BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c90340_g1_i1 len=1067 path=[1045:0-1066]

Length=1067
                                                                      Score     E

dbj|BAO02522.1|  (1-2)-alpha-L-fucosidase ortholog                      273   1e-83   
ref|XP_009614380.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     275   1e-82   
ref|XP_009768592.1|  PREDICTED: GDSL esterase/lipase At3g48460-li...    272   1e-82   
ref|XP_009768591.1|  PREDICTED: GDSL esterase/lipase At3g48460-li...    271   3e-82   
ref|XP_009768590.1|  PREDICTED: GDSL esterase/lipase At3g48460-li...    271   9e-82   
ref|XP_006341772.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     271   3e-81   
ref|XP_004239496.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     269   5e-81   
gb|KDP26728.1|  hypothetical protein JCGZ_17886                         255   6e-77   
gb|KDO82083.1|  hypothetical protein CISIN_1g047058mg                   249   2e-76   
ref|XP_006438155.1|  hypothetical protein CICLE_v10033695mg             248   1e-75   
gb|KDP42125.1|  hypothetical protein JCGZ_01913                         251   2e-75   
ref|XP_002515022.1|  Alpha-L-fucosidase 2 precursor, putative           248   2e-75   Ricinus communis
ref|XP_002267715.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     241   1e-71   Vitis vinifera
ref|XP_010251345.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     239   1e-71   
ref|XP_009791093.1|  PREDICTED: GDSL esterase/lipase At3g48460          235   4e-70   
ref|XP_006351456.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     234   9e-70   
ref|XP_004236316.1|  PREDICTED: GDSL esterase/lipase At3g48460          234   1e-69   
ref|XP_006484334.1|  PREDICTED: anther-specific proline-rich prot...    239   1e-68   
ref|XP_009596313.1|  PREDICTED: GDSL esterase/lipase At3g48460          230   5e-68   
ref|XP_006440021.1|  hypothetical protein CICLE_v10020570mg             221   1e-64   
ref|XP_006476962.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     221   2e-64   
ref|XP_010911635.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     221   2e-64   
ref|XP_002321669.1|  GDSL-motif lipase/hydrolase family protein         220   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_008439284.1|  PREDICTED: GDSL esterase/lipase At3g48460          218   3e-63   
ref|XP_011024095.1|  PREDICTED: GDSL esterase/lipase At3g48460          217   5e-63   
emb|CDP15060.1|  unnamed protein product                                217   6e-63   
ref|XP_009359493.1|  PREDICTED: GDSL esterase/lipase At3g48460          216   2e-62   
ref|XP_007037866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    215   3e-62   
gb|KHG00751.1|  hypothetical protein F383_21550                         213   2e-61   
ref|XP_008797234.1|  PREDICTED: GDSL esterase/lipase At3g48460          213   2e-61   
ref|XP_008392856.1|  PREDICTED: GDSL esterase/lipase At3g48460          213   3e-61   
ref|XP_008393854.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     211   7e-61   
gb|KHN14076.1|  GDSL esterase/lipase                                    210   1e-60   
ref|XP_003608902.1|  GDSL esterase/lipase                               210   2e-60   
ref|XP_003549836.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     210   2e-60   
ref|XP_007209226.1|  hypothetical protein PRUPE_ppa006897mg             210   3e-60   
ref|XP_011072984.1|  PREDICTED: GDSL esterase/lipase At3g48460          210   3e-60   
ref|XP_008239404.1|  PREDICTED: GDSL esterase/lipase At3g48460          210   3e-60   
gb|AES91099.2|  GDSL-like lipase/acylhydrolase                          208   8e-60   
gb|ACU17921.1|  unknown                                                 208   1e-59   Glycine max [soybeans]
ref|XP_007155513.1|  hypothetical protein PHAVU_003G208000g             207   2e-59   
ref|XP_011084056.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     207   2e-59   
ref|XP_004152509.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     208   2e-59   
ref|XP_009333827.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     207   4e-59   
ref|XP_002274810.1|  PREDICTED: GDSL esterase/lipase At3g48460          206   5e-59   Vitis vinifera
emb|CBI14877.3|  unnamed protein product                                207   8e-59   
ref|XP_010250902.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     206   9e-59   
ref|XP_002511260.1|  Esterase precursor, putative                       206   1e-58   Ricinus communis
gb|KHN34384.1|  GDSL esterase/lipase                                    204   3e-58   
ref|XP_003525626.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     204   3e-58   
ref|XP_004515840.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     204   4e-58   
gb|EYU40119.1|  hypothetical protein MIMGU_mgv1a021460mg                204   4e-58   
ref|XP_010248800.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     204   1e-57   
ref|XP_009385138.1|  PREDICTED: GDSL esterase/lipase At3g48460          197   1e-55   
ref|XP_010696197.1|  PREDICTED: GDSL esterase/lipase At3g48460          198   2e-55   
ref|XP_010101939.1|  GDSL esterase/lipase                               196   4e-55   
gb|ADN33970.1|  lipase                                                  195   7e-55   
emb|CBI27521.3|  unnamed protein product                                191   7e-55   
gb|EYU40122.1|  hypothetical protein MIMGU_mgv1a007918mg                194   2e-54   
ref|XP_008361146.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    188   7e-54   
ref|XP_004301038.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     190   5e-53   
emb|CAN62554.1|  hypothetical protein VITISV_031355                     191   6e-53   Vitis vinifera
gb|KDP22802.1|  hypothetical protein JCGZ_00389                         190   2e-52   
ref|XP_010550714.1|  PREDICTED: GDSL esterase/lipase At3g48460          187   1e-51   
gb|EEE60284.1|  hypothetical protein OsJ_13340                          186   1e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010100310.1|  GDSL esterase/lipase                               181   2e-51   
gb|EYU40388.1|  hypothetical protein MIMGU_mgv1a008158mg                187   2e-51   
ref|NP_001051872.1|  Os03g0844600                                       186   3e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EAY92552.1|  hypothetical protein OsI_14292                          186   3e-51   Oryza sativa Indica Group [Indian rice]
gb|EPS63670.1|  hypothetical protein M569_11113                         185   3e-51   
ref|XP_010027288.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     180   7e-50   
ref|XP_002318700.2|  hypothetical protein POPTR_0012s09490g             180   9e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010503477.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     182   9e-50   
ref|XP_010026792.1|  PREDICTED: GDSL esterase/lipase At3g48460          181   3e-49   
ref|XP_010515164.1|  PREDICTED: GDSL esterase/lipase At3g48460          181   3e-49   
ref|XP_006650886.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     179   9e-49   
emb|CDY37927.1|  BnaA06g18900D                                          179   2e-48   
ref|XP_002875905.1|  GDSL-motif lipase/hydrolase family protein         178   2e-48   
ref|XP_009150194.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     178   3e-48   
ref|XP_006852134.1|  hypothetical protein AMTR_s00049p00054830          177   3e-48   
ref|XP_006404256.1|  hypothetical protein EUTSA_v10010448mg             178   4e-48   
ref|NP_190416.1|  GDSL esterase/lipase                                  177   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291232.1|  hypothetical protein CARUB_v10017363mg             177   7e-48   
gb|AGT16586.1|  hypothetical protein SHCRBa_109_M04_R_50                177   7e-48   
ref|XP_010426341.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     177   7e-48   
emb|CDY08074.1|  BnaA06g16520D                                          176   2e-47   
ref|XP_009149816.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     176   2e-47   
gb|KFK34151.1|  gdsl esterase lipase                                    176   2e-47   
ref|XP_004981071.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     176   3e-47   
emb|CDY39587.1|  BnaCnng09560D                                          175   4e-47   
ref|XP_003562455.1|  PREDICTED: GDSL esterase/lipase At3g48460          176   4e-47   
emb|CDX77910.1|  BnaC03g53090D                                          175   5e-47   
ref|XP_002463534.1|  hypothetical protein SORBIDRAFT_01g001540          173   3e-46   Sorghum bicolor [broomcorn]
gb|ACU18341.1|  unknown                                                 164   7e-45   Glycine max [soybeans]
dbj|BAJ87991.1|  predicted protein                                      166   6e-44   
dbj|BAJ88861.1|  predicted protein                                      166   7e-44   
ref|XP_004964803.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    157   1e-40   
ref|XP_002439448.1|  hypothetical protein SORBIDRAFT_09g006570          157   2e-40   Sorghum bicolor [broomcorn]
ref|XP_010557579.1|  PREDICTED: GDSL esterase/lipase At5g03980          156   3e-40   
ref|XP_004960620.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     154   1e-39   
ref|XP_004964802.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    154   2e-39   
dbj|BAD69424.1|  putative lipase                                        152   7e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011036871.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     150   7e-39   
ref|NP_001056858.1|  Os06g0157000                                       152   8e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141565.1|  uncharacterized protein LOC100273681               152   1e-38   Zea mays [maize]
gb|ACG38031.1|  alpha-L-fucosidase 2 precursor                          152   1e-38   Zea mays [maize]
gb|EEE65121.1|  hypothetical protein OsJ_20187                          152   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008777733.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     152   2e-38   
dbj|BAJ99814.1|  predicted protein                                      150   2e-38   
gb|EMT16610.1|  GDSL esterase/lipase                                    151   2e-38   
dbj|BAJ97605.1|  predicted protein                                      150   3e-38   
ref|XP_003564307.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     150   3e-38   
ref|XP_006449476.1|  hypothetical protein CICLE_v10015707mg             150   3e-38   
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     150   4e-38   
gb|EAY96951.1|  hypothetical protein OsI_18870                          150   4e-38   Oryza sativa Indica Group [Indian rice]
gb|AAS91011.1|  putative lipase                                         150   4e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961580.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    150   5e-38   
ref|NP_001054912.2|  Os05g0209600                                       150   5e-38   Oryza sativa Japonica Group [Japonica rice]
gb|KDO77812.1|  hypothetical protein CISIN_1g018031mg                   148   6e-38   
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     150   7e-38   
ref|XP_006467672.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     149   7e-38   
dbj|BAJ97092.1|  predicted protein                                      150   7e-38   
gb|KHN08453.1|  GDSL esterase/lipase                                    148   8e-38   
ref|XP_010912585.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     150   9e-38   
ref|XP_006654152.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     149   9e-38   
ref|XP_008777731.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     150   1e-37   
ref|NP_001149411.1|  esterase precursor                                 149   1e-37   Zea mays [maize]
gb|ACF87885.1|  unknown                                                 149   1e-37   Zea mays [maize]
ref|XP_004960619.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     149   1e-37   
ref|XP_003568743.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     149   1e-37   
ref|XP_010241274.1|  PREDICTED: acetylajmalan esterase-like             149   2e-37   
ref|NP_001168581.1|  hypothetical protein precursor                     149   2e-37   Zea mays [maize]
ref|XP_004963669.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     149   2e-37   
gb|EMT16237.1|  GDSL esterase/lipase                                    149   2e-37   
ref|XP_006655809.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     147   2e-37   
ref|XP_002437861.1|  hypothetical protein SORBIDRAFT_10g003930          148   2e-37   Sorghum bicolor [broomcorn]
gb|KDO77809.1|  hypothetical protein CISIN_1g018031mg                   148   3e-37   
ref|XP_008671733.1|  PREDICTED: uncharacterized protein LOC100191...    149   3e-37   
ref|XP_002453668.1|  hypothetical protein SORBIDRAFT_04g010100          148   3e-37   Sorghum bicolor [broomcorn]
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     149   3e-37   
ref|NP_001242505.1|  uncharacterized protein LOC100815771 precursor     148   4e-37   
ref|XP_010231603.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     148   4e-37   
ref|XP_006286793.1|  hypothetical protein CARUB_v10003448mg             146   4e-37   
ref|XP_004971993.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     147   4e-37   
ref|XP_008812188.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     147   5e-37   
ref|XP_006382478.1|  hypothetical protein POPTR_0005s02510g             147   5e-37   
ref|XP_008658948.1|  PREDICTED: uncharacterized protein LOC100501...    147   5e-37   
ref|XP_006828268.1|  hypothetical protein AMTR_s00023p00212280          147   5e-37   
ref|XP_009615529.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     147   6e-37   
ref|XP_006844513.1|  hypothetical protein AMTR_s00016p00145970          147   6e-37   
ref|XP_003593742.1|  GDSL esterase/lipase                               147   7e-37   
ref|XP_010042460.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     141   8e-37   
ref|XP_006382477.1|  hypothetical protein POPTR_0005s02500g             147   9e-37   
ref|XP_004966154.1|  PREDICTED: acetylajmalan esterase-like             147   9e-37   
ref|XP_006656659.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     147   1e-36   
ref|XP_006398857.1|  hypothetical protein EUTSA_v10015547mg             145   1e-36   
ref|XP_006398909.1|  hypothetical protein EUTSA_v10015988mg             145   1e-36   
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    147   1e-36   
gb|EAZ15955.1|  hypothetical protein OsJ_31400                          146   1e-36   Oryza sativa Japonica Group [Japonica rice]
emb|CDO96755.1|  unnamed protein product                                146   2e-36   
ref|XP_010231604.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     146   2e-36   
gb|AFW85778.1|  hypothetical protein ZEAMMB73_678347                    146   2e-36   
ref|NP_001054913.1|  Os05g0210100                                       146   2e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EEE54108.1|  hypothetical protein OsJ_00868                          145   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064517.1|  Os10g0392900                                       146   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010251983.1|  PREDICTED: acetylajmalan esterase-like             145   3e-36   
ref|XP_006656658.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     145   3e-36   
ref|XP_002439450.1|  hypothetical protein SORBIDRAFT_09g006590          145   3e-36   Sorghum bicolor [broomcorn]
gb|EAZ37226.1|  hypothetical protein OsJ_21564                          145   4e-36   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK05475.1|  predicted protein                                      145   4e-36   
ref|XP_003546024.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     145   4e-36   
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     145   5e-36   
ref|XP_004952371.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     145   5e-36   
ref|XP_010052211.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     144   5e-36   
ref|XP_004251965.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     144   6e-36   
ref|NP_001057786.1|  Os06g0531900                                       145   6e-36   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK01308.1|  predicted protein                                      144   6e-36   
gb|EEC70166.1|  hypothetical protein OsI_00887                          145   6e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_010251328.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     144   8e-36   
gb|EMT32479.1|  GDSL esterase/lipase                                    143   8e-36   
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     144   8e-36   
dbj|BAJ90120.1|  predicted protein                                      144   9e-36   
gb|EMT23758.1|  GDSL esterase/lipase                                    144   1e-35   
ref|XP_009383158.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     144   1e-35   
gb|ABL11233.1|  UCW116, putative lipase                                 144   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90380.1|  predicted protein                                      144   1e-35   
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     144   1e-35   
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    144   1e-35   
ref|NP_001172233.1|  Os01g0216900                                       144   2e-35   
gb|EAZ01210.1|  hypothetical protein OsI_23235                          143   2e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_002299039.1|  hypothetical protein POPTR_0001s46820g             143   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_007148063.1|  hypothetical protein PHAVU_006G177400g             143   2e-35   
gb|AFW69252.1|  alpha-L-fucosidase 2                                    144   2e-35   
ref|XP_003564303.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     143   2e-35   
ref|XP_006655093.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     143   2e-35   
ref|XP_007212730.1|  hypothetical protein PRUPE_ppa019092mg             143   3e-35   
ref|XP_002436507.1|  hypothetical protein SORBIDRAFT_10g003900          143   3e-35   Sorghum bicolor [broomcorn]
ref|NP_001147763.1|  esterase precursor                                 143   3e-35   Zea mays [maize]
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     143   4e-35   
emb|CDY30822.1|  BnaC05g21980D                                          143   4e-35   
ref|XP_004966744.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     142   4e-35   
ref|XP_004964800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     142   4e-35   
ref|XP_008225209.1|  PREDICTED: GDSL esterase/lipase At5g45910          142   4e-35   
ref|NP_001132224.1|  alpha-L-fucosidase 2 precursor                     142   4e-35   Zea mays [maize]
ref|XP_009352808.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     142   5e-35   
ref|XP_010929733.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     142   6e-35   
ref|XP_006656143.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     142   7e-35   
ref|XP_004971763.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     141   8e-35   
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                     141   8e-35   
ref|XP_010918534.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    142   8e-35   
ref|XP_008655072.1|  PREDICTED: LOC100284848 isoform X1                 141   8e-35   
ref|NP_001054914.2|  Os05g0210400                                       142   9e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     141   9e-35   
ref|NP_001151231.1|  alpha-L-fucosidase 2 precursor                     141   1e-34   Zea mays [maize]
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    141   1e-34   
ref|XP_002439451.1|  hypothetical protein SORBIDRAFT_09g006600          141   2e-34   Sorghum bicolor [broomcorn]
ref|XP_003577537.1|  PREDICTED: acetylajmalan esterase                  140   2e-34   
ref|XP_010041182.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     140   2e-34   
ref|XP_008791125.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     140   2e-34   
dbj|BAK07773.1|  predicted protein                                      140   2e-34   
ref|NP_001168439.1|  uncharacterized protein LOC100382211               139   2e-34   Zea mays [maize]
gb|KDP21068.1|  hypothetical protein JCGZ_21539                         140   2e-34   
ref|XP_010915611.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    140   2e-34   
ref|XP_010918532.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    142   2e-34   
ref|XP_010918533.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    141   2e-34   
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     140   2e-34   
ref|XP_004968628.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     140   2e-34   
ref|NP_001056855.1|  Os06g0156600                                       140   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004248464.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    140   3e-34   
ref|XP_011086014.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     140   3e-34   
ref|XP_003560500.1|  PREDICTED: acetylajmalan esterase-like             140   3e-34   
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600          140   3e-34   
ref|XP_006662321.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     140   3e-34   
ref|XP_010912632.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    140   3e-34   
ref|NP_001042396.1|  Os01g0215700                                       140   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     140   3e-34   
ref|NP_001151215.1|  LOC100284848 precursor                             140   3e-34   Zea mays [maize]
gb|ACF83155.1|  unknown                                                 140   3e-34   Zea mays [maize]
gb|KCW63215.1|  hypothetical protein EUGRSUZ_G00835                     139   4e-34   
ref|NP_001140937.1|  hypothetical protein                               140   4e-34   Zea mays [maize]
ref|XP_007212863.1|  hypothetical protein PRUPE_ppa021567mg             140   4e-34   
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                     139   4e-34   
gb|EEE54111.1|  hypothetical protein OsJ_00875                          139   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     139   4e-34   
ref|XP_009782266.1|  PREDICTED: acetylajmalan esterase-like             139   4e-34   
dbj|BAA94228.1|  putative esterase                                      139   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010042817.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     134   5e-34   
ref|NP_001152155.1|  esterase precursor                                 140   5e-34   Zea mays [maize]
ref|XP_002455947.1|  hypothetical protein SORBIDRAFT_03g027770          140   5e-34   Sorghum bicolor [broomcorn]
gb|EEC71081.1|  hypothetical protein OsI_02841                          140   5e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_006382474.1|  hypothetical protein POPTR_0005s02480g             139   5e-34   
ref|XP_011096421.1|  PREDICTED: GDSL esterase/lipase At5g45910          139   5e-34   
ref|XP_004971765.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     139   5e-34   
ref|XP_009416172.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     139   5e-34   
ref|XP_009629651.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    139   6e-34   
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850          139   6e-34   Sorghum bicolor [broomcorn]
ref|XP_010925692.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     139   6e-34   
gb|ACG28261.1|  alpha-L-fucosidase 2 precursor                          139   6e-34   Zea mays [maize]
gb|EAZ12674.1|  hypothetical protein OsJ_02589                          140   6e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643905.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     139   6e-34   
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     139   7e-34   
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     139   7e-34   
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     139   7e-34   
ref|XP_011039366.1|  PREDICTED: acetylajmalan esterase-like             139   7e-34   
ref|XP_008806794.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     139   7e-34   
ref|XP_010052212.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     139   7e-34   
ref|NP_001042390.1|  Os01g0214600                                       138   8e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     139   8e-34   
ref|XP_009122651.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    138   8e-34   
gb|ACR36611.1|  unknown                                                 135   8e-34   Zea mays [maize]
ref|XP_004963464.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     139   8e-34   
ref|XP_010915610.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    139   8e-34   
emb|CAG27610.1|  esterase                                               139   8e-34   Alopecurus myosuroides
ref|XP_009757390.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     139   9e-34   
dbj|BAK06896.1|  predicted protein                                      139   9e-34   
ref|XP_009608978.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     139   9e-34   
ref|XP_003564306.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     139   1e-33   
ref|XP_008655208.1|  PREDICTED: uncharacterized protein LOC100382...    139   1e-33   
ref|XP_004968644.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     138   1e-33   
ref|XP_004968622.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     138   1e-33   
ref|XP_004971762.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     138   1e-33   
gb|KCW76151.1|  hypothetical protein EUGRSUZ_D00528                     135   1e-33   
ref|XP_004957689.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     138   1e-33   
gb|AFW80395.1|  esterase                                                138   1e-33   
ref|NP_001150078.1|  esterase                                           138   1e-33   
ref|NP_001149156.1|  esterase precursor                                 138   1e-33   
emb|CDP09073.1|  unnamed protein product                                138   1e-33   
gb|EAZ11025.1|  hypothetical protein OsJ_00869                          137   2e-33   
ref|XP_004965533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     138   2e-33   
ref|NP_001056856.1|  Os06g0156700                                       138   2e-33   
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg             138   2e-33   
ref|XP_004485879.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     138   2e-33   
ref|XP_002457139.1|  hypothetical protein SORBIDRAFT_03g001870          138   2e-33   
ref|XP_002457140.1|  hypothetical protein SORBIDRAFT_03g001880          137   2e-33   
ref|XP_002438501.1|  hypothetical protein SORBIDRAFT_10g020950          138   2e-33   
ref|XP_009784633.1|  PREDICTED: GDSL esterase/lipase At5g45910          137   2e-33   
gb|KHG30334.1|  hypothetical protein F383_10781                         137   2e-33   
gb|EMT15617.1|  GDSL esterase/lipase                                    137   3e-33   
emb|CDY43308.1|  BnaC03g58800D                                          138   3e-33   
emb|CDM83418.1|  unnamed protein product                                138   3e-33   
ref|XP_008655207.1|  PREDICTED: uncharacterized protein LOC100382...    137   3e-33   
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     137   3e-33   
dbj|BAJ86410.1|  predicted protein                                      137   3e-33   
emb|CDY30819.1|  BnaC05g21950D                                          137   3e-33   
gb|ACF85857.1|  unknown                                                 137   3e-33   
gb|ACN30561.1|  unknown                                                 137   3e-33   
gb|KHN08454.1|  GDSL esterase/lipase                                    140   4e-33   
ref|NP_001152399.1|  alpha-L-fucosidase 2 precursor                     137   4e-33   
ref|XP_006646093.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     137   4e-33   
ref|XP_006656415.1|  PREDICTED: acetylajmalan esterase-like             137   4e-33   
ref|XP_008785278.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     137   4e-33   
gb|EMT19408.1|  GDSL esterase/lipase                                    136   4e-33   
dbj|BAJ97312.1|  predicted protein                                      137   4e-33   
ref|NP_001176564.1|  Os11g0521000                                       137   5e-33   
ref|XP_009786912.1|  PREDICTED: acetylajmalan esterase-like             136   5e-33   
gb|EMT23216.1|  GDSL esterase/lipase                                    137   5e-33   
emb|CDP16034.1|  unnamed protein product                                135   5e-33   
ref|XP_007025434.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    136   5e-33   
emb|CDM82009.1|  unnamed protein product                                136   6e-33   
gb|EMT01787.1|  GDSL esterase/lipase                                    136   6e-33   
ref|NP_001142390.1|  Zea nodulation homolog1 precursor                  136   6e-33   
ref|XP_006828273.1|  hypothetical protein AMTR_s00023p00217880          136   7e-33   
ref|NP_001042391.1|  Os01g0214800                                       136   7e-33   
ref|XP_010915608.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     136   7e-33   
ref|XP_008783975.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     136   7e-33   
gb|EMT02424.1|  GDSL esterase/lipase                                    135   7e-33   
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     136   8e-33   
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878    140   8e-33   
ref|XP_009414900.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     136   9e-33   
ref|XP_006643906.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     136   9e-33   
emb|CDO98569.1|  unnamed protein product                                135   1e-32   
gb|EMT01788.1|  GDSL esterase/lipase                                    135   1e-32   
ref|XP_006367777.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     135   1e-32   
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     135   1e-32   
dbj|BAJ86481.1|  predicted protein                                      136   1e-32   
gb|KCW44565.1|  hypothetical protein EUGRSUZ_L01922                     135   1e-32   
ref|XP_008673524.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     135   1e-32   
ref|XP_010052214.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     135   1e-32   
ref|XP_006483686.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     133   1e-32   
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078             135   2e-32   
dbj|BAK05242.1|  predicted protein                                      135   2e-32   
emb|CDX70269.1|  BnaA10g26180D                                          134   2e-32   
emb|CDP21061.1|  unnamed protein product                                135   2e-32   
dbj|BAK05927.1|  predicted protein                                      135   2e-32   
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924    139   2e-32   
gb|EMT25207.1|  GDSL esterase/lipase                                    135   2e-32   
ref|XP_009627361.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    135   2e-32   
gb|ADQ08656.1|  GDSL-lipase                                             135   2e-32   
ref|XP_002305752.2|  GDSL-motif lipase/hydrolase family protein         135   2e-32   
emb|CDY41414.1|  BnaCnng10500D                                          134   2e-32   
ref|XP_009608031.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    134   2e-32   
ref|NP_001151338.1|  LOC100284971 precursor                             135   2e-32   
ref|XP_003565496.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     135   2e-32   
gb|ADQ08655.1|  GDSL-lipase                                             135   2e-32   
dbj|BAK01569.1|  predicted protein                                      135   2e-32   
ref|XP_011027710.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     135   2e-32   
dbj|BAJ85333.1|  predicted protein                                      134   2e-32   
ref|XP_003565527.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     134   2e-32   
gb|EPS71267.1|  hypothetical protein M569_03493                         135   3e-32   
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     135   3e-32   
emb|CDP02931.1|  unnamed protein product                                134   3e-32   
ref|XP_002454933.1|  hypothetical protein SORBIDRAFT_03g001670          134   3e-32   
emb|CDX94634.1|  BnaC07g10240D                                          135   3e-32   
dbj|BAA94236.1|  putative esterase                                      134   3e-32   
ref|NP_001149136.1|  alpha-L-fucosidase 2 precursor                     135   3e-32   
ref|XP_003593737.1|  GDSL esterase/lipase                               134   3e-32   
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580          134   4e-32   
ref|NP_001132231.1|  uncharacterized protein LOC100193666 precursor     134   4e-32   
ref|XP_008649840.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    134   4e-32   
emb|CDO96749.1|  unnamed protein product                                134   4e-32   
ref|XP_008654982.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1         135   4e-32   
gb|ACL53525.1|  unknown                                                 135   4e-32   
gb|AFW76565.1|  hypothetical protein ZEAMMB73_187768                    134   4e-32   
ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     134   5e-32   
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...    134   5e-32   
ref|XP_004144819.1|  PREDICTED: acetylajmalan esterase-like             134   5e-32   
sp|P0C8Z7.1|GDL91_ARATH  RecName: Full=GDSL esterase/lipase At1g2...    134   5e-32   
gb|EEC80045.1|  hypothetical protein OsI_21742                          134   5e-32   
emb|CDM82194.1|  unnamed protein product                                134   5e-32   
tpg|DAA52848.1|  TPA: hypothetical protein ZEAMMB73_895572              134   5e-32   
ref|XP_002267222.2|  PREDICTED: GDSL esterase/lipase At5g45910          134   5e-32   
gb|KCW76148.1|  hypothetical protein EUGRSUZ_D00525                     134   6e-32   
gb|KCW64327.1|  hypothetical protein EUGRSUZ_G01959                     134   6e-32   
ref|XP_010066434.1|  PREDICTED: acetylajmalan esterase                  134   6e-32   
ref|NP_001042393.2|  Os01g0215000                                       134   6e-32   
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     134   6e-32   
dbj|BAH01022.1|  unnamed protein product                                133   7e-32   
ref|XP_010915606.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     133   7e-32   
ref|XP_006853138.1|  hypothetical protein AMTR_s00038p00165200          137   7e-32   
gb|EAY98628.1|  hypothetical protein OsI_20553                          133   7e-32   
gb|EEE62726.1|  hypothetical protein OsJ_17529                          133   7e-32   
dbj|BAJ99647.1|  predicted protein                                      133   8e-32   
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     134   8e-32   
ref|XP_002450809.1|  hypothetical protein SORBIDRAFT_05g018910          133   9e-32   
ref|XP_004171165.1|  PREDICTED: acetylajmalan esterase-like             132   9e-32   
emb|CDO98571.1|  unnamed protein product                                132   1e-31   
ref|XP_010925693.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    133   1e-31   
ref|XP_010241275.1|  PREDICTED: acetylajmalan esterase-like             133   1e-31   
ref|NP_973931.1|  GDSL esterase/lipase                                  131   2e-31   
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     132   2e-31   
ref|XP_009413940.1|  PREDICTED: uncharacterized protein LOC103995136    135   2e-31   
dbj|BAD61220.1|  lanatoside 15'-O-acetylesterase-like                   132   2e-31   
ref|XP_004296391.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     132   2e-31   
ref|XP_003637203.1|  GDSL esterase/lipase                               132   2e-31   
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     133   2e-31   
emb|CDP15821.1|  unnamed protein product                                132   2e-31   
ref|XP_004230198.1|  PREDICTED: GDSL esterase/lipase At5g03980          132   2e-31   
ref|XP_006663479.1|  PREDICTED: acetylajmalan esterase-like             132   2e-31   
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     132   2e-31   
gb|KHG23842.1|  hypothetical protein F383_29871                         132   2e-31   
gb|EAY81107.1|  hypothetical protein OsI_36286                          132   2e-31   
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    132   2e-31   
ref|XP_007217900.1|  hypothetical protein PRUPE_ppa012875mg             126   2e-31   
ref|XP_009411654.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     132   2e-31   
gb|EAZ18532.1|  hypothetical protein OsJ_34061                          132   2e-31   
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                     132   2e-31   
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     132   3e-31   
ref|NP_174185.2|  GDSL esterase/lipase                                  132   3e-31   
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg             132   3e-31   
ref|XP_010915607.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     132   3e-31   
gb|EMT22154.1|  GDSL esterase/lipase                                    132   4e-31   
gb|AFK42362.1|  unknown                                                 131   4e-31   
ref|XP_004234095.1|  PREDICTED: GDSL esterase/lipase At5g45910          131   4e-31   
ref|XP_002454932.1|  hypothetical protein SORBIDRAFT_03g001650          131   4e-31   
ref|NP_174179.3|  GDSL esterase/lipase                                  131   4e-31   
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479    135   4e-31   
emb|CDX90162.1|  BnaA08g18220D                                          131   4e-31   
dbj|BAD73016.1|  putative esterase                                      132   4e-31   
ref|NP_001058440.1|  Os06g0694200                                       131   4e-31   
ref|XP_004170182.1|  PREDICTED: GDSL esterase/lipase At4g01130-like     131   4e-31   
gb|KGN45708.1|  hypothetical protein Csa_6G007420                       132   4e-31   
gb|KHG07034.1|  Acetylajmalan esterase                                  131   5e-31   
ref|XP_006643907.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     131   5e-31   
ref|NP_174180.1|  GDSL esterase/lipase                                  131   5e-31   
gb|EAZ27028.1|  hypothetical protein OsJ_10957                          131   6e-31   
ref|XP_008783909.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     130   6e-31   
emb|CDY15655.1|  BnaA07g08260D                                          130   8e-31   
ref|NP_001042399.1|  Os01g0216400                                       130   8e-31   
dbj|BAK05007.1|  predicted protein                                      130   8e-31   
dbj|BAJ98970.1|  predicted protein                                      130   8e-31   
gb|EYU34358.1|  hypothetical protein MIMGU_mgv1a024690mg                128   9e-31   
ref|XP_008783973.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     130   9e-31   
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     130   9e-31   
dbj|BAK07356.1|  predicted protein                                      130   9e-31   
emb|CBI30663.3|  unnamed protein product                                134   1e-30   
ref|XP_010277743.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     130   1e-30   
ref|XP_009602651.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    130   1e-30   
gb|EAZ02202.1|  hypothetical protein OsI_24297                          130   1e-30   
ref|XP_008673536.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    130   1e-30   
ref|XP_009629822.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     130   1e-30   
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     130   1e-30   
gb|KFK31510.1|  hypothetical protein AALP_AA6G122100                    130   1e-30   
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     130   1e-30   
ref|XP_009613369.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    130   1e-30   
ref|XP_002873127.1|  GDSL-motif lipase/hydrolase family protein         129   2e-30   
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     129   2e-30   
ref|NP_001055986.1|  Os05g0506600                                       129   2e-30   
ref|XP_006844517.1|  hypothetical protein AMTR_s00016p00148320          129   2e-30   
ref|XP_007030130.1|  SGNH hydrolase-type esterase superfamily pro...    129   2e-30   
gb|EMT16276.1|  GDSL esterase/lipase                                    128   2e-30   
ref|XP_009421256.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   2e-30   
gb|AAF24544.2|AC007508_7  F1K23.13                                      134   2e-30   
gb|EAZ38126.1|  hypothetical protein OsJ_22475                          129   2e-30   
gb|AES71053.2|  GDSL-like lipase/acylhydrolase                          129   2e-30   
ref|XP_010672326.1|  PREDICTED: acetylajmalan esterase-like             129   2e-30   
ref|XP_002452237.1|  hypothetical protein SORBIDRAFT_04g022180          129   2e-30   
gb|EAY85214.1|  hypothetical protein OsI_06576                          129   2e-30   
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     129   2e-30   
ref|XP_003572041.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   2e-30   
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     129   2e-30   
ref|XP_002893540.1|  predicted protein                                  134   2e-30   
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    129   3e-30   
ref|XP_003565495.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   3e-30   
ref|XP_006655466.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   3e-30   
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    129   3e-30   
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     129   3e-30   
ref|NP_174182.1|  GDSL esterase/lipase                                  129   3e-30   
gb|EAY98626.1|  hypothetical protein OsI_20551                          129   3e-30   
ref|XP_007018722.1|  SGNH hydrolase-type esterase superfamily pro...    129   3e-30   
ref|XP_010462953.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     129   3e-30   
ref|XP_006645634.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   3e-30   
ref|XP_007148064.1|  hypothetical protein PHAVU_006G177500g             129   3e-30   
emb|CDX90163.1|  BnaA08g18210D                                          129   4e-30   
gb|EMT23217.1|  GDSL esterase/lipase                                    128   4e-30   
gb|EEE59101.1|  hypothetical protein OsJ_10956                          128   4e-30   
emb|CDM83549.1|  unnamed protein product                                129   4e-30   
gb|ABK25197.1|  unknown                                                 125   4e-30   
ref|NP_196018.1|  GDSL esterase/lipase                                  127   4e-30   
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    128   5e-30   
ref|NP_001050175.1|  Os03g0365800                                       128   5e-30   
ref|NP_001130668.1|  uncharacterized protein LOC100191771 precursor     128   5e-30   
gb|AAM65183.1|  lipase, putative                                        128   5e-30   
ref|XP_003565533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     128   5e-30   
ref|XP_004968627.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    128   6e-30   
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     128   6e-30   
ref|NP_199403.1|  GDSL esterase/lipase                                  128   6e-30   
ref|XP_009352954.1|  PREDICTED: uncharacterized protein LOC103944252    132   6e-30   
ref|XP_003569350.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     128   7e-30   
dbj|BAD19158.1|  lipase-like                                            128   7e-30   
ref|XP_009792971.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     128   7e-30   



