQLTIFYDGKIV  442
            MRRNCNLE  L P S S+       + N         D  S E  ++ + LTIFY+GK+V
Sbjct  1    MRRNCNLEFRLMPPSLSTFSPNICSNNNTSSYFSMEEDKESTELEQKSEPLTIFYNGKLV  60

Query  441  SSDVTEIQARAIILLASQERTKKTTRSLA-----SSPLLLQKQLYSPNALSMKGSLQRFL  277
             S VT++QA+AII LAS+E  +KT +SL+     SSP LLQ Q       ++K SLQRFL
Sbjct  61   VSHVTDLQAKAIIYLASRETEEKTNKSLSPISEPSSP-LLQPQ-------TVKKSLQRFL  112

Query  276  QKRKNRVQSTSPYH  235
            QKRK+R Q+TSPYH
Sbjct  113  QKRKSRTQTTSPYH  126



>gb|KHG24533.1| Protein TIFY 5A -like protein [Gossypium arboreum]
Length=120

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 86/135 (64%), Gaps = 22/135 (16%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L PSS S G  + +   N   Q              QQQLTIFY+G++  
Sbjct  1    MRRNCNLELRLHPSSYSGGDRVEESSENPENQ--------------QQQLTIFYNGRVCV  46

Query  438  SDVTEIQARAIILLASQERTKK--TTR--SLASSPLLLQKQLYSPN---ALSMKGSLQRF  280
             DVTEIQARAI+++A++E  ++  T R  S  +SP +   Q+ SPN   + SMK SLQRF
Sbjct  47   CDVTEIQARAILMIANRETDERLRTPRPGSEPASPTV-HSQINSPNNGLSTSMKRSLQRF  105

Query  279  LQKRKNRVQSTSPYH  235
            LQKRKNR+Q+TSPY+
Sbjct  106  LQKRKNRIQATSPYY  120



>ref|XP_002307919.2| hypothetical protein POPTR_0006s02410g [Populus trichocarpa]
 gb|EEE91442.2| hypothetical protein POPTR_0006s02410g [Populus trichocarpa]
Length=120

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLAS-SPLLLQKQLYSPNALSMKG  295
            LTIFY+G+I   DVTE QARAII LAS+E+ +++  + ++ +P  L  QL+SP  LS+K 
Sbjct  40   LTIFYNGRISVCDVTEFQARAIIWLASREKEERSNTARSNQAPKPLHSQLHSPPGLSLKR  99

Query  294  SLQRFLQKRKNRVQSTSPY  238
            SLQRFLQKRK R ++ SPY
Sbjct  100  SLQRFLQKRKKRAEAISPY  118



>ref|XP_009375343.1| PREDICTED: protein TIFY 5A-like [Pyrus x bretschneideri]
Length=111

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 59/81 (73%), Gaps = 2/81 (2%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLL--QKQLYSPNALSMK  298
            +TIFY+G++   DVTE+QARAIILLA++E     T S  SS +LL  + Q+Y P  +SMK
Sbjct  25   ITIFYNGQVFVCDVTELQARAIILLATREMRGGGTSSRWSSAVLLALRSQIYGPPGVSMK  84

Query  297  GSLQRFLQKRKNRVQSTSPYH  235
             SL+RFLQKRK R Q+ SPY+
Sbjct  85   RSLRRFLQKRKQRSQAASPYN  105



>ref|XP_007217297.1| hypothetical protein PRUPE_ppa018461mg, partial [Prunus persica]
 gb|EMJ18496.1| hypothetical protein PRUPE_ppa018461mg, partial [Prunus persica]
Length=112

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL-LQKQLYSPNALSMKG  295
            +TIFY+G++  SD+TE+QARA+ILLA+ +  ++   S++++ LL LQ Q+Y P  +SMK 
Sbjct  30   ITIFYNGQVFVSDITELQARAMILLAAGDMAERGISSVSNAALLALQSQIYGPPGVSMKR  89

Query  294  SLQRFLQKRKNRVQSTSPYH  235
            SLQ FLQKRK R Q  SPY+
Sbjct  90   SLQSFLQKRKKRSQEASPYN  109



>emb|CBI30921.3| unnamed protein product [Vitis vinifera]
Length=96

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            LTIFY+G+I  SDVTE++ARAIIL AS+E  ++    L+ S   +Q QL  P+ +SMK S
Sbjct  20   LTIFYNGRICVSDVTELRARAIILAASREMEERKRAPLSPS---MQSQLCGPSGVSMKRS  76

Query  291  LQRFLQKRKNRVQSTSPYH  235
            L RFLQKRKNR ++ SPY+
Sbjct  77   LHRFLQKRKNRREAMSPYN  95



>gb|EYU33377.1| hypothetical protein MIMGU_mgv1a016361mg [Erythranthe guttata]
Length=123

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 75/128 (59%), Gaps = 13/128 (10%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQE-DYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIV  442
            M+RNCNLEL L    S    S + E  Y     L   D  S   +++Q QLT+FY+G+I 
Sbjct  1    MKRNCNLELPLVTMPSVFSDSSAHEHSYQFYNMLNMEDDQSPNQKQKQHQLTVFYNGRIA  60

Query  441  SSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQRFLQKRKN  262
            +SDVTE QARAIILLAS E   +   ++ +S             LSMK SLQRFL+KRK 
Sbjct  61   ASDVTEFQARAIILLASGEMEDEKRSAIPTS------------GLSMKRSLQRFLEKRKT  108

Query  261  RVQSTSPY  238
            R+Q TSPY
Sbjct  109  RLQCTSPY  116



>gb|AFL46174.1| jasmonate ZIM domain protein j [Nicotiana attenuata]
Length=132

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 83/136 (61%), Gaps = 11/136 (8%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MR+NCNLEL L P S S  P      Y ++ +    +       ++ QQLTIFY+GK+V 
Sbjct  1    MRKNCNLELRLMPPSFSFSPKSCTTPYFSMNR----EDKENTEEKEPQQLTIFYNGKLVV  56

Query  438  SDVTEIQARAIILLASQERTKK------TTRSLASSPLLLQKQLYSPNA-LSMKGSLQRF  280
            SD TE+QA+AII LAS+E  KK       + S +         L SP + +SMK SLQRF
Sbjct  57   SDATELQAKAIIYLASREMEKKIKIRSPISESSSPISEPSSPLLQSPASDISMKRSLQRF  116

Query  279  LQKRKNRVQSTSPYHR  232
            LQKRKNR+Q+TSPYHR
Sbjct  117  LQKRKNRIQATSPYHR  132



>ref|XP_009800006.1| PREDICTED: protein TIFY 5A-like [Nicotiana sylvestris]
Length=132

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 81/135 (60%), Gaps = 11/135 (8%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L P S S  P      Y +  +    +       +Q QQLTIFY+GK V 
Sbjct  1    MRRNCNLELRLMPPSFSFSPKNCTTPYFSTDR----EDKESTEEKQPQQLTIFYNGKFVV  56

Query  438  SDVTEIQARAIILLASQERTKKT------TRSLASSPLLLQKQLYSPNA-LSMKGSLQRF  280
            SD TE+QA+AII LAS+E  +KT      + S +         L SP + LSMK SLQRF
Sbjct  57   SDATELQAKAIIYLASREMEEKTKIRSPISESSSPISEPSSPFLQSPASDLSMKRSLQRF  116

Query  279  LQKRKNRVQSTSPYH  235
            LQKRKNR+Q+TSPYH
Sbjct  117  LQKRKNRIQATSPYH  131



>ref|XP_002277952.1| PREDICTED: protein TIFY 5A-like [Vitis vinifera]
Length=143

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            LTIFY+G+I  SDVTE++ARAIIL AS+E  ++    L+ S   +Q QL  P+ +SMK S
Sbjct  67   LTIFYNGRICVSDVTELRARAIILAASREMEERKRAPLSPS---MQSQLCGPSGVSMKRS  123

Query  291  LQRFLQKRKNRVQSTSPYH  235
            L RFLQKRKNR ++ SPY+
Sbjct  124  LHRFLQKRKNRREAMSPYN  142



>ref|XP_004244919.1| PREDICTED: protein TIFY 5A-like [Solanum lycopersicum]
Length=103

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 9/80 (11%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTR-SLASSPLLLQKQLYSPNALSMKG  295
            LTIFY+GK V+S VT++QA+AII LAS+E  +KT + S  SSP LLQ Q       ++K 
Sbjct  31   LTIFYNGKFVASHVTQLQAKAIIYLASREMEEKTNKLSEPSSP-LLQPQ-------TVKK  82

Query  294  SLQRFLQKRKNRVQSTSPYH  235
            SLQRFLQKRKNR+Q TSPYH
Sbjct  83   SLQRFLQKRKNRIQITSPYH  102



>gb|KGN49405.1| hypothetical protein Csa_6G523460 [Cucumis sativus]
Length=132

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 14/138 (10%)
 Frame = -2

Query  636  HSISRKMRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFY  457
            +S S +MRRNCNLEL LSP+ + +    +  D    Q   T+D S +  +     LTIFY
Sbjct  4    NSTSLRMRRNCNLELRLSPTPNPNPNPAAVSD----QPSATADDSPQSQQ-----LTIFY  54

Query  456  DGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQ----KQLYSPNALSMKGSL  289
            +G+I   DVTE+QARAI+ LA++E  ++   S   SP+L Q     +  +   LSMK SL
Sbjct  55   NGRICVCDVTELQARAILKLATRE-MEENGLSETPSPMLQQSSPPPRTPTTPGLSMKKSL  113

Query  288  QRFLQKRKNRVQSTSPYH  235
            QRFLQKRK+RVQ+TSPY+
Sbjct  114  QRFLQKRKHRVQATSPYN  131



>ref|XP_010275855.1| PREDICTED: protein TIFY 5A-like [Nelumbo nucifera]
Length=137

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 57/80 (71%), Gaps = 4/80 (5%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKK--TTRSLASSPLLLQKQLYSPNALSMK  298
            LTIFY+G++   DVT++QARAII +A +E  ++  T RS  S PL  Q QL S   LSMK
Sbjct  58   LTIFYNGRVCVCDVTDLQARAIICIARREMGERMTTPRSPLSPPL--QSQLQSLPGLSMK  115

Query  297  GSLQRFLQKRKNRVQSTSPY  238
             SLQRFLQKRKNR+Q  SPY
Sbjct  116  RSLQRFLQKRKNRMQDASPY  135



>ref|XP_009778558.1| PREDICTED: protein TIFY 5A-like [Nicotiana sylvestris]
Length=127

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 58/83 (70%), Gaps = 9/83 (11%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKT----TRSLASSPLLLQKQLYSPNALS  304
            LTIFY+ +IV SD TE+QAR II LAS+E  +KT      S A SPLL Q Q      LS
Sbjct  49   LTIFYNRQIVISDATELQAREIIYLASRETEEKTKIPSPISEAPSPLL-QTQ----TGLS  103

Query  303  MKGSLQRFLQKRKNRVQSTSPYH  235
            MK SLQRFLQKRKNR+Q TSPYH
Sbjct  104  MKRSLQRFLQKRKNRIQETSPYH  126



>ref|XP_010244732.1| PREDICTED: protein TIFY 5A-like [Nelumbo nucifera]
Length=141

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL--LQKQLYSPNALSMK  298
            LTIFY+G++   DVTE QARAII +A +E  ++   S   SPL   LQ  L SP  LSMK
Sbjct  62   LTIFYNGRVCVCDVTEFQARAIIWIARREMEERL--STPRSPLSPSLQSPLQSPPGLSMK  119

Query  297  GSLQRFLQKRKNRVQSTSPYH  235
             SLQRFLQKRKNR+Q  SPY 
Sbjct  120  RSLQRFLQKRKNRMQDASPYR  140



>gb|KCW73813.1| hypothetical protein EUGRSUZ_E02416 [Eucalyptus grandis]
Length=104

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS---QERTK--KTTRSLASSP--LLLQKQLYSP-  316
            LTIFYDG +   DVTE+QARAI++LAS   QER K   T  S  +SP       +LYSP 
Sbjct  14   LTIFYDGHVCVCDVTELQARAILVLASREMQERMKATPTVTSWPNSPSRTSPSAELYSPT  73

Query  315  -NALSMKGSLQRFLQKRKNRVQSTSPYH  235
               LSMK SLQRFLQKRK R  +TSPYH
Sbjct  74   GTGLSMKRSLQRFLQKRKLRFHATSPYH  101



>ref|XP_009622676.1| PREDICTED: protein TIFY 5A-like [Nicotiana tomentosiformis]
 gb|AGU37284.1| jasmonate ZIM-domain protein 12b [Nicotiana tabacum]
Length=131

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 82/135 (61%), Gaps = 12/135 (9%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L P S S  P      Y ++ +        E +  +QQQLTIFY+GK+V 
Sbjct  1    MRRNCNLELRLMPPSFSFSPKNCTTPYFSMDR-----EEKESTEEKQQQLTIFYNGKLVV  55

Query  438  SDVTEIQARAIILLASQERTKKT------TRSLASSPLLLQKQLYSPNA-LSMKGSLQRF  280
            SD TE QA+AII LAS+E  +KT      + S +         L SP   +SMK SLQRF
Sbjct  56   SDATEFQAKAIIYLASREMEEKTKIRSSISESSSPISEPSSPFLQSPATNISMKRSLQRF  115

Query  279  LQKRKNRVQSTSPYH  235
            LQKRKNR+Q+TSPYH
Sbjct  116  LQKRKNRIQATSPYH  130



>ref|XP_008229679.1| PREDICTED: protein TIFY 5A-like isoform X3 [Prunus mume]
Length=105

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL-LQKQLYSPNALSMKG  295
            +TIFY+G++  SDVTE++ RA+ILLA+ +  ++   S++++ LL LQ Q+Y P  +SMK 
Sbjct  23   ITIFYNGQVFVSDVTELKVRAMILLAAGDMAERGISSVSNAALLALQSQIYGPPGVSMKR  82

Query  294  SLQRFLQKRKNRVQSTSPYH  235
            SLQ FLQKRK R Q  SPY+
Sbjct  83   SLQSFLQKRKKRSQEASPYN  102



>ref|XP_010056897.1| PREDICTED: protein TIFY 5B-like [Eucalyptus grandis]
Length=116

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS---QERTK--KTTRSLASSP--LLLQKQLYSP-  316
            LTIFYDG +   DVTE+QARAI++LAS   QER K   T  S  +SP       +LYSP 
Sbjct  26   LTIFYDGHVCVCDVTELQARAILVLASREMQERMKATPTVTSWPNSPSRTSPSAELYSPT  85

Query  315  -NALSMKGSLQRFLQKRKNRVQSTSPYH  235
               LSMK SLQRFLQKRK R  +TSPYH
Sbjct  86   GTGLSMKRSLQRFLQKRKLRFHATSPYH  113



>ref|XP_007147916.1| hypothetical protein PHAVU_006G165800g [Phaseolus vulgaris]
 gb|ESW19910.1| hypothetical protein PHAVU_006G165800g [Phaseolus vulgaris]
Length=127

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 84/135 (62%), Gaps = 16/135 (12%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQ-LPTSDHsseesrrqqqQLTIFYDGKIV  442
            MRRNCNLEL+L P S S         ++ VQ+    S       +  QQ LTIFYDGKI 
Sbjct  1    MRRNCNLELALFPPSDSGPL-----HHHRVQEGTQISPFHHHHRQEHQQPLTIFYDGKIC  55

Query  441  SSDVTEIQARAIILLAS-----QERTKKTTRSLASSPLLLQKQLYSPN-ALSMKGSLQRF  280
             +DVTE+QA++I++LA+     ++R++  + ++  SP     QLYSP  +LSM+ SLQRF
Sbjct  56   VADVTELQAKSILMLANGKLEERDRSEGCSATVMQSP----HQLYSPGTSLSMRKSLQRF  111

Query  279  LQKRKNRVQSTSPYH  235
            L KRKNRVQ   PYH
Sbjct  112  LIKRKNRVQEALPYH  126



>ref|XP_008229678.1| PREDICTED: protein TIFY 5A-like isoform X2 [Prunus mume]
Length=119

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL-LQKQLYSPNALSMKG  295
            +TIFY+G++  SDVTE++ RA+ILLA+ +  ++   S++++ LL LQ Q+Y P  +SMK 
Sbjct  37   ITIFYNGQVFVSDVTELKVRAMILLAAGDMAERGISSVSNAALLALQSQIYGPPGVSMKR  96

Query  294  SLQRFLQKRKNRVQSTSPYH  235
            SLQ FLQKRK R Q  SPY+
Sbjct  97   SLQSFLQKRKKRSQEASPYN  116



>ref|XP_008229677.1| PREDICTED: protein TIFY 5A-like isoform X1 [Prunus mume]
Length=120

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL-LQKQLYSPNALSMKG  295
            +TIFY+G++  SDVTE++ RA+ILLA+ +  ++   S++++ LL LQ Q+Y P  +SMK 
Sbjct  38   ITIFYNGQVFVSDVTELKVRAMILLAAGDMAERGISSVSNAALLALQSQIYGPPGVSMKR  97

Query  294  SLQRFLQKRKNRVQSTSPYH  235
            SLQ FLQKRK R Q  SPY+
Sbjct  98   SLQSFLQKRKKRSQEASPYN  117



>emb|CDP17466.1| unnamed protein product [Coffea canephora]
Length=119

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 61/84 (73%), Gaps = 6/84 (7%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPL----LLQKQLYSPNA-L  307
            +TIFY+G +   DVTE+QARAII  AS+E  +K+ R+L+SS      +LQ  +Y P A L
Sbjct  35   MTIFYNGMVAVCDVTELQARAIISFASREMEEKS-RTLSSSSEPSSPVLQSPIYGPAAGL  93

Query  306  SMKGSLQRFLQKRKNRVQSTSPYH  235
            SMK SLQRFLQKRKNR+Q+  PYH
Sbjct  94   SMKRSLQRFLQKRKNRIQAAFPYH  117



>ref|XP_006346840.1| PREDICTED: protein TIFY 5A-like [Solanum tuberosum]
Length=115

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 79/131 (60%), Gaps = 20/131 (15%)
 Frame = -2

Query  618  MRRNCNLElslspssss---sgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGK  448
            MRRNCNLEL+L P S S   S  + + ED    QQL           +Q QQLTIFY+GK
Sbjct  1    MRRNCNLELTLMPPSISDNFSSKNCTMED----QQL---------ENKQSQQLTIFYNGK  47

Query  447  IVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQRFLQKR  268
             V SD TE+QA+AII LAS+    KT +    S  LLQ Q      L MK SLQ FLQKR
Sbjct  48   FVVSDATELQAKAIIYLASRGMEVKTNKMSDPSSPLLQPQ----TGLFMKRSLQGFLQKR  103

Query  267  KNRVQSTSPYH  235
            K RVQ+TSPYH
Sbjct  104  KRRVQATSPYH  114



>ref|XP_007212237.1| hypothetical protein PRUPE_ppa013410mg [Prunus persica]
 gb|EMJ13436.1| hypothetical protein PRUPE_ppa013410mg [Prunus persica]
Length=124

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 83/135 (61%), Gaps = 19/135 (14%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L               Y   ++    +   E+ ++QQQ +TIFY+G + +
Sbjct  1    MRRNCNLELQLL-----------HPSYETHKKQQEQEQHEEQLQKQQQMMTIFYNGAMCA  49

Query  438  SDVTEIQARAIILLASQERTKKT------TRSLASSPLLLQKQLYSPNA-LSMKGSLQRF  280
             DVTE+QAR+I+ LA++E  ++       + S  SSP ++   L SP A +SMK SLQRF
Sbjct  50   RDVTELQARSILFLANREMEERVKSPFTPSGSELSSPTVMSP-LCSPVAGMSMKRSLQRF  108

Query  279  LQKRKNRVQSTSPYH  235
            LQKRK+RVQ+TSPYH
Sbjct  109  LQKRKHRVQATSPYH  123



>ref|XP_004134648.1| PREDICTED: protein TIFY 5A-like [Cucumis sativus]
 ref|XP_004171528.1| PREDICTED: protein TIFY 5A-like [Cucumis sativus]
Length=123

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 83/132 (63%), Gaps = 14/132 (11%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL LSP+ + +    +  D    Q   T+D S +  +     LTIFY+G+I  
Sbjct  1    MRRNCNLELRLSPTPNPNPNPAAVSD----QPSATADDSPQSQQ-----LTIFYNGRICV  51

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSPLLLQ----KQLYSPNALSMKGSLQRFLQK  271
             DVTE+QARAI+ LA++E  ++   S   SP+L Q     +  +   LSMK SLQRFLQK
Sbjct  52   CDVTELQARAILKLATRE-MEENGLSETPSPMLQQSSPPPRTPTTPGLSMKKSLQRFLQK  110

Query  270  RKNRVQSTSPYH  235
            RK+RVQ+TSPY+
Sbjct  111  RKHRVQATSPYN  122



>gb|KDO78202.1| hypothetical protein CISIN_1g046141mg [Citrus sinensis]
Length=120

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 8/79 (10%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPN-ALSMKG  295
            LTIFY+G++   DVTE QA+AI+LLAS+E          +SP   + QLYSPN  LSMK 
Sbjct  49   LTIFYNGQVCICDVTEFQAKAILLLASREMEP-------ASPANPESQLYSPNSGLSMKR  101

Query  294  SLQRFLQKRKNRVQSTSPY  238
            SLQRFLQKRK+R  +TSPY
Sbjct  102  SLQRFLQKRKHRSLATSPY  120



>ref|XP_006467450.1| PREDICTED: protein TIFY 5A-like [Citrus sinensis]
Length=120

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 8/79 (10%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPN-ALSMKG  295
            LTIFY+G++   DVTE QA+AI+LLAS+E          +SP   + QLYSPN  LSMK 
Sbjct  49   LTIFYNGQVCICDVTEFQAKAILLLASREME-------PASPANPESQLYSPNSGLSMKR  101

Query  294  SLQRFLQKRKNRVQSTSPY  238
            SLQRFLQKRK+R  +TSPY
Sbjct  102  SLQRFLQKRKHRSLATSPY  120



>ref|XP_004244920.1| PREDICTED: protein TIFY 5A-like [Solanum lycopersicum]
Length=112

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 76/129 (59%), Gaps = 17/129 (13%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL+L P S S        D  + +   T D   E  + QQ  LTIFY GK V 
Sbjct  1    MRRNCNLELTLMPPSIS--------DNFSSKNCTTEDQQLENKQSQQ--LTIFYHGKFVV  50

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQRFLQKRKNR  259
            SD TE+QA+AII LAS+    KT +    S  LLQ Q       ++K SLQ FLQKRK R
Sbjct  51   SDATELQAKAIIYLASRGMEMKTNKMSEPSSPLLQPQ-------TVKKSLQGFLQKRKKR  103

Query  258  VQSTSPYHR  232
            VQ+TSPYH+
Sbjct  104  VQATSPYHK  112



>ref|XP_006346841.1| PREDICTED: protein TIFY 5A-like [Solanum tuberosum]
Length=124

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 84/134 (63%), Gaps = 17/134 (13%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQED--YNAVQQLPTSDHsseesrrqqqQLTIFYDGKI  445
            MRRNCNLEL L P S S+    +  +  Y ++++    D  S E   + Q LTIFY+GK 
Sbjct  1    MRRNCNLELRLMPPSLSTFSPNNCNNTSYFSMEE----DKESTELENKSQPLTIFYNGKF  56

Query  444  VSSDVTEIQARAIILLASQERTKKTTRS----LASSPLLLQKQLYSPNALSMKGSLQRFL  277
            V S VT++QA+AII LAS+E  +KT ++       S  LLQ Q       ++K SLQRFL
Sbjct  57   VVSHVTDLQAKAIIYLASRETEEKTNKTSSPMSEPSSPLLQPQ-------TVKKSLQRFL  109

Query  276  QKRKNRVQSTSPYH  235
            QKRKNR+++TSPYH
Sbjct  110  QKRKNRIETTSPYH  123



>gb|KDP37988.1| hypothetical protein JCGZ_04631 [Jatropha curcas]
Length=143

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 6/84 (7%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSP----LLLQKQLYSPN-AL  307
            LTIFY+G I   DVTE+QAR I++LAS+E   K  RS + SP      L   +YSPN  L
Sbjct  50   LTIFYNGNICVCDVTELQARNILMLASREMDDKI-RSASGSPEPTSPTLSSPVYSPNNGL  108

Query  306  SMKGSLQRFLQKRKNRVQSTSPYH  235
            SMK SLQRFLQKR +R+Q+T PY+
Sbjct  109  SMKRSLQRFLQKRNHRIQATYPYN  132



>ref|XP_006449712.1| hypothetical protein CICLE_v10017198mg [Citrus clementina]
 gb|ESR62952.1| hypothetical protein CICLE_v10017198mg [Citrus clementina]
Length=120

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 80/131 (61%), Gaps = 15/131 (11%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLP---TSDHsseesrrqqqQLTIFYDGK  448
            MRRNCNLEL L P S S       ED++         T   SS   + QQQQLTIFY+G+
Sbjct  1    MRRNCNLELRLLPYSDSLSS----EDFSLAAGYGHNMTMGESSVSPQNQQQQLTIFYNGQ  56

Query  447  IVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPN-ALSMKGSLQRFLQK  271
            +   DVTE QA+AI+LLAS+E          +SP   + QLY PN  LSMK SLQRFLQK
Sbjct  57   VCICDVTEFQAKAILLLASREME-------PASPPNPESQLYRPNSGLSMKRSLQRFLQK  109

Query  270  RKNRVQSTSPY  238
            RK+R  +TSPY
Sbjct  110  RKHRSLATSPY  120



>ref|XP_004486286.1| PREDICTED: protein TIFY 5A-like [Cicer arietinum]
Length=139

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 84/141 (60%), Gaps = 16/141 (11%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L P   +S    +Q   N V++   SD     ++ QQQ LTIFYDGKI  
Sbjct  1    MRRNCNLELCLFPPYHTSANRHNQ--CNLVEEEDHSD-KRLTTQNQQQPLTIFYDGKICV  57

Query  438  SDVTEIQARAIILLASQE-----RTKKTTRSLASSPLLL--QKQLYSPNA------LSMK  298
            +DVTE QA++I+++A+++      T     S  S+P ++    QLYSP        LSMK
Sbjct  58   TDVTEFQAKSILMMANKKLQESVNTPTPRGSEPSTPTIVYSPNQLYSPAGLGPGPRLSMK  117

Query  297  GSLQRFLQKRKNRVQSTSPYH  235
              LQRFLQKRKNRV   SPY+
Sbjct  118  RCLQRFLQKRKNRVLEASPYN  138



>ref|XP_011012848.1| PREDICTED: protein TIFY 5A-like [Populus euphratica]
Length=149

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 7/130 (5%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            M+RNCNLEL L  S+ S         Y  + +        E  +++Q+QLTIFY+G+++ 
Sbjct  1    MKRNCNLELRLHTSADSDNH---HHRYQPLVEASNESRQLELKQQEQKQLTIFYNGRVLV  57