>dbj|BAO02522.1| (1-2)-alpha-L-fucosidase ortholog, partial [Nicotiana alata]
Length=449

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/272 (47%), Positives = 186/272 (68%), Gaps = 2/272 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFAIAGST L +E ++     +  W  IPLNFQ+QI WF+K  Q  GC++     CK 
Sbjct  179  GVNFAIAGSTILPKEKFSMKNITNLFWKGIPLNFQTQIDWFNKLKQQMGCTDKTGKSCKP  238

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            +++NALFW+G++GVSDY +I   S+   R ++Q  +   ++L++ +L  GAK+IVVQGLP
Sbjct  239  ELENALFWIGSVGVSDYARIQGSSL-PTRWLTQQSVDQVSRLIEALLGSGAKYIVVQGLP  297

Query  481  PIGCFPVSISSCPPQQ-LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PIGC P+ IS CP +  LD MGC + +N+A+ +HN++LQ+ +ERFRR  P C I+YA+YW
Sbjct  298  PIGCLPLHISLCPLKAALDHMGCAAAVNTAVMVHNQILQRRLERFRRLNPNCHILYADYW  357

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+L I  N   Y F+E  K CCG  GG  NF+ +S+ G+ G   C++P  +ISWDGIHL
Sbjct  358  NAYLTIMMNLKKYQFEEAFKPCCGATGGPLNFNLHSLCGSPGTVSCNNPSKFISWDGIHL  417

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
            + AMN+ + +L LN+ +C+P FSE+V  ++ +
Sbjct  418  TEAMNQKVTDLFLNQGFCQPSFSELVKSRSGM  449



>ref|XP_009614380.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Nicotiana tomentosiformis]
Length=636

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 189/272 (69%), Gaps = 2/272 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFAIAGST L +E ++     +  W  IPLNFQ+QI WF+K  Q  GC++     CKA
Sbjct  366  GVNFAIAGSTILPKEKFSMQNITNLFWKGIPLNFQTQIDWFNKLKQQMGCTDKTGKSCKA  425

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            +++NALFW+G++GVSDY +I   S+   R ++Q  +   ++L++T+L  GAK+IVVQGLP
Sbjct  426  ELENALFWIGSVGVSDYARIQGSSL-PTRWLTQQSVDQVSRLIETLLGSGAKYIVVQGLP  484

Query  481  PIGCFPVSISSCPPQQ-LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PIGC P+ IS CP +  LD MGC + +N+A+ +HN++LQ+ +ERFRR +P C I+YA+YW
Sbjct  485  PIGCLPLHISLCPLKAALDHMGCAAAVNTAVMVHNQILQRRLERFRRLYPNCHILYADYW  544

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+L I  N   Y F+E  K CCG  GG  NF+ +S+ G+ G   C++P  +ISWDGIHL
Sbjct  545  NAYLTILMNLKKYQFEEAFKPCCGATGGPLNFNLHSLCGSPGTVSCNNPSKFISWDGIHL  604

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
            + AMN+ + +L LN+ +C+P FSE+V  ++ +
Sbjct  605  TEAMNQKVTDLFLNQGFCQPSFSELVKSRSGM  636



>ref|XP_009768592.1| PREDICTED: GDSL esterase/lipase At3g48460-like isoform X3 [Nicotiana 
sylvestris]
Length=513

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/272 (47%), Positives = 187/272 (69%), Gaps = 2/272 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFAIAGST L +E ++     +  W  IPLNFQ+QI WF+K  Q  GC++ +   CK 
Sbjct  243  GVNFAIAGSTILPKEKFSMQNITNLFWKGIPLNFQTQIDWFNKLKQQMGCTDKSGKSCKP  302

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            +++NALFW+G++GVSDY +I   S+   R ++Q  +   ++L++ +L  GAK+IVVQGLP
Sbjct  303  ELENALFWIGSVGVSDYARIQGSSL-PTRWLTQQSVDQVSKLIEALLGSGAKYIVVQGLP  361

Query  481  PIGCFPVSISSCPPQQ-LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PIGC P+ IS CP +  LD MGC + +N+A+ +HN++LQ+ +ERFRR  P C I+YA+YW
Sbjct  362  PIGCLPLHISLCPLKAALDHMGCAAAVNTAVMVHNQILQRRLERFRRLNPNCHILYADYW  421

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+L I  N   Y F+E  K CCG  GG  NF+ +S+ G+ G   C++P  +ISWDGIHL
Sbjct  422  NAYLTIMMNLKKYQFEEAFKPCCGATGGPLNFNLHSLCGSPGTVSCNNPSKFISWDGIHL  481

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
            + AMN+ + +L LN+ +C+P FSE+V  ++ +
Sbjct  482  TEAMNQKVTDLFLNQGFCQPSFSELVKSRSGM  513



>ref|XP_009768591.1| PREDICTED: GDSL esterase/lipase At3g48460-like isoform X2 [Nicotiana 
sylvestris]
Length=547

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/272 (47%), Positives = 187/272 (69%), Gaps = 2/272 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFAIAGST L +E ++     +  W  IPLNFQ+QI WF+K  Q  GC++ +   CK 
Sbjct  277  GVNFAIAGSTILPKEKFSMQNITNLFWKGIPLNFQTQIDWFNKLKQQMGCTDKSGKSCKP  336

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            +++NALFW+G++GVSDY +I   S+   R ++Q  +   ++L++ +L  GAK+IVVQGLP
Sbjct  337  ELENALFWIGSVGVSDYARIQGSSL-PTRWLTQQSVDQVSKLIEALLGSGAKYIVVQGLP  395

Query  481  PIGCFPVSISSCPPQQ-LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PIGC P+ IS CP +  LD MGC + +N+A+ +HN++LQ+ +ERFRR  P C I+YA+YW
Sbjct  396  PIGCLPLHISLCPLKAALDHMGCAAAVNTAVMVHNQILQRRLERFRRLNPNCHILYADYW  455

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+L I  N   Y F+E  K CCG  GG  NF+ +S+ G+ G   C++P  +ISWDGIHL
Sbjct  456  NAYLTIMMNLKKYQFEEAFKPCCGATGGPLNFNLHSLCGSPGTVSCNNPSKFISWDGIHL  515

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
            + AMN+ + +L LN+ +C+P FSE+V  ++ +
Sbjct  516  TEAMNQKVTDLFLNQGFCQPSFSELVKSRSGM  547



>ref|XP_009768590.1| PREDICTED: GDSL esterase/lipase At3g48460-like isoform X1 [Nicotiana 
sylvestris]
Length=583

 Score =   271 bits (694),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/272 (47%), Positives = 187/272 (69%), Gaps = 2/272 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFAIAGST L +E ++     +  W  IPLNFQ+QI WF+K  Q  GC++ +   CK 
Sbjct  313  GVNFAIAGSTILPKEKFSMQNITNLFWKGIPLNFQTQIDWFNKLKQQMGCTDKSGKSCKP  372

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            +++NALFW+G++GVSDY +I   S+   R ++Q  +   ++L++ +L  GAK+IVVQGLP
Sbjct  373  ELENALFWIGSVGVSDYARIQGSSL-PTRWLTQQSVDQVSKLIEALLGSGAKYIVVQGLP  431

Query  481  PIGCFPVSISSCPPQQ-LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PIGC P+ IS CP +  LD MGC + +N+A+ +HN++LQ+ +ERFRR  P C I+YA+YW
Sbjct  432  PIGCLPLHISLCPLKAALDHMGCAAAVNTAVMVHNQILQRRLERFRRLNPNCHILYADYW  491

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+L I  N   Y F+E  K CCG  GG  NF+ +S+ G+ G   C++P  +ISWDGIHL
Sbjct  492  NAYLTIMMNLKKYQFEEAFKPCCGATGGPLNFNLHSLCGSPGTVSCNNPSKFISWDGIHL  551

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
            + AMN+ + +L LN+ +C+P FSE+V  ++ +
Sbjct  552  TEAMNQKVTDLFLNQGFCQPSFSELVKSRSGM  583



>ref|XP_006341772.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Solanum tuberosum]
Length=604

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 186/272 (68%), Gaps = 2/272 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFAIAGST LS+E +++ K  +  W  +P+NFQ+QI WF KF Q  GC++     C+A
Sbjct  334  GANFAIAGSTILSKEDFSTKKLTNPFWKGLPMNFQTQIDWFFKFKQQMGCTDKNGKNCQA  393

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            +++NALFW+G++GVSDY +I   S+ +   ++Q  +   ++L++  L  GAK+IVVQGLP
Sbjct  394  EMENALFWIGSVGVSDYARIQGSSLTS-HWLTQQSVFQVSRLIEATLQSGAKYIVVQGLP  452

Query  481  PIGCFPVSISSCPPQQ-LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PIGC P+ IS CP +  LD MGC + +N+A+ LHN++LQK +E FR  +P C  +YA+YW
Sbjct  453  PIGCLPLHISLCPLKAALDHMGCAAAVNAAVMLHNQILQKKLEIFRSLYPNCHFLYADYW  512

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+L I  N   Y F+E  K CCG  GG  NF+ +S  G+ G  KC+DP  +ISWDGIHL
Sbjct  513  NAYLTIKMNLKKYQFEEAFKPCCGAVGGPLNFNLHSPCGSPGTVKCNDPSKFISWDGIHL  572

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
            + AMN+ + +L LN+ +C+P FSE+V  K+ +
Sbjct  573  TEAMNRKVTDLFLNQGFCQPSFSELVKSKSGM  604



>ref|XP_004239496.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Solanum lycopersicum]
Length=572

 Score =   269 bits (688),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/272 (47%), Positives = 187/272 (69%), Gaps = 2/272 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFAIAGST LS++ +++ K  +  W  +P+NFQ+QI WF KF Q  GC++     C+A
Sbjct  302  GANFAIAGSTILSQDDFSTKKLTNPFWKGLPMNFQTQIDWFSKFKQQIGCTDKNGKNCQA  361

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            +++NALFW+G++GVSDY +I   S+ +   ++Q  +   ++L++  +  GAK+IVVQGLP
Sbjct  362  EMENALFWIGSVGVSDYARIQGSSLTS-HWLTQQSVFQVSRLIEATVQSGAKYIVVQGLP  420

Query  481  PIGCFPVSISSCPPQQ-LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P+GC P+ IS CP +  LD MGC + +N+A+ LHN++LQK +E FR  +P C I+YA+YW
Sbjct  421  PLGCLPLHISLCPLKAALDHMGCAAAVNAAVMLHNQILQKKLEMFRSLYPNCHILYADYW  480

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+L I  N   Y F+E  K CCG  GG  NF+ +S  G+ G  KC+DP  +ISWDGIHL
Sbjct  481  NAYLTIKMNLKKYQFEEAFKPCCGAVGGPLNFNLHSPCGSPGTVKCNDPSKFISWDGIHL  540

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
            + AMN+ + +L LN+ +C+P FSE+V  K+ +
Sbjct  541  TEAMNRKVTDLFLNQGFCQPSFSELVKGKSGM  572



>gb|KDP26728.1| hypothetical protein JCGZ_17886 [Jatropha curcas]
Length=438

 Score =   255 bits (651),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 179/270 (66%), Gaps = 3/270 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKA-HSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCK  297
            G NFA+ GST LS  ++ S K   S  W  +P N   QI WF+ +LQS GC    D +CK
Sbjct  154  GANFAVGGSTCLSSAFFASQKNFRSLVWKPVPDNTLEQIEWFNSYLQSVGCKEKDDEKCK  213

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
              I+N+LFW+GALG SDY +I   S  A + +S+  + H  Q L+++L +GAK+IVVQGL
Sbjct  214  TQIENSLFWIGALGSSDYARILGSSFSA-KSLSEASVGHVGQFLESLLDKGAKYIVVQGL  272

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PP+GC PV +     ++ D++GC+S++NS I  HN+LL+K +E +R     C II+A+ W
Sbjct  273  PPVGCCPVQLLLNKAKEHDKLGCSSEVNSKIMSHNELLKKSLEAYREGNKDCVIIFADTW  332

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
            KA++ I  N   +NF+E  KACCG GGGE NF   ++ G+ G+T C+DP+ YISWDGIH 
Sbjct  333  KAYMEILKNHKKFNFEEPFKACCGVGGGELNFCLKNLCGSVGSTTCTDPNKYISWDGIHF  392

Query  838  SGAMNKHLAELLLN-KDYCEPPFSEMVNKK  924
            + AMNKHLA+LL + K YC P F+ ++  +
Sbjct  393  TEAMNKHLAKLLFHEKGYCSPEFNVLIEAR  422



>gb|KDO82083.1| hypothetical protein CISIN_1g047058mg, partial [Citrus sinensis]
Length=301

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/271 (44%), Positives = 176/271 (65%), Gaps = 2/271 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+AGST+ S + +  +  +   W  IPL+FQ QI WF +F++   C   +D+ CKA
Sbjct  33   GANFAVAGSTAFSHDLFAKSIGNRLMWKGIPLDFQVQIEWFRRFMREVACKGMSDSECKA  92

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            +I+NALFW+G +G SDY +    SI +   +++L +   +++++++L  GAK+IVVQGLP
Sbjct  93   EIENALFWVGEIGGSDYARTFGSSI-SHELLTKLTLGQISKIVKSLLDNGAKYIVVQGLP  151

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
            P+GC P+ +        DQMGC S  N+ +  HN  LQKMI  +++Q+P C I YA++W+
Sbjct  152  PLGCCPLEMFLSKAFDRDQMGCASTCNALVQSHNDNLQKMILEWQKQYPNCVIAYADFWR  211

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            AF  I  +  +Y F E  KACC G GG  NF+ +S+ G+ G + C+DP   + WDGIHL+
Sbjct  212  AFETILTHYKDYEFDEPFKACC-GAGGPLNFNMHSLCGSIGTSTCTDPSRLMHWDGIHLT  270

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
             AM KH+A+L LN+ YC+P F E+V KK  +
Sbjct  271  EAMYKHIADLFLNQGYCKPSFQELVKKKRGM  301



>ref|XP_006438155.1| hypothetical protein CICLE_v10033695mg [Citrus clementina]
 gb|ESR51395.1| hypothetical protein CICLE_v10033695mg [Citrus clementina]
Length=327

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/271 (44%), Positives = 176/271 (65%), Gaps = 2/271 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+AGST+ S + +  +  +   W  IPL+FQ QI WF +F++   C   +D+ CKA
Sbjct  59   GANFAVAGSTAFSHDLFAKSIGNLLMWKGIPLDFQVQIEWFRRFMREVACKGMSDSECKA  118

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            +I+NALFW+G +G SDY +    SI +   +++L +   +++++++L  GAK+IVVQGLP
Sbjct  119  EIENALFWVGEIGGSDYARTFGSSI-SHELLTKLTLGQISKIVKSLLDNGAKYIVVQGLP  177

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
            P+GC P+ +        DQMGC S  N+ +  HN  LQKMI  +++Q+P C I YA++W+
Sbjct  178  PLGCCPLEMFLSKAFDRDQMGCASTCNALVQSHNDNLQKMILEWQKQYPNCVIAYADFWR  237

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            AF  I  +  +Y F E  KACC G GG  NF+ +S+ G+ G + C+DP   + WDGIHL+
Sbjct  238  AFETILTHYKDYEFDEPFKACC-GAGGPLNFNMHSLCGSIGTSTCTDPSRLMHWDGIHLT  296

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
             AM KH+A+L LN+ YC+P F E+V KK  +
Sbjct  297  EAMYKHIADLFLNQGYCKPSFQELVKKKRGM  327



>gb|KDP42125.1| hypothetical protein JCGZ_01913 [Jatropha curcas]
Length=454

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 178/273 (65%), Gaps = 3/273 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKA-HSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCK  297
            G NFA+ GST LS +++ + K   S  W  +P N   QI WF+ +LQS GC    DA+CK
Sbjct  170  GANFAVGGSTCLSSQFFANQKIFRSLMWKPVPDNTLEQIEWFNSYLQSAGCKEKDDAKCK  229

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
              I+N+LFW+GALG SDY +I   S    + +S+  + H  Q LQ++L +GAK+I+VQGL
Sbjct  230  TQIENSLFWIGALGSSDYARILGSSFSG-KSLSEASVGHVGQFLQSLLDKGAKYIIVQGL  288

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PP+GC P+ +     +  D++GC++ +NS I  HN+LLQK +E +R     C II+A+ W
Sbjct  289  PPVGCCPLQMLLNKAKGHDELGCSAAVNSMIMSHNELLQKSLEEYREGNKDCVIIFADTW  348

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
            KA++ I  +   +NF+E  KACCG GGGE NF   ++ G++G+T C DP+ YISWDGIH 
Sbjct  349  KAYMEILKDHKKFNFEEPFKACCGVGGGELNFCLKNLCGSAGSTTCKDPEKYISWDGIHF  408