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSP----LLLQKQLYSPNALSMKGSLQRFLQK  271
             DV E+QARAI+LLAS+E   +    +AS P     +   QLYSP    MK SLQRFL+K
Sbjct  58   CDVAELQARAILLLASREMEDRLRSPVASEPSATSPISPSQLYSPVGPPMKRSLQRFLKK  117

Query  270  RKNRVQSTSP  241
            RK+R+Q+T P
Sbjct  118  RKHRIQATFP  127



>gb|EYU33376.1| hypothetical protein MIMGU_mgv1a016361mg [Erythranthe guttata]
Length=124

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 75/129 (58%), Gaps = 14/129 (11%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQE-DYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIV  442
            M+RNCNLEL L    S    S + E  Y     L   D  S   +++Q QLT+FY+G+I 
Sbjct  1    MKRNCNLELPLVTMPSVFSDSSAHEHSYQFYNMLNMEDDQSPNQKQKQHQLTVFYNGRIA  60

Query  441  SSDVTEIQ-ARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQRFLQKRK  265
            +SDVTE Q ARAIILLAS E   +   ++ +S             LSMK SLQRFL+KRK
Sbjct  61   ASDVTEFQQARAIILLASGEMEDEKRSAIPTS------------GLSMKRSLQRFLEKRK  108

Query  264  NRVQSTSPY  238
             R+Q TSPY
Sbjct  109  TRLQCTSPY  117



>ref|XP_008225498.1| PREDICTED: protein TIFY 5B [Prunus mume]
Length=124

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 81/135 (60%), Gaps = 19/135 (14%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L               Y   ++    +   E+ ++QQQ +TIFY+G +  
Sbjct  1    MRRNCNLELQLL-----------HPSYETHKKQQEQEQHEEQQQKQQQMMTIFYNGAMCV  49

Query  438  SDVTEIQARAIILLASQERTKKT------TRSLASSPLLLQKQLYSPNA-LSMKGSLQRF  280
             DVTE+QAR+I+ LA++E  ++       + S  SSP ++   L SP A LSMK SLQRF
Sbjct  50   RDVTELQARSILFLANREMEERVKSPFTPSGSELSSPTVMSP-LCSPVAGLSMKRSLQRF  108

Query  279  LQKRKNRVQSTSPYH  235
            LQKRK RVQ+TSPYH
Sbjct  109  LQKRKLRVQATSPYH  123



>ref|XP_009377943.1| PREDICTED: protein TIFY 5A-like [Pyrus x bretschneideri]
Length=109

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLL--QKQLYSPNALSMK  298
            +TIF++G++  SDVTE+QARAIILLA++E   +  RS+ SS  LL    ++Y P  +S+K
Sbjct  25   ITIFHNGQVFVSDVTELQARAIILLAAREMEGR-DRSMWSSAALLAFHSRIYGPPGVSLK  83

Query  297  GSLQRFLQKRKNRVQSTSPYH  235
             SLQ FLQKRK R Q+ SPY+
Sbjct  84   RSLQSFLQKRKQRSQAASPYN  104



>gb|KDP37989.1| hypothetical protein JCGZ_04632 [Jatropha curcas]
Length=135

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 83/137 (61%), Gaps = 14/137 (10%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL L P S           +  +    +++    ES +Q+QQLTIFY+G +  
Sbjct  1    MRRNCNLELRLVPFSDIDHHHRDNRHHQPI----STEKEGSESPQQKQQLTIFYNGSVCV  56

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSPLL--------LQKQLYSPNA-LSMKGSLQ  286
             DVTE+QARAI+LLAS+E  +K  +S   +P          L  QL  P+A LSMK S+Q
Sbjct  57   CDVTELQARAILLLASREMEEK-LKSPVGTPTCSSETASQKLPSQLCRPSAGLSMKRSIQ  115

Query  285  RFLQKRKNRVQSTSPYH  235
            RFLQKR +R+ +TSPY+
Sbjct  116  RFLQKRNHRIHATSPYN  132



>ref|XP_002519662.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42635.1| conserved hypothetical protein [Ricinus communis]
Length=139

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 80/136 (59%), Gaps = 17/136 (13%)
 Frame = -2

Query  618  MRRNCNLEl---slspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGK  448
            MRRNCNLEL     S        S S ED+        S+ S  +  +QQQQLTIFY+G 
Sbjct  1    MRRNCNLELRLFPFSDPDDHLQHSSSMEDF--------SNKSPRQEGQQQQQLTIFYNGN  52

Query  447  IVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL-----LQKQLYSP-NALSMKGSLQ  286
            +   DVT+ QARAI+LLAS+E   K  RS + S        L   +YSP N LSMK SLQ
Sbjct  53   VCVCDVTDFQARAILLLASKEMEHKPRRSPSGSSSEPASPTLPSPIYSPNNGLSMKRSLQ  112

Query  285  RFLQKRKNRVQSTSPY  238
            RFLQKR +R+Q+T PY
Sbjct  113  RFLQKRNHRIQATCPY  128



>ref|XP_006368137.1| PREDICTED: protein TIFY 5A-like [Solanum tuberosum]
Length=89

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 54/79 (68%), Gaps = 4/79 (5%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            LTIFY+G+ V S VT++QA+AII  AS+E  +K+ +    S  LLQ Q        M  S
Sbjct  14   LTIFYNGQFVVSHVTQLQAKAIIYRASREMEEKSNKMSEPSSPLLQPQ----TGRFMDKS  69

Query  291  LQRFLQKRKNRVQSTSPYH  235
            LQRFLQKRKNR+Q+TSPYH
Sbjct  70   LQRFLQKRKNRIQTTSPYH  88



>gb|KEH21427.1| jasmonate zim-domain protein [Medicago truncatula]
Length=83

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 12/82 (15%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS----QERTKKTTRSLASSPLLLQKQLYSPNALS  304
            LTIFYDGK+  +DVTE QA++I++LA+    QE+ K    S  ++P+         + LS
Sbjct  8    LTIFYDGKMCLTDVTEFQAKSILMLANKIKLQEKVKTPRGSEPTTPVQ--------SGLS  59

Query  303  MKGSLQRFLQKRKNRVQSTSPY  238
            MK SLQRFLQKRKNRVQ  SPY
Sbjct  60   MKRSLQRFLQKRKNRVQEASPY  81



>ref|XP_006346836.1| PREDICTED: protein TIFY 5A-like [Solanum tuberosum]
Length=106

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 54/79 (68%), Gaps = 4/79 (5%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            LTIFY+G+ V S VT++QA+AII  AS+E  +K+ +    S  LLQ Q        M  S
Sbjct  31   LTIFYNGQFVVSHVTQLQAKAIIYRASREMEEKSNKMSEPSSPLLQPQ----TGRFMDKS  86

Query  291  LQRFLQKRKNRVQSTSPYH  235
            LQRFLQKRKNR+Q+TSPYH
Sbjct  87   LQRFLQKRKNRIQTTSPYH  105



>ref|XP_006346838.1| PREDICTED: protein TIFY 5A-like [Solanum tuberosum]
 ref|XP_006346839.1| PREDICTED: protein TIFY 5A-like [Solanum tuberosum]
Length=106

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 54/79 (68%), Gaps = 4/79 (5%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            LTIFY+G+ V S VT++QA+AII  AS+E  +K+ +    S  LLQ Q        M  S
Sbjct  31   LTIFYNGQFVVSHVTQLQAKAIIYRASREMEEKSNKMSEPSSPLLQPQ----TGRFMDKS  86

Query  291  LQRFLQKRKNRVQSTSPYH  235
            LQRFLQKRKNR+Q+TSPYH
Sbjct  87   LQRFLQKRKNRIQTTSPYH  105



>ref|XP_008439622.1| PREDICTED: protein TIFY 5A [Cucumis melo]
Length=132

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 4/82 (5%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQ---KQLYSPNALSM  301
            LTIFY+G+I   DVTE+QARAI+ LA++E  ++   S   SP+L Q    +  +   LSM
Sbjct  51   LTIFYNGRICVCDVTELQARAILKLATRE-MEENGLSETPSPMLQQSPPPRTPTTPGLSM  109

Query  300  KGSLQRFLQKRKNRVQSTSPYH  235
            K SLQRFLQKRK+RVQ+TSPY+
Sbjct  110  KKSLQRFLQKRKHRVQATSPYN  131



>gb|AET05592.2| jasmonate zim-domain protein [Medicago truncatula]
Length=118

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 12/82 (15%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS----QERTKKTTRSLASSPLLLQKQLYSPNALS  304
            LTIFYDGK+  +DVTE QA++I++LA+    QE+ K    S  ++P+         + LS
Sbjct  43   LTIFYDGKMCLTDVTEFQAKSILMLANKIKLQEKVKTPRGSEPTTPVQ--------SGLS  94

Query  303  MKGSLQRFLQKRKNRVQSTSPY  238
            MK SLQRFLQKRKNRVQ  SPY
Sbjct  95   MKRSLQRFLQKRKNRVQEASPY  116



>ref|XP_010324845.1| PREDICTED: protein TIFY 5A-like [Solanum lycopersicum]
Length=116

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 75/131 (57%), Gaps = 19/131 (15%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRR CNLEL L P +       ++E  +  ++               QQLTIFYDGK+V 
Sbjct  1    MRRKCNLELRLVPPAPYFDSMGNKETIDEEKE--------------HQQLTIFYDGKVVV  46

Query  438  SDVTEIQARAIILLASQE--RTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQRFLQKRK  265
            SD +E+QA+AII LAS+E     KT  +L+  P  L +       +SMK SLQRFLQKRK
Sbjct  47   SDASEVQAKAIIHLASREMKENTKTPSTLSEPPSSLSQ---FETEVSMKKSLQRFLQKRK  103

Query  264  NRVQSTSPYHR  232
            +R Q+ SP H+
Sbjct  104  SRTQAISPCHQ  114



>emb|CAN84091.1| hypothetical protein VITISV_007759 [Vitis vinifera]
Length=121

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 61/104 (59%), Gaps = 27/104 (26%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQ-----------------------ARAIILLASQE-RTKKTTR  364
            LTIFYDG++   +VTE+Q                       ARAIIL AS+E  TK  T 
Sbjct  17   LTIFYDGRVCVCEVTELQGLFMNPADQVFLWAVVPFGYMYEARAIILTASREVETKTPTA  76

Query  363  SLAS--SPLLLQKQLYSPNALSMKGSLQRFLQKRKNRVQSTSPY  238
            S  +  SP L Q QLYSP  LSMK SL+ FLQKRKNR+++TSPY
Sbjct  77   SDVTMVSPSL-QSQLYSPTGLSMKRSLRSFLQKRKNRIEATSPY  119



>ref|XP_008371611.1| PREDICTED: protein TIFY 5A [Malus domestica]
 ref|XP_008356030.1| PREDICTED: protein TIFY 5A-like [Malus domestica]
Length=114

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 75/136 (55%), Gaps = 31/136 (23%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL                      QL     +  + + QQQQ+TIFY+G    
Sbjct  1    MRRNCNLEL----------------------QLCFPGANETQQQEQQQQMTIFYNGIACV  38

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASS-------PLLLQKQLYSPNA-LSMKGSLQR  283
             DVTE+QAR+II LA++E  ++    L  S       P ++   L SP A +SMK SLQR
Sbjct  39   RDVTELQARSIIFLANKEMEERVKSPLTPSGSSEPPTPTVMSP-LCSPVAGMSMKRSLQR  97

Query  282  FLQKRKNRVQSTSPYH  235
            FLQKRK+R Q+TSPYH
Sbjct  98   FLQKRKHRTQATSPYH  113



>ref|XP_008371769.1| PREDICTED: protein TIFY 5A-like [Malus domestica]
Length=119

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 10/88 (11%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQER--------TKKTTRSLASSPLLLQKQLYSP  316
            LTIFY+G +   DVTE+QAR+I+ LA++E         T  +  +   SP ++   L SP
Sbjct  32   LTIFYNGMVCVCDVTELQARSILFLANKEMEEGVNSLFTPPSGSAEPPSPNVMSP-LCSP  90

Query  315  NA-LSMKGSLQRFLQKRKNRVQSTSPYH  235
             A +SMK SLQRFLQKRK+R Q+TSPYH
Sbjct  91   VAGMSMKKSLQRFLQKRKHRTQATSPYH  118



>gb|AGC73981.1| jasmonate ZIM-domain protein 8 [Salvia miltiorrhiza]
Length=122

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 3/79 (4%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYS-PNALSMKG  295
            LTIFY+GKI S D TE+QARAII LAS+E  +K++R+       L   +YS    +SMK 
Sbjct  41   LTIFYNGKIASCDATELQARAIISLASREVEEKSSRNSPPP--PLNSPVYSAATGMSMKR  98

Query  294  SLQRFLQKRKNRVQSTSPY  238
            SL+RFL+KRK+R QS SPY
Sbjct  99   SLKRFLEKRKSRAQSMSPY  117



>ref|XP_002890853.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67112.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=131

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 61/85 (72%), Gaps = 6/85 (7%)
 Frame = -2

Query  471  LTIFYDGKIV-SSDVTEIQARAIILLASQERTKKTTRSLASSP----LLLQKQLYSPNAL  307
            +TIFY+GK+  SSDVT +QA++II +A++E  KK++ + +  P         QL +P A 
Sbjct  44   MTIFYNGKMCFSSDVTHLQAKSIISIANREMEKKSSSNGSDPPNKSTPFHHNQLPNPKA-  102

Query  306  SMKGSLQRFLQKRKNRVQSTSPYHR  232
            SMK SLQ FLQKRK+R+Q+TSPYH+
Sbjct  103  SMKKSLQSFLQKRKSRIQATSPYHQ  127