Query  838  SGAMNKHLAELLLN-KDYCEPPFSEMVNKKTSI  933
            + AMNKHLA+LL + K YC P F  ++  +  +
Sbjct  409  TEAMNKHLAKLLFHEKGYCSPEFDVLIEARKKV  441



>ref|XP_002515022.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF47576.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=331

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 175/270 (65%), Gaps = 2/270 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNK-AHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCK  297
            G NFAIAGST L+ +++ + K  HSF W   P N  +Q+ WF++FL +  C    +A CK
Sbjct  60   GANFAIAGSTCLTSDFFANYKIPHSFMWKAKPENVLTQVDWFNRFLLNVACQGKGEAECK  119

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
            + I+++LFW+GA+G SDY +I   +I   R +++  +  T ++L+ +L  GAK+IVVQGL
Sbjct  120  SQIEDSLFWVGAIGFSDYARIFGAAISG-RSLTEAAVDKTAKILKAMLDRGAKYIVVQGL  178

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PP GC P+ +   P +  D MGC+S INS I  HN +LQK +  FR Q+    ++YA+ W
Sbjct  179  PPAGCCPLQLLMNPSKDRDSMGCSSGINSMIQAHNDILQKKLGEFRAQYKGSVLVYADTW  238

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+ A+  N   +NF+E  KACCG GGG  NFD +S+ G++G + CS+P ++ISWDGIH 
Sbjct  239  NAYKAVLVNYKKFNFQEPFKACCGAGGGTLNFDLHSLCGSTGTSACSNPQNFISWDGIHF  298

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKT  927
            + AM+  LA +  ++ YC PPF  +V  KT
Sbjct  299  TEAMHAVLANMFFHQGYCSPPFDALVKAKT  328



>ref|XP_002267715.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Vitis vinifera]
Length=416

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 168/271 (62%), Gaps = 2/271 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKA-HSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCK  297
            G+NFA+AGST+LS +YY +N+   +  W +IP   Q+Q+ WF+KFL +  C+      CK
Sbjct  143  GVNFAVAGSTALSTDYYINNRVGQTLVWKDIPQTVQTQVNWFNKFLLNVECNGMNHLACK  202

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
              ++N+LFW+G LG+ DY + +  S V+++ +  L +  T +L++ +L  GAK+IVVQ L
Sbjct  203  GQLENSLFWVGELGMYDYSRTYGSS-VSIKWLIDLSVSSTCRLVKALLDRGAKYIVVQSL  261

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PP GC P  IS  P    D +GC    N+    HN+LLQ  +   ++Q+P   I YA+ W
Sbjct  262  PPTGCLPFDISLSPVSDHDNLGCADTANTVTQTHNELLQAKLAEQQKQYPDSIIAYADIW  321

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+  +  NP  + F E  KACCG G G+ NFD  S+ G      CSDP  +I+WDG+HL
Sbjct  322  NAYYTVLKNPSQFGFSEPFKACCGCGKGDLNFDLRSLCGARNTRVCSDPSKHITWDGVHL  381

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKTS  930
            + AM+  LA+LLLNK YC+P F ++V KK S
Sbjct  382  TEAMHHVLADLLLNKGYCKPSFDQLVKKKRS  412



>ref|XP_010251345.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Nelumbo nucifera]
Length=388

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 170/272 (63%), Gaps = 5/272 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKA-HSFTWTNIPLNFQSQIAWFHKFL---QSKGCSNAADA  288
            G+NFAIAGST L ++Y+  NK  H+  W  +P + Q+Q+ W+  F    Q   C+   + 
Sbjct  115  GVNFAIAGSTVLPKDYFVRNKVGHTLMWKAVPESLQTQVEWYINFFEEQQQSECNRKEER  174

Query  289  RCKADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             C A++++ LFW+G +GV+DY +    S V++  ++Q  + +  +LL+T+L  GAK+IV+
Sbjct  175  SCMAELEDVLFWIGDMGVNDYARNFGTS-VSVHSLAQRIVQNVMKLLKTLLDRGAKYIVI  233

Query  469  QGLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYA  648
            QGLPP GC P+ +   P    D+ GC +  N  +  HN LLQ+ +    +Q+P C IIYA
Sbjct  234  QGLPPTGCLPLDLFLSPASDRDETGCAAGANLVVAAHNDLLQRKLVDLEKQYPHCAIIYA  293

Query  649  NYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDG  828
            +YW AFL I  NP  + F E  K CCG G G  NFD +S+ G+ GA++C+DP  +I+WDG
Sbjct  294  DYWNAFLTILKNPAQFGFSEPFKTCCGTGAGILNFDLHSLCGSPGASRCTDPTKHINWDG  353

Query  829  IHLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            +H + AMN+ LA LL ++ +C P F +++  K
Sbjct  354  VHPTEAMNQKLANLLFDQGFCRPSFGQLIRYK  385



>ref|XP_009791093.1| PREDICTED: GDSL esterase/lipase At3g48460 [Nicotiana sylvestris]
Length=381

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 168/270 (62%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADA--RC  294
            G+NFA+AGST++   ++  N   + T    P + Q+Q+ WF++FL+S+GC N+     +C
Sbjct  115  GVNFAVAGSTAIRHRFFVRN---NLTLNVTPQSLQTQLTWFNRFLESEGCKNSTTTPKQC  171

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +A   +ALFW+G +G +DY      S V+   I  L     T  LQ +L++GAK++VVQG
Sbjct  172  EAVFSDALFWVGEIGANDYAYSFGSS-VSPNTIQHLATTSLTGFLQVLLSKGAKYVVVQG  230

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LPP GC  +S+   P    D MGC   ++   +LHN ++Q  ++ FR+QFPQ  IIYA+Y
Sbjct  231  LPPTGCLTLSMYLAPETDRDDMGCVGSVDKQSNLHNSIIQTKLDSFRKQFPQTVIIYADY  290

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W A+  +      Y FKE  K+CCG GGG +NFD  +  G+  A+ CSDP  YI+WDG+H
Sbjct  291  WNAYSTVVKGANKYGFKELFKSCCGSGGGNYNFDVFNTCGSPSASSCSDPSQYINWDGVH  350

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ AM K +A L LN  +C+PPFS ++ KK
Sbjct  351  LTEAMYKTMANLFLNGTFCKPPFSYLLAKK  380



>ref|XP_006351456.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Solanum tuberosum]
Length=381

 Score =   234 bits (598),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 166/270 (61%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADA--RC  294
            G+NFA+AGST++   ++  N   + T    P + Q+Q+ WF++FL+SKGC N+     +C
Sbjct  115  GVNFAVAGSTAIRHRFFVKN---NITLNVTPQSLQTQLTWFNRFLESKGCVNSTTTPQQC  171

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +A   +ALFW+G +G +DY    + S V+   I +L     T  LQ +L +GAK+++VQG
Sbjct  172  EALFSDALFWVGEIGANDYAYSFASS-VSPNTIQRLATRSFTGFLQALLNKGAKYVLVQG  230

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LPP GC  +S+   P    D MGC    N    LHN ++Q  ++ FR+QFPQ  I+YA+Y
Sbjct  231  LPPTGCLTLSMYLAPDTDRDDMGCVESANKHSILHNSIIQAKLDSFRKQFPQTVIVYADY  290

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W A+  +  N   Y FKE  K+CCG GGG  NF+  S  G+  A+ C DP  YI+WDG+H
Sbjct  291  WNAYSTVVRNANKYGFKEVFKSCCGAGGGNLNFEVFSTCGSPSASSCPDPSQYINWDGVH  350

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ AM K +A + LN  YC+PPFS ++ KK
Sbjct  351  LTEAMYKTIASMFLNGTYCKPPFSYLLAKK  380



>ref|XP_004236316.1| PREDICTED: GDSL esterase/lipase At3g48460 [Solanum lycopersicum]
Length=381

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 165/270 (61%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADA--RC  294
            G+NFA+AGST++   ++  N   + T    P + Q+Q+ WF++FL+SKGC N+     +C
Sbjct  115  GVNFAVAGSTAIRHRFFVKN---NITLNVTPQSLQTQLTWFNRFLESKGCVNSTSTPQQC  171

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +A   +ALFW+G +G +DY      S V+   I +L     T  LQ +L +GAK+++VQG
Sbjct  172  EALFSDALFWVGEIGANDY-AYSFASTVSPNTIQRLATRSFTGFLQALLNKGAKYVLVQG  230

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LPP GC  +S+   P    D MGC    N    LHN ++Q  ++ FR+QFPQ  I+YA+Y
Sbjct  231  LPPTGCLTLSMYLAPDTDRDAMGCVGSANKHSILHNSIIQAQLDSFRKQFPQTVIVYADY  290

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W A+  +  NP    FKE  K+CCG GGG  NFD  S  G+  A+ C DP  YI+WDG+H
Sbjct  291  WNAYSTVVRNPNKNGFKEVFKSCCGAGGGSLNFDIFSTCGSPSASSCPDPSQYINWDGVH  350

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ AM K +A + L+  YC+PPFS ++ KK
Sbjct  351  LTEAMYKTMASMFLHGKYCKPPFSYLLAKK  380



>ref|XP_006484334.1| PREDICTED: anther-specific proline-rich protein APG-like [Citrus 
sinensis]
Length=678

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 175/268 (65%), Gaps = 2/268 (1%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+AGST+ S + +  +  +   W  IPL+FQ QI WF +F++   C   +D+ CKA
Sbjct  410  GANFAVAGSTAFSHDLFAKSIGNLLMWKGIPLDFQVQIEWFRRFMREVACKGMSDSECKA  469

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            +I+NALFW+G +G SDY +    SI +   +++L +   +++++++L  GAK+IVVQGLP
Sbjct  470  EIENALFWVGEIGGSDYARTFGSSI-SHELLTKLTLGQISKIVKSLLDNGAKYIVVQGLP  528

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
            P+GC P+ +        DQMGC S  N+ +  HN  LQKMI  +++Q+P C I YA++W+
Sbjct  529  PLGCCPLEMFLSKAFDRDQMGCASTCNALVQSHNDNLQKMILEWQKQYPNCVIAYADFWR  588

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            AF  I  +  +Y F E  KACC G GG  NF+ +S+ G+ G + C+DP   + WDGIHL+
Sbjct  589  AFETILTHYKDYEFDEPFKACC-GAGGPLNFNMHSLCGSIGTSTCTDPSRLMHWDGIHLT  647

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM KH+A+L LN+ YC+P F E+V KK
Sbjct  648  EAMYKHIADLFLNQGYCKPSFQELVKKK  675



>ref|XP_009596313.1| PREDICTED: GDSL esterase/lipase At3g48460 [Nicotiana tomentosiformis]
Length=381

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/270 (42%), Positives = 165/270 (61%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADA--RC  294
            G+NFA+AGST++   ++  N   + T    P + Q+Q+ WF++FL+S+GC N+     +C
Sbjct  115  GVNFAVAGSTAIRHRFFVRN---NLTLNVTPQSLQTQLTWFNRFLESQGCKNSTTTPKQC  171

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +A   +ALFW+G +G +DY      S V+   I  L     T  LQ +L +GAK++VVQG
Sbjct  172  EAVFSDALFWVGEIGANDYAYSFGSS-VSPNTIQHLATTSVTGFLQVLLNKGAKYVVVQG  230

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LPP GC  +S+   P    D MGC   ++   +LHN ++Q  ++ FR+QFPQ  IIYA+Y
Sbjct  231  LPPTGCLTLSMYLAPETDRDDMGCVGSVDKQSNLHNSIIQTKLDSFRKQFPQAVIIYADY  290

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W A+  +      Y FKE  K+CCG GGG +NFD  +  G+  A+ C DP  YI+WDG+H
Sbjct  291  WNAYSTVVKGANKYGFKELFKSCCGSGGGNYNFDVFNTCGSPSASSCPDPSQYINWDGVH  350

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ AM K +A L LN  +C+P FS ++ KK
Sbjct  351  LTEAMYKTMANLFLNGTFCKPSFSYLLAKK  380



>ref|XP_006440021.1| hypothetical protein CICLE_v10020570mg [Citrus clementina]
 gb|ESR53261.1| hypothetical protein CICLE_v10020570mg [Citrus clementina]
Length=384

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 167/270 (62%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADA--RC  294
            G+NFA+ G+T+++  ++  N   + +    P + Q+Q+ WF+KFL+SKGC  A  +  +C
Sbjct  115  GVNFAVGGATAVNHAFFVKN---NLSLDITPQSIQTQLIWFNKFLESKGCKEAESSGPQC  171

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +A  D+ALFW+G +GV+DY      S+ +   I +L I   T  LQ +L  GAK++VVQG
Sbjct  172  QAAFDDALFWVGEIGVNDYAYTLGSSVTS-DTIRKLAIPSFTNFLQALLKRGAKYVVVQG  230

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LP  GC P+++   P    D +GC   +N+    HN +LQ  ++  R+QFPQ  I+YA+Y
Sbjct  231  LPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADY  290

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W AF  +  NPG Y FKE  KACCG G   +NF+  +  G+  A  C +P  YI+WDG+H
Sbjct  291  WNAFRMVMKNPGKYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVH  350

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ AM K ++++ L+  +  PPFS ++++K
Sbjct  351  LTEAMYKVMSDMFLSGTFSRPPFSYLLSRK  380



>ref|XP_006476962.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Citrus sinensis]
 gb|KDO69353.1| hypothetical protein CISIN_1g016679mg [Citrus sinensis]
Length=384

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 167/270 (62%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADA--RC  294
            G+NFA+ G+T+++  ++  N   + +    P + Q+Q+ WF+KFL+SKGC  A  +  +C
Sbjct  115  GVNFAVGGATAINHAFFVKN---NLSLDITPQSIQTQLIWFNKFLESKGCKAAESSVPQC  171

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +A  D+ALFW+G +GV+DY      S+ +   I +L I   T  LQ +L  GAK++VVQG
Sbjct  172  QAAFDDALFWVGEIGVNDYAYTLGSSVTS-DTIRKLAIPSFTNFLQALLKRGAKYVVVQG  230

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LP  GC P+++   P    D +GC   +N+    HN +LQ  ++  R+QFPQ  I+YA+Y
Sbjct  231  LPTTGCLPLAMYLAPEDDRDGIGCVKSVNNQSYTHNLVLQAQLQNLRQQFPQAVIVYADY  290

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W AF  +  NPG Y FKE  KACCG G   +NF+  +  G+  A  C +P  YI+WDG+H
Sbjct  291  WNAFRMVMKNPGKYGFKEPFKACCGSGEPPYNFNVFATCGSPSAKACPNPYQYINWDGVH  350

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ AM K ++++ L+  +  PPFS ++++K
Sbjct  351  LTEAMYKVMSDMFLSGTFSRPPFSYLLSRK  380



>ref|XP_010911635.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Elaeis guineensis]
Length=391

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 166/270 (61%), Gaps = 5/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++ E++  N     T    P +  +Q+ WF K+L+ KGC      RC+A
Sbjct  125  GVNFAVAGSTAIAHEFFAQNNV---TMDITPQSLMTQLIWFEKYLEGKGCRGKGSRRCQA  181

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            ++++ALFW+G +G +DY    + S+ +   I +L I +    LQ +L  GAK++VVQGLP
Sbjct  182  EMEDALFWVGEIGANDYAYSFTSSL-SPNLIRELAIKNVHNFLQALLDNGAKYMVVQGLP  240

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P+S+   PP   D +GC + +N+    HN LLQ  +   RR++P   I YA+Y+ 
Sbjct  241  LTGCLPLSMVLAPPDDRDGIGCAASVNNQSYTHNLLLQNKLRDLRRRYPNAIISYADYFS  300

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIHL  837
            A LA+  NP  + F E  KACCG GGG FNFD  +  G+   +K CS+P  +++WDG+HL
Sbjct  301  AHLAVMKNPATHGFTEPYKACCGSGGGSFNFDLFATCGSPNVSKACSNPTKFVNWDGVHL  360

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKT  927
            + AM K ++++ L++ YC P F  ++  ++
Sbjct  361  TEAMYKVVSDMFLHRRYCRPSFDVLLRNQS  390



>ref|XP_002321669.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEF05796.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=377

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 163/273 (60%), Gaps = 6/273 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADA--RC  294
            G+NFA+AGST+++  ++  N   + T    P + Q+Q+ W +KFL+S+GC  A  +   C
Sbjct  109  GINFAVAGSTAINHAFFVKN---NLTLDMTPQSIQTQMIWLNKFLESQGCKGAVSSSPEC  165

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            KA  D+AL W+G +GV+DY      S V+   I +L I   T  LQT+L +G KH+VVQG
Sbjct  166  KAVFDDALIWVGEIGVNDYAYTVGSS-VSSDTIRKLAISSVTGFLQTLLKKGVKHVVVQG  224

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LPP GC P+++        D +GC    N+    HN + QK ++  R+QFP   I Y +Y
Sbjct  225  LPPTGCLPLAMVLASEDDRDDLGCVKSANNQSYTHNVVYQKTVQDLRKQFPDAVIAYLDY  284

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W A+  +  NP  Y FKE   ACCG GG  +NF+  S  GTS A+ CS+P  YI+WDG+H
Sbjct  285  WNAYATVMKNPKKYGFKEPFMACCGSGGPPYNFEVFSTCGTSHASACSNPSQYINWDGVH  344

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
            L+ AM K L+ + L+  +  PPF  ++++K  +
Sbjct  345  LTEAMYKALSHMFLSGTFSHPPFGSLMDRKQHV  377



>ref|XP_008439284.1| PREDICTED: GDSL esterase/lipase At3g48460 [Cucumis melo]
Length=378

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/269 (41%), Positives = 168/269 (62%), Gaps = 6/269 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGC-SNAADARCK  297
            G+NFA+AGST+++ E+Y  N   + +  N P + Q+Q+ WF+KFL+++GC      A+CK
Sbjct  111  GVNFAVAGSTAINHEFYVRN---NLSIDNTPQSIQTQLLWFNKFLETQGCRGEETKAQCK  167

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
            A  D+ALFW+G +GV+DY       I A   I +L +   T +LQ++L +GAK++VVQGL
Sbjct  168  AAFDDALFWVGEIGVNDYAYSFGSPISA-DTIRKLAVASVTGVLQSLLKKGAKYMVVQGL  226

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PP GC  +S+S       D +GC   +N+   +H+  LQ  ++  RRQFP+  IIYA+YW
Sbjct  227  PPSGCLALSMSLASVDDRDDIGCVRSLNNQTYVHSMALQASLQSLRRQFPEAVIIYADYW  286

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+  +  NP  Y F+E  KACC G G  +NF+  ++ G S  + C  P  YI+WDG+HL
Sbjct  287  NAYRTVIKNPSKYGFRERFKACC-GVGEPYNFELFTVCGMSSVSSCKTPSEYINWDGVHL  345

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            + AM K + ++L+   +  PPFS +++ K
Sbjct  346  TEAMYKVVHDMLIEGGFTHPPFSYLLDMK  374



>ref|XP_011024095.1| PREDICTED: GDSL esterase/lipase At3g48460 [Populus euphratica]
Length=377

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 163/273 (60%), Gaps = 6/273 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSN--AADARC  294
            G+NFA AGST+++  ++  N   + T    P + Q+Q+ WF+KFL+S+GC    ++   C
Sbjct  109  GVNFAFAGSTAINHAFFVKN---NLTLDMTPQSIQTQMNWFNKFLESQGCKGTVSSSPEC  165

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            KA  D+AL W+G +GV+DY      S V+   I +L I   T  LQT+L +G KH+VVQG
Sbjct  166  KAVFDDALIWVGEIGVNDYAYTVGSS-VSSDTIRKLAISSVTGFLQTLLKKGVKHVVVQG  224

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LPP GC P+++        D +GC    N+    HN + QK ++  R QFP   I Y +Y
Sbjct  225  LPPTGCLPLAMVLASEDDRDDLGCVKSANNQSYTHNVVYQKTVQDLRNQFPDAVIAYLDY  284

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W A+ A+  NP  Y F+E   ACCG GG  +NF+  S  GTS A+ CS+P  YI+WDG+H
Sbjct  285  WNAYAAVMKNPKKYGFEEPFMACCGSGGPPYNFEVFSTCGTSQASVCSNPSQYINWDGVH  344

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
            L+ AM K L+ + ++  +  PPF  ++++K  +
Sbjct  345  LTEAMYKALSHMFMSGTFSHPPFGSLMDRKQHV  377



>emb|CDP15060.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 160/270 (59%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADA--RC  294
            G+NFA+AGST++   ++  N   + T    P + Q+Q+ WF++FL+SKGC N+      C
Sbjct  115  GINFAVAGSTAIIYSFFVKN---NLTLNRTPQSLQTQLVWFNEFLESKGCKNSITTPKEC  171

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            KA  DNAL WLG +G +DY      S V+   I +L I   T+ L+ +L +G K+++VQG
Sbjct  172  KAVFDNALIWLGEIGANDYAYTFGSS-VSGTTIQKLAIGSVTRFLEAILDKGVKYLLVQG  230

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LPP GC  ++         D +GC +  N     HN +LQ  +  FR++FP   I+YA+Y
Sbjct  231  LPPTGCLTLTRYLAAENDRDTLGCVASSNKQSYAHNTILQAKLNDFRKKFPNAVIVYADY  290

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W A+ ++  NP  Y  KE  KACCG   G +NFD  +  G+  AT CS+P  YI+WDG+H
Sbjct  291  WNAYASVVKNPEKYGIKELFKACCGSNSGLYNFDLFNTCGSPMATSCSNPSQYINWDGVH  350

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+  M K +AELLL   +  PPF  ++++K
Sbjct  351  LTEGMYKAVAELLLEGKFSNPPFEYLLSRK  380



>ref|XP_009359493.1| PREDICTED: GDSL esterase/lipase At3g48460 [Pyrus x bretschneideri]
Length=390

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 161/269 (60%), Gaps = 9/269 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST++  E++  N   + +    P +  SQ+ WF+KFL+SKGC       CK 
Sbjct  126  GVNFAVAGSTAIEHEFFVKN---NLSLAITPQSILSQLLWFNKFLESKGC-KVGGPECK-  180

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
              D+ALFW+G +GV+DY + I S   V    I +L +   T  LQ +L +GAK++VVQGL
Sbjct  181  -FDDALFWVGEIGVNDYAYTIGSA--VPGDTIQKLGVSRVTSFLQALLKKGAKYVVVQGL  237

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC P++++  P    D +GC   +N+    HN +LQ  ++  R+QFP   I YA+YW
Sbjct  238  PLSGCLPLAMTLAPEDDRDSIGCVKSVNNQTYSHNLVLQAKLQELRKQFPHAVITYADYW  297

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A LA+  NP  Y F E+ KACCG     +NFD  +  GT  AT C  P  YI+WDG+HL
Sbjct  298  NAHLAVMKNPSQYGFTESFKACCGKSDDPYNFDVFATCGTPSATACKSPSQYINWDGVHL  357

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            + AM K L+++ L  +   PPFS +++ K
Sbjct  358  TEAMYKVLSDMFLKGNATHPPFSSLLDMK  386



>ref|XP_007037866.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY22367.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=381

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/269 (40%), Positives = 165/269 (61%), Gaps = 6/269 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADA-RCK  297
            G+NFA+AGST+++  ++  N   + +    P + Q+Q+ WF K+L+S+GC        CK
Sbjct  114  GVNFAVAGSTAINHAFFAKN---NLSLDITPESIQTQLIWFDKYLESQGCKGPESGPECK  170

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
              +D+ALFW+G +GV+DY      S V+   I +L I+  T+ LQ++L +GAK++VVQ L
Sbjct  171  EGLDDALFWIGEIGVNDYAYTLG-STVSDDTIRKLAIYSLTEFLQSLLKKGAKYVVVQAL  229

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC P++++  P    D +GC   +N+    HN +LQ  +   R+QFPQ  I YA+YW
Sbjct  230  PTTGCLPLAMTLAPSDDRDDIGCVKSVNNQSYTHNLVLQAKLSDLRQQFPQAVIAYADYW  289

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+  +  NP  Y FKE+ KACC G G  +NFD  +  GT   T CS+P  +I+WDG+HL
Sbjct  290  NAYRTVMKNPEKYGFKESFKACC-GTGDPYNFDVFNTCGTPSVTACSNPSEHINWDGVHL  348

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            + AM K +A++ LN +   PPF  ++ +K
Sbjct  349  TEAMYKVVADMFLNGNLSNPPFKSLLERK  377



>gb|KHG00751.1| hypothetical protein F383_21550 [Gossypium arboreum]
Length=386

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 165/268 (62%), Gaps = 5/268 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++  ++  N   + +    P + Q+Q+ WF K+L+S+ C +    +CK 
Sbjct  120  GVNFAVAGSTAINHAFFVKN---NLSLDITPESIQTQMMWFDKYLESESCKDPESDQCKE  176

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
              D+ALFW+G +GV+DY      S V+   I +L I+  T+ LQ +L +GAK++VV+ LP
Sbjct  177  AFDDALFWVGEIGVNDY-AYTLGSTVSGDTIRKLAINSFTEFLQGLLKKGAKYVVVEALP  235

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P++++  P    D +GC   +N+  + HN +LQ  +   R+QFPQ  I+YA+YW 
Sbjct  236  TTGCLPLAMTLAPSDDRDDIGCVKSVNNQSNAHNLVLQSKVSDLRQQFPQAIIVYADYWN  295

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  +P  Y FKE+ KACC G G  +NF+  +  G    T CS+P  YI+WDG+HL+
Sbjct  296  AYRTVMQSPEKYGFKESFKACC-GTGEPYNFEVFNTCGNPSVTACSNPAQYINWDGVHLT  354

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K +A++ +  + C PPF  ++ +K
Sbjct  355  EAMYKVVADMFIGGNLCNPPFKTLLERK  382



>ref|XP_008797234.1| PREDICTED: GDSL esterase/lipase At3g48460 [Phoenix dactylifera]
Length=393

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 163/270 (60%), Gaps = 5/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST++  E++  N   + T    P +  +Q  WF K+L+ KGC      RC+A
Sbjct  127  GVNFAVAGSTAIEHEFFARN---NITMDITPQSLMTQFMWFKKYLEGKGCRGNGSPRCRA  183

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            ++ NALFW+G +G +DY    + S+ +   I +L + +    LQ +L  GAKHIVVQGLP
Sbjct  184  EMANALFWVGEIGANDYAYSFTSSL-SPNLIRELAVKNVINFLQALLENGAKHIVVQGLP  242

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P+++   P    D +GC + +N+    HN LLQ  ++  RR++P   I YA+Y+ 
Sbjct  243  LTGCLPLAMVLAPADDRDDIGCTASVNNQSYTHNLLLQNKLQDLRRRYPDAIISYADYFS  302

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIHL  837
            A  A+  +P  + F E  KACCG GGG FNFD  +  G+   +K CS+P  +++WDG+HL
Sbjct  303  AHHAVMKSPSTHGFIEPFKACCGTGGGPFNFDLFATCGSPNVSKACSNPTKFVNWDGVHL  362

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKT  927
            + AM K ++++  ++ YC P F  +++ K+
Sbjct  363  TEAMYKVVSDMFFHRGYCRPSFDILLSNKS  392



>ref|XP_008392856.1| PREDICTED: GDSL esterase/lipase At3g48460 [Malus domestica]
Length=390

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 158/268 (59%), Gaps = 7/268 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST++  E++  N   + +    P +  SQ+ WF+KFL+SKGC       CK 
Sbjct  126  GVNFAVAGSTAIEHEFFVKN---NLSLAITPQSILSQLLWFNKFLESKGC-KVGGPECK-  180

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
              D+ALFW+G +GV+DY      S V    I +L +   T  LQ +L +GAK++VVQGLP
Sbjct  181  -FDDALFWVGEIGVNDY-AYTLGSAVPGDTIQKLGVSRVTSFLQALLKKGAKYVVVQGLP  238

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P++++  P    D +GC   +N+    HN +LQ  ++  R+QFP   I YA+YW 
Sbjct  239  LSGCLPLAMTLAPEDDRDSVGCVKSVNNQTYSHNLVLQAKLQVLRKQFPHAVITYADYWN  298

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A L +  NP  Y F E+ KACCG     +NFD  +  GT  AT C  P  YI+WDG+HL+
Sbjct  299  AHLTVMKNPSQYGFTESFKACCGKSDDPYNFDVFATCGTPSATACKSPSQYINWDGVHLT  358

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K L+++ L  +   PPFS +++ K
Sbjct  359  EAMYKVLSDMFLKGNATHPPFSSLLDIK  386



>ref|XP_008393854.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Malus domestica]
Length=390

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/268 (42%), Positives = 158/268 (59%), Gaps = 8/268 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST++  E++  N   + +    P +  +Q+ WF+KFLQSKGC      RCK 
Sbjct  127  GVNFAVAGSTAIEHEFFVKN---NLSLDITPQSILTQLLWFNKFLQSKGC-KVGGPRCK-  181

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
              D+ALFW+G +GV+DY      S V    I +L I   T  LQ +L +GAK +VVQGLP
Sbjct  182  -FDDALFWVGEIGVNDYAYTLG-SDVPGDTIQKLGISRVTSFLQALLKKGAKSVVVQGLP  239

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P+S++  P    D++GC   +N     HN +LQ  +   R QFP   I YA+YW 
Sbjct  240  LSGCLPLSMTLAPEDDRDRIGCVKSVNHQTYSHNLVLQAKLHELRTQFPHAVIAYADYWN  299

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+L +  +P  Y F E  KACC G G  +NFD ++  GT  AT C  P  YI+WDG+HL+
Sbjct  300  AYLTVMKSPSQYGFTERFKACC-GSGDPYNFDVSATCGTPSATVCKSPSQYINWDGVHLT  358

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K L++  L  +   PPFS ++++K
Sbjct  359  EAMYKVLSDTFLKGNATHPPFSYLLDRK  386



>gb|KHN14076.1| GDSL esterase/lipase [Glycine soja]
Length=373

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 165/271 (61%), Gaps = 8/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++  ++     H+ +    P + Q+Q+ WF+++L+S+ C    +++C  
Sbjct  110  GVNFAVAGSTAINHLFFVK---HNLSLDITPQSIQTQMIWFNRYLESQDCQ---ESKCN-  162

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            D D+ LFW G +GV+DY      S V+   I +L I   +  LQT+L +GAK++VVQGLP
Sbjct  163  DFDDTLFWFGEIGVNDY-AYTLGSTVSDETIRKLAISSVSGALQTLLEKGAKYLVVQGLP  221

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +S+   PP   D +GC   +N+    HN +LQ  ++ FR+Q+PQ  I+YA+Y+ 
Sbjct  222  LTGCLTLSMYLAPPDDRDDIGCVKSVNNQSYYHNLVLQDKLQEFRKQYPQAVILYADYYD  281

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  + FKET   CCG G   +NF   +  GT  AT CS P  YI+WDG+HL+
Sbjct  282  AYRTVMKNPSKFGFKETFNVCCGSGEPPYNFTVFATCGTPNATVCSSPSQYINWDGVHLT  341

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
             AM K ++ + L  ++ +PPF+ ++ KK  +
Sbjct  342  EAMYKVISSMFLQGNFTQPPFNFLLGKKERV  372



>ref|XP_003608902.1| GDSL esterase/lipase [Medicago truncatula]
Length=384

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/268 (39%), Positives = 159/268 (59%), Gaps = 6/268 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++ E++  N   + +    P + Q+QI WF+K+L+S+GC    D++CK 
Sbjct  116  GVNFAVAGSTAINHEFFVRN---NLSLDITPQSIQTQILWFNKYLESQGC-QGVDSKCK-  170

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            D D  LFW G +GV+DY      S V+   I +L +   +  LQ++L +GAK++VVQG P
Sbjct  171  DFDETLFWFGEIGVNDY-AYTLGSTVSEDTIRKLAMSSVSGALQSLLEKGAKYLVVQGHP  229

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
            P GC  +++   P    D +GC    N   + HN +LQ  ++ FR+Q+P   I+YA+Y+ 
Sbjct  230  PTGCLTLTMYLAPEDDRDDLGCVKSANDLSNNHNLMLQARLQEFRKQYPHAVIVYADYFN  289

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  Y FK+    CCG G   +NF      GT  AT C+ P  YI+WDG+HL+
Sbjct  290  AYRTVMKNPSKYGFKDLFSVCCGSGEPPYNFTVFETCGTPNATVCTSPSQYINWDGVHLT  349

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K ++ + L  +Y +PPF   V K+
Sbjct  350  EAMYKVVSNMFLQGNYSQPPFDFFVRKQ  377



>ref|XP_003549836.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Glycine max]
Length=380

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 165/271 (61%), Gaps = 8/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++  ++     H+ +    P + Q+Q+ WF+++L+S+ C    +++C  
Sbjct  117  GVNFAVAGSTAINHLFFVK---HNLSLDITPQSIQTQMIWFNRYLESQDCQ---ESKCN-  169

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            D D+ LFW G +GV+DY      S V+   I +L I   +  LQT+L +GAK++VVQGLP
Sbjct  170  DFDDTLFWFGEIGVNDY-AYTLGSTVSDETIRKLAISSVSGALQTLLEKGAKYLVVQGLP  228

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +S+   PP   D +GC   +N+    HN +LQ  ++ FR+Q+PQ  I+YA+Y+ 
Sbjct  229  LTGCLTLSMYLAPPDDRDDIGCVKSVNNQSYYHNLVLQDKLQEFRKQYPQAVILYADYYD  288

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  + FKET   CCG G   +NF   +  GT  AT CS P  YI+WDG+HL+
Sbjct  289  AYRTVMKNPSKFGFKETFNVCCGSGEPPYNFTVFATCGTPNATVCSSPSQYINWDGVHLT  348

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
             AM K ++ + L  ++ +PPF+ ++ KK  +
Sbjct  349  EAMYKVISSMFLQGNFTQPPFNFLLGKKERV  379



>ref|XP_007209226.1| hypothetical protein PRUPE_ppa006897mg [Prunus persica]
 gb|EMJ10425.1| hypothetical protein PRUPE_ppa006897mg [Prunus persica]
Length=391

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 159/268 (59%), Gaps = 5/268 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST++  +++  N   + +    P + Q+Q+ WF KFL+S+GC  A  A   A
Sbjct  125  GVNFAVAGSTAIEHQFFVKN---NLSLAITPQSIQTQLLWFDKFLESQGCKVAGAACKAA  181

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
              D+ LFW+G +GV+DY      SI     I QL I   T  LQ +L +GAK++VVQGLP
Sbjct  182  AFDDTLFWVGEIGVNDYAYTIGSSIPG-DTIQQLGISRVTSFLQALLKKGAKYVVVQGLP  240

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P++++  P    D +GC    N+    HN +LQ  +++ R QFP   I YA+YW 
Sbjct  241  LSGCLPLAMTLAPEDDRDGIGCVKSANNQTYSHNLVLQAKLQQLRTQFPHAVITYADYWN  300

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  Y FKE+ KACC G G  +NF+  ++ GT  A+ C  P  YI+WDG+HL+
Sbjct  301  AYFTVMKNPNQYGFKESFKACC-GTGDPYNFEVFAVCGTPSASACPSPSQYINWDGVHLT  359

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K L ++ LN     PPFS +++ K
Sbjct  360  EAMYKVLTDMFLNGKATHPPFSYLLDMK  387



>ref|XP_011072984.1| PREDICTED: GDSL esterase/lipase At3g48460 [Sesamum indicum]
Length=385

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 161/270 (60%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSN--AADARC  294
            G+NFA+AGST++   ++  N   + T    P + ++Q+ WF K L+ KGC +  A    C
Sbjct  116  GINFAVAGSTAIIHSFFAKN---NMTLNITPQSLRTQLNWFEKVLEGKGCKDKMATPREC  172

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +A   +AL W+G +G +DY      S V  + I QL I+  T  LQ +L +GAK++VVQG
Sbjct  173  EAVFKDALIWVGEIGANDYAYSFGSS-VPTKTIQQLAINSFTGFLQALLKKGAKYVVVQG  231

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LPP GC  +S+   P    D +GC    N     HN  L+  ++ FR+QFPQ  I+Y +Y
Sbjct  232  LPPTGCLTLSMYLAPSDDRDAVGCVGSPNRQSYTHNLALKAKLDGFRKQFPQSIILYLDY  291

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            + A+L +  N   +  KE  KACCG GGG +NFD  +  G+  A+ C++P  YI+WDG+H
Sbjct  292  YNAYLTVIKNARQHGMKELYKACCGYGGGTYNFDYFNACGSPSASSCANPSQYINWDGVH  351

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ AM K +A+  LN  Y +PPFS ++++K
Sbjct  352  LTEAMYKAMADAFLNGTYSQPPFSYLLSQK  381



>ref|XP_008239404.1| PREDICTED: GDSL esterase/lipase At3g48460 [Prunus mume]
Length=391

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/268 (41%), Positives = 159/268 (59%), Gaps = 5/268 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST++  +++  N   + +    P +  +Q+ WF KFL+S+GC  A  A   A
Sbjct  125  GVNFAVAGSTAIEHQFFVKN---NLSLAITPQSILTQLLWFDKFLESQGCKVAGAACKAA  181

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
              D+ALFW+G +GV+DY       I     I QL I   T  LQ +L +GAK++VVQGLP
Sbjct  182  AFDDALFWVGEIGVNDYAYTVGSDIPG-DTIQQLGISRVTNFLQALLKKGAKYVVVQGLP  240

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P++++  P    D +GC   +N+    HN +LQ  +++ R QFP   I YA+YW 
Sbjct  241  LSGCLPLAMTLAPEDDRDSIGCVKSVNNQTYSHNLVLQAKLQQLRTQFPHAVITYADYWN  300

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  Y FKE+ KACC G G  +NF+  ++ GT  A+ C  P  YI+WDG+HL+
Sbjct  301  AYFTVMKNPNQYGFKESFKACC-GTGDPYNFEVYAVCGTPSASACPSPSQYINWDGVHLT  359

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K L ++ LN     PPFS +++ K
Sbjct  360  EAMYKVLTDMFLNGKATHPPFSYLLDMK  387



>gb|AES91099.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=380

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 159/268 (59%), Gaps = 6/268 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++ E++  N   + +    P + Q+QI WF+K+L+S+GC    D++CK 
Sbjct  115  GVNFAVAGSTAINHEFFVRN---NLSLDITPQSIQTQILWFNKYLESQGC-QGVDSKCK-  169

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            D D  LFW G +GV+DY      S V+   I +L +   +  LQ++L +GAK++VVQG P
Sbjct  170  DFDETLFWFGEIGVNDY-AYTLGSTVSEDTIRKLAMSSVSGALQSLLEKGAKYLVVQGHP  228

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
            P GC  +++   P    D +GC    N   + HN +LQ  ++ FR+Q+P   I+YA+Y+ 
Sbjct  229  PTGCLTLTMYLAPEDDRDDLGCVKSANDLSNNHNLMLQARLQEFRKQYPHAVIVYADYFN  288

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  Y FK+    CCG G   +NF      GT  AT C+ P  YI+WDG+HL+
Sbjct  289  AYRTVMKNPSKYGFKDLFSVCCGSGEPPYNFTVFETCGTPNATVCTSPSQYINWDGVHLT  348

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K ++ + L  +Y +PPF  ++  K
Sbjct  349  EAMYKVVSNMFLQGNYSQPPFDFLLENK  376



>gb|ACU17921.1| unknown [Glycine max]
Length=380

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/271 (38%), Positives = 165/271 (61%), Gaps = 8/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++  ++     H+ +    P + Q+Q+ WF+++L+S+ C    +++C  
Sbjct  117  GVNFAVAGSTAINHLFFVK---HNLSLDITPQSIQTQMIWFNRYLESQDCQ---ESKCN-  169

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            D D+ LFW G +GV+DY      S V+   I +L I   +  LQT+L +GAK++VVQGLP
Sbjct  170  DFDDTLFWFGEIGVNDY-AYTLGSTVSDETIRKLAISSVSGALQTLLEKGAKYLVVQGLP  228

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +S+   PP   D +GC   +N+    HN +LQ  ++ FR+Q+PQ  I+YA+Y+ 
Sbjct  229  LTGCLTLSMYLAPPDDRDDIGCVKSVNNQSYYHNLVLQDKLQEFRKQYPQAVILYADYYD  288

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  + FKET   CCG G   +NF   +  GT  AT CS P  +I+WDG+HL+
Sbjct  289  AYRTVMKNPSKFGFKETFNVCCGSGEPPYNFTVFATCGTPNATVCSSPSQHINWDGVHLT  348

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
             AM K ++ + L  ++ +PPF+ ++ KK  +
Sbjct  349  EAMYKVISSMFLQGNFTQPPFNFLLGKKERV  379



>ref|XP_007155513.1| hypothetical protein PHAVU_003G208000g [Phaseolus vulgaris]
 gb|ESW27507.1| hypothetical protein PHAVU_003G208000g [Phaseolus vulgaris]
Length=382

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 164/268 (61%), Gaps = 8/268 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++  ++  N   + +    P + Q+Q+ WF+++L+S+ C    +++CK 
Sbjct  119  GVNFAVAGSTAINHLFFVKN---NLSLDITPQSIQTQMIWFNRYLESQECE---ESKCK-  171

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            D D+ LFW G +GV+DY      S V    I +L I   +  LQ +L +GAK++VVQGLP
Sbjct  172  DFDDTLFWFGEIGVNDY-AYTLGSTVPDDTIRKLAISSVSGALQALLEKGAKYLVVQGLP  230

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +S+   PP   D++GC   +N+  + HN +LQ  ++ FR+Q+PQ  I+YA+Y+ 
Sbjct  231  LSGCLTLSMYLAPPDDRDEIGCVKSVNNQSNYHNLVLQNKLQEFRKQYPQAVILYADYFN  290

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  I  NP  Y FKE    CCG G   +NF      GT  AT C++P  YI+WDG+HL+
Sbjct  291  AYRTIMKNPTKYGFKEVFNVCCGSGEPPYNFSVFGTCGTPNATACTNPSQYINWDGVHLT  350

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K ++ + L  ++ +PPF+ ++ +K
Sbjct  351  EAMYKVISSMFLQGNFTQPPFNFLLAQK  378



>ref|XP_011084056.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Sesamum indicum]
Length=385

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 160/270 (59%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGC--SNAADARC  294
            G+NFA+AG+T++ + ++  N   + ++  +  + Q+Q+  F+K L+ +GC  S  +   C
Sbjct  116  GVNFAVAGATAIRQSFFLKN---NISFNLVAQSLQTQLVRFNKLLEGEGCKDSRTSPREC  172

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +A +++AL W+G +G +DY      S ++ + I  L +   T  LQ +L +GAK+I+VQG
Sbjct  173  RAALNDALIWVGEIGANDY-TCSLGSSLSSKTIQALALDSVTVFLQALLNKGAKYIIVQG  231

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LPP GC   S +   P   D+MGC + +N     HN  LQ  +   R+Q+P+  I+YA+Y
Sbjct  232  LPPTGCITYSFAIASPDDRDEMGCVASVNRITSTHNVALQAKLRSLRKQYPKSVIVYADY  291

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            + + L +  N   Y FKE  K CCG GGG +NFD  +  G+  +  C++P  YI+WDG H
Sbjct  292  YNSHLRVVKNARKYGFKEQYKVCCGHGGGPYNFDIFNTCGSQSSRSCTNPSEYINWDGAH  351

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ A+NK L  L LN  YC PPF  ++ KK
Sbjct  352  LTEAVNKVLTNLFLNGTYCSPPFDYLLRKK  381



>ref|XP_004152509.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Cucumis sativus]
 ref|XP_004157767.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Cucumis sativus]
 gb|KGN64371.1| hypothetical protein Csa_1G050100 [Cucumis sativus]
Length=406

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 166/269 (62%), Gaps = 6/269 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGC-SNAADARCK  297
            G+NFA+AGST+++ E+Y  N   + +    P + Q+Q+ WF+KFL+++GC      A+C+
Sbjct  141  GVNFAVAGSTAINHEFYVRN---NLSIDITPQSIQTQLLWFNKFLETQGCRGEETKAQCE  197

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
            A  D+AL W+G +GV+DY      S ++   I +L +   T +LQ++L +GAK++VVQGL
Sbjct  198  AAFDDALLWVGEIGVNDY-AYSFGSPISPDTIRKLGVASVTGVLQSLLKKGAKYMVVQGL  256

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PP GC  +S+S       D +GC   +N+   +H+  LQ  ++  RRQFP+  IIYA+YW
Sbjct  257  PPSGCLALSMSLASVDDRDDIGCVRSLNNQTYVHSMALQASLQSLRRQFPEAVIIYADYW  316

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+  +  NP  Y F E  KACC G G  +NF+  ++ G S  + C  P  YI+WDG+HL
Sbjct  317  NAYRTVIKNPNKYGFSERFKACC-GVGEPYNFELFTVCGMSSVSSCKTPSEYINWDGVHL  375

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            + AM K + ++L+   +  PPFS +++ K
Sbjct  376  TEAMYKVVHDMLIEGGFTHPPFSNLLDMK  404



>ref|XP_009333827.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Pyrus x bretschneideri]
Length=392

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/268 (40%), Positives = 157/268 (59%), Gaps = 8/268 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST++  E++  N   + +    P + Q+Q+ WF+K L+SKGC       CK 
Sbjct  129  GVNFAVAGSTAIEHEFFVKN---NLSLDITPQSIQTQLLWFNKLLESKGC-KVGGPSCK-  183

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
              D+ALFW+G +GV+DY       +     I +L +   T  LQ +L +GAK++VVQGLP
Sbjct  184  -FDDALFWVGEIGVNDYAYTLGSDVTG-DTIQKLGVSRVTSFLQALLKKGAKYVVVQGLP  241

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P+++S       D++GC   +N+    HN +LQ  +   R QFP   I YA+YW 
Sbjct  242  LSGCLPLAMSLAQEDDRDRIGCVKSVNNQTYSHNLVLQAKLHELRTQFPHAVIAYADYWN  301

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  +P  Y FKE  KACC G G  +NFD ++  GT  AT C  P  YI+WDG+HL+
Sbjct  302  AYFTVMKSPSQYGFKERFKACC-GSGDPYNFDVSATCGTPSATVCKSPSQYINWDGVHLT  360

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K L++  L  +   PPFS ++++K
Sbjct  361  EAMYKVLSDTFLKGNATHPPFSYLLDRK  388



>ref|XP_002274810.1| PREDICTED: GDSL esterase/lipase At3g48460 [Vitis vinifera]
Length=384

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 157/269 (58%), Gaps = 7/269 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAA-DARCK  297
            G+NFA+AGST++  E++  N   + T    P + Q+Q+ WF++FL+ +GC  A  ++ C 
Sbjct  118  GVNFAVAGSTAIPHEFFVKN---NLTLDITPQSIQTQLIWFNEFLEKQGCRGATKNSGCT  174

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
               D+ LFW+G +G +DY      S+     I +L I   T  LQ +L +G K++VVQGL
Sbjct  175  --FDDTLFWVGEIGANDYAYTVGSSVPGST-IQELGIKSITSFLQALLKKGVKYLVVQGL  231

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PP GC  ++++  P    D +GC   +N     HN +LQ  +   R QFP   I+YA+YW
Sbjct  232  PPTGCLTLALTLAPDDDRDAIGCVGSVNKQSYSHNTILQAKLHDLRVQFPHAVIVYADYW  291

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+  I  N   Y FKE  K CCG GG  +NFD  +  G+S A+ C +P  YI+WDG+HL
Sbjct  292  NAYHTIMKNGDRYGFKEPFKTCCGSGGDPYNFDVFATCGSSSASACPNPSQYINWDGVHL  351

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            + AM K +A   L+  +C PPF  ++++K
Sbjct  352  TEAMYKVVANSFLHGGFCHPPFDYLLSRK  380



>emb|CBI14877.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 157/269 (58%), Gaps = 7/269 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAA-DARCK  297
            G+NFA+AGST++  E++  N   + T    P + Q+Q+ WF++FL+ +GC  A  ++ C 
Sbjct  145  GVNFAVAGSTAIPHEFFVKN---NLTLDITPQSIQTQLIWFNEFLEKQGCRGATKNSGCT  201

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
               D+ LFW+G +G +DY      S+     I +L I   T  LQ +L +G K++VVQGL
Sbjct  202  --FDDTLFWVGEIGANDYAYTVGSSVPGST-IQELGIKSITSFLQALLKKGVKYLVVQGL  258

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PP GC  ++++  P    D +GC   +N     HN +LQ  +   R QFP   I+YA+YW
Sbjct  259  PPTGCLTLALTLAPDDDRDAIGCVGSVNKQSYSHNTILQAKLHDLRVQFPHAVIVYADYW  318

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+  I  N   Y FKE  K CCG GG  +NFD  +  G+S A+ C +P  YI+WDG+HL
Sbjct  319  NAYHTIMKNGDRYGFKEPFKTCCGSGGDPYNFDVFATCGSSSASACPNPSQYINWDGVHL  378

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            + AM K +A   L+  +C PPF  ++++K
Sbjct  379  TEAMYKVVANSFLHGGFCHPPFDYLLSRK  407



>ref|XP_010250902.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Nelumbo nucifera]
Length=400

 Score =   206 bits (525),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 160/270 (59%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAA-DARCK  297
            G+NFA+AGST++  +++  N   + T    P +  +Q+ WF++ L+  GC  +   A+C+
Sbjct  131  GVNFAVAGSTAIDHDFFVRN---NLTLNRTPQSLHTQLTWFNELLEGHGCGGSTLSAQCR  187

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
            A++  ALFW+G +G +DY  +   S V+   +  L I+  T+ LQ +L +GAK+IVVQGL
Sbjct  188  AELGEALFWVGEIGANDYAYLFG-STVSQTLVQDLAINSVTRFLQELLKKGAKYIVVQGL  246

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC  ++++  PP   D +GC    N    +HN  LQ  ++  RRQ P   I+YA+Y+
Sbjct  247  PMTGCLSLAMTLAPPNDRDDVGCVRSSNMQSRMHNTALQNKLQELRRQHPDAIIVYADYF  306

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIH  834
             A+  +  NP  Y FKE  K CCG GG  +N D  +  G+  A K C +P  +I+WDG+H
Sbjct  307  NAYSTVVKNPVKYGFKEKFKTCCGSGGDPYNLDPFATCGSPAALKACPNPAQFINWDGVH  366

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ AM K +AEL L+  Y  PP + +++ K
Sbjct  367  LTEAMYKTVAELFLHGGYTRPPLNILISHK  396



>ref|XP_002511260.1| Esterase precursor, putative [Ricinus communis]
 gb|EEF51862.1| Esterase precursor, putative [Ricinus communis]
Length=387

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 156/270 (58%), Gaps = 6/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGC--SNAADARC  294
            G+NFA+AGST+++  ++  N   + T    P + Q+QI WF+++L+ +GC  S ++   C
Sbjct  118  GVNFAVAGSTAINHAFFEKN---NLTLDITPQSIQTQIIWFNEYLEKQGCNGSVSSSPEC  174

Query  295  KADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +A    AL W+G +G +DY      S V+   I +L I   T  LQ +L++G K++VVQG
Sbjct  175  RAAFGEALIWVGEIGANDYVYTIGSS-VSSDTIRKLAISSVTAFLQALLSKGVKYVVVQG  233

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LPP GC  ++++  P    D +GC   +N+    HN + Q  +   RRQFP  TI Y +Y
Sbjct  234  LPPTGCLTLAMTLAPEYDRDDIGCVKSVNNQTSTHNDVYQATLGDLRRQFPNATIAYLDY  293

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W A+  +  NP  Y FKE  KACCG     +NF   +  GT+ A+ C +P  YI+WDG+H
Sbjct  294  WNAYRTVMKNPAAYGFKEPFKACCGSSDPPYNFSVFATCGTTSASACPNPAQYINWDGVH  353

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ AM K L  + L   Y  PPF  ++++K
Sbjct  354  LTEAMYKVLTGMFLYGTYSRPPFEYLLSRK  383