>ref|XP_002316712.1| hypothetical protein POPTR_0011s02260g [Populus trichocarpa]
 gb|EEE97324.1| hypothetical protein POPTR_0011s02260g [Populus trichocarpa]
Length=149

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 77/130 (59%), Gaps = 7/130 (5%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            M+RNCNLEL L   + S         Y  + +        E  +++Q+QLTIFY+G+++ 
Sbjct  1    MKRNCNLELRLHTPADSDNH---HHRYQPLVEASNESRQLELEQQEQKQLTIFYNGRVLV  57

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSPLLLQK----QLYSPNALSMKGSLQRFLQK  271
             DV E+QARAI++LAS+E   +    + S P         QLYSP  L MK SLQRFL+K
Sbjct  58   CDVAELQARAILMLASREMEDRLRSPVGSEPSASSPISPSQLYSPVGLPMKRSLQRFLKK  117

Query  270  RKNRVQSTSP  241
            RK+R+Q+T P
Sbjct  118  RKHRIQATFP  127



>ref|XP_002519661.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42634.1| conserved hypothetical protein [Ricinus communis]
Length=164

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 8/87 (9%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPL-------LLQKQLYSPN  313
            LTIFY+G++    VTE+QARAI+ LAS+E   K   SL  +P         L   L SP+
Sbjct  77   LTIFYNGRVCVCYVTELQARAILSLASREMEDKMKTSLLGTPTGRSEFVSPLPSPLCSPS  136

Query  312  -ALSMKGSLQRFLQKRKNRVQSTSPYH  235
              LSMK S+QRFLQKRK+R Q+TSPY+
Sbjct  137  TGLSMKRSIQRFLQKRKHRAQATSPYN  163



>ref|XP_004293626.1| PREDICTED: protein TIFY 5A-like [Fragaria vesca subsp. vesca]
Length=130

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 84/136 (62%), Gaps = 15/136 (11%)
 Frame = -2

Query  618  MRRNCNLElslspsssssg-psiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIV  442
            MRRNCNLEL L+ SS++SG P  +  D  AV +       S     QQQ LTIFYDG + 
Sbjct  1    MRRNCNLELRLNTSSANSGFPLRNHRDRPAVLE-------SSSGTPQQQPLTIFYDGVMC  53

Query  441  SSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPN------ALSMKGSLQRF  280
             SDVTE+QARAI+ LA++E  ++   S + SP     +  SP+      + SMK SLQ F
Sbjct  54   VSDVTELQARAILFLANKEMEERLKTSPSPSPCASTSEPSSPSLHSPICSPSMKKSLQTF  113

Query  279  LQKRKNRVQSTS-PYH  235
            LQKRK R+Q+TS PY+
Sbjct  114  LQKRKYRIQATSHPYN  129



>ref|XP_011096584.1| PREDICTED: protein TIFY 5A [Sesamum indicum]
Length=140

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 77/140 (55%), Gaps = 22/140 (16%)
 Frame = -2

Query  618  MRRNCNLElslspsss-ssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIV  442
            M+RNCNLEL L   S            YN++  +   +            LTIFY+G++ 
Sbjct  1    MKRNCNLELRLVTPSVFYHSSDYMNARYNSMLDMSPDEKQQ---------LTIFYNGRVA  51

Query  441  SSDVTEIQARAIILLASQERTKKTTR-------SLASSPLLLQKQLY-----SPNALSMK  298
            + DVTE+QAR+II LA +E   + ++       S  SSP+L+   ++     S + LSMK
Sbjct  52   TCDVTELQARSIISLARREMEDEKSKTSVGGSGSQPSSPVLISSPIHNNRQTSGSGLSMK  111

Query  297  GSLQRFLQKRKNRVQSTSPY  238
             SLQ FLQKRK+RVQ+ SPY
Sbjct  112  RSLQSFLQKRKSRVQAISPY  131



>ref|XP_008371770.1| PREDICTED: protein TIFY 5A-like [Malus domestica]
Length=118

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 8/88 (9%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS---QERTK-----KTTRSLASSPLLLQKQLYSP  316
            LTIFY+G +   DVTE+QAR+I+ LA+   +ER K      +  S   SP ++     + 
Sbjct  31   LTIFYNGMMCVRDVTELQARSILFLANKGMEERVKSPFTPPSGLSEPPSPNVVSPLCSTV  90

Query  315  NALSMKGSLQRFLQKRKNRVQSTSPYHR  232
              +SMK SLQRFLQKRK+R Q+TSPYHR
Sbjct  91   AGVSMKRSLQRFLQKRKHRTQATSPYHR  118



>gb|EYU43255.1| hypothetical protein MIMGU_mgv1a016202mg [Erythranthe guttata]
 gb|EYU43256.1| hypothetical protein MIMGU_mgv1a016202mg [Erythranthe guttata]
Length=131

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 74/133 (56%), Gaps = 23/133 (17%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            M+RNCNL+L L   S      I+  + N  Q+L                 TIFY+G++  
Sbjct  1    MKRNCNLDLRLVTPSLPPPSMINWNNRNDTQEL-----------------TIFYNGRVAV  43

Query  438  SDVTEIQARAIILLASQERTK-KTTRSLASSPL----LLQKQLYSPNA-LSMKGSLQRFL  277
             D TE+QARAII +AS    + KT  S  S P+    LL   +YSP++ +SMK SL+ FL
Sbjct  44   CDATELQARAIIWVASHAVVEDKTNGSPGSDPVSSSPLLSPSMYSPSSVVSMKRSLKMFL  103

Query  276  QKRKNRVQSTSPY  238
            QKRK R Q++SPY
Sbjct  104  QKRKTRSQASSPY  116



>ref|NP_564349.1| protein TIFY 5A [Arabidopsis thaliana]
 sp|Q8LBM2.1|TIF5A_ARATH RecName: Full=Protein TIFY 5A; AltName: Full=Jasmonate ZIM domain-containing 
protein 8 [Arabidopsis thaliana]
 gb|AAM64680.1| unknown [Arabidopsis thaliana]
 gb|ABG48454.1| At1g30135 [Arabidopsis thaliana]
 gb|AEE31184.1| protein TIFY 5A [Arabidopsis thaliana]
Length=131

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 6/84 (7%)
 Frame = -2

Query  471  LTIFYDGKIV-SSDVTEIQARAIILLASQERTKKTTRSLASSP----LLLQKQLYSPNAL  307
            +TIFY+GK+  SSDVT +QAR+II +AS+E   K++ + +  P         QL +P A 
Sbjct  46   ITIFYNGKMCFSSDVTHLQARSIISIASREMKTKSSSNGSDPPNKSTSFHHNQLPNPKA-  104

Query  306  SMKGSLQRFLQKRKNRVQSTSPYH  235
            SMK SLQ FLQKRK R+Q+TSPYH
Sbjct  105  SMKKSLQSFLQKRKIRIQATSPYH  128



>ref|XP_009360904.1| PREDICTED: protein TIFY 5A-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009360907.1| PREDICTED: protein TIFY 5A-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009360908.1| PREDICTED: protein TIFY 5A-like isoform X1 [Pyrus x bretschneideri]
Length=114

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 73/140 (52%), Gaps = 39/140 (28%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL                      QL     +  + + QQQQ+TIFY+G    
Sbjct  1    MRRNCNLEL----------------------QLCFPGVNETQQQEQQQQMTIFYNGVACV  38

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSPLL-----------LQKQLYSPNA-LSMKG  295
             DVTE+QAR+II LA++E  ++       SP             +   L SP A +SMK 
Sbjct  39   RDVTELQARSIIFLANKEMEER-----GKSPFTPSGSSEPPSPTVMPPLCSPVAGMSMKR  93

Query  294  SLQRFLQKRKNRVQSTSPYH  235
            SLQRFLQKRK+R Q+TSPYH
Sbjct  94   SLQRFLQKRKHRTQATSPYH  113



>ref|XP_009360906.1| PREDICTED: protein TIFY 5A-like isoform X2 [Pyrus x bretschneideri]
Length=114

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 71/135 (53%), Gaps = 29/135 (21%)
 Frame = -2

Query  618  MRRNCNLElslspsssssgpsiSQEDYNAVQQLPTSDHsseesrrqqqQLTIFYDGKIVS  439
            MRRNCNLEL                      QL     +  + + QQQQ+TIFY+G    
Sbjct  1    MRRNCNLEL----------------------QLCFPGVNETQQQEQQQQMTIFYNGVACV  38

Query  438  SDVTEIQARAIILLASQERTKKTTRSLASSPLL------LQKQLYSPNA-LSMKGSLQRF  280
             DVTE+QAR+II LA++E  ++       S         +   L SP A +SMK SLQRF
Sbjct  39   RDVTELQARSIIFLANKEMEERVKSPFTPSGSSEPPSPTVMSPLCSPVAGMSMKRSLQRF  98

Query  279  LQKRKNRVQSTSPYH  235
            LQKRK R Q+TSPYH
Sbjct  99   LQKRKLRTQATSPYH  113



>ref|XP_003631116.1| Protein TIFY 5A [Medicago truncatula]
Length=218

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 12/77 (16%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS----QERTKKTTRSLASSPLLLQKQLYSPNALS  304
            LTIFYDGK+  +DVTE QA++I++LA+    QE+ K    S  ++P+         + LS
Sbjct  43   LTIFYDGKMCLTDVTEFQAKSILMLANKIKLQEKVKTPRGSEPTTPV--------QSGLS  94

Query  303  MKGSLQRFLQKRKNRVQ  253
            MK SLQRFLQKRKNRVQ
Sbjct  95   MKRSLQRFLQKRKNRVQ  111



>ref|XP_009109614.1| PREDICTED: protein TIFY 5A-like [Brassica rapa]
 emb|CDX90230.1| BnaA08g17540D [Brassica napus]
Length=130

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 60/85 (71%), Gaps = 8/85 (9%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKTTRSLASSPL-----LLQKQLYSPNA  310
            +TIFY+GK+ VSS+VT +QA++II +AS+E  ++++ S  S P      L   QL +P A
Sbjct  43   ITIFYNGKMCVSSNVTHLQAKSIISIASREMEERSS-SNGSDPRNRLTRLHHHQLPNPKA  101

Query  309  LSMKGSLQRFLQKRKNRVQSTSPYH  235
             SMK SLQ FLQKR+ R+Q+ SPYH
Sbjct  102  -SMKRSLQSFLQKRRIRIQAASPYH  125



>ref|XP_008356033.1| PREDICTED: protein TIFY 5A-like [Malus domestica]
Length=87

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 7/87 (8%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL------LQKQLYSPNA  310
            +TIFY+  +   DVTE+QAR+II LA++E  ++       S         L   L SP A
Sbjct  1    MTIFYBRXMCVRDVTELQARSIIFLANKEMEERVKSPFTPSGSSEPXSPNLMSPLGSPVA  60

Query  309  -LSMKGSLQRFLQKRKNRVQSTSPYHR  232
              S+K SLQRFLQ+RK+R Q+TSPYHR
Sbjct  61   GTSLKRSLQRFLQERKHRNQATSPYHR  87



>emb|CDY51470.1| BnaC03g59110D [Brassica napus]
Length=130

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 60/85 (71%), Gaps = 8/85 (9%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKTTRSLASSPL-----LLQKQLYSPNA  310
            +TIFY+GK+ VSS+VT +QA++II +AS+E  ++++ S  S P      L   QL +P A
Sbjct  43   ITIFYNGKMCVSSNVTHLQAKSIISIASREMEERSS-SNRSDPRNRLTRLHHHQLPNPKA  101

Query  309  LSMKGSLQRFLQKRKNRVQSTSPYH  235
             SMK SLQ FLQKR+ R+Q+ SPYH
Sbjct  102  -SMKRSLQSFLQKRRIRIQAASPYH  125



>ref|XP_008811927.1| PREDICTED: protein TIFY 5A-like [Phoenix dactylifera]
Length=143

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 52/90 (58%), Gaps = 13/90 (14%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTR------------SLASSPLLLQKQ  328
            ++IFY G++   D TEIQARAII +A +E  +  TR            S AS       Q
Sbjct  46   ISIFYGGRVCVCDATEIQARAIICMARREMEEMATRKQNDRGMESCQLSPASRTPQAMPQ  105

Query  327  LYSPNALSMKGSLQRFLQKRKNRVQSTSPY  238
            L +P  LSMK SLQ+FLQKRK+R   +SPY
Sbjct  106  LLNP-GLSMKRSLQQFLQKRKSRTDDSSPY  134



>ref|XP_009397408.1| PREDICTED: protein TIFY 5A-like [Musa acuminata subsp. malaccensis]
Length=151

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 59/90 (66%), Gaps = 13/90 (14%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQE---RTKKTTRS---------LASSPLLLQKQ  328
            +T+ YDG+I + DVTE+QARAII +A +E     KKTT++           SSP  +++ 
Sbjct  51   ITLLYDGRICACDVTEMQARAIIAMAKREMDGHMKKTTQAHRQPIESSLPPSSPRPVERL  110

Query  327  LYSPNALSMKGSLQRFLQKRKNRVQSTSPY  238
            L +P  LSMK SLQRFL KRK+R+ + SPY
Sbjct  111  LINPE-LSMKRSLQRFLHKRKSRLHALSPY  139



>ref|XP_009141392.1| PREDICTED: protein TIFY 5B-like [Brassica rapa]
 emb|CDY43664.1| BnaA04g20270D [Brassica napus]
Length=119

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 4/84 (5%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLAS---QERTKKTTRSLASSPLLLQKQLYSPNALS  304
            LTIFY+G I VSSD+T +QA+AI+ LAS   +ER+     S  S P ++   L     +S
Sbjct  34   LTIFYNGHICVSSDLTHLQAKAILSLASKDMEERSLSLKSSNRSEPSIIPYNLNHNQKVS  93