>gb|KHN34384.1| GDSL esterase/lipase [Glycine soja]
Length=373

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 163/271 (60%), Gaps = 8/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++  ++     H+ +      + Q+Q+ WF+++L+S+ C    +++C  
Sbjct  110  GVNFAVAGSTAINHLFFVK---HNLSLDITAQSIQTQMIWFNRYLESQECQ---ESKCN-  162

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            D D+ LFW G +GV+DY      S V+   I +L I   +  LQT+L +GAK++VVQG+P
Sbjct  163  DFDDTLFWFGEIGVNDY-AYTLGSTVSDETIRKLAISSVSGALQTLLEKGAKYLVVQGMP  221

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +S+   PP   D + C   +N+    HN +LQ  ++ FR+Q+PQ  I+YA+Y+ 
Sbjct  222  LTGCLTLSMYLAPPDDRDDIRCVKSVNNQSYYHNLVLQDKLQEFRKQYPQAVILYADYYD  281

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  Y FKET   CCG G   +NF   +  GT  AT CS P  YI+WDG+HL+
Sbjct  282  AYRTVMKNPSKYGFKETFNVCCGSGEPPYNFTVFATCGTPNATVCSSPSQYINWDGVHLT  341

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
             AM K ++ + L  ++ +PPF+ ++ KK  +
Sbjct  342  EAMYKVISSMFLQGNFTQPPFNFLLEKKERV  372



>ref|XP_003525626.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Glycine max]
Length=380

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 163/271 (60%), Gaps = 8/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++  ++     H+ +      + Q+Q+ WF+++L+S+ C    +++C  
Sbjct  117  GVNFAVAGSTAINHLFFVK---HNLSLDITAQSIQTQMIWFNRYLESQECQ---ESKCN-  169

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            D D+ LFW G +GV+DY      S V+   I +L I   +  LQT+L +GAK++VVQG+P
Sbjct  170  DFDDTLFWFGEIGVNDY-AYTLGSTVSDETIRKLAISSVSGALQTLLEKGAKYLVVQGMP  228

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +S+   PP   D + C   +N+    HN +LQ  ++ FR+Q+PQ  I+YA+Y+ 
Sbjct  229  LTGCLTLSMYLAPPDDRDDIRCVKSVNNQSYYHNLVLQDKLQEFRKQYPQAVILYADYYD  288

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  Y FKET   CCG G   +NF   +  GT  AT CS P  YI+WDG+HL+
Sbjct  289  AYRTVMKNPSKYGFKETFNVCCGSGEPPYNFTVFATCGTPNATVCSSPSQYINWDGVHLT  348

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
             AM K ++ + L  ++ +PPF+ ++ KK  +
Sbjct  349  EAMYKVISSMFLQGNFTQPPFNFLLEKKERV  379



>ref|XP_004515840.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Cicer arietinum]
Length=378

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 159/268 (59%), Gaps = 8/268 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++  ++  N   + +    P + Q+Q+ WF+++LQ +GC    +++C  
Sbjct  115  GVNFAVAGSTAINHAFFVMN---NLSLDITPQSIQTQMLWFNRYLQKQGC---VESKCN-  167

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            D D  LFW G +GV+DY      S ++   I +L I   +  LQT+L +GAK+IVV+G P
Sbjct  168  DFDETLFWFGEIGVNDY-AYRLGSTISNDTIRKLAISSVSGALQTLLQKGAKYIVVEGFP  226

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
            P GC  +++        D++GC    N   + HN LLQ  I+ FR+Q+P   I+YA+YW+
Sbjct  227  PTGCLTLAMYLASEDDRDEIGCVKSANDESNAHNLLLQSKIQEFRKQYPHAVIVYADYWE  286

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  Y FK+    CCG G   +NF   +  GT  AT C+ P  YI+WDG+HL+
Sbjct  287  AYRTVMKNPAKYGFKDLFTVCCGSGEPPYNFSVFATCGTPNATVCTSPSHYINWDGVHLT  346

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K ++ + L  ++ +PPF+ ++  K
Sbjct  347  EAMYKVVSNMFLQGNFTQPPFNFLLETK  374



>gb|EYU40119.1| hypothetical protein MIMGU_mgv1a021460mg [Erythranthe guttata]
Length=381

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 155/276 (56%), Gaps = 12/276 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADAR---  291
            G+NFA+ G  ++   ++     H+ ++  +P + Q+Q+ WF K   +KGC    D R   
Sbjct  106  GVNFAVGGGCAIRYGFFVK---HNVSFNLVPQSLQTQLVWFTKIAAAKGCKLQLDRRSPA  162

Query  292  -----CKADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAK  456
                 C A + +AL W+G +G +DY      S V ++ I  L ++     LQ +L  GAK
Sbjct  163  TPSKECAAVLGDALIWMGEIGANDYTSSLGSS-VPIKTIQTLAVNSVVGFLQVLLNNGAK  221

Query  457  HIVVQGLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT  636
            +IVVQGLPP GC   + +   P+  D  GC +  N     HN  L+  ++  R+Q+P+  
Sbjct  222  YIVVQGLPPTGCATYTFALSSPEDRDADGCVASSNRIALGHNAALKAKLDSLRKQYPEAV  281

Query  637  IIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            I+YA+Y+ A L +  NP  Y   E  KACCG GGGEFNFD  +  GT+ +  C++P  YI
Sbjct  282  ILYADYYNAHLTVLRNPRKYGIVERYKACCGFGGGEFNFDIFNTCGTASSAACANPSEYI  341

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            +WDG H + AMNK LA    N  YC+PPFS +++KK
Sbjct  342  NWDGAHFTEAMNKVLANSFFNGTYCDPPFSYLLSKK  377



>ref|XP_010248800.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Nelumbo nucifera]
Length=403

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 162/274 (59%), Gaps = 9/274 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSN----AADA  288
            G+NFA+AGST++  +++  N     T  + P +  +Q+ WF+KFL+  GC      ++ A
Sbjct  131  GVNFAVAGSTAIDHDFFVINN---LTLDSTPQSLHTQLTWFNKFLEDNGCGGTTTLSSSA  187

Query  289  RCKADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             C+  +D+ALFW+G +GV+DY  +   S V+   I  L I+  T  LQ +L  GAK++VV
Sbjct  188  ECRRALDDALFWVGEIGVNDYAYL-VGSTVSPTTIQDLAINSITGFLQELLKRGAKYVVV  246

Query  469  QGLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYA  648
            QGLP  GC  +++        D +GC   IN    +HN  LQ  ++  RRQ+P   I YA
Sbjct  247  QGLPMTGCLSMAMEFSLLTDRDDVGCVGSINMLSSMHNSALQDKLQGLRRQYPDAIIAYA  306

Query  649  NYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGA-TKCSDPDSYISWD  825
            +Y+ A+ AI  N   Y F+E  K CCG GG  +NF   +  G+  A T CS+P  +I+WD
Sbjct  307  DYFSAYHAIIKNHHKYGFQEPFKTCCGSGGDPYNFVPFATCGSPAASTACSNPAQFINWD  366

Query  826  GIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKKT  927
            G+HL+ AM K  A+L L++ Y  PPFS +++++T
Sbjct  367  GVHLTEAMYKATADLFLHRSYSHPPFSVLMSRRT  400



>ref|XP_009385138.1| PREDICTED: GDSL esterase/lipase At3g48460 [Musa acuminata subsp. 
malaccensis]
Length=386

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 153/270 (57%), Gaps = 5/270 (2%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST++  +++  N     T    P +  +Q+ WF K+L+ KGC      RC+A
Sbjct  118  GVNFAVAGSTAIEHDFFVKNNV---TIDITPQSLMTQLMWFDKYLEEKGCKTKGSRRCRA  174

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               +ALFW+G +G +DY      S ++   I QL +      ++ +L  GAK+IVVQGLP
Sbjct  175  ATADALFWVGEIGANDY-AYGFTSTLSPTVIQQLAVKKVFDFVEALLIRGAKYIVVQGLP  233

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P++++  P    D +GC + +N     HN ++Q  ++  R +FP+  I YA++  
Sbjct  234  LTGCLPLTLTLAPSDDRDDIGCVASVNRQSYNHNAIVQNELQELRDRFPEAIISYADFLG  293

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIHL  837
            A   +  +P  Y F E  K CCG GG  +NFD  +  G+   T  C +P+ +I+WDG+HL
Sbjct  294  AHHNVMKHPAAYGFTEKLKVCCGSGGDPYNFDLFATCGSPNVTTACPEPNKFINWDGVHL  353

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKKT  927
            + AM K +A++  +  YC+P F  ++  K+
Sbjct  354  TEAMYKVVADVFFHHGYCKPSFDVLLTAKS  383



>ref|XP_010696197.1| PREDICTED: GDSL esterase/lipase At3g48460 [Beta vulgaris subsp. 
vulgaris]
Length=415

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 158/271 (58%), Gaps = 7/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAAD---AR  291
            G+NFA+AGST++   ++  N   + T    P +  +Q+ WF K+L+ +GCS+       +
Sbjct  145  GVNFAVAGSTAIEHRFFVKN---NLTLNITPESLGTQLGWFSKYLEKQGCSDQHKNDPMK  201

Query  292  CKADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
            C    D+AL W+G +G +DY    S++ V  R +  L I   +  L+ +L +GAKH+VVQ
Sbjct  202  CSVLFDDALVWVGEIGANDY-AYASETDVNKRALQSLAITRISNFLEAILKKGAKHVVVQ  260

Query  472  GLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYAN  651
            GLPP GC  +++   P    D +GC   +N+    HN LLQ  ++  R+QFP+  I+YA+
Sbjct  261  GLPPTGCLTLAMYLAPSDDRDDLGCVRSVNTQSYTHNTLLQAKLQDLRKQFPRSLIVYAD  320

Query  652  YWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGI  831
            Y+ A+  I  +   Y FKE  K CCG G   +N+D  +  G+  ++ C  P  YI+WDG+
Sbjct  321  YYNAYRDIMKSSSKYGFKEAFKTCCGSGNEPYNYDFFAACGSPSSSPCPYPSQYINWDGV  380

Query  832  HLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            HL+ AM K ++ LLL   Y  PPF +++N+K
Sbjct  381  HLTEAMYKVVSGLLLQGGYSHPPFQDLLNRK  411



>ref|XP_010101939.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB90587.1| GDSL esterase/lipase [Morus notabilis]
Length=384

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 161/270 (60%), Gaps = 8/270 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST++  +++  N   + T    P + Q+Q+ WF+K+L+S GC N  D RC+A
Sbjct  117  GVNFAVAGSTAIEYDFFVKN---NLTLDITPQSIQTQLLWFNKYLESLGCKNL-DWRCEA  172

Query  301  -DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
             + D++LFW+G +GV+DY      S ++   I +L +   T  L  +L +GAK++VVQGL
Sbjct  173  AEFDDSLFWVGEIGVNDY-AYTVGSTISQDTIRELAVGRFTGFLTALLNKGAKYVVVQGL  231

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC P++++  P    D +GC   +N+    HN  +   ++  RRQFP   I +A+YW
Sbjct  232  PMTGCLPLAMTLAPEDDRDDIGCVKSVNNQSYTHNLAILNKLKDIRRQFPHAVITFADYW  291

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGT-SGATKCSDPDSYISWDGIH  834
             A+  +  NPG +   E  KACC G G  +NF+  +  GT S  T C +P  YI+WDG+H
Sbjct  292  SAYRRVMQNPGQFGMTERFKACC-GLGDPYNFEVFTTCGTPSVKTACKNPSQYINWDGVH  350

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+  M K ++++ L      PPF+ +++KK
Sbjct  351  LTEGMYKVVSDMFLKGRLSYPPFNYLLDKK  380



>gb|ADN33970.1| lipase [Cucumis melo subsp. melo]
Length=354

 Score =   195 bits (495),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/269 (38%), Positives = 156/269 (58%), Gaps = 30/269 (11%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGC-SNAADARCK  297
            G+NFA+AGST+++ E+Y  N   + +  N P + Q+Q+ WF+KFL+++GC      A+CK
Sbjct  111  GVNFAVAGSTAINHEFYVRN---NLSIDNTPQSIQTQLLWFNKFLETQGCRGEETKAQCK  167

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
            A  D+ALF L  L          +S++ +  IS L              +GAK++VVQGL
Sbjct  168  AAFDDALFGLVKL----------ESMIML--ISLL-------------KKGAKYMVVQGL  202

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            PP GC  +S+S       D +GC   +N+   +H+  LQ  ++  RRQFP+  IIYA+YW
Sbjct  203  PPSGCLALSMSLASVDDRDDIGCVRSLNNQTYVHSMALQASLQSLRRQFPEAVIIYADYW  262

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+  +  NP  Y F+E  KACC G G  +NF+  ++ G S  + C  P  YI+WDG+HL
Sbjct  263  NAYRTVIKNPSKYGFRERFKACC-GVGEPYNFELFTVCGMSSVSSCKTPSEYINWDGVHL  321

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            + AM K + ++L+   +  PPFS +++ K
Sbjct  322  TEAMYKVVHDMLIEGGFTHPPFSYLLDMK  350



>emb|CBI27521.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   191 bits (484),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 131/213 (62%), Gaps = 1/213 (0%)
 Frame = +1

Query  292  CKADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
            CK  ++N+LFW+G LG+ DY + +  S V+++ +  L +  T +L++ +L  GAK+IVVQ
Sbjct  6    CKGQLENSLFWVGELGMYDYSRTYGSS-VSIKWLIDLSVSSTCRLVKALLDRGAKYIVVQ  64

Query  472  GLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYAN  651
             LPP GC P  IS  P    D +GC    N+    HN+LLQ  +   ++Q+P   I YA+
Sbjct  65   SLPPTGCLPFDISLSPVSDHDNLGCADTANTVTQTHNELLQAKLAEQQKQYPDSIIAYAD  124

Query  652  YWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGI  831
             W A+  +  NP  + F E  KACCG G G+ NFD  S+ G      CSDP  +I+WDG+
Sbjct  125  IWNAYYTVLKNPSQFGFSEPFKACCGCGKGDLNFDLRSLCGARNTRVCSDPSKHITWDGV  184

Query  832  HLSGAMNKHLAELLLNKDYCEPPFSEMVNKKTS  930
            HL+ AM+  LA+LLLNK YC+P F ++V KK S
Sbjct  185  HLTEAMHHVLADLLLNKGYCKPSFDQLVKKKRS  217



>gb|EYU40122.1| hypothetical protein MIMGU_mgv1a007918mg [Erythranthe guttata]
Length=391

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 158/272 (58%), Gaps = 8/272 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFL-QSKGCSNAADA--R  291
            G+NFA+AGST++   +++ N   + +    P + ++++ WF K L + KGC ++      
Sbjct  120  GVNFAVAGSTAIVHSFFSKN---NMSLNITPQSIRTELDWFDKLLLEGKGCRDSVTTPEE  176

Query  292  CKADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
            C    ++AL W G +G +DY      S V  + I +L I+  T  L+ +L +GAK++VVQ
Sbjct  177  CARVFNDALIWAGEIGANDYAYSFGSS-VPTKTIQELAINSVTSFLEALLKKGAKYVVVQ  235

Query  472  GLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYAN  651
            GLPP GC  +S+   P    D  GC   +N+    HN  L+  +  FR+QFP+ TI+YA+
Sbjct  236  GLPPTGCLTLSMYLAPSDDRDSFGCVGSVNNQSYAHNVALKAKLRLFRKQFPKSTIVYAD  295

Query  652  YWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGI  831
            Y+ A+L +  N   Y  K     CCG G G +NFD     G+  +T C +P+ Y++WDG+
Sbjct  296  YYNAYLDVIRNAEKYGIKNLYGVCCGYGNGTYNFDYFHACGSPSSTSCGNPNEYVNWDGV  355

Query  832  HLSGAMNKHLAELLLN-KDYCEPPFSEMVNKK  924
            HL+ AM K +A+L LN   Y +PPFS +++KK
Sbjct  356  HLTEAMYKAVADLFLNGTTYMQPPFSYLLSKK  387



>ref|XP_008361146.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At3g48460-like, 
partial [Malus domestica]
Length=232

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 136/233 (58%), Gaps = 5/233 (2%)
 Frame = +1

Query  226  SQIAWFHKFLQSKGCSNAADARCKADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLC  405
            +Q+ WF+KFLQSKGC      RCK   D+ALFW G +GV+DY      S V    I +L 
Sbjct  1    TQLLWFNKFLQSKGC-KVGGPRCK--FDDALFWXGEIGVNDYAYTLG-SDVPGDTIQKLG  56

Query  406  IHHttqllqtvltEGAKHIVVQGLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNK  585
            I   T  LQ +L +GAK +VVQGLP  GC P+S++  P    D++GC   +N     HN 
Sbjct  57   ISRVTSFLQALLKKGAKXVVVQGLPLSGCLPLSMTLAPEDDRDRIGCVKSVNHQTYSHNL  116

Query  586  LLQKMIERFRRQFPQCTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNS  765
            +LQ  +   R QFP   I YA+YW A+L +  +P  Y F E  KACC G G  +NFD ++
Sbjct  117  VLQAKLHELRTQFPHAVIAYADYWNAYLTVMKSPSQYGFTERFKACC-GSGDPYNFDVSA  175

Query  766  MRGTSGATKCSDPDSYISWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
              G   AT C  P  YI+WDG+HL+ AM K L++  L  +   PPFS ++++K
Sbjct  176  TCGXPSATVCKSPSQYINWDGVHLTEAMYKVLSDTFLKGNATHPPFSYLLDRK  228



>ref|XP_004301038.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Fragaria vesca 
subsp. vesca]
Length=375

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/268 (37%), Positives = 157/268 (59%), Gaps = 12/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+++ +++  N   + T    P +  SQ+ WF+KFL+++G   A+      
Sbjct  118  GVNFAVAGSTAINHDFFVKN---NLTLDITPQSIMSQLNWFNKFLETQGSKAAS------  168

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
              D+ALFW+G +GV+DY      +I     I +L I   T  LQ +L +GAK++VVQGLP
Sbjct  169  -FDDALFWVGEIGVNDYAYTLGSTIPG-DTIQKLGISSVTSFLQALLKKGAKYVVVQGLP  226

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P++++       D +GC   +N+    HN +LQ  ++  R+QFP   I YA+YW 
Sbjct  227  TSGCLPLAMTLASEDDRDSIGCVKSVNNQSYSHNLVLQAKLQDLRKQFPHAVITYADYWN  286

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+ ++  NP  Y FKE+ KACC G G  +NF+  +  G    + CS P  YI+WDG+HL+
Sbjct  287  AYYSVMKNPSQYGFKESFKACC-GSGDPYNFNVFATCGAPSVSACSKPSQYINWDGVHLT  345

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K + ++ ++     PP S +++ +
Sbjct  346  EAMYKVITDMFVSGKETHPPCSYLLDMR  373



>emb|CAN62554.1| hypothetical protein VITISV_031355 [Vitis vinifera]
Length=385

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 152/270 (56%), Gaps = 8/270 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAA-DARCK  297
            G+NFA+AGST++  E++  N   + T    P + Q+Q+ WF++FL+ +GC  A  ++ C 
Sbjct  118  GVNFAVAGSTAIPHEFFVKN---NLTLDITPQSIQTQLIWFNEFLEKQGCRGATKNSGCT  174

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
               D+ LFW+G +G +DY      S+     I +L I   T  LQ +L +G K++VVQGL
Sbjct  175  --FDDTLFWVGEIGANDYAYTVGSSVPGST-IQELGIKSITSFLQALLKKGVKYLVVQGL  231

Query  478  PPIGCFPVSISS-CPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            PP G     +         D +GC   +N     HN +LQ  +   R QFP   I+YA+Y
Sbjct  232  PPTGMSHTGLEHWLLNDDRDAIGCVGSVNKQSYSHNTILQAKLHDLRVQFPHAVIVYADY  291

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W A+  I  N   Y FKE  K CCG GG  +NFD  +  G+S A+ C +P  YI+WDG+H
Sbjct  292  WNAYHTIMKNGDRYGFKEPFKTCCGSGGDPYNFDVFATCGSSSASACPNPSQYINWDGVH  351

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ AM K +A   L+  +C PPF  ++++K
Sbjct  352  LTEAMYKVVANSFLHGGFCHPPFDYLLSRK  381



>gb|KDP22802.1| hypothetical protein JCGZ_00389 [Jatropha curcas]
Length=421

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/269 (38%), Positives = 155/269 (58%), Gaps = 9/269 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHS-FTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCK  297
            G+NFA++GST++  E++  N   S F  T+I    Q+QI  F++FL+ KGC  +  +  +
Sbjct  117  GLNFAVSGSTAIEHEFFVKNNISSAFNLTSI----QNQINCFNEFLEKKGCKGSVSSSSE  172

Query  298  AD--IDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
                ++++L W G  G +DY  I   S  +   I +  +      +Q +L++G K I VQ
Sbjct  173  CSGLLEDSLIWFGETGANDY-AISFPSSFSKDTIREHAVSSAITAIQALLSKGLKSIAVQ  231

Query  472  GLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYAN  651
            GLPPIGC   ++   PP   D +GC  + N+  + HN L Q+ +E  R+QFP   I+Y +
Sbjct  232  GLPPIGCLTANLFVAPPNDKDDIGCGKNGNNQSNTHNVLYQEKLEELRKQFPNAIIVYLD  291

Query  652  YWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDG  828
            Y+KA++    N  +Y FKE   ACCG G    NF   +  GT+  T  C++P+ YI+WDG
Sbjct  292  YYKAYIDTVKNAESYGFKEKFMACCGSGNPPLNFTLPASCGTANTTSACANPNEYINWDG  351

Query  829  IHLSGAMNKHLAELLLNKDYCEPPFSEMV  915
            +HL+ AMNK LA + LN  Y +PPF  ++
Sbjct  352  VHLTEAMNKVLANMFLNGTYSQPPFQSLL  380



>ref|XP_010550714.1| PREDICTED: GDSL esterase/lipase At3g48460 [Tarenaya hassleriana]
Length=375

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 157/271 (58%), Gaps = 10/271 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T++   ++  N   + +    P + ++Q+ WF  +L++ G     D R   
Sbjct  115  GVNFAVSGATAIKHAFFVKN---NLSLDMTPESIETQLGWFESYLETLGV----DQRVSV  167

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
             ++++LFW+G +GV+DY      S+ +   I  L I   T  L+ +L +G K+++VQG P
Sbjct  168  -LEDSLFWIGEIGVNDYAYTVGSSM-SEDTIRTLGIASFTNFLEALLKKGVKYMLVQGHP  225

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC   +N+    HN +LQ  + + R QFP+ TI+YA+YW 
Sbjct  226  ATGCLTLTLSLAAEDDRDSLGCVRSVNNQSYTHNLVLQSKLRQLRLQFPEATIVYADYWN  285

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+ A+  NP  Y  +E  KACC G G  +NF+     G+  AT C DPD YI+WDG+HL+
Sbjct  286  AYRAVVRNPEKYGIRERFKACC-GTGEPYNFEVFMTCGSPFATACEDPDRYINWDGVHLT  344

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKKTSI  933
             AM + LA++ +N  +  PPF  ++ KK ++
Sbjct  345  EAMYEVLADMFVNGTFTRPPFGYLLKKKLNL  375



>gb|EEE60284.1| hypothetical protein OsJ_13340 [Oryza sativa Japonica Group]
Length=340

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 153/271 (56%), Gaps = 13/271 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T++  E++  N   + +    P +  +++AWF   L+     + A AR   
Sbjct  76   GVNFAVAGATAIEHEFFARN---NLSVDITPQSIMTELAWFEAHLRR----SPAAARAVG  128

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
            D   ALFW+G +G +DY +   + + +    I  + +   T  ++ +L +GAK+I+VQGL
Sbjct  129  D---ALFWVGEIGANDYAYSFMAATTIPQDQIRNMAVDRLTTFIEALLKKGAKYIIVQGL  185

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC P++++   P+  D + C + +N     HN+ LQ  + R RRQ P   I YA+Y+
Sbjct  186  PLTGCLPLTMTLARPEDRDNISCAATVNQQSHAHNRRLQASLRRLRRQHPAAVIAYADYY  245

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIH  834
             A LA+   P  Y F E  K CCG GGG +NF+  S  G+   T  C+ P  Y++WDG+H
Sbjct  246  AAHLAVMAAPARYGFTEPFKTCCGAGGGAYNFEIFSTCGSPEVTTACAQPAKYVNWDGVH  305

Query  835  LSGAMNKHLAELLL-NKDYCEPPFSEMVNKK  924
            ++ AM + +A +   +  YC PPFS ++ ++
Sbjct  306  MTEAMYRVVAGMFFQDGRYCHPPFSTLLARR  336



>ref|XP_010100310.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB82444.1| GDSL esterase/lipase [Morus notabilis]
Length=211

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 132/207 (64%), Gaps = 3/207 (1%)
 Frame = +1

Query  310  NALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLPPIG  489
            N LFW+G +G SDY +++  SI +   +++L + H  ++L+ ++  GAK+I+VQGL P+G
Sbjct  3    NTLFWIGGIGSSDYSRMYGSSIKSQY-LNKLSVIHACKILKALINNGAKYIMVQGLRPMG  61

Query  490  CFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWKAFL  669
            C P  +S C P   D+ GC++  N+ I  HN LLQ+ +E FR ++P   I Y + + A+ 
Sbjct  62   CLPSQLSRCSPSDRDKSGCSAKANAVIIAHNTLLQQKLEHFRHKYPDRIISYVDTYGAYQ  121

Query  670  AIFNNPGNYNFKETKKACCGG--GGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLSG  843
             I  N  +Y+F+E  KACCG       ++FD N + GTSG++ C D   YISWDGIH +G
Sbjct  122  TILANYKSYHFEEPFKACCGAHDSSNGYDFDVNRICGTSGSSTCQDSSKYISWDGIHFTG  181

Query  844  AMNKHLAELLLNKDYCEPPFSEMVNKK  924
            AMN  LA+L LNK YC+P F +++  K
Sbjct  182  AMNAQLADLFLNKGYCQPSFQDILKAK  208



>gb|EYU40388.1| hypothetical protein MIMGU_mgv1a008158mg [Erythranthe guttata]
Length=383