Query  303  MKGSLQRFLQKRKNRVQSTSPYHR  232
            MK SL+ FLQKR  R+Q++ PYHR
Sbjct  94   MKRSLRSFLQKRNVRIQASCPYHR  117



>ref|XP_008371615.1| PREDICTED: protein TIFY 5A-like [Malus domestica]
 ref|XP_008345997.1| PREDICTED: protein TIFY 5A-like [Malus domestica]
Length=130

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 7/87 (8%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL------LQKQLYSPNA  310
            +TIFY+  +   DVTE+QAR+II LA++E  ++       S         L   L SP A
Sbjct  44   MTIFYNRMMCVRDVTELQARSIIFLANKEMEERVKSPFTPSGSSEPXSPNLMSPLGSPVA  103

Query  309  -LSMKGSLQRFLQKRKNRVQSTSPYHR  232
              S+K SLQRFLQ+RK+R Q+TSPYHR
Sbjct  104  GTSLKRSLQRFLQERKHRNQATSPYHR  130



>gb|KGN65527.1| hypothetical protein Csa_1G435720 [Cucumis sativus]
Length=150

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 59/93 (63%), Gaps = 14/93 (15%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRS------LASSPLLLQKQ------  328
            +TIFY+G++  +D TE QA+AII+LAS++   ++T         ++SP    ++      
Sbjct  57   MTIFYNGRVCVADFTEDQAKAIIMLASRQVEDRSTNPEHKLERPSTSPDQCHREPVSLSV  116

Query  327  --LYSPNALSMKGSLQRFLQKRKNRVQSTSPYH  235
                S + LSMK SLQRFLQKRKNR+QS SPY+
Sbjct  117  SGSGSGSGLSMKRSLQRFLQKRKNRIQSASPYN  149



>ref|XP_009417059.1| PREDICTED: protein TIFY 5A-like [Musa acuminata subsp. malaccensis]
Length=127

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 49/88 (56%), Gaps = 9/88 (10%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQER----TKKTTRSLASSPLLLQK----QLYSP  316
            +TIFY G++   D TE+QARAII +A +E     T K  R          +    Q+  P
Sbjct  30   MTIFYQGRVCVCDATEMQARAIISMAKKEMEDTVTTKQQRQSTEEEESSSRAVAPQVLDP  89

Query  315  NALSMKGSLQRFLQKRKNRVQSTSPYHR  232
              LSMK SLQRFLQKRK RV   SPY R
Sbjct  90   G-LSMKRSLQRFLQKRKARVSDASPYSR  116



>emb|CDP06840.1| unnamed protein product [Coffea canephora]
Length=120

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = -2

Query  471  LTIFYDGKIVS-SDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKG  295
            +T+ ++ + V   D TE+QA  I+ LA +E   K +    + P +++ QL+S + LS++ 
Sbjct  37   ITVLHNMRSVCICDATELQAIIILWLARREVDDKLSSFTGAVPSIMKVQLHSSSGLSLRK  96

Query  294  SLQRFLQKRKNRVQSTSPYHR*FI  223
            SLQRFLQKRK+R+QS +PY   F+
Sbjct  97   SLQRFLQKRKDRIQSATPYKHKFL  120



>ref|XP_010538254.1| PREDICTED: protein TIFY 5A [Tarenaya hassleriana]
Length=118

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            +TIFY+GK+  SDVT +Q + II LAS+   ++ + S +       +  +  +  S+K S
Sbjct  39   MTIFYNGKMCVSDVTLLQFKEIISLASRGLVEERSTSKSHHHGHHHRHHHPLHVASVKKS  98

Query  291  LQRFLQKRKNRVQSTSPYH  235
            LQ FLQKR++RVQ++SPYH
Sbjct  99   LQSFLQKRRDRVQASSPYH  117



>ref|XP_002879504.1| hypothetical protein ARALYDRAFT_482423 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55763.1| hypothetical protein ARALYDRAFT_482423 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 57/88 (65%), Gaps = 10/88 (11%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLAS---QERTKKTTRSLASSPLLLQKQLYSP----  316
            LTIFY+G + VSSD+T ++A+AI+ LAS   +ER+     S  S P  L K  YSP    
Sbjct  76   LTIFYNGHMCVSSDLTHLEAKAILSLASRDVEERSLSLKSSDDSEPPTLPK--YSPRFHN  133

Query  315  NALSMKGSLQRFLQKRKNRVQSTSPYHR  232
              +SMK SL+ FLQKR  R+Q+TSPY R
Sbjct  134  QKVSMKRSLRSFLQKRNVRIQATSPYSR  161



>ref|XP_010907301.1| PREDICTED: protein TIFY 5A-like [Elaeis guineensis]
Length=155

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 53/105 (50%), Gaps = 32/105 (30%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKK----------------------TTRSL  358
            +TIFY+G+I   DVTE QA+AII +A +E   K                        +  
Sbjct  46   ITIFYNGQICVCDVTEFQAKAIICMAQKEMNDKMNKNHHNQQQQQFQQKHNKKSNPPQPP  105

Query  357  ASS----PLLLQKQLYSPNALSMKGSLQRFLQKRKNRVQSTSPYH  235
            ASS    P LL +       LSMK SLQRFLQKRK R+ + SPY+
Sbjct  106  ASSSEAMPQLLNQ------GLSMKRSLQRFLQKRKTRINAASPYN  144



>emb|CDX99884.1| BnaC05g23060D [Brassica napus]
Length=132

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 8/86 (9%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKTT------RSLASSPLLLQKQLYSPN  313
            LTIFY+GK+ V S+VT  QA++II +AS+E  +K +      R+ ++      +QL +P 
Sbjct  43   LTIFYNGKMCVYSNVTHHQAKSIISMASREMEEKLSSNGPDPRNRSTRLNNYHQQLPNPK  102

Query  312  ALSMKGSLQRFLQKRKNRVQSTSPYH  235
            A SMK SLQ FLQKR+ R+Q+TSPYH
Sbjct  103  A-SMKRSLQSFLQKRQIRLQATSPYH  127



>ref|XP_008787820.1| PREDICTED: protein TIFY 5A isoform X1 [Phoenix dactylifera]
Length=156

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 53/102 (52%), Gaps = 25/102 (25%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKK---------------TTRSLASSPLLL  337
            +TIFY+G+I   DVTE QARAII +A +E   +                     SSP   
Sbjct  46   ITIFYNGRICVCDVTEFQARAIISMAKREMDDRMKKNQLHQQQQHQHQQKNHNKSSP--P  103

Query  336  QKQLYSPNA--------LSMKGSLQRFLQKRKNRVQSTSPYH  235
            Q  ++SP A        LSMK SLQ FLQKRK R+ + SPY+
Sbjct  104  QPPVFSPQALPQTLDQGLSMKRSLQLFLQKRKMRINAASPYN  145



>ref|XP_006415508.1| hypothetical protein EUTSA_v10009598mg [Eutrema salsugineum]
 gb|ESQ33861.1| hypothetical protein EUTSA_v10009598mg [Eutrema salsugineum]
Length=130

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 21/93 (23%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQ------------ARAIILLASQERTKKTTRSLASSPLLLQK  331
            +TIFY+G++ VSSDVT++Q            A++II +AS+E  ++++R           
Sbjct  42   ITIFYNGQMCVSSDVTKLQVCICIQIHKHGSAKSIISIASREMEERSSR--------FYN  93

Query  330  QLYSPNALSMKGSLQRFLQKRKNRVQSTSPYHR  232
            QL +    SMK SLQ FLQKRK R+Q+TSPYH+
Sbjct  94   QLSTNPKASMKKSLQSFLQKRKIRIQATSPYHQ  126



>ref|XP_010499533.1| PREDICTED: protein TIFY 5A [Camelina sativa]
Length=140

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 7/86 (8%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKTTR-----SLASSPLLLQKQLYSPNA  310
            +TIFY+GK+ VSSDVT +QA++II +A+++  +K++      S   S          PN 
Sbjct  49   ITIFYNGKMCVSSDVTHLQAKSIISMANRDMEEKSSSINGSDSQNKSTRFHHNHYQLPNP  108

Query  309  -LSMKGSLQRFLQKRKNRVQSTSPYH  235
              SMK SLQ FL KRK R+Q++SPYH
Sbjct  109  KASMKRSLQSFLHKRKIRIQASSPYH  134



>ref|XP_008451847.1| PREDICTED: protein TIFY 5A-like [Cucumis melo]
Length=127

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 10/87 (11%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPN------A  310
            + +FY+G +   D TE+QARAI+ + SQER++        +P  L  Q+           
Sbjct  43   IMVFYNGALSLCDFTELQARAILWIGSQERSRNVR---CRNPEWLNMQMLKSGNGNGNAG  99

Query  309  LSMKGSLQRFLQKRK-NRVQSTSPYHR  232
             S+K SLQRFLQ+RK  R+++ SPYH+
Sbjct  100  FSIKKSLQRFLQRRKMRRIRTMSPYHK  126



>ref|XP_010478391.1| PREDICTED: protein TIFY 5A-like [Camelina sativa]
Length=141

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 8/87 (9%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLY------SPN  313
            +TIFY+GK+ VSSDVT +QA++II +A+++  +K++    S       Q +       PN
Sbjct  49   ITIFYNGKMFVSSDVTHLQAKSIISMANRDMEEKSSSINGSDFPNKSTQFHHNHYQLPPN  108

Query  312  A-LSMKGSLQRFLQKRKNRVQSTSPYH  235
               SMK SLQ FL KRK R+Q++SPYH
Sbjct  109  PKASMKRSLQNFLHKRKIRIQASSPYH  135



>ref|XP_009628916.1| PREDICTED: protein TIFY 5A-like [Nicotiana tomentosiformis]
Length=65

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 47/68 (69%), Gaps = 9/68 (13%)
 Frame = -2

Query  426  EIQARAIILLASQERTKKTTRS----LASSPLLLQKQLYSPNALSMKGSLQRFLQKRKNR  259
            ++QA+AII LAS+E  + T  S     ASSPLL Q Q      LSMK SLQ FLQKRKNR
Sbjct  2    KMQAKAIIYLASREMEENTKTSSPISEASSPLL-QTQ----TGLSMKRSLQGFLQKRKNR  56

Query  258  VQSTSPYH  235
            +Q+TSPYH
Sbjct  57   IQATSPYH  64



>ref|XP_009360903.1| PREDICTED: protein TIFY 5A-like [Pyrus x bretschneideri]
Length=130

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLL------LQKQLYSPNA  310
            +TIFY+  +   DVTE+QAR+II LA++E  ++       S             L SP A
Sbjct  44   MTIFYNRMMCVRDVTELQARSIIFLANKEMEERVKSPFTPSGSSEPPSPNFMSPLGSPVA  103

Query  309  -LSMKGSLQRFLQKRKNRVQSTSPYH  235
              S+K SLQ FLQKRK+R Q+TSPYH
Sbjct  104  GRSLKRSLQSFLQKRKHRNQATSPYH  129



>ref|XP_010540587.1| PREDICTED: protein TIFY 5A-like [Tarenaya hassleriana]
Length=152

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 59/109 (54%), Gaps = 33/109 (30%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLAS---QERTKKTTR---------------------  364
            +TIFY+GK+  SDVT++QA+AII LA+   +ER+   +R                     
Sbjct  39   ITIFYNGKMCVSDVTDLQAKAIISLANRRVEERSSSRSRPNNKLSTTSHHLHQHSHHHHH  98

Query  363  ------SLASSPLLLQKQLYSPNALSMKGSLQRFLQKRKNRVQSTSPYH  235
                  +  +S L LQ    S +A  MK SLQRFLQ R++R+Q++ PYH
Sbjct  99   HHHHHHNSQTSSLTLQG---SNSAAFMKRSLQRFLQNRRDRIQASCPYH  144



>ref|XP_009389762.1| PREDICTED: protein TIFY 5A-like [Musa acuminata subsp. malaccensis]
Length=137

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            +TIFYDG+I +  VTE++AR II +A +E   +  +    S LL  +Q      LSM  S
Sbjct  49   ITIFYDGRICTCQVTEMEARNIISMAEREMDDQMRKKNEQSSLLSPQQKPDSAELSMIRS  108

Query  291  LQRFLQKRKNRVQSTSPY-HR  232
            LQ+FLQ RK+R  +  PY HR
Sbjct  109  LQQFLQNRKSRQSALPPYNHR  129



>ref|XP_004147775.1| PREDICTED: protein TIFY 5A-like [Cucumis sativus]
 ref|XP_004165262.1| PREDICTED: protein TIFY 5A-like [Cucumis sativus]
 gb|KGN53504.1| hypothetical protein Csa_4G062400 [Cucumis sativus]
Length=129

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 10/87 (11%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQ-LYSPN-----A  310
            + +FY+G +   D TE+QARAII + SQER+         +P  L  Q L S N      
Sbjct  45   IMVFYNGALSICDFTELQARAIIWVGSQERSGNVR---CRNPEWLNMQMLKSGNGNGNAG  101

Query  309  LSMKGSLQRFLQKRK-NRVQSTSPYHR  232
             S+K SLQ+FLQ+RK  R+++ SPYH+
Sbjct  102  FSIKKSLQKFLQRRKMRRIRTMSPYHK  128



>ref|XP_009115185.1| PREDICTED: protein TIFY 5A-like [Brassica rapa]
Length=133

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 10/87 (11%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKTTRSLASSPLL-------LQKQLYSP  316
            LTIFY+GK+ V S+VT  QA++II +A +E  +K + S  S P           +QL +P
Sbjct  44   LTIFYNGKMCVYSNVTHHQAKSIISMAGREMEEKVS-SNVSDPRNRSTRLNNYHQQLPNP  102

Query  315  NALSMKGSLQRFLQKRKNRVQSTSPYH  235
             A SMK SLQ FLQKR+ R+Q+ SPYH
Sbjct  103  KA-SMKRSLQSFLQKRQIRLQAASPYH  128



>ref|XP_006295117.1| hypothetical protein CARUB_v10024191mg [Capsella rubella]
 gb|EOA28015.1| hypothetical protein CARUB_v10024191mg [Capsella rubella]
Length=168

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 58/92 (63%), Gaps = 17/92 (18%)
 Frame = -2

Query  471  LTIFYDGK-IVSSDVTEIQARAIILLASQERTKKTTRSLASS-----PLL------LQKQ  328
            LTIFY+G  ++SSD+T ++A AI+ LAS++  ++   SL SS     P++      +Q+Q
Sbjct  80   LTIFYNGHMLISSDLTNLEANAILSLASRDVEERPPSSLRSSHGSDPPMITNNSTRIQQQ  139

Query  327  LYSPNALSMKGSLQRFLQKRKNRVQSTSPYHR  232
                   SMK SL+ FLQKR  R+Q+T PYHR
Sbjct  140  -----KASMKRSLRNFLQKRNVRIQATCPYHR  166



>ref|XP_009790070.1| PREDICTED: protein TIFY 5A-like [Nicotiana sylvestris]
 gb|AGU37282.1| jasmonate ZIM-domain protein 11b [Nicotiana tabacum]
Length=116

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKK--TTRSLASSPLLLQKQLYSPNALSMK  298
            +TIFY+      D +E+QA AI+  A  E  +K  T+ S   +P L Q QL+SP  LS++
Sbjct  37   ITIFYNALDGECDTSELQALAILCHARGEMEEKYNTSASNLKAPSL-QFQLHSPYGLSLR  95

Query  297  GSLQRFLQKRKN-RVQSTSPY  238
             SLQRFLQKRK  R+Q+ +PY
Sbjct  96   KSLQRFLQKRKERRIQAANPY  116



>emb|CDX84301.1| BnaC04g10630D [Brassica napus]
Length=116

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 54/87 (62%), Gaps = 14/87 (16%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKT---TRSLASSPLLLQKQLYSPNAL-  307
            + IFY+G + VSSD+T +QA+AI+ LAS +  +K+     S  S P  +      PN L 
Sbjct  34   MVIFYNGHVFVSSDLTHLQAKAILSLASGDMKEKSLSLESSDGSDPSTV------PNILT  87

Query  306  ---SMKGSLQRFLQKRKNRVQSTSPYH  235
               SMK SL+RFLQKR  R+Q++ PYH
Sbjct  88   RKASMKRSLRRFLQKRNVRIQASCPYH  114



>ref|XP_002862641.1| hypothetical protein ARALYDRAFT_333262 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38899.1| hypothetical protein ARALYDRAFT_333262 [Arabidopsis lyrata subsp. 
lyrata]
Length=130

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 6/86 (7%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLAS---QERTKKTTRSLASSPLLLQK--QLYSPNA  310
            LTIFY+G + VSSD+T ++A+AI+ LAS   +ER+     S  S P  L K    +    
Sbjct  45   LTIFYNGHMCVSSDLTHLEAKAILSLASRDVEERSLSLKSSDDSEPPTLPKYSTRFHNQK  104

Query  309  LSMKGSLQRFLQKRKNRVQSTSPYHR  232
            +SMK SL+ FLQKR  R+Q+TSPY R
Sbjct  105  VSMKRSLRSFLQKRNVRIQATSPYSR  130



>ref|XP_009418985.1| PREDICTED: protein TIFY 5A-like [Musa acuminata subsp. malaccensis]
Length=147

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 50/89 (56%), Gaps = 7/89 (8%)
 Frame = -2

Query  468  TIFYDGKIVSSDVTEIQARAIILLASQE----RTKKTTRSLASSPLLLQKQLYSPNALSM  301
            T+F +G++   D TEIQARAII +A +E     TKK  +   + P            LSM
Sbjct  52   TVFCNGRVYLCDATEIQARAIISMARREMDDTMTKKNQQQPTAPPPPQAVPQILNPGLSM  111

Query  300  KGSLQRFLQKRKNRVQSTSPY---HR*FI  223
            K SLQRFLQKRK R+   SPY   H+ F+
Sbjct  112  KRSLQRFLQKRKARISDVSPYTQRHKLFL  140



>ref|XP_006304275.1| hypothetical protein CARUB_v10010507mg [Capsella rubella]
 gb|EOA37173.1| hypothetical protein CARUB_v10010507mg [Capsella rubella]
Length=114

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 10/85 (12%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQ----ERTKKTTRSLASSPLLLQKQLYSPNAL  307
            LTIFY+GK+ VSS+VT +QA++II +A++    + + ++TR   +       QL +P A 
Sbjct  28   LTIFYNGKMCVSSNVTHLQAKSIISMANRSNGSDPSNESTRFHHNH---YDHQLPNPKA-  83

Query  306  SMKGSLQRFLQKRKNRVQ-STSPYH  235
            SMK SLQ FLQKRK R+Q ++SPYH
Sbjct  84   SMKRSLQSFLQKRKIRIQAASSPYH  108



>ref|XP_010907302.1| PREDICTED: protein TIFY 5A-like [Elaeis guineensis]
Length=153

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 53/104 (51%), Gaps = 31/104 (30%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSL---------------------A  355
            +TIFY+G+I   D TE QARAII +A +E   +  ++                      A
Sbjct  45   ITIFYNGQICVCDGTEFQARAIISMAKKEMDDRMNKNYHIQQQHQFEQKHNKLNPPQPPA  104

Query  354  SS----PLLLQKQLYSPNALSMKGSLQRFLQKRKNRVQSTSPYH  235
            SS    P LL +       LSMK SLQRFLQKRK R+ + SPY+
Sbjct  105  SSSKAMPQLLNQ------GLSMKRSLQRFLQKRKARMNAASPYN  142



>ref|NP_181007.1| jasmonate-zim-domain protein 7 [Arabidopsis thaliana]
 sp|O64687.1|TIF5B_ARATH RecName: Full=Protein TIFY 5B; AltName: Full=Jasmonate ZIM domain-containing 
protein 7 [Arabidopsis thaliana]
 gb|AAC26695.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAR20723.1| At2g34600 [Arabidopsis thaliana]
 gb|AAR24741.1| At2g34600 [Arabidopsis thaliana]
 gb|AEC08997.1| jasmonate-zim-domain protein 7 [Arabidopsis thaliana]
Length=148

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 6/86 (7%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKTTR---SLASSPLLLQKQ--LYSPNA  310
            LTIFY+G + VSSD+T ++A AI+ LAS++  +K+     S  S P  +      +    
Sbjct  61   LTIFYNGHMCVSSDLTHLEANAILSLASRDVEEKSLSLRSSDGSDPPTIPNNSTRFHYQK  120

Query  309  LSMKGSLQRFLQKRKNRVQSTSPYHR  232
             SMK SL  FLQKR  R+Q+TSPYHR
Sbjct  121  ASMKRSLHSFLQKRSLRIQATSPYHR  146



>ref|XP_003593904.1| Protein TIFY 5A [Medicago truncatula]
Length=78

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 8/71 (11%)
 Frame = -2

Query  423  IQARAIILLAS----QERTKKTTRSLASSPLLLQK---QLYSPN-ALSMKGSLQRFLQKR  268
            +QA++I++LA+    QE+      S  S+P  + +   QLYSP   LSMK SLQRFLQKR
Sbjct  7    LQAKSILMLANRIKVQEKVMTPIGSEPSTPTTIVQSPHQLYSPGPGLSMKRSLQRFLQKR  66

Query  267  KNRVQSTSPYH  235
            KNRVQ  SPY+
Sbjct  67   KNRVQEASPYY  77



>ref|XP_006605684.1| PREDICTED: protein TIFY 5A-like [Glycine max]
Length=111

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 4/69 (6%)
 Frame = -2

Query  435  DVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQ---LYSPNALSMKGSLQRFLQKRK  265
            DVTE+QAR I+ LASQER   T  + A+S L LQ Q   +++P   S+K SL+ FLQKRK
Sbjct  40   DVTELQARVILWLASQEREGNTGPASATS-LSLQSQALLMHAPQGSSVKRSLRNFLQKRK  98

Query  264  NRVQSTSPY  238
             R Q + P+
Sbjct  99   KRFQKSHPH  107



>ref|XP_009143759.1| PREDICTED: protein TIFY 5B-like [Brassica rapa]
 emb|CDY17268.1| BnaA05g09200D [Brassica napus]
Length=116

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 14/87 (16%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKT---TRSLASSPLLLQKQLYSPNAL-  307
            + IFY+G++ VSSD+T +QA+AI+ LAS +  +K+     S  S P  +      PN L 
Sbjct  34   MVIFYNGRVFVSSDLTHLQAKAILSLASGDMKEKSLSLESSDGSDPSTV------PNILT  87

Query  306  ---SMKGSLQRFLQKRKNRVQSTSPYH  235
               SMK SL+ FLQKR  R+Q++ PYH
Sbjct  88   RKASMKRSLRSFLQKRNVRIQASCPYH  114



>ref|XP_010509733.1| PREDICTED: protein TIFY 5B-like [Camelina sativa]
Length=129

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 6/85 (7%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQE--RTKKTTRSLASSPLLLQK--QLYSPNAL  307
            LTIFY+G + +SSD+T ++A+AI+ LAS++   + +++     SP++      ++   A 
Sbjct  44   LTIFYNGHMCISSDLTNLEAKAILSLASRDVGSSLRSSNGSDPSPMITNNITTIHRQKA-  102

Query  306  SMKGSLQRFLQKRKNRVQSTSPYHR  232
            SMK SL+ FLQKR  R+Q+T PYHR
Sbjct  103  SMKRSLRSFLQKRNVRIQATCPYHR  127



>ref|XP_006304276.1| hypothetical protein CARUB_v10010507mg, partial [Capsella rubella]
 gb|EOA37174.1| hypothetical protein CARUB_v10010507mg, partial [Capsella rubella]
Length=162

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 10/85 (12%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQ----ERTKKTTRSLASSPLLLQKQLYSPNAL  307
            LTIFY+GK+ VSS+VT +QA++II +A++    + + ++TR   +       QL +P A 
Sbjct  76   LTIFYNGKMCVSSNVTHLQAKSIISMANRSNGSDPSNESTRFHHNH---YDHQLPNPKA-  131

Query  306  SMKGSLQRFLQKRKNRVQ-STSPYH  235
            SMK SLQ FLQKRK R+Q ++SPYH
Sbjct  132  SMKRSLQSFLQKRKIRIQAASSPYH  156



>emb|CDY26288.1| BnaA09g26390D [Brassica napus]
Length=133

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 56/88 (64%), Gaps = 10/88 (11%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKTTRSLASSPLL-------LQKQLYSP  316
            LTIFY+GK+ V S+VT  QA++II +A +E  +K + S  S P           +QL +P
Sbjct  44   LTIFYNGKMCVYSNVTHHQAKSIISMAGREMEEKVS-SNVSDPRNRSTRLNNYHQQLPNP  102

Query  315  NALSMKGSLQRFLQKRKNRVQSTSPYHR  232
             A SMK SLQ FLQK + R+Q+ SPYH+
Sbjct  103  KA-SMKRSLQSFLQKGQIRLQAASPYHQ  129



>ref|XP_010908138.1| PREDICTED: protein TIFY 5A-like [Elaeis guineensis]
Length=135

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 47/86 (55%), Gaps = 13/86 (15%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTR------------SLASSPLLLQKQ  328
            +TIFY G++   D TEIQARAII +A +E  +   +            S AS       Q
Sbjct  51   ITIFYGGRVCVCDATEIQARAIICMAQREMEEMAAKKQKDRGMEPYPPSPASRTPPAMPQ  110

Query  327  LYSPNALSMKGSLQRFLQKRKNRVQS  250
            L +P  LSMK SL++FLQKRK+R   
Sbjct  111  LLNP-GLSMKRSLKQFLQKRKSRTDG  135



>ref|XP_009408785.1| PREDICTED: protein TIFY 5A [Musa acuminata subsp. malaccensis]
Length=158

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 49/96 (51%), Gaps = 19/96 (20%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTR------------------SLASSP  346
            LTI Y+G+I   DVTEI+A AII +A QE   +T +                       P
Sbjct  52   LTICYNGRICVCDVTEIEAEAIIAMARQETDDQTRKKRQEQQPKESSTTSSSSPPPLPPP  111

Query  345  LLLQKQLYSPNALSMKGSLQRFLQKRKNRVQSTSPY  238
              LQ     P  LS K SLQRFLQKRK+R+ + SPY
Sbjct  112  RFLQHLHIDPE-LSRKRSLQRFLQKRKSRMNAVSPY  146



>ref|XP_009630463.1| PREDICTED: protein TIFY 5A-like [Nicotiana tomentosiformis]
 gb|AGU37281.1| jasmonate ZIM-domain protein 11a [Nicotiana tabacum]
Length=115

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = -2

Query  468  TIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLAS--SPLLLQKQLYSPNALSMKG  295
            TIFY+ +      +E+QA AI+  A +E  +K   S ++  +P L Q QL+SP  LS++ 
Sbjct  37   TIFYNAQDGECHTSELQALAILWHARREMEEKYNMSASNLRAPSL-QFQLHSPYGLSLRK  95