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/271 (39%), Positives = 157/271 (58%), Gaps = 7/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSK-GCSN--AADAR  291
            G+NFA+ G+T++   ++  N   + T+  +P + Q+Q+ WF K L+S  GC +       
Sbjct  110  GVNFAVGGATAIRHGFFMKN---NITFNLVPQSLQTQLVWFDKILESDYGCKDLKTTPRE  166

Query  292  CKADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
            C+    +AL WLG +G +DY      S ++ + I  L I+  T  LQ ++ +GAK+IVVQ
Sbjct  167  CRGVFGDALIWLGEIGANDY-TCSLGSSLSGKIIQTLAINSVTGFLQALMNKGAKYIVVQ  225

Query  472  GLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYAN  651
            GLP  GC   S S   P+  D+MGC + +N     HN  LQ  +   + Q PQ  I+YA+
Sbjct  226  GLPQTGCTTYSFSLSSPEDRDEMGCVASMNKLSSAHNSALQAKLNVIKNQNPQAVIVYAD  285

Query  652  YWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGI  831
            Y+ A L++  N   + FKE  KACCG GGG +NFD  +  G+  ++ CS+P  YI+WDG 
Sbjct  286  YYNAHLSLMKNFKKHGFKELYKACCGYGGGAYNFDVFNTCGSPSSSSCSNPYEYINWDGA  345

Query  832  HLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            HL+ A+ K L +  LN  +C PPF  +V+KK
Sbjct  346  HLTEAVYKVLTDSFLNGTFCSPPFHYLVSKK  376



>ref|NP_001051872.1| Os03g0844600 [Oryza sativa Japonica Group]
 gb|AAS07373.1| putative GDSL-like lipase/acylhydrolase [Oryza sativa Japonica 
Group]
 gb|ABF99853.1| GDSL-motif lipase/hydrolase family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13786.1| Os03g0844600 [Oryza sativa Japonica Group]
 dbj|BAG86909.1| unnamed protein product [Oryza sativa Japonica Group]
Length=367

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 153/271 (56%), Gaps = 13/271 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T++  E++  N   + +    P +  +++AWF   L+     + A AR   
Sbjct  103  GVNFAVAGATAIEHEFFARN---NLSVDITPQSIMTELAWFEAHLRR----SPAAARAVG  155

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
            D   ALFW+G +G +DY +   + + +    I  + +   T  ++ +L +GAK+I+VQGL
Sbjct  156  D---ALFWVGEIGANDYAYSFMAATTIPQDQIRNMAVDRLTTFIEALLKKGAKYIIVQGL  212

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC P++++   P+  D + C + +N     HN+ LQ  + R RRQ P   I YA+Y+
Sbjct  213  PLTGCLPLTMTLARPEDRDNISCAATVNQQSHAHNRRLQASLRRLRRQHPAAVIAYADYY  272

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIH  834
             A LA+   P  Y F E  K CCG GGG +NF+  S  G+   T  C+ P  Y++WDG+H
Sbjct  273  AAHLAVMAAPARYGFTEPFKTCCGAGGGAYNFEIFSTCGSPEVTTACAQPAKYVNWDGVH  332

Query  835  LSGAMNKHLAELLL-NKDYCEPPFSEMVNKK  924
            ++ AM + +A +   +  YC PPFS ++ ++
Sbjct  333  MTEAMYRVVAGMFFQDGRYCHPPFSTLLARR  363



>gb|EAY92552.1| hypothetical protein OsI_14292 [Oryza sativa Indica Group]
Length=370

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 153/271 (56%), Gaps = 13/271 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T++  E++  N   + +    P +  +++AWF   L+     + A AR   
Sbjct  106  GVNFAVAGATAIEHEFFARN---NLSVDITPQSIMTELAWFEAHLRR----SPAAARAVG  158

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
            D   ALFW+G +G +DY +   + + +    I  + +   T  ++ +L +GAK+I+VQGL
Sbjct  159  D---ALFWVGEIGANDYAYSFMAATTIPQDQIRNMAVDRLTTFIEALLKKGAKYIIVQGL  215

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC P++++   P+  D + C + +N     HN+ LQ  + R RRQ P   I YA+Y+
Sbjct  216  PLTGCLPLTMTLARPEDRDNISCAATVNQQSHAHNRRLQASLRRLRRQHPAAVIAYADYY  275

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIH  834
             A LA+   P  Y F E  K CCG GGG +NF+  S  G+   T  C+ P  Y++WDG+H
Sbjct  276  AAHLAVMAAPARYGFTEPFKTCCGAGGGAYNFEIFSTCGSPEVTTACAQPAKYVNWDGVH  335

Query  835  LSGAMNKHLAELLL-NKDYCEPPFSEMVNKK  924
            ++ AM + +A +   +  YC PPFS ++ ++
Sbjct  336  MTEAMYRVVAGMFFQDGRYCHPPFSTLLARR  366



>gb|EPS63670.1| hypothetical protein M569_11113, partial [Genlisea aurea]
Length=359

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/267 (36%), Positives = 153/267 (57%), Gaps = 19/267 (7%)
 Frame = +1

Query  124  MNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKAD  303
            +NFA+AG+T++   ++  N   + T    P +  +Q+ WF               R +  
Sbjct  111  VNFAVAGATAIDHRFFAKN---NMTLDVTPESLATQLGWF---------------RERKR  152

Query  304  IDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLPP  483
              +ALFW+G +G +DY      S    RGI +L I+  T+ LQ +L  GAK++VVQGLPP
Sbjct  153  AADALFWVGEIGANDYAYSFGSSFYP-RGIRRLAINTLTKFLQALLEGGAKYVVVQGLPP  211

Query  484  IGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWKA  663
             GC  +S+   P    D  GC +  N     HN  L+  +  FR++FP+ TI+YA+Y++A
Sbjct  212  TGCLTLSLYLAPANDRDWAGCVASGNKHSQDHNAALKAKLNYFRQKFPKATIVYADYYEA  271

Query  664  FLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLSG  843
            +L +  NP  +  KE  K+CCG GGG +NF+  S+ G+  +T C +P  Y++WDG+HL+ 
Sbjct  272  YLDVIRNPAAHGIKELFKSCCGNGGGSYNFNYFSVCGSPSSTACRNPSEYVNWDGVHLTE  331

Query  844  AMNKHLAELLLNKDYCEPPFSEMVNKK  924
             M + +AE  LN  + +PP+ ++++KK
Sbjct  332  GMYRAVAESFLNGTHTQPPWPQLLDKK  358



>ref|XP_010027288.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Eucalyptus grandis]
Length=307

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 132/214 (62%), Gaps = 12/214 (6%)
 Frame = +1

Query  304  IDNALFWLGALGVSDYFQIHSKSIVA-------MRGISQLCIHHttqllqtvltEGAKHI  462
            ++ +LFW+G +G SDY ++ + S  +        R +SQ+C     +L++ +L  GAK++
Sbjct  97   MEGSLFWIGGIGFSDYPRLLNSSSSSISSQWFNQRSVSQVC-----KLVKELLGSGAKYL  151

Query  463  VVQGLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            VVQGLPP GCFPVS++S P    DQ GC+   N  +  HN+LLQK +   ++ F   TII
Sbjct  152  VVQGLPPSGCFPVSLASTPTSDRDQHGCSKSANDMVTAHNELLQKSLAELQKTFSSATII  211

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA++WKA++ I  NP  YNF E  KACCG   G FNFD +++ G+S  + CSD   +++W
Sbjct  212  YADFWKAYMNILQNPQQYNFTEPFKACCGVASGPFNFDIHNLCGSSSTSACSDATKHMNW  271

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            DGIHL+ AMNK +    LN     PP   ++ +K
Sbjct  272  DGIHLTEAMNKQITLQFLNHGCTNPPLPAVIKQK  305



>ref|XP_002318700.2| hypothetical protein POPTR_0012s09490g, partial [Populus trichocarpa]
 gb|EEE96920.2| hypothetical protein POPTR_0012s09490g, partial [Populus trichocarpa]
Length=320

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 95/266 (36%), Positives = 146/266 (55%), Gaps = 38/266 (14%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADAR--C  294
            G+NFA+AGST+++  ++  N  +       P + Q+Q+ WF+KFL+S+GC  A  +R  C
Sbjct  59   GVNFAVAGSTAINHAFFVRNNVN---LAITPQSIQTQMIWFNKFLESQGCKGAVSSRHEC  115

Query  295  KADIDNALFWLGALGVSDYFQIHS-----------KSIVAMRGISQLCIHHttqllqtvl  441
            KA  D+AL W+G +GV+DY  I             +SI+ + G  Q  +           
Sbjct  116  KAVRDDALIWVGEIGVNDYAYILDLPCQVTQLGSLQSIICITGFLQTLLK----------  165

Query  442  tEGAKHIVVQGLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQ  621
             +G K+IVVQGLPP GC P++++  P            +N+    H  + QK ++  R+Q
Sbjct  166  -KGVKNIVVQGLPPTGCLPLAMALAP-----------TLNNQSYTHTVVYQKTVQDLRKQ  213

Query  622  FPQCTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSD  801
            FP   I Y +YW A+  +  NP  Y F+E   ACC  GG  +NF+  S  G+S A+ C +
Sbjct  214  FPDAVITYLDYWNAYSMVMKNPKKYGFQEPFMACCVSGGPPYNFEVFSTCGSSDASACPN  273

Query  802  PDSYISWDGIHLSGAMNKHLAELLLN  879
            P  YI+W+G+HL+ AM K L+ + L+
Sbjct  274  PSQYINWEGVHLTEAMYKVLSRMFLS  299



>ref|XP_010503477.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Camelina sativa]
Length=383

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 151/268 (56%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   ++  N   + T    P + ++++ WF K+L++ G           
Sbjct  122  GVNFAVSGATVIKHAFFVKN---NLTLDMTPQSIETELGWFDKYLETLGTDQKVSL----  174

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               ++LFW+G +GV+DY      S V+   I QL I   T+ L+T+L +G K+++VQG P
Sbjct  175  -FKDSLFWIGEIGVNDYAYTLG-STVSSDTIRQLSISTFTRFLETLLNKGVKYMLVQGHP  232

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC    N+   +HN  LQ  +++ R ++P  TI+YA+YW 
Sbjct  233  ATGCLTLAMSLAAEDDRDSLGCVKSANNQSYIHNLALQSKLKQLRIKYPTATIVYADYWN  292

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+ A+  NPG Y   E  KACC G G  +NF      GT+ AT C DP  YI+WDG+HL+
Sbjct  293  AYRAVIQNPGKYGITEKFKACC-GTGEPYNFQVFQTCGTAAATACKDPSQYINWDGVHLT  351

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K +A++ L   +  P FS ++ KK
Sbjct  352  EAMYKVMADMFLGGTFTRPRFSNLLIKK  379



>ref|XP_010026792.1| PREDICTED: GDSL esterase/lipase At3g48460 [Eucalyptus grandis]
 gb|KCW83214.1| hypothetical protein EUGRSUZ_B00158 [Eucalyptus grandis]
Length=389

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/270 (37%), Positives = 155/270 (57%), Gaps = 11/270 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQS-KGCSNAADARCK  297
            G+NFA+AGST+++ E++  N   + +    P +  +Q+ WF K+++S +GC   A   C+
Sbjct  125  GVNFAVAGSTAINHEFFVRN---NMSLDVTPQSLLTQLLWFSKYMESHEGCRGKA---CR  178

Query  298  ADIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
              + +AL W+G +GV+DY + I S   V+   I +L I   T  L+ +L  GA+++VVQG
Sbjct  179  GALRDALVWVGEIGVNDYAYTIGSN--VSADTIQKLTITTVTAFLEALLRRGARYMVVQG  236

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            LP  GC P+++   P  + D +GC    N     HN  L   I   R+QFP   I+YA+Y
Sbjct  237  LPLSGCLPLALFLDPLGEKDDLGCVKSANDQTRAHNAALLATISNLRKQFPDAVIVYADY  296

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIH  834
            W A   +  +   + FKE+ +ACC G G  ++F   +  GT+ A  C  P  YI+WDG+H
Sbjct  297  WYAHHTVLKSAAKHGFKESFRACC-GTGEPYHFTPFATCGTAFADVCPRPSEYINWDGVH  355

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            L+ A  + +A++ LN  Y  PPF  M++KK
Sbjct  356  LTEATYQVIADMFLNGRYTHPPFRYMLSKK  385



>ref|XP_010515164.1| PREDICTED: GDSL esterase/lipase At3g48460 [Camelina sativa]
Length=382

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 151/268 (56%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   ++  N   + +    P + ++++ WF K+L++ G           
Sbjct  121  GVNFAVSGATVIKYAFFVKN---NLSLDMTPQSIETELGWFEKYLETLGTDQKVSL----  173

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               ++LFW+G +GV+DY      S V+   I QL I   T+ L+T+L +G K+++VQG P
Sbjct  174  -FQDSLFWIGEIGVNDY-AYTLGSTVSSDTIRQLSISTFTRFLETLLNKGVKYMLVQGHP  231

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC    N+   +HN  LQ  +++ R ++P  TI+YA+YW 
Sbjct  232  ATGCLTLAMSLAAEDDRDSLGCVKSANNQSYIHNLALQSKLKQLRIKYPTATIVYADYWN  291

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+ A+  NPG Y   E  KACC G G  +NF      GT+ AT C DP  YI+WDG+HL+
Sbjct  292  AYRAVIQNPGKYGITEKFKACC-GTGEPYNFQVFQTCGTAAATACKDPSQYINWDGVHLT  350

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K +A++ L   +  P FS ++ KK
Sbjct  351  EAMYKVMADMFLGGTFTRPRFSNLLIKK  378



>ref|XP_006650886.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Oryza brachyantha]
Length=370

 Score =   179 bits (454),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/271 (34%), Positives = 154/271 (57%), Gaps = 13/271 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T++  +++  N   + +    P +  +++AWF   L+    + AA      
Sbjct  106  GVNFAVAGATAIEHDFFARN---NLSVDITPQSIMTELAWFEAHLRRSPAAAAA------  156

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
             + +ALFW+G +G +DY +   + + +    I  + +   T  L+ +L +GAK+I+VQGL
Sbjct  157  -VGDALFWVGEIGANDYAYSFMAAATIHPAQIRTMAVDRVTTFLEALLKKGAKYIIVQGL  215

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC P++++   P+  D + C + +N+    HN+ L   + R R+Q P   I YA+Y+
Sbjct  216  PLTGCLPLTMTLARPEDRDNISCAASVNAQSHAHNRRLLAGVRRLRQQPPAAVIAYADYY  275

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIH  834
             A LA+   P  Y F E  K CCG GGG +NF+  S  G+   T  C+ P  Y++WDG+H
Sbjct  276  AAHLAVMRAPARYGFTEPFKTCCGAGGGAYNFEIFSTCGSPEVTTACAQPARYVNWDGVH  335

Query  835  LSGAMNKHLAELLL-NKDYCEPPFSEMVNKK  924
            ++ AM K +A +   +  YC+PPFS ++ +K
Sbjct  336  MTEAMYKAVAGMFFQDGSYCQPPFSTVLARK  366



>emb|CDY37927.1| BnaA06g18900D [Brassica napus]
Length=382

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 151/268 (56%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   ++  N   + T    P + ++++ WF K+L++ G +         
Sbjct  121  GVNFAVSGATVIKHAFFAKN---NLTLDMTPQSLETELGWFEKYLETLGTNQKVSL----  173

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               ++LFW+G +GV+DY      S V+   I +L I   T+ L+T+LT+G +H+VVQG P
Sbjct  174  -FKDSLFWIGEIGVNDY-AYTVGSTVSSDTIRELSISTYTRFLETLLTKGVRHMVVQGHP  231

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC   +N+    HN  LQ  +++ R ++P  TI+YA+YW 
Sbjct  232  ATGCLTLAMSLAAEDDRDYLGCVQSVNNQSYTHNLALQYKLKQLRIKYPNATIVYADYWN  291

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  Y   E  KACC G G  +NF      G++ AT C +P  YI+WDG+HL+
Sbjct  292  AYREVIKNPSKYGISEKFKACC-GTGEPYNFQVFETCGSATATACKEPSRYINWDGVHLT  350

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
              M K +A++ L   +  P FS ++NKK
Sbjct  351  EGMYKVMADMFLGGSFTRPKFSYLLNKK  378



>ref|XP_002875905.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52164.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=381

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 152/268 (57%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   ++  N   + +    P + ++++AWF K+L++ G +         
Sbjct  120  GVNFAVSGATVIKHAFFVKN---NLSLDMTPQSIETELAWFEKYLETLGTNQKVSL----  172

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               ++LFW+G +GV+DY      S V+   I +L I   T+ L+T+L +G K+++VQG P
Sbjct  173  -FKDSLFWIGEIGVNDY-AYTLGSTVSSDTIRELSISTFTRFLETLLNKGVKYMLVQGHP  230

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC    N+    HN  LQ  +++ R ++P  TI+YA+YW 
Sbjct  231  ATGCLTLAMSLAAEDDRDSLGCVQSANNQSYTHNLALQSKLKQLRIKYPSATIVYADYWN  290

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+ A+  NP  Y   E  KACC G G  +NF      GT  AT C DP+ YI+WDG+HL+
Sbjct  291  AYRAVIQNPSKYGITEKFKACC-GTGEPYNFQVFQTCGTVAATACKDPNQYINWDGVHLT  349

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K +A++ L+  +  P FS ++ KK
Sbjct  350  EAMYKVMADMFLDGTFTRPRFSNLLFKK  377



>ref|XP_009150194.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Brassica rapa]
Length=382

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 149/268 (56%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   ++  N   + T    P + ++++ WF K+L + G +         
Sbjct  121  GVNFAVSGATVIKHAFFAEN---NLTLDMTPQSLETELGWFEKYLGTLGTNQKVSL----  173

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               ++LFW+G +GV+DY      S V+   I +L I   T+ L+T+L +G +H+VVQG P
Sbjct  174  -FKDSLFWIGEIGVNDY-AYTVGSTVSSDTIRELSISTYTRFLETLLNKGVRHMVVQGHP  231

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC   +N+    HN  LQ  +++ R ++P  TI+YA+YW 
Sbjct  232  ATGCLTLAMSLAAEDDRDYLGCVQSVNNQSYTHNLALQYKLKQLRIKYPNATIVYADYWN  291

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  NP  Y   E  KACC G G  +NF      G++ AT C DP  YI+WDG+HL+
Sbjct  292  AYREVIKNPSKYGISEKFKACC-GTGEPYNFQVFETCGSATATACKDPSRYINWDGVHLT  350

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
              M K +A++ L   +  P FS ++NKK
Sbjct  351  EGMYKVMADMFLGGSFTRPKFSYLLNKK  378



>ref|XP_006852134.1| hypothetical protein AMTR_s00049p00054830 [Amborella trichopoda]
 gb|ERN13601.1| hypothetical protein AMTR_s00049p00054830 [Amborella trichopoda]
Length=367

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/277 (37%), Positives = 162/277 (58%), Gaps = 17/277 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTS-NKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCK  297
            G+NFA+AGST+L  ++Y+S N + SF     P + Q+Q  WF +FLQ++     A A+  
Sbjct  95   GVNFAVAGSTALDSDFYSSRNLSISFL---SPQSLQNQWNWFSQFLQAQ--CRGAHAKDG  149

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
               D+ LFW+G +G +DY      S++    + +L I +  +L++ ++ +GAK++VVQGL
Sbjct  150  CIDDSILFWVGEIGANDYAYTAGTSVLPGT-VRELAILNVARLVEGLIKKGAKYLVVQGL  208

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P IGC P+S+      + D +GC++  +    LHN LLQ  +E  R+ +P   IIYA++ 
Sbjct  209  PSIGCLPLSMVLMSSTK-DDIGCSAFADRQSQLHNSLLQTKLEELRQHYPNTVIIYADFS  267

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSG--------ATKCSDPDSY  813
             A   I  NP  Y F E  KACC G GG +NFD  +   T          A+ C +P+ Y
Sbjct  268  GAHRTIMQNPQAYGFTEPFKACC-GVGGPYNFDLIATCWTDNVSPVTWQRASACPNPEKY  326

Query  814  ISWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            ++WDG+H++ A+ + +A+L+LN  Y  PPF E+ + K
Sbjct  327  VNWDGVHMTDALYRVVADLILNHGYSRPPFPELFSSK  363



>ref|XP_006404256.1| hypothetical protein EUTSA_v10010448mg [Eutrema salsugineum]
 gb|ESQ45709.1| hypothetical protein EUTSA_v10010448mg [Eutrema salsugineum]
Length=382

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 149/268 (56%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   Y+  N   + T    P + ++Q+ WF K+L++ G +         
Sbjct  121  GVNFAVSGATVIKHAYFVKN---NLTLDMTPQSIETQLGWFEKYLETLGTNQKVSL----  173

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
             + ++LFW+G +GV+DY      S V+   I +L I      L+ +L +G KH+++QG P
Sbjct  174  -LKDSLFWIGEIGVNDY-AYTVGSTVSSATIRKLSISTYIMFLENLLKKGVKHMLIQGHP  231

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC   +N+    HN  L+  + + R ++P+ TI+YA+YW 
Sbjct  232  ATGCLTLAMSLAGEDDRDDLGCVKSVNNQSYTHNLALKSRLRQLRIKYPKATIVYADYWN  291

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+ A+  +P  Y   E  KACC G G  +NF      G++ AT C DP  YI+WDG+HL+
Sbjct  292  AYRAVIQSPRKYGITEKFKACC-GVGEPYNFQVFQTCGSAEATACKDPSRYINWDGVHLT  350

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K +A+L L+  +  P F  ++ KK
Sbjct  351  EAMYKVMADLFLSGKFTSPKFGYLLKKK  378



>ref|NP_190416.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9STM6.1|GDL57_ARATH RecName: Full=GDSL esterase/lipase At3g48460; AltName: Full=Extracellular 
lipase At3g48460; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB41152.1| lipase-like protein [Arabidopsis thaliana]
 gb|AAO41890.1| putative lipase [Arabidopsis thaliana]
 gb|AAO50725.1| putative lipase [Arabidopsis thaliana]
 gb|AEE78419.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=381

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 153/268 (57%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++GST +   ++  N   + +    P + ++++AWF K+L++ G +         
Sbjct  120  GVNFAVSGSTVIKHAFFVKN---NLSLDMTPQSIETELAWFEKYLETLGTNQKVSL----  172

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               ++LFW+G +GV+DY      S V+   I +L I   T+ L+T+L +G K+++VQG P
Sbjct  173  -FKDSLFWIGEIGVNDY-AYTLGSTVSSDTIRELSISTFTRFLETLLNKGVKYMLVQGHP  230

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC    N+    HN  LQ  +++ R ++P  TI+YA+YW 
Sbjct  231  ATGCLTLAMSLAAEDDRDSLGCVQSANNQSYTHNLALQSKLKQLRIKYPSATIVYADYWN  290

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+ A+  +P  Y   E  KACC G G  +NF      GT  AT C DP+ YI+WDG+HL+
Sbjct  291  AYRAVIKHPSKYGITEKFKACC-GIGEPYNFQVFQTCGTDAATVCKDPNQYINWDGVHLT  349

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K +A++ L+  +  P FS+++ KK
Sbjct  350  EAMYKVMADMFLDGTFTRPRFSDLLIKK  377



>ref|XP_006291232.1| hypothetical protein CARUB_v10017363mg [Capsella rubella]
 gb|EOA24130.1| hypothetical protein CARUB_v10017363mg [Capsella rubella]
Length=408

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 149/268 (56%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   ++  N   + T    P + ++++ WF K+L++ G           
Sbjct  147  GVNFAVSGATVIKHAFFVKN---NLTLDMTPQSIETELGWFDKYLETLGTDQKVSL----  199

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               ++LFW+G +GV+DY      S V    I +L I   T+ L+T+L +G K+++VQG P
Sbjct  200  -FKDSLFWIGEIGVNDYAYTLG-STVTSDTIRELSISTFTRFLETLLKKGVKYMLVQGHP  257

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC    N+    HN  LQ  +++ R ++P  TI+YA+YW 
Sbjct  258  ATGCLTLAMSLAAEDDRDSLGCVQSANNQSYTHNLALQSKLKQLRIKYPTATIVYADYWN  317

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+ A+  NPG Y   E  KACC G G  +NF      G++ AT C DP  YI+WDG+HL+
Sbjct  318  AYRAVIQNPGKYGITEKFKACC-GTGEPYNFQVFQTCGSAAATACKDPSQYINWDGVHLT  376

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K +A++ L   +  P FS ++ KK
Sbjct  377  EAMYKVMADMFLGGSFTRPRFSNLLIKK  404



>gb|AGT16586.1| hypothetical protein SHCRBa_109_M04_R_50 [Saccharum hybrid cultivar 
R570]
Length=393

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 150/270 (56%), Gaps = 10/270 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T++  +++  N   + +    P +  +Q+ WF   L++     AA A  ++
Sbjct  127  GVNFAVAGATAIEHDFFARN---NLSIDVTPQSIMTQLDWFDAHLRA-----AAGAGERS  178

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
             + +ALFW+G +G +DY + + ++  +  + +  + +   T  ++ +L  GAK+++VQGL
Sbjct  179  AVADALFWVGEIGANDYAYTVVARDTIPPKLVRTMAVQRVTAFVEGLLERGAKYVIVQGL  238

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC P++++       D +GC + +N     HN+ L   +   RR+ P   + YA+Y+
Sbjct  239  PLTGCLPLAMTLARADDRDAVGCAASVNRQSYAHNRRLLAGLRELRRRHPGAVVAYADYY  298

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIH  834
             A LA+   P  Y F E  + CCG GGG +NFD  +  G+   T  C+ P  Y++WDG+H
Sbjct  299  AAHLAVMRAPARYGFAEPFRTCCGSGGGAYNFDLFATCGSPQVTTACARPADYVNWDGVH  358

Query  835  LSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            ++ AM K +A +     YC P F +++  K
Sbjct  359  MTEAMYKVVAGMFFRDAYCRPAFKDLLAMK  388



>ref|XP_010426341.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Camelina sativa]
Length=382