Query  294  SLQRFLQKRKN-RVQSTSPY  238
            SLQRFLQKR+  R+Q+ +PY
Sbjct  96   SLQRFLQKRRERRIQAANPY  115



>ref|XP_011091963.1| PREDICTED: protein TIFY 5A-like [Sesamum indicum]
Length=107

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 5/73 (7%)
 Frame = -2

Query  447  IVSSDVTEIQARAIILLA---SQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQRFL  277
            I SSDVTE+QA AI+ LA   + ER  +  R+   SP   Q Q +    LS+K SLQ+FL
Sbjct  37   IFSSDVTELQAIAILWLAKRVTDERRNELERN--RSPSRQQLQFHGSRGLSLKKSLQKFL  94

Query  276  QKRKNRVQSTSPY  238
            +KR++R+Q++ PY
Sbjct  95   RKRRDRIQASMPY  107



>ref|XP_009406706.1| PREDICTED: protein TIFY 5A-like [Musa acuminata subsp. malaccensis]
Length=149

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 17/94 (18%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQE----------------RTKKTTRSLASSPLL  340
            +TIFYDG++   + TE+QA+A+I +A +E                    T+         
Sbjct  41   MTIFYDGRVCVCNATEMQAKALISMAKREMDDMVTEQKQQQQQQSVESSTSSLPRPPSPR  100

Query  339  LQKQLYSPNALSMKGSLQRFLQKRKNRVQSTSPY  238
               Q+ +P  LSMK SLQRFLQKRK R+   SPY
Sbjct  101  PMPQMLNP-GLSMKRSLQRFLQKRKARMNDVSPY  133



>ref|XP_007145968.1| hypothetical protein PHAVU_006G001900g [Phaseolus vulgaris]
 gb|ESW17962.1| hypothetical protein PHAVU_006G001900g [Phaseolus vulgaris]
Length=91

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 11/73 (15%)
 Frame = -2

Query  435  DVTEIQARAIILLASQERTKK-------TTRSLASSPLLLQKQLYSPNALSMKGSLQRFL  277
            DVTE+QAR II LASQE           T+ S+ S PLL    +++P   S+K SL+ FL
Sbjct  23   DVTELQARVIIWLASQEMDGSSRGGGSVTSLSMQSQPLL----MHAPQGFSIKTSLRNFL  78

Query  276  QKRKNRVQSTSPY  238
             KRK R Q + P+
Sbjct  79   HKRKKRSQKSHPH  91



>ref|XP_009408786.1| PREDICTED: protein TIFY 5A-like [Musa acuminata subsp. malaccensis]
Length=133

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSP--------LLLQKQLYSP  316
            +T+FY+G+I   ++T+ +ARAII +A ++  ++  +  +  P            +QL   
Sbjct  43   ITLFYNGRICVCNLTDTKARAIISMAKRQMDEQQAKGSSFLPRDPPPSPHPHPPEQLLIN  102

Query  315  NALSMKGSLQRFLQKRKNRVQSTSPY  238
              L+MK SLQ FLQKRK+RV S SPY
Sbjct  103  PGLAMKRSLQLFLQKRKSRVHSLSPY  128



>gb|KHN06969.1| hypothetical protein glysoja_032812 [Glycine soja]
Length=63

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = -2

Query  390  QERTKKTTRSLASSPLLLQ--KQLYSPN-ALSMKGSLQRFLQKRKNRVQSTSPY  238
            +ER +  T S  SSP ++Q   QLYSP    SM+ SLQRFLQKR+NRVQ  SPY
Sbjct  8    EERVRTPTGSEPSSPTVMQSNNQLYSPGTGPSMRKSLQRFLQKRRNRVQEASPY  61



>ref|XP_010504925.1| PREDICTED: protein TIFY 5B-like [Camelina sativa]
Length=128

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -2

Query  471  LTIFYDGKI-VSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPN--ALSM  301
            LTIFY+G + +SS +T ++A+AI+ LAS++       S  S P ++   + + +    SM
Sbjct  44   LTIFYNGHMCISSYLTHLEAKAILSLASRDVGSSLRSSDGSDPPMITNNITTIHRQKASM  103

Query  300  KGSLQRFLQKRKNRVQSTSPYH  235
            K SL+ FL+KR  R+Q+T PYH
Sbjct  104  KRSLRSFLEKRNVRIQATCPYH  125



>ref|XP_010044866.1| PREDICTED: protein TIFY 9-like [Eucalyptus grandis]
 gb|KCW86984.1| hypothetical protein EUGRSUZ_B03545 [Eucalyptus grandis]
Length=214

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 11/88 (13%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTR---SLASSPLLLQKQ------LYS  319
            +TIFY+GK+   DV  I A  I+ LA +E +K       ++A  P   Q Q      +Y 
Sbjct  115  MTIFYNGKMTVVDVPPIMAENILKLAMEESSKSPESDKLAIAMPPPSHQHQWFESLNIYL  174

Query  318  PNALSMKGSLQRFLQKRKNRVQSTSPYH  235
            P  ++ + SLQRFL+KRK R+ S SPYH
Sbjct  175  P--IARRKSLQRFLEKRKERLTSASPYH  200



>ref|XP_007145967.1| hypothetical protein PHAVU_006G001900g [Phaseolus vulgaris]
 gb|ESW17961.1| hypothetical protein PHAVU_006G001900g [Phaseolus vulgaris]
Length=117

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 11/73 (15%)
 Frame = -2

Query  435  DVTEIQARAIILLASQERTKK-------TTRSLASSPLLLQKQLYSPNALSMKGSLQRFL  277
            DVTE+QAR II LASQE           T+ S+ S PLL    +++P   S+K SL+ FL
Sbjct  49   DVTELQARVIIWLASQEMDGSSRGGGSVTSLSMQSQPLL----MHAPQGFSIKTSLRNFL  104

Query  276  QKRKNRVQSTSPY  238
             KRK R Q + P+
Sbjct  105  HKRKKRSQKSHPH  117



>dbj|BAK05553.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=150

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 53/103 (51%), Gaps = 23/103 (22%)
 Frame = -2

Query  471  LTIFYDGKIVSS-DVTEIQARAIILLASQERTKKTT---------------RSLASSP--  346
            L I YD +++ + DV E+QA AII +A+QE T K T               R+   +P  
Sbjct  41   LAIVYDRRVLCAVDVVELQAMAIISMANQETTGKITDMDEAGIAQGAWRAARAPTRAPPN  100

Query  345  ---LLLQKQLYSPNALSMKGSLQRFLQKRKNRVQSTSPY--HR  232
               ++    +     LSMK SLQRFL+KRK R  + SPY  HR
Sbjct  101  HGGIVAPTPVGDQGGLSMKRSLQRFLEKRKTRASTASPYGVHR  143



>gb|EMS66242.1| Protein TIFY 5A [Triticum urartu]
Length=150

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 54/104 (52%), Gaps = 25/104 (24%)
 Frame = -2

Query  471  LTIFYDGKIVSS-DVTEIQARAIILLASQERTKKTT-------RSLASSPLLLQKQLYSP  316
            LTI YD +++ + DV E+QA AII +A+QE T + T          A  P   Q +  SP
Sbjct  41   LTIVYDRRVLCAVDVVELQAMAIISMANQETTGRITDMDDAGIAQGACRPARAQTR-ASP  99

Query  315  N--------------ALSMKGSLQRFLQKRKNRVQSTSPY--HR  232
            +               LSMK SLQRFL+KRK R  + SPY  HR
Sbjct  100  DHGCIEAPTPLDDQGGLSMKRSLQRFLEKRKARASAASPYVVHR  143



>ref|XP_010941162.1| PREDICTED: protein TIFY 5A-like [Elaeis guineensis]
Length=159

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 48/97 (49%), Gaps = 19/97 (20%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPN-------  313
            +TIFY+G+I   DVTE Q RAII +A++E   +  +         Q    + N       
Sbjct  48   ITIFYNGRICVCDVTEFQVRAIISMANREMDDRLKKKQLHHQQQHQYLQENRNESSPPHQ  107

Query  312  -----------ALSMKGSLQRFLQKRKNRVQ-STSPY  238
                        L MK SLQRFLQKRK R+  +T+PY
Sbjct  108  PQAAPPQLLNQGLLMKRSLQRFLQKRKTRINAATTPY  144



>ref|XP_004486292.1| PREDICTED: protein TIFY 5A-like, partial [Cicer arietinum]
Length=75

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 9/72 (13%)
 Frame = -2

Query  423  IQARAIILLASQE-----RTKKTTRSLASSPLLLQ--KQLYSP--NALSMKGSLQRFLQK  271
            +QA++I+++A+++      T  T  S  S+P ++Q   QLY P    LS+K SLQRFLQK
Sbjct  3    VQAKSILMMANKKLQESVNTPTTRGSEPSTPTIVQSPNQLYRPAGPGLSIKRSLQRFLQK  62

Query  270  RKNRVQSTSPYH  235
            RKNRV   SPY+
Sbjct  63   RKNRVLEASPYN  74



>ref|XP_010688800.1| PREDICTED: protein TIFY 5A-like [Beta vulgaris subsp. vulgaris]
Length=124

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 8/85 (9%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQE-RTKKTTRSLASSPLLLQKQLYS---PNALS  304
            +TIF+DG++  +D  E+QARAII  A+++  T+     + S+ L  + QL+    P   S
Sbjct  34   MTIFFDGQVCVADAIELQARAIIWSATRDFETRMKMAGVGSNKLFQKLQLHELPLP-GCS  92

Query  303  MKGSLQRFLQ---KRKNRVQSTSPY  238
            +K SL+ FLQ   KR+N   S  PY
Sbjct  93   IKTSLKLFLQQKRKRQNHANSLCPY  117



>ref|XP_009145396.1| PREDICTED: uncharacterized protein LOC103869096 [Brassica rapa]
 emb|CDY10631.1| BnaA05g17310D [Brassica napus]
Length=123

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 8/76 (11%)
 Frame = -2

Query  462  FYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQR  283
            FY G++   D+ EIQ RA+I +AS+ER      +L  +P+ L+    SP   S+K S++R
Sbjct  40   FYSGRVREYDLVEIQIRAVIEMASKER---DITALELAPVRLK----SPLVFSVKRSVER  92

Query  282  FLQKRKNRVQ-STSPY  238
            FL+KRK R +  T+PY
Sbjct  93   FLEKRKKRSKYVTTPY  108



>ref|XP_009412023.1| PREDICTED: protein TIFY 5A-like [Musa acuminata subsp. malaccensis]
Length=151

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERT-----KKTTRSLASSPLLLQKQLYSP---  316
            +TIFY G++   DVTE+QARAII  A +E       K++ R   SS L        P   
Sbjct  59   ITIFYKGQMCVCDVTEVQARAIISAAERETEDAEAKKQSDRRPDSSSLPPPPAPVPPRVL  118

Query  315  -NALSMKGSLQRFLQKRKNR-VQSTSPY  238
              +LSMK SLQRFLQ RK R V S+ PY
Sbjct  119  NRSLSMKRSLQRFLQNRKTRAVDSSPPY  146



>ref|XP_010549495.1| PREDICTED: protein TIFY 5A-like [Tarenaya hassleriana]
Length=139

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 58/98 (59%), Gaps = 19/98 (19%)
 Frame = -2

Query  471  LTIFYDGKIVS-SDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNA-----  310
            +TIFY+GKI+  SD+T +QA+AII LA++   K+++   + SP       +  +      
Sbjct  41   MTIFYNGKIICISDITHLQAQAIISLANRGMEKRSSSRSSPSPHHHHDHHHDHHHHRHHG  100

Query  309  ----LSMKG---------SLQRFLQKRKNRVQSTSPYH  235
                +S+KG         SLQRFLQKR++R+Q+T PY+
Sbjct  101  HHPLMSLKGYNSVGPTKKSLQRFLQKRRDRIQATCPYN  138



>ref|XP_006846121.1| hypothetical protein AMTR_s00012p00148380 [Amborella trichopoda]
 gb|ERN07796.1| hypothetical protein AMTR_s00012p00148380 [Amborella trichopoda]
Length=154

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 52/105 (50%), Gaps = 26/105 (25%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTR---------------------SLA  355
            LTIFY+G++  S VT+ QA AI+ LA++E    T R                       +
Sbjct  51   LTIFYNGRVSVSHVTQGQASAILGLATEEDVDTTLRISPIDGNNNNTIVESSSDQSSDSS  110

Query  354  SSPLLLQKQLY----SPNALSMKGSLQRFLQKRKNRVQSTSPYHR  232
              P LL +Q +    +  A  MK SLQRFLQKRK R+   SPY R
Sbjct  111  IPPFLLCQQPHMGFSAAAATGMKHSLQRFLQKRK-RLHKNSPYRR  154



>ref|XP_004163015.1| PREDICTED: protein TIFY 5A-like [Cucumis sativus]
Length=119

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = -2

Query  447  IVSSDVTEIQARAIILLASQ----ERTKKTTRSLASSP--LLLQKQLYSPNALSMKGSLQ  286
            + + D+TEIQA+AII+ A++    ER++  T  ++SS   +L+     SP   SM+ SLQ
Sbjct  45   LFTPDLTEIQAKAIIVQATRQMEAERSRWRTCRISSSAERVLMTNGEASP---SMRRSLQ  101

Query  285  RFLQKRKNRVQSTSPY  238
            RFLQKRK R+Q+ SPY
Sbjct  102  RFLQKRKLRIQTLSPY  117



>gb|KHN21823.1| hypothetical protein glysoja_044061 [Glycine soja]
Length=116

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 9/74 (12%)
 Frame = -2

Query  435  DVTEIQ-----ARAIILLASQERTKKTTRSLASSPLLLQKQ---LYSPNALSMKGSLQRF  280
            DVTE+Q     AR I+ LASQER   T  + A+S L LQ Q   +++P   S+K SL+ F
Sbjct  40   DVTELQVMCIAARVILWLASQEREGNTGPASATS-LSLQSQALLMHAPQGSSVKRSLRNF  98