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 151/268 (56%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   ++  N   + T    P + ++++ WF K+L++ G           
Sbjct  121  GVNFAVSGATVIKHAFFVKN---NLTLDMTPQSIETELGWFDKYLETLGNDQKVSL----  173

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               ++LFW+G +GV+DY      S V+   I +L I   T+ L+T+L +G ++++VQG P
Sbjct  174  -FKDSLFWIGEIGVNDY-AYTLGSTVSSDTIRRLSISTFTRFLETLLNKGVQYMLVQGHP  231

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC    N+   +HN  LQ  +++ R ++P  TI+YA+YW 
Sbjct  232  ATGCLTLAMSLAAEDDRDSLGCVKSANNQSYIHNLALQSKLKQLRIKYPNATIVYADYWN  291

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+ A+  NPG Y   E  KACC G G  +NF      GT+ AT C DP  YI+WDG+HL+
Sbjct  292  AYRAVIQNPGMYGITEKFKACC-GTGEPYNFQVFQTCGTAAATACKDPSQYINWDGVHLT  350

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
             AM K +A++ L   +  P FS ++ KK
Sbjct  351  EAMYKVMADMFLGGTFTRPRFSNLLIKK  378



>emb|CDY08074.1| BnaA06g16520D [Brassica napus]
Length=382

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/269 (34%), Positives = 154/269 (57%), Gaps = 12/269 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   +++ N   + T    P + ++++ WF K+L++       + R K 
Sbjct  121  GVNFAVSGATVIEHSFFSEN---NLTLDMTPQSIETELGWFEKYLET------LETRDKV  171

Query  301  DI-DNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
             + +++LFW+G +GV+DY      S V+   I +L I   T+ L+T+L +G ++++VQG 
Sbjct  172  SLFNDSLFWIGEIGVNDY-AYTVGSAVSSDTIRELSISTHTRFLETLLNKGVRYMLVQGH  230

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC  ++++       D +GC   +N+    HN  LQ  +E  R ++P  TI+YA+YW
Sbjct  231  PATGCLTLTMTLAAQDDRDNLGCVKSVNNQSYTHNLALQSKLEELRIKYPNATIVYADYW  290

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+  +  NP  Y   E  KACC G G  +NF      G++ AT C +P  YI+WDG+HL
Sbjct  291  NAYRKVIKNPSKYGISEKFKACC-GIGEPYNFQVFDTCGSASATACKEPSRYINWDGVHL  349

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            +  M K +A++ L+  +  P FS ++NKK
Sbjct  350  TEGMYKVMADMFLDGSFTRPKFSYLLNKK  378



>ref|XP_009149816.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Brassica rapa]
Length=382

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/269 (34%), Positives = 154/269 (57%), Gaps = 12/269 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   +++ N   + T    P + ++++ WF K+L++       + R K 
Sbjct  121  GVNFAVSGATVIEHSFFSEN---NLTLDMTPQSIETELGWFEKYLET------LETRDKV  171

Query  301  DI-DNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
             + +++LFW+G +GV+DY      S V+   I +L I   T+ L+T+L +G ++++VQG 
Sbjct  172  SLFNDSLFWIGEIGVNDY-AYTVGSAVSSDTIRELSISTHTRFLETLLNKGVRYMLVQGH  230

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC  ++++       D +GC   +N+    HN  LQ  +E  R ++P  TI+YA+YW
Sbjct  231  PATGCLTLTMTLAAQDDRDNLGCVKSVNNQSYTHNLALQSKLEELRIKYPNATIVYADYW  290

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+  +  NP  Y   E  KACC G G  +NF      G++ AT C +P  YI+WDG+HL
Sbjct  291  NAYRKVIKNPSKYGISEKFKACC-GIGEPYNFQVFDTCGSASATACKEPSRYINWDGVHL  349

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            +  M K +A++ L+  +  P FS ++NKK
Sbjct  350  TEGMYKVMADMFLDGSFTRPKFSYLLNKK  378



>gb|KFK34151.1| gdsl esterase lipase [Arabis alpina]
Length=377

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 150/268 (56%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++GST +   ++  N   + T    P + ++++ WF K+L++ G +         
Sbjct  116  GVNFAVSGSTVIKHAFFVKN---NLTLDMTPQSIETELGWFDKYLETLGTNQKVSV----  168

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               ++LFW+G +GV+DY  I   S V+   I +L I   T+ L+T+L +G K+++VQG P
Sbjct  169  -FKDSLFWIGEIGVNDYAYILG-STVSSDTIRELSISTFTRFLETLLNKGVKYMLVQGHP  226

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC    N+    HN  LQ  +++ R ++P  TI+YA+YW 
Sbjct  227  ATGCLTLAMSLAAEDDRDSLGCVQSANNQSYTHNLALQSKLKQLRIKYPNATIVYADYWN  286

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+ A+  NP  Y   E  KACC G G  +NF      G++ AT C DP  YI+WDG+HL+
Sbjct  287  AYRAVIQNPKKYGITEKFKACC-GIGEPYNFQVFETCGSAEATVCKDPSQYINWDGVHLT  345

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
              M K +A++ L   +  P FS ++ KK
Sbjct  346  EGMYKIMADMFLGGSFTRPKFSYLLGKK  373



>ref|XP_004981071.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Setaria italica]
Length=392

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 152/271 (56%), Gaps = 14/271 (5%)
 Frame = +1

Query  124  MNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKAD  303
            +NFA+AGST++  +++  N   + +    P +  +Q+AWF   L+    S+         
Sbjct  127  VNFAVAGSTAIEHDFFARN---NLSLDITPQSIMTQLAWFDDHLRKANESSKV-------  176

Query  304  IDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
            + +ALFW+G +G +DY + + ++  +  + +  + +   T  ++ +L  GAK+++VQGLP
Sbjct  177  VGDALFWVGEIGANDYAYTVIARDTIPTKLVRTMAVQRITTFVEGLLERGAKYVMVQGLP  236

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  ++++   P   D + C + +N     HN+ L   + + RR+ P   I YA+Y+ 
Sbjct  237  LTGCLTLAMTLARPDDRDNVSCVASVNRQSYAHNRRLLAALHQLRRRHPDAVIAYADYYA  296

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGA-TKCSDPDSYISWDGIHL  837
            A LA+  +P  Y F E  +ACCG GGG++NFD  +  G+    T C+ P  Y++WDG+H+
Sbjct  297  AHLAVMRSPAAYGFTEPFRACCGSGGGDYNFDLFATCGSPAVNTACAQPARYVNWDGVHM  356

Query  838  SGAMNKHLAELLLNKD--YCEPPFSEMVNKK  924
            + AM K +A +  +    YC P FS+++ +K
Sbjct  357  TEAMYKVVAGMFFHAGDAYCRPAFSDLLARK  387



>emb|CDY39587.1| BnaCnng09560D [Brassica napus]
Length=382

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 153/269 (57%), Gaps = 12/269 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   +++ N   + T    P + ++++ WF K+L++       + R K 
Sbjct  121  GVNFAVSGATVIKHSFFSEN---NLTLDMTPQSIETELGWFEKYLET------LETRDKV  171

Query  301  DI-DNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
             +  ++LFW+G +GV+DY      S V+   I +L I   T+ L+T+L +G ++++VQG 
Sbjct  172  SLFKDSLFWIGEIGVNDY-AYTVGSAVSSDTIRELSISTHTRFLETLLNKGVRYMLVQGH  230

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC  ++++       D +GC   +N+    HN  LQ  +E  R ++P  TI+YA+YW
Sbjct  231  PATGCLTLTMTLADEDDRDNLGCVKSVNNQSYTHNLALQSKLEELRIKYPNATIVYADYW  290

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHL  837
             A+  +  NP  Y   E  KACC G G  +NF      G++ AT C DP  YI+WDG+HL
Sbjct  291  NAYRKVIKNPSKYGISEKFKACC-GIGEPYNFQVFETCGSASATACKDPSRYINWDGVHL  349

Query  838  SGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            +  M K +A++ L+  +  P FS ++NKK
Sbjct  350  TEGMYKVMADMFLDGCFTRPKFSYLLNKK  378



>ref|XP_003562455.1| PREDICTED: GDSL esterase/lipase At3g48460 [Brachypodium distachyon]
Length=404

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 153/281 (54%), Gaps = 16/281 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAA------  282
            G+NFA+AG+T++  +++  N   + T    P +  +++AW  K L +      A      
Sbjct  123  GVNFAVAGATAIEHDFFVRN---NLTVDITPQSIMTELAWLDKHLAAAEKKKKAGKGAGK  179

Query  283  --DARCKADIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGA  453
              D   +  I  ALFW+G +G +DY +   +   V+ + I  + +      ++ +L  GA
Sbjct  180  KKDLEEEEGIGEALFWVGEIGANDYAYSFMAADTVSPKNIQAMAVARVASFVEELLKRGA  239

Query  454  KHIVVQGLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQC  633
            K+IVVQGLP  GC P++++    +  D + C + +N     HN+LLQ  + R R++ P  
Sbjct  240  KYIVVQGLPLTGCLPLAMTLARQEDRDNISCVASVNQQSYDHNRLLQADLNRLRQKHPGA  299

Query  634  TIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGT-SGATKCSDPDS  810
            +I YA+Y+ A LA+  +P  + F E  K CCG GGG +NF+  S  G+   AT C+ P  
Sbjct  300  SIAYADYYAAHLAVMRSPARHGFTEPFKTCCGTGGGAYNFEIFSTCGSPEVATACAQPAK  359

Query  811  YISWDGIHLSGAMNKHLAELLLNKD---YCEPPFSEMVNKK  924
            Y++WDG+H++ AM K +A +    +   YC P FS ++ KK
Sbjct  360  YVNWDGVHMTEAMYKVVAGMFFEDNSGKYCRPAFSSLLTKK  400



>emb|CDX77910.1| BnaC03g53090D [Brassica napus]
Length=382

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 148/268 (55%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++G+T +   ++  N   + T    P + ++++ WF K+L++ G +         
Sbjct  121  GVNFAVSGATVIKHAFFAEN---NLTLDMTPQSLETELGWFEKYLETLGTNQKVSL----  173

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
               ++LFW+G +GV+DY      S V+   I +  I   T+ L+T+L +G +H+VVQG P
Sbjct  174  -FKDSLFWIGEIGVNDY-AYTVGSTVSSDTIREFSISTYTRFLETLLNKGVRHMVVQGHP  231

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC  +++S       D +GC   +N+    HN  LQ  +++ R ++P  TI+YA+YW 
Sbjct  232  ATGCLTLAMSLAAEDDRDYLGCVQSVNNQSYTHNLALQYKLKQLRIKYPNATIVYADYWN  291

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLS  840
            A+  +  N   Y   E  KACC G G  +NF      G++ AT C DP  YI+WDG+HL+
Sbjct  292  AYREVIKNSSKYGISEKFKACC-GTGEPYNFQVFETCGSATATACKDPSRYINWDGVHLT  350

Query  841  GAMNKHLAELLLNKDYCEPPFSEMVNKK  924
              M K +A++ L   +  P FS ++NKK
Sbjct  351  EGMYKVMADMFLGGSFTRPKFSYLLNKK  378



>ref|XP_002463534.1| hypothetical protein SORBIDRAFT_01g001540 [Sorghum bicolor]
 gb|EER90532.1| hypothetical protein SORBIDRAFT_01g001540 [Sorghum bicolor]
Length=397

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/274 (30%), Positives = 149/274 (54%), Gaps = 13/274 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T++  +++  N   + +    P +  +Q+ WF   L+S           + 
Sbjct  126  GVNFAVAGATAIEHDFFARN---NLSIDVTPQSIMTQLDWFDAHLRSASAGTGE----RT  178

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
             + +ALFW+G +G +DY + + ++  +  + +  + +   T  ++ +L  GAK+++VQGL
Sbjct  179  AVADALFWVGEIGANDYAYTVIARDTIPPKLVRTMAVQRVTAFVEGLLQRGAKYVIVQGL  238

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC P++++       D +GC + +N    +HN+ L   +   RR+ P   + YA+Y+
Sbjct  239  PLTGCLPLAMTLARADDRDAVGCAASVNRQSYVHNRRLLAGLRELRRRHPGAVVAYADYY  298

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIH  834
             A LA+   P  Y F E  + CCG GGG +NFD  +  G+   T  C+ P  Y++WDG+H
Sbjct  299  AAHLAVMRAPARYGFSEPFRTCCGSGGGAYNFDLFATCGSPQVTTACARPAEYVNWDGVH  358

Query  835  LSGAMNKHLAELLLNKD----YCEPPFSEMVNKK  924
            ++ AM K +A +  ++     YC P F +++  K
Sbjct  359  MTEAMYKAVAGMFFDEHGGEAYCRPAFKDLLAMK  392



>gb|ACU18341.1| unknown [Glycine max]
Length=212

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 122/205 (60%), Gaps = 1/205 (0%)
 Frame = +1

Query  319  FWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLPPIGCFP  498
            F LG +GV+DY      S V+   I +L I   +  LQT+L +GAK++VVQG+P  GC  
Sbjct  8    FGLGEIGVNDYAYTLG-STVSDETIRKLAISSVSGALQTLLEKGAKYLVVQGMPLTGCLT  66

Query  499  VSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWKAFLAIF  678
            +S+   PP   D + C   +N+    HN +LQ  ++ FR+Q+PQ  I+YA+Y+ A+  + 
Sbjct  67   LSMYLAPPDDRDDIRCVKSVNNQSYYHNLVLQDKLQEFRKQYPQAVILYADYYDAYRTVM  126

Query  679  NNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDGIHLSGAMNKH  858
             NP  Y FKET   CCG G   +NF   +  GT  AT CS P  YI+WDG+HL+ AM K 
Sbjct  127  KNPSKYGFKETFNVCCGSGEPPYNFTVFATCGTPNATVCSSPSQYINWDGVHLTEAMYKV  186

Query  859  LAELLLNKDYCEPPFSEMVNKKTSI  933
            ++ + L  ++ +PPF+ ++ KK  +
Sbjct  187  ISSMFLQGNFTQPPFNFLLEKKERV  211



>dbj|BAJ87991.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 144/270 (53%), Gaps = 12/270 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T++  +++  N   + +    P +  +++ WF   L+++G + A     K 
Sbjct  111  GVNFAVAGATAIEHDFFAKN---NLSIDITPQSIMTELGWFDAHLKTRGAAAAG----KK  163

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
            ++  AL+W+G +G +DY +   +   +    I  + +   T  L+ +L  GAK++VVQGL
Sbjct  164  EVGEALYWVGEIGANDYAYSFMAADSIPPERIRTMAVDRVTTFLEGLLKRGAKYVVVQGL  223

Query  478  PPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYW  657
            P  GC P++++   P+  D + C + +N     HN  LQ  I R R+  P   I YA+Y+
Sbjct  224  PLTGCLPLAMTLARPEDRDNLSCVASVNKQSMDHNHHLQAGIHRLRQAHPDAVIAYADYY  283

Query  658  KAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGA-TKCSDPDSYISWDGIH  834
             A LA+   P  Y F E  K CCG GGG +NF+  S  G+      C+ P  Y++WDG+H
Sbjct  284  AAHLAVMRTPARYGFAEPFKTCCGTGGGAYNFEIFSTCGSPEVPAACAQPARYVNWDGVH  343

Query  835  LSGAMNKHLAELLLNKD---YCEPPFSEMV  915
            ++ AM K +A +        +  P F  ++
Sbjct  344  MTEAMYKVVAGMFFRDGSGAFIRPSFGSLI  373



>dbj|BAJ88861.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   166 bits (421),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/274 (33%), Positives = 148/274 (54%), Gaps = 12/274 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T++  E++      + +    P +  +Q+ WF   L+++    AA    K 
Sbjct  118  GVNFAVAGATAIEHEFFVRQ---NLSANITPQSIMAQLGWFDTHLRAR---RAAGGGSKD  171

Query  301  D-IDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            + + +ALFW+G +G +DY +   +   +    I  + I   T  L+ +L  GA+++ VQG
Sbjct  172  EGVGDALFWVGEIGANDYGYSFMAPDALPSERIRSMAIDRITTFLEGLLKRGARYVAVQG  231

Query  475  LPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANY  654
            +P IGC P++++   P + D + C + +N     HN+ LQ  + R RR  P   I YA+Y
Sbjct  232  MPLIGCLPLTMTLSQPGERDNLSCVAPLNQKSLGHNQHLQARLHRLRRSHPDAIIAYADY  291

Query  655  WKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGA-TKCSDPDSYISWDGI  831
              A LA+  +P  Y F E  KACCG GGG +NF   S  G+    T C+ P  Y++WDG+
Sbjct  292  HAAHLAVVRSPARYGFAEPFKACCGTGGGAYNFQIFSTCGSPEVDTACAQPARYVNWDGV  351

Query  832  HLSGAMNKHLAELLLNK---DYCEPPFSEMVNKK  924
            H++ AM K +A +  +     YC P F  ++  +
Sbjct  352  HMTEAMYKVVAGMFFHDATGAYCRPTFCSLLAAR  385



>ref|XP_004964803.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X2 [Setaria 
italica]
Length=363

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/264 (34%), Positives = 143/264 (54%), Gaps = 10/264 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N PLN  +QI WF + + S   S  A   CK+
Sbjct  101  GANMAIIGATTMDSGFFQSLGIADKIWNNGPLN--TQIQWFQQLMPSICGSTQA---CKS  155

Query  301  DIDNALFWLGALGVSDY-FQIHSK-SIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF LG  G +DY  QI    S     G S   +    + +  +++ GA  IVV G
Sbjct  156  YLSKSLFVLGEFGGNDYNAQIFGGYSPEQASGQSATIVDAIGKGVDQLISLGATSIVVPG  215

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + P+GCFP+ ++   +      DQ GC    N+    HN+LLQ  +   + ++P   I+Y
Sbjct  216  VLPVGCFPIYLTLYQTSNAGDYDQYGCLKRFNALSSRHNQLLQAKVSSLQSKYPGARIMY  275

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+++     +  +PG+Y F    +ACCG GGG++N+  ++  G SGA+ CS+P+S +SWD
Sbjct  276  ADFYSHVYDMVRSPGSYGFSTNLRACCGAGGGKYNYQNSARCGMSGASACSNPESSLSWD  335

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            GIHL+ A  K +A+  ++  YC P
Sbjct  336  GIHLTEAAYKKIADGWVSGAYCHP  359



>ref|XP_002439448.1| hypothetical protein SORBIDRAFT_09g006570 [Sorghum bicolor]
 gb|EES17878.1| hypothetical protein SORBIDRAFT_09g006570 [Sorghum bicolor]
Length=364

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/267 (34%), Positives = 140/267 (52%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T+++ +++ S       W N PL+  +QI WF + L S  C N     CK 
Sbjct  103  GANMAIIGATTMNFDFFNSIGLRDKIWNNGPLD--TQIQWFRQLLPSV-CGN----DCKN  155

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +S+  +RG     I      L+T++  GA  +VV G
Sbjct  156  YLSKSLFVVGEFGGNDYNAALFSRRSMAEVRGYVPRVITKLIHGLETIIRRGAVDVVVPG  215

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP  ++   +      D+ GC    N     HN LL++ +   RR +P   I+Y
Sbjct  216  VLPIGCFPTYLTLYGTSNAADYDRDGCLRSYNDLSSYHNALLKRSLSSLRRTYPHARIMY  275

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+++   + +   P N+  K   K CCG GG G++N++ N+  G SGA  C+DP +Y+ W
Sbjct  276  ADFYTQVIDMIRTPHNFGLKYGLKVCCGAGGQGKYNYNNNARCGMSGARACADPGNYLIW  335

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  + +A+  L   YC PP 
Sbjct  336  DGIHLTEAAYRSIADGWLKGTYCNPPI  362



>ref|XP_010557579.1| PREDICTED: GDSL esterase/lipase At5g03980 [Tarenaya hassleriana]
Length=373

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/261 (36%), Positives = 139/261 (53%), Gaps = 20/261 (8%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+L+  ++T+   H    TN PL    Q++WF+  L+S   SN     C  
Sbjct  113  GVNFAVAGSTALNSSFFTARGLH-VPATNTPLG--KQLSWFNSHLRSVCRSN-----CSE  164

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             +  +LF +G +G +DY    FQ   KS+  +R      +      ++ V+  GA  +VV
Sbjct  165  RLRRSLFMVGEIGGNDYNYGFFQ--GKSVDEVRAFIPHVVQTIAAAVREVIRHGAVRVVV  222

Query  469  QGLPPIGCFPVSISSCP---PQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G  PIGCFP+ +SS P   P+  D  GC   +N     HN  LQ  I   R++FP   I
Sbjct  223  PGNFPIGCFPIYLSSFPANDPRAYDDKGCLRHMNEFAVEHNNALQAAIASLRQEFPHAVI  282

Query  640  IYANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
            +Y +Y+ AF ++        F E    ++CCG GG  +N+D +   G SG   C +PD Y
Sbjct  283  VYGDYYAAFQSVLGRASTLGFDERAALRSCCGVGGA-YNYDGSRQCGASGVPVCPNPDRY  341

Query  814  ISWDGIHLSGAMNKHLAELLL  876
            ISWDG+HL+    +H++E L+
Sbjct  342  ISWDGVHLTQKAYRHMSEFLV  362



>ref|XP_004960620.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Setaria italica]
Length=372

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/273 (32%), Positives = 145/273 (53%), Gaps = 11/273 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L  +Y+  N   S    N  +N Q Q  WF +  Q+  CS+  +  C+A
Sbjct  101  GANFAVMGATALDLKYFKDNNVWSIPPFNTSMNVQLQ--WFDEVKQTI-CSDPEE--CRA  155

Query  301  DIDNALFWLGALGVSDY-FQIHSK-SIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                ALF  G  G +DY F   +  S+  ++ +    +    + ++ +L EGA+H+VV G
Sbjct  156  FFSKALFVFGEFGGNDYSFAWKADWSLEKVKTMVPAVVSSLVRGIERLLDEGARHVVVPG  215

Query  475  LPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              P GC P++++  P +   +     GC    NS    HN +L+  ++R +R+ P+  I+
Sbjct  216  NLPAGCIPITLTMYPSEDRSEYDPRTGCLKKYNSVALYHNAMLRIALDRLQRRRPEARIV  275

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+  ++     P  Y +K      C GGGG +N++ ++  G  G+T C DPD+++SW
Sbjct  276  YADYYTPYIQFARTPHLYGYKRGALRACCGGGGPYNYNMSASCGLPGSTTCEDPDAHVSW  335

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNK  921
            DGIHL+ A  + +A   L   Y  PP + +V +
Sbjct  336  DGIHLTEAPYRFIANTWLKGPYAHPPLATVVRE  368



>ref|XP_004964802.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X1 [Setaria 
italica]
Length=377

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/275 (34%), Positives = 145/275 (53%), Gaps = 18/275 (7%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFL-------QSKGCSNA  279
            G N AI G+T++   ++ S       W N PLN  +QI WF + +       Q     NA
Sbjct  101  GANMAIIGATTMDSGFFQSLGIADKIWNNGPLN--TQIQWFQQLMPSICGSTQGTHAINA  158

Query  280  ----ADARCKADIDNALFWLGALGVSDY-FQIHSK-SIVAMRGISQLCIHHttqllqtvl  441
                A A CK+ +  +LF LG  G +DY  QI    S     G S   +    + +  ++
Sbjct  159  TPADAGAPCKSYLSKSLFVLGEFGGNDYNAQIFGGYSPEQASGQSATIVDAIGKGVDQLI  218

Query  442  tEGAKHIVVQGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERF  612
            + GA  IVV G+ P+GCFP+ ++   +      DQ GC    N+    HN+LLQ  +   
Sbjct  219  SLGATSIVVPGVLPVGCFPIYLTLYQTSNAGDYDQYGCLKRFNALSSRHNQLLQAKVSSL  278

Query  613  RRQFPQCTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK  792
            + ++P   I+YA+++     +  +PG+Y F    +ACCG GGG++N+  ++  G SGA+ 
Sbjct  279  QSKYPGARIMYADFYSHVYDMVRSPGSYGFSTNLRACCGAGGGKYNYQNSARCGMSGASA  338

Query  793  CSDPDSYISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            CS+P+S +SWDGIHL+ A  K +A+  ++  YC P
Sbjct  339  CSNPESSLSWDGIHLTEAAYKKIADGWVSGAYCHP  373



>dbj|BAD69424.1| putative lipase [Oryza sativa Japonica Group]
 gb|EEC80046.1| hypothetical protein OsI_21745 [Oryza sativa Indica Group]
Length=340

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/265 (33%), Positives = 137/265 (52%), Gaps = 14/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++F  QI WF +       S+     CK+
Sbjct  79   GANMAITGATAMDANFFRSLGLSDKIWNNGPISF--QIQWFQQI-----SSSVCGQNCKS  131

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRG---ISQLCIHHttqllqtvltEGAKHIVVQ  471
             + N+LF  G  G +DY  +      A +     SQ+ +   +  ++ ++  GA  +VV 
Sbjct  132  YLANSLFVFGEFGGNDYNAMLFGGYSADQASTYTSQI-VDTISNGVEKLIAMGAVDVVVP  190

Query  472  GLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            G+ PIGCFP+ ++   +      D +GC    N     HN  L+  I   + ++    I+
Sbjct  191  GVLPIGCFPIYLTIYGTSSSSDYDSLGCLKKFNDLSTNHNNQLKTKISALQSKYKSARIM  250

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+++     +  NPGNY F    + CCG GGG+FN++ N+  G SGA+ CS+P S++SW
Sbjct  251  YADFYSGVYDMVRNPGNYGFSTVFETCCGSGGGKFNYNNNARCGMSGASACSNPASHLSW  310

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DGIHL+ A  K + +  LN  YC P
Sbjct  311  DGIHLTEAAYKQITDGWLNGPYCSP  335



>ref|XP_011036871.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Populus euphratica]
Length=287

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 144/260 (55%), Gaps = 16/260 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+L  E  +S    +   TN  L+  +Q+ W   +  +  CS      C  
Sbjct  27   GVNFAVAGSTALPAEVLSSKNIMNIV-TNESLS--TQLEWMFSYFNTT-CSK----DCAK  78

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +I+++LF +G +G +DY    + SK+    + +    +      ++ V+  GA+ +VV G
Sbjct  79   EINSSLFMVGEIGGNDYNYAFMFSKTTEETKALVPGVVKAIKDAVEKVIGYGARRVVVPG  138

Query  475  LPPIGCFPVSISSCPPQQ---LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGCFPV +S   P      D+  C  ++NS    HN+LL++ ++  ++ +P   I+Y
Sbjct  139  NFPIGCFPVYLSQFEPNDADAYDEFHCLKELNSFASYHNELLKQTVDELKKNYPDVIIVY  198

Query  646  ANYWKAFLAIFNNPGNYNF--KETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
             +Y+KAF++I+ N  +  F  K  +KACCG GG + NF    M G  G   C +PD +IS
Sbjct  199  GDYYKAFMSIYQNAQSLGFDTKTIQKACCGTGG-DHNFSLWRMCGALGVPVCPNPDQHIS  257

Query  820  WDGIHLSGAMNKHLAELLLN  879
            WDGIHL+    +H+AE L+N
Sbjct  258  WDGIHLTQKAYQHMAEWLIN  277



>ref|NP_001056858.1| Os06g0157000 [Oryza sativa Japonica Group]
 dbj|BAF18772.1| Os06g0157000 [Oryza sativa Japonica Group]
Length=341

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 87/265 (33%), Positives = 137/265 (52%), Gaps = 14/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++F  QI WF +       S+     CK+
Sbjct  80   GANMAITGATAMDANFFRSLGLSDKIWNNGPISF--QIQWFQQI-----SSSVCGQNCKS  132

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRG---ISQLCIHHttqllqtvltEGAKHIVVQ  471
             + N+LF  G  G +DY  +      A +     SQ+ +   +  ++ ++  GA  +VV 
Sbjct  133  YLANSLFVFGEFGGNDYNAMLFGGYSADQASTYTSQI-VDTISNGVEKLIAMGAVDVVVP  191

Query  472  GLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            G+ PIGCFP+ ++   +      D +GC    N     HN  L+  I   + ++    I+
Sbjct  192  GVLPIGCFPIYLTIYGTSSSSDYDSLGCLKKFNDLSTNHNNQLKTKISALQSKYKSARIM  251

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+++     +  NPGNY F    + CCG GGG+FN++ N+  G SGA+ CS+P S++SW
Sbjct  252  YADFYSGVYDMVRNPGNYGFSTVFETCCGSGGGKFNYNNNARCGMSGASACSNPASHLSW  311

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DGIHL+ A  K + +  LN  YC P
Sbjct  312  DGIHLTEAAYKQITDGWLNGPYCSP  336



>ref|NP_001141565.1| uncharacterized protein LOC100273681 [Zea mays]
 gb|ACF86627.1| unknown [Zea mays]
 gb|AFW70979.1| alpha-L-fucosidase 2 [Zea mays]
Length=378

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 135/266 (51%), Gaps = 13/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF +   S          CK+
Sbjct  116  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQ--WFQQIATS-----VCGQSCKS  168

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + N+LF  G  G +DY        SI   R      ++  ++ +  ++  GA  IVV G
Sbjct  169  YLGNSLFVFGEFGGNDYNAMIFGGYSIEQARKYVPKIVNTISRGIDKLIAMGATDIVVPG  228

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFR-RQFPQCTII  642
            + PIGCFP+ ++   S      D +GC +  N     HN LLQK ++  + R      I+
Sbjct  229  VLPIGCFPIYLTIYQSSNGSDYDSLGCLNSFNDLSTYHNSLLQKRVDIIQSRHRKTARIM  288

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+++ A   +  NP +Y F    + CCG GGG++N+  ++  G +GA  CS P S++SW
Sbjct  289  YADFYSAVYDMVRNPQSYGFSSVFETCCGSGGGKYNYQNSARCGMAGAAACSSPASHLSW  348

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPP  900
            DGIHL+ A  KH+ +  L   YC PP
Sbjct  349  DGIHLTEAAYKHITDAWLRGPYCRPP  374



>gb|ACG38031.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=378

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 135/266 (51%), Gaps = 13/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF +   S          CK+
Sbjct  116  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQ--WFQQIATS-----VCGQSCKS  168

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + N+LF  G  G +DY        SI   R      ++  ++ +  ++  GA  IVV G
Sbjct  169  YLGNSLFVFGEFGGNDYNAMIFGGYSIEQARKYVPKIVNTISRGIDKLIAMGATDIVVPG  228

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFR-RQFPQCTII  642
            + PIGCFP+ ++   S      D +GC +  N     HN LLQK ++  + R      I+
Sbjct  229  VLPIGCFPIYLTIYQSSNGSDYDSLGCLNSFNDLSTYHNSLLQKRVDIIQSRHRKTARIM  288

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+++ A   +  NP +Y F    + CCG GGG++N+  ++  G +GA  CS P S++SW
Sbjct  289  YADFYSAVYDMVRNPQSYGFSSVFETCCGSGGGKYNYQNSARCGMAGAAACSSPASHLSW  348

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPP  900
            DGIHL+ A  KH+ +  L   YC PP
Sbjct  349  DGIHLTEAAYKHITDAWLKGPYCRPP  374



>gb|EEE65121.1| hypothetical protein OsJ_20187 [Oryza sativa Japonica Group]
Length=367

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/265 (33%), Positives = 137/265 (52%), Gaps = 14/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++F  QI WF +       S+     CK+
Sbjct  106  GANMAITGATAMDANFFRSLGLSDKIWNNGPISF--QIQWFQQI-----SSSVCGQNCKS  158

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRG---ISQLCIHHttqllqtvltEGAKHIVVQ  471
             + N+LF  G  G +DY  +      A +     SQ+ +   +  ++ ++  GA  +VV 
Sbjct  159  YLANSLFVFGEFGGNDYNAMLFGGYSADQASTYTSQI-VDTISNGVEKLIAMGAVDVVVP  217

Query  472  GLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            G+ PIGCFP+ ++   +      D +GC    N     HN  L+  I   + ++    I+
Sbjct  218  GVLPIGCFPIYLTIYGTSSSSDYDSLGCLKKFNDLSTNHNNQLKTKISALQSKYKSARIM  277

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+++     +  NPGNY F    + CCG GGG+FN++ N+  G SGA+ CS+P S++SW
Sbjct  278  YADFYSGVYDMVRNPGNYGFSTVFETCCGSGGGKFNYNNNARCGMSGASACSNPASHLSW  337

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DGIHL+ A  K + +  LN  YC P
Sbjct  338  DGIHLTEAAYKQITDGWLNGPYCSP  362



>ref|XP_008777733.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Phoenix dactylifera]
Length=375

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 143/269 (53%), Gaps = 13/269 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L+ +++ + K  + TWT   L  Q  I WF + L S  CS   D+ C  
Sbjct  110  GANFAVGGATALANDFFRA-KGLNVTWTEYSLGIQ--IEWFKQLLPSL-CS--LDSGCHD  163

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             ++N LF +G +G +DY    I  +++  +       I   +  ++ ++  GAK +VV G
Sbjct  164  FLNNTLFLMGEIGGNDYNDPFIQGRTVEEITTYVPSVISAISSSIKVLIDLGAKTLVVPG  223

Query  475  LPPIGCFPVSIS----SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              PIGC P+ ++    S       Q GC + +N   + HN+LL   + + R+  P  TII
Sbjct  224  NFPIGCVPLYLALFQNSSKGDYDPQTGCINWLNKFSEYHNRLLMDELNKLRQLHPDATII  283

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YANY++A L+I  +PG Y  + T+ ACC G  G  N     + G   AT CSDP  YISW
Sbjct  284  YANYYEALLSIVRSPGQYGIEVTEAACC-GPSGPVNVTSPVLCGDPAATVCSDPSKYISW  342

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            DG+HL+ A   ++A  LL   Y  PP + 
Sbjct  343  DGVHLTEAAYGNIARGLLEGPYATPPIAR  371



>dbj|BAJ99814.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/272 (30%), Positives = 145/272 (53%), Gaps = 11/272 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+ ++  +Y+  N    F   N  L+ Q  + WF + L+   C+    + C+ 
Sbjct  32   GVNFAVGGAPAIDIDYFERNNIVQFKLLNNSLSVQ--LGWFEE-LRPAICNKTETSGCRG  88

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                ALF++G  GV+DY       K+   +       + +    ++ ++  GA ++VV G
Sbjct  89   CFSKALFFVGEFGVNDYNFLWFAGKTEDEVMSHVPTVVKNIAAAVEGLIKGGAVYVVVPG  148

Query  475  LPPIGCFPVSISS---CPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
             PP+GC P  ++S       + D MGC +DIN     HN LL+  I   R ++ + TII+
Sbjct  149  NPPLGCSPTMLTSRSGLNTTEYDDMGCLTDINRVARHHNSLLRSSIVSLRGRYRRATIIF  208

Query  646  ANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            A+++   + I  NP ++   E    +ACCG GG  +N++ +++ G  GAT C +P ++++
Sbjct  209  ADFYSPIIKILRNPSHFGVAEADALRACCGAGG-PYNWNGSAICGMPGATACENPSAFVN  267

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPFSEMV  915
            WDG+H + A N ++A+  LN  + +PP   +V
Sbjct  268  WDGVHYTEATNGYIADWWLNGPFADPPIMSVV  299



>gb|EMT16610.1| GDSL esterase/lipase [Aegilops tauschii]
Length=368

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 142/268 (53%), Gaps = 15/268 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+TSL+ +++  NK  +F   N  LN Q  + WF K L+   C  A  + C  
Sbjct  102  GVNFAVGGATSLNVDFFERNKYVNFKLLNSSLNVQ--LDWFEK-LKPSFCKTAGPSEC--  156

Query  301  DIDNALFWLGALGVSDYFQI--HSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                 LF +G  GV+DY       KS   +R      + +       ++  GA ++V+ G
Sbjct  157  -FSKTLFVVGEFGVNDYNLAWGAGKSEGEVRAYVPQVVQNIANAADVLIKGGATYVVLPG  215

Query  475  LPPIGCFPVSISS----CPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            +PPIGC P  +++       ++ DQ+GC SD++     HN  L+  I+  RR++    +I
Sbjct  216  IPPIGCSPSLLATRVQLNKAKEFDQLGCLSDLDRVTKYHNTKLRDAIDGLRRKYAHAKVI  275

Query  643  YANYWKAFLAIFNNPGNYNFK--ETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
             A+++   + I  NPG +     +  +ACCGGGG ++N++ +++    G   C DP +++
Sbjct  276  KADFYNPIIEILQNPGRFGVAGGDVLRACCGGGG-KYNWNISAVCSQPGVAACKDPSAFV  334

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPP  900
            SWDG H + A  +H+A+  L+  Y +PP
Sbjct  335  SWDGTHFTEATYRHVAKGWLSGPYADPP  362



>dbj|BAJ97605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=362

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 137/265 (52%), Gaps = 13/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N PL+  +QI WF K L S     A    CK 
Sbjct  101  GANMAIIGATTMDFSFFQSIGLSDKIWNNGPLD--TQIQWFRKLLPS-----ACGKDCKR  153

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +++  +RG     + H  + L+T++  GA  IVV G
Sbjct  154  HLSKSLFVVGEFGGNDYNAALFSGRTMADVRGYVPRVVSHIIRGLETMIRVGAMDIVVPG  213

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D  GC    N     HN LL++ +   +R +P   I+Y
Sbjct  214  VLPIGCFPIYLTLYGTSNAGDYDGDGCLKSYNELSAHHNSLLRRSLANLQRTYPHTRIMY  273

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+++   + +   P N+  K   K CCG GG G++N++  +  G +GA+ CSDP +Y+ W
Sbjct  274  ADFYAQVIQMIRAPQNFGLKYGLKVCCGAGGQGKYNYNNKARCGMAGASACSDPHNYLIW  333

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DGIHL+ A  + +A   L   YC P
Sbjct  334  DGIHLTEAAYRSIANGWLKGPYCSP  358



>ref|XP_003564307.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=364

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 137/266 (52%), Gaps = 16/266 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N PL+  +QI WF   L S        + CK 
Sbjct  104  GANMAIIGATAMGSSFFQSLGVGDKIWNNGPLD--TQIQWFQNLLPS-----VCGSSCKT  156

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             +  +LF LG LG +DY    F  ++    A  G S   +       + +++ GA +IV+
Sbjct  157  YLSKSLFVLGELGGNDYNAQLFGGYTPEQAA--GQSPAIVDGIGSGAEKLISLGAMYIVI  214

Query  469  QGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G+ P+GCFP+ ++   +      DQ GC    N+    HN LLQ  +   + ++P   I
Sbjct  215  PGVLPVGCFPIYLTLYQTSNGGDYDQYGCLKRFNALSQRHNSLLQAKVSSLQSKYPWAKI  274

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            +YA+++     +  +P +Y F    +ACCG GGG++N+   +  G +GA+ C +P S +S
Sbjct  275  MYADFYSHVYDMVKSPSSYGFSTNLRACCGAGGGKYNYQNGARCGMAGASACGNPASSLS  334

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEP  897
            WDGIHL+ A  K +A+  +N  YC P
Sbjct  335  WDGIHLTEAAYKKIADGWVNGAYCHP  360



>ref|XP_006449476.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
 gb|ESR62716.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
Length=362

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 141/264 (53%), Gaps = 10/264 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L    +   K  S  WTN  L+ Q  I WF K L+S  CS   D  C+ 
Sbjct  101  GVNFAVAGATALRSAIFYKQKIGSRLWTNDSLSVQ--IDWFKK-LKSSICSTRKD--CET  155

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF++G +G +DY        SI  +R    L +   T   + ++ EGA  +VV G
Sbjct  156  YFKKSLFFVGEIGGNDYNYRAFVGGSINQLRASVPLVVKAITNATRLLIEEGAVELVVPG  215

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC  V ++   S      DQ GC    N+    HN +L+  + + R+++P   IIY
Sbjct  216  NFPIGCSAVYLTLFQSLNEMDYDQNGCLKAPNAFARYHNTMLKAQLHKLRQKYPHANIIY  275

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+Y+ A +  ++ PG+Y F       C GGGG +NF+ ++  G +G+  C +P ++ +WD
Sbjct  276  ADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNNSARCGHTGSRACENPSTHANWD  335

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            GIHL+ A  +H+A  L++  +  P
Sbjct  336  GIHLTEAAYRHVANGLIHGPFATP  359



>ref|XP_004485880.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Cicer arietinum]
Length=375

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 142/271 (52%), Gaps = 9/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  E++         WTN  LN Q  + WF K L+   C+   D  C +
Sbjct  108  GVNFAVAGATALDVEFFIQEGLAKLLWTNDSLNIQ--LGWFKK-LKPSLCTTKQD--CDS  162

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
                +LF +G +G +DY +   + +I  ++    L +   T+ +  ++ EGA  ++V G 
Sbjct  163  YFKKSLFVVGEIGGNDYNYAAFAGNISDLQATVPLVVEEITKTITELIAEGAVELLVPGN  222

Query  478  PPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYA  648
             PIGC  V ++   S   +  D+ GC    N     HNK L   +E  R++ P   IIYA
Sbjct  223  LPIGCSAVYLTLFRSKNIEDYDKNGCLKAFNGFAKYHNKQLNLALETLRQKNPHARIIYA  282

Query  649  NYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDG  828
            NY+ A    F+ P +Y F       C GGGG +NF+ ++  G S +  C+DP +Y +WDG
Sbjct  283  NYFGAANRFFHAPRHYGFTNGASRACCGGGGPYNFNNSARCGHSNSKACADPTTYANWDG  342

Query  829  IHLSGAMNKHLAELLLNKDYCEPPFSEMVNK  921
            IHL+ A  +H+A+ L+   +  PP +  + K
Sbjct  343  IHLTEAAYRHIAKGLIEGPFTNPPLNPSLFK  373



>gb|EAY96951.1| hypothetical protein OsI_18870 [Oryza sativa Indica Group]
Length=361

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 141/267 (53%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+TS+   ++ S       W N PL+  +QI WF + L S  C N     C++
Sbjct  100  GANMAIIGATSMDAAFFKSIGLSDKIWNNGPLD--TQIQWFRQLLPSV-CGN----DCRS  152

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +++  +R      +    + L+T++  GA  +VV G
Sbjct  153  YLSKSLFVVGEFGGNDYNAPLFAGRAMTEVRDYVPQVVSKIIRGLETLIRMGAVDVVVPG  212

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D+ GC    NS    HN LL++ +   +R +P   ++Y
Sbjct  213  VLPIGCFPIYLTLYGTSNGADYDRNGCLKSYNSLSSYHNTLLKRSLSNLQRTYPHARVMY  272

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+++    A+  +P N+  K   K CCG GG G +N++  +  G SG++ C+DP +Y+ W
Sbjct  273  ADFYSQVTAMVRSPQNFGLKYGLKVCCGAGGQGTYNYNNKARCGMSGSSACADPANYLIW  332

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  + +A+  L   YC PP 
Sbjct  333  DGIHLTEAAYRSIADGWLKGPYCNPPI  359



>gb|AAS91011.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAT01386.1| unknown protein, contains GDSL-like lipase/acylhydrolase domain 
[Oryza sativa Japonica Group]
 gb|AAT44169.1| unknown protein, contains GDSL-like lipase/acylhydrolase domain 
[Oryza sativa Japonica Group]
 dbj|BAG94533.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 141/267 (53%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+TS+   ++ S       W N PL+  +QI WF + L S  C N     C++
Sbjct  100  GANMAIIGATSMDAAFFKSIGLSDKIWNNGPLD--TQIQWFRQLLPSV-CGN----DCRS  152

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +++  +R      +    + L+T++  GA  +VV G
Sbjct  153  YLSKSLFVVGEFGGNDYNAPLFAGRAMTEVRDYVPQVVSKIIRGLETLIRMGAVDVVVPG  212

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D+ GC    NS    HN LL++ +   +R +P   ++Y
Sbjct  213  VLPIGCFPIYLTLYGTSNGADYDRNGCLKSYNSLSSYHNTLLKRSLSNLQRTYPHARVMY  272

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+++    A+  +P N+  K   K CCG GG G +N++  +  G SG++ C+DP +Y+ W
Sbjct  273  ADFYSQVTAMVRSPQNFGLKYGLKVCCGAGGQGTYNYNNKARCGMSGSSACADPANYLIW  332

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  + +A+  L   YC PP 
Sbjct  333  DGIHLTEAAYRSIADGWLKGPYCNPPI  359



>ref|XP_004961580.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X2 [Setaria 
italica]
Length=381

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 147/269 (55%), Gaps = 13/269 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+T++   ++  N    F   N  L+ Q  + WF + L+S  C+NA +A   +
Sbjct  109  GVNFAVGGATAIDVGFFERNGLVPFKLLNNSLDVQ--LGWFEE-LRSSLCNNATEAAQGS  165

Query  301  D--IDNALFWLGALGVSDYFQIHS--KSIVAMRG-ISQLCIHHttqllqtvltEGAKHIV  465
                  +LF +G  GV+DY  I S  K+   +R  + ++     + + + +   GA ++V
Sbjct  166  GGCFGKSLFIVGEFGVNDYAFIFSANKTEAEVRSYVPKVVRTIASAVERLINNNGAAYVV  225

Query  466  VQGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT  636
            V G PPIGC P  ++   S      D++GC  D+N  +  HN LL++ +   R + P  T
Sbjct  226  VPGNPPIGCSPAILTLRQSPNAADYDRIGCLRDVNDVVRYHNALLRRAVVGLRAKHPHAT  285

Query  637  IIYANYWKAFLAIFNNPGNYNF-KETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
            II+A+++     I  NP  +    +  KACCG GG ++N++ +++ G  G   C DP +Y
Sbjct  286  IIFADFYTPIRRILENPDQFGVVSDVLKACCGTGG-DYNWNASAVCGMPGVAACRDPSAY  344

Query  814  ISWDGIHLSGAMNKHLAELLLNKDYCEPP  900
            +SWDG+H + A+N+++AE  L   Y +PP
Sbjct  345  VSWDGVHFTEAVNQYVAEGWLQGPYADPP  373



>ref|NP_001054912.2| Os05g0209600 [Oryza sativa Japonica Group]
 dbj|BAF16826.2| Os05g0209600, partial [Oryza sativa Japonica Group]
Length=367

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 141/267 (53%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+TS+   ++ S       W N PL+  +QI WF + L S  C N     C++
Sbjct  106  GANMAIIGATSMDAAFFKSIGLSDKIWNNGPLD--TQIQWFRQLLPSV-CGN----DCRS  158

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +++  +R      +    + L+T++  GA  +VV G
Sbjct  159  YLSKSLFVVGEFGGNDYNAPLFAGRAMTEVRDYVPQVVSKIIRGLETLIRMGAVDVVVPG  218

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D+ GC    NS    HN LL++ +   +R +P   ++Y
Sbjct  219  VLPIGCFPIYLTLYGTSNGADYDRNGCLKSYNSLSSYHNTLLKRSLSNLQRTYPHARVMY  278

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+++    A+  +P N+  K   K CCG GG G +N++  +  G SG++ C+DP +Y+ W
Sbjct  279  ADFYSQVTAMVRSPQNFGLKYGLKVCCGAGGQGTYNYNNKARCGMSGSSACADPANYLIW  338

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  + +A+  L   YC PP 
Sbjct  339  DGIHLTEAAYRSIADGWLKGPYCNPPI  365



>gb|KDO77812.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=286

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 142/264 (54%), Gaps = 10/264 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L    +   K  S  WTN  L+ Q  I WF K L+S  CS   D  C+ 
Sbjct  25   GVNFAVAGATALRSVIFYKQKIGSRLWTNDSLSVQ--IDWFKK-LKSSICSTRKD--CET  79

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF++G +G +DY       +SI  +R    L +   T   + ++ EGA  +VV G
Sbjct  80   YFKKSLFFVGEIGGNDYNYRAFVGESINQLRASVPLVVKAITNATRLLIEEGAVELVVPG  139

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC  V ++   S      D+ GC    N+    HN +L+  + + R+++P   IIY
Sbjct  140  NFPIGCSAVYLTLFQSLNEMDYDRNGCLKAPNAFARYHNTMLKAELHKLRQKYPHANIIY  199

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+Y+ A +  ++ PG+Y F       C GGGG +NF+ ++  G +G+  C +P ++ +WD
Sbjct  200  ADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNNSARCGHTGSRACENPSTHANWD  259

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            GIHL+ +  +H+A  L++  +  P
Sbjct  260  GIHLTESAYRHVANGLIHGPFATP  283



>ref|XP_008225208.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Prunus mume]
Length=380

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 144/271 (53%), Gaps = 14/271 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+T L   +  + + HS +  N   + + Q+ WF + L S  C+ + D  CK 
Sbjct  112  GVNFAVIGATGLDASFLATMEIHSPSTNN---SLRIQLEWFKQMLPSL-CNTSLD--CKK  165

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +L  +G++G +DY    +  KSI  +R    L I      +  ++  GA  I+V G
Sbjct  166  FLSTSLILMGSIGCNDYNDGLLGGKSIELVRSYLPLVIEAIASTINELIELGAATILVPG  225

Query  475  LPPIGCFPVSIS---SCPPQQLD-QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              PIGC P  +S   S    Q D   GC   +N     HN+ LQ  + R RR  PQ TI+
Sbjct  226  NNPIGCLPSYLSKFESSDKSQYDASTGCLKWLNEFAQYHNEQLQIELSRIRRLHPQVTIV  285

Query  643  YANYWKAFLAIFNNPGNYNFK-ETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            YA+Y+ A L ++ +P  + F  ET KACCGGGG  +NF+ +   G +GAT C +P  +I+
Sbjct  286  YADYYNALLQLYQSPRQFGFTGETSKACCGGGG-PYNFNSSVQCGNAGATVCENPSQFIN  344

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPFSEM  912
            WDG+H + A  + + + LL  +Y  P  + +
Sbjct  345  WDGMHCTEAAYRLMTKALLQGNYTFPRLASL  375



>ref|XP_006467672.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Citrus sinensis]
Length=362

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 89/264 (34%), Positives = 142/264 (54%), Gaps = 10/264 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L    +   K  S  WTN  L+ Q  I WF K L+S  CS   D  C+ 
Sbjct  101  GVNFAVAGATALRSAIFYKQKIGSRLWTNDSLSVQ--IDWFKK-LKSSICSTRKD--CET  155

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF++G +G +DY       +SI  +R    L +   T   + ++ EGA  +VV G
Sbjct  156  YFKKSLFFVGEIGGNDYNYRAFVGESINQLRASVPLVVKAITNATRLLIEEGAVELVVPG  215

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC  V ++   S      D+ GC    N+    HN +L+  + + R+++P   IIY
Sbjct  216  NFPIGCSAVYLTLFQSLNEMDYDRNGCLKAPNAFARYHNTMLKAELHKLRQKYPHANIIY  275

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+Y+ A +  ++ PG+Y F       C GGGG +NF+ ++  G +G+  C +P ++ +WD
Sbjct  276  ADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNNSARCGHTGSRACENPSTHANWD  335

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            GIHL+ A  +H+A  L++  +  P
Sbjct  336  GIHLTEAAYRHVANGLIHGPFATP  359



>dbj|BAJ97092.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   150 bits (378),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/272 (30%), Positives = 145/272 (53%), Gaps = 11/272 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+ ++  +Y+  N    F   N  L+ Q  + WF + L+   C+    + C+ 
Sbjct  105  GVNFAVGGAPAIDIDYFERNNIVQFKLLNNSLSVQ--LGWFEE-LRPAICNKTETSGCRG  161

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                ALF++G  GV+DY       K+   +       + +    ++ ++  GA ++VV G
Sbjct  162  CFSKALFFVGEFGVNDYNFLWFAGKTEDEVMSHVPTVVKNIAAAVEGLIKGGAVYVVVPG  221

Query  475  LPPIGCFPVSISS---CPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
             PP+GC P  ++S       + D MGC +DIN     HN LL+  I   R ++ + TII+
Sbjct  222  NPPLGCSPTMLTSRSGLNTTEYDDMGCLTDINRVARHHNSLLRSSIVSLRGRYRRATIIF  281

Query  646  ANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            A+++   + I  NP ++   E    +ACCG GG  +N++ +++ G