Query  279  LQKRKNRVQSTSPY  238
            LQKRK R Q + P+
Sbjct  99   LQKRKKRFQKSHPH  112



>ref|XP_008444384.1| PREDICTED: protein TIFY 5A-like [Cucumis melo]
Length=120

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 8/75 (11%)
 Frame = -2

Query  447  IVSSDVTEIQARAIILLASQ----ERTKKTTR-SLASSPLLLQKQLYSPNALSMKGSLQR  283
            + + D+TEIQA+AII+ A++    ER   T R S ++  + ++    SP   SM+ SLQR
Sbjct  47   VPTPDLTEIQAKAIIVEATRQMEAERRWTTCRISSSAERVWMRSGEASP---SMRRSLQR  103

Query  282  FLQKRKNRVQSTSPY  238
            FLQKRK R+Q+ SPY
Sbjct  104  FLQKRKLRIQTLSPY  118



>ref|XP_004149668.1| PREDICTED: protein TIFY 5A-like [Cucumis sativus]
 gb|KGN65534.1| hypothetical protein Csa_1G435790 [Cucumis sativus]
Length=119

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = -2

Query  447  IVSSDVTEIQARAIILLASQ----ERTKKTTRSLASSP--LLLQKQLYSPNALSMKGSLQ  286
            + + D+TEIQA+AII+ A++    ER++  T  ++SS   +L+     SP   S++ SLQ
Sbjct  45   LFTPDLTEIQAKAIIVQATRQMEAERSRWRTCRISSSAERVLMTNGEASP---SLRRSLQ  101

Query  285  RFLQKRKNRVQSTSPY  238
            RFLQKRK R+Q+ SPY
Sbjct  102  RFLQKRKLRIQTLSPY  117



>ref|XP_006836445.1| hypothetical protein AMTR_s00092p00170060 [Amborella trichopoda]
 gb|ERM99298.1| hypothetical protein AMTR_s00092p00170060 [Amborella trichopoda]
Length=145

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 23/102 (23%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTT----------------RSLASSPLL  340
            LTIFY+G++    VTE QA AI+ LA++E     T                 S+ S P L
Sbjct  45   LTIFYNGRVSVCHVTEGQASAILGLAAEEEEDVDTTLRISPVESSSDQSSSSSIISIPPL  104

Query  339  LQKQL-YSPNA-----LSMKGSLQRFLQKRKNRVQSTSPYHR  232
            LQ  + +S  A      SMK SLQRFLQKRK ++ + SPY+R
Sbjct  105  LQPHIGFSAVAKMATGQSMKRSLQRFLQKRK-KLHTNSPYYR  145



>ref|XP_006300003.1| hypothetical protein CARUB_v10016226mg [Capsella rubella]
 gb|EOA32901.1| hypothetical protein CARUB_v10016226mg [Capsella rubella]
Length=126

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 7/71 (10%)
 Frame = -2

Query  462  FYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQR  283
            F +G++   D+ EIQ RAII +AS+ER + TT  LA  P+    +L SP   S+K S++R
Sbjct  42   FCNGRLSEYDLVEIQIRAIIEMASKER-EVTTLELA--PV----RLESPLGCSVKRSVKR  94

Query  282  FLQKRKNRVQS  250
            FL+KRK R +S
Sbjct  95   FLEKRKKRNKS  105



>ref|NP_568287.1| protein TIFY 9 [Arabidopsis thaliana]
 sp|Q93ZM9.1|TIF9_ARATH RecName: Full=Protein TIFY 9; AltName: Full=Jasmonate ZIM domain-containing 
protein 10; AltName: Full=Protein JASMONATE-ASSOCIATED 
1; AltName: Full=Protein JAZ10 [Arabidopsis thaliana]
 gb|AAL08300.1| AT5g13220/T31B5_40 [Arabidopsis thaliana]
 gb|AAL87368.1| AT5g13220/T31B5_40 [Arabidopsis thaliana]
 gb|AED91866.1| protein TIFY 9 [Arabidopsis thaliana]
Length=197

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 52/89 (58%), Gaps = 10/89 (11%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASS-----PLLLQKQLYSPN--  313
            +TIFY+G +    V+  +A  I+ +A++  +KK   S+ +      P  L+ +L+  N  
Sbjct  105  MTIFYNGSVSVFQVSRNKAGEIMKVANEAASKKDESSMETDLSVILPTTLRPKLFGQNLE  164

Query  312  ---ALSMKGSLQRFLQKRKNRVQSTSPYH  235
                ++ + SLQRFL+KRK R+ STSPY+
Sbjct  165  GDLPIARRKSLQRFLEKRKERLVSTSPYY  193



>ref|NP_001078200.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76617.1| uncharacterized protein AT3G22275 [Arabidopsis thaliana]
Length=125

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 7/74 (9%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            +  FY G++   D+ EIQ RAII +AS++R         ++  L+  +L SP   S+K S
Sbjct  38   INAFYSGRLSEYDLVEIQMRAIIEMASKDRE-------VTALELVPVRLESPLGCSVKRS  90

Query  291  LQRFLQKRKNRVQS  250
            ++RFL+KRK R +S
Sbjct  91   VKRFLEKRKKRSKS  104



>ref|XP_002885495.1| hypothetical protein ARALYDRAFT_479741 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61754.1| hypothetical protein ARALYDRAFT_479741 [Arabidopsis lyrata subsp. 
lyrata]
Length=123

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 7/74 (9%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            +  F+ G++   D+ EIQ RAII +AS+ER      +L  +P+ L+    SP   S+K S
Sbjct  38   INAFHSGRLSEYDLVEIQIRAIIEMASKER---DVTALELAPVRLE----SPLGCSVKRS  90

Query  291  LQRFLQKRKNRVQS  250
            ++RFL+KRK R +S
Sbjct  91   VKRFLEKRKKRSKS  104



>emb|CDY37403.1| BnaC05g30270D [Brassica napus]
Length=123

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 7/68 (10%)
 Frame = -2

Query  462  FYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQR  283
            FY+G++   D+ EIQ RA+I +AS+ER       L  +P+ L+    SP    +K S++R
Sbjct  40   FYNGRVREYDLVEIQIRAVIEMASKERDITV---LELAPVRLE----SPLVFPVKRSVER  92

Query  282  FLQKRKNR  259
            FL+KRK R
Sbjct  93   FLEKRKKR  100



>ref|XP_006399812.1| hypothetical protein EUTSA_v10014724mg [Eutrema salsugineum]
 gb|ESQ41265.1| hypothetical protein EUTSA_v10014724mg [Eutrema salsugineum]
Length=197

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 9/87 (10%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTT---RSLAS-SPLLLQKQLYSPN---  313
            +TIFY+GK+    V+  +A  I+ +A +  TKK T   + L+   P  L+ +L+  N   
Sbjct  106  MTIFYNGKVSVFQVSRNKADDILKVAMETATKKDTSMEKDLSVIPPTTLRPKLFGQNLEG  165

Query  312  --ALSMKGSLQRFLQKRKNRVQSTSPY  238
               ++ + SLQRFL+KRK R+ STSPY
Sbjct  166  DLPIARRKSLQRFLEKRKERLVSTSPY  192



>ref|XP_002297866.1| hypothetical protein POPTR_0001s13240g [Populus trichocarpa]
 gb|EEE82671.1| hypothetical protein POPTR_0001s13240g [Populus trichocarpa]
Length=196

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 48/87 (55%), Gaps = 14/87 (16%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKG-  295
            LTIFY+G +   +V   +A  I+ LA ++R  KT+    + P   Q+QL+     S+ G 
Sbjct  111  LTIFYNGTVAVFNVPRDKAENILKLA-EKRISKTSAEPMTDPKTDQQQLFE----SLDGA  165

Query  294  --------SLQRFLQKRKNRVQSTSPY  238
                    SLQRFL+KRK R+ S SPY
Sbjct  166  DLPIARRKSLQRFLEKRKGRLTSVSPY  192



>emb|CDX92936.1| BnaA03g36580D [Brassica napus]
Length=122

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 45/77 (58%), Gaps = 7/77 (9%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            +  FY+GK+   D+ E Q RAII +AS+ER      +L  +P  L+  L      S+K S
Sbjct  37   INAFYNGKVREHDLVEFQIRAIIEMASKER---GITALELTPTRLESSL----VFSLKRS  89

Query  291  LQRFLQKRKNRVQSTSP  241
            ++ FL+KRK R +S +P
Sbjct  90   VKSFLEKRKKRNKSFAP  106



>ref|XP_006406188.1| hypothetical protein EUTSA_v10021766mg [Eutrema salsugineum]
 gb|ESQ47641.1| hypothetical protein EUTSA_v10021766mg [Eutrema salsugineum]
Length=125

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 7/71 (10%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            +  FY+GK+   D  EIQ RAII +AS+ER      +L  +P+     L SP   S+K S
Sbjct  37   MNAFYNGKLREYDHVEIQIRAIIEMASKER---EVTALELAPV----SLGSPLRSSLKRS  89

Query  291  LQRFLQKRKNR  259
            ++RFL+KRKN+
Sbjct  90   VKRFLEKRKNK  100



>ref|XP_006836619.1| hypothetical protein AMTR_s00131p00119200 [Amborella trichopoda]
 gb|ERM99472.1| hypothetical protein AMTR_s00131p00119200 [Amborella trichopoda]
Length=233

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 14/90 (16%)
 Frame = -2

Query  471  LTIFYDGKIV-SSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQL----------  325
            +TIFYDGK+V   DV+  +A+ I+L+A+        ++  S PL                
Sbjct  114  MTIFYDGKMVLIDDVSAEKAKIIMLMAAN--GAGCPQNSGSVPLPANTSSSNHRSSVSSK  171

Query  324  -YSPNALSMKGSLQRFLQKRKNRVQSTSPY  238
             +S   ++ K SLQRFL+KRK+R++ST+P+
Sbjct  172  NFSDMPMARKASLQRFLEKRKDRIKSTAPF  201



>emb|CDY70721.1| BnaCnng69490D [Brassica napus]
Length=122

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 7/77 (9%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGS  292
            +  F +GK+   D+ E Q RAII +AS+ER      +L  +P+    +L SP   S+K S
Sbjct  37   INAFSNGKVREHDLVEFQIRAIIEMASKERG---ITALELAPM----RLGSPLGFSLKRS  89

Query  291  LQRFLQKRKNRVQSTSP  241
            ++ FL+KRK R +S +P
Sbjct  90   VKSFLEKRKKRNKSFAP  106



>emb|CDY24300.1| BnaC03g42730D [Brassica napus]
Length=122

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 7/74 (9%)
 Frame = -2

Query  462  FYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSLQR  283
            F +GK+   D+ E Q RAII +AS+ER      +L  +P+ L+    SP   S+K S++ 
Sbjct  40   FSNGKVREHDLVEFQIRAIIEMASKERG---ITALELAPMRLE----SPLVFSLKRSVKS  92

Query  282  FLQKRKNRVQSTSP  241
            FL+KRK R +S +P
Sbjct  93   FLEKRKKRNKSFAP  106



>ref|XP_007142558.1| hypothetical protein PHAVU_008G290900g [Phaseolus vulgaris]
 gb|ESW14552.1| hypothetical protein PHAVU_008G290900g [Phaseolus vulgaris]
Length=98

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 6/79 (8%)
 Frame = -2

Query  468  TIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASSPLLLQKQLYSPNALSMKGSL  289
             I ++ +    D TE+QARAII LAS+E  + +  SL S  LL+     SP+ LS+K SL
Sbjct  25   AILHNERHCIFDTTELQARAIIWLASREMVENS--SLRSEALLVH---ISPH-LSIKKSL  78

Query  288  QRFLQKRKNRVQSTSPYHR  232
            Q FLQ+R  R  S    H+
Sbjct  79   QNFLQRRNKRKSSQRNNHK  97



>ref|XP_009390857.1| PREDICTED: protein TIFY 10A-like [Musa acuminata subsp. malaccensis]
Length=209

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 6/81 (7%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQ-ARAIILLASQERTKKTTRSLASSPLLLQKQL-YSPNALSMK  298
            LTIFY GK++  D   ++ A+ +  LAS  R   T ++  + P   Q  L Y P  ++ K
Sbjct  105  LTIFYGGKVLVFDNFPLEKAKDLFQLAS--RGNSTAQNFGNLPRTAQPNLSYLP--IARK  160

Query  297  GSLQRFLQKRKNRVQSTSPYH  235
             SLQRFL+KRK+R+ S +PY 
Sbjct  161  VSLQRFLEKRKDRIHSRAPYQ  181



>ref|XP_010495178.1| PREDICTED: protein TIFY 9-like [Camelina sativa]
Length=170

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 11/90 (12%)
 Frame = -2

Query  471  LTIFYDGKIVSSDVTEIQARAIILLASQERTKKTTRSLASS------PLLLQKQLYSPN-  313
            +TIFY+G +    V+  +A  I+ +A +    K   S   +      P  L+ +L+  N 
Sbjct  76   MTIFYNGTVSVYQVSRNKAEEIMKVAKETTVSKKDESSTETDLSVITPTTLRPKLFGQNL  135

Query  312  ----ALSMKGSLQRFLQKRKNRVQSTSPYH  235
                 ++ + SLQRFL+KRK RV STSPY+
Sbjct  136  EGDLPIARRKSLQRFLEKRKERVISTSPYY  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1590667407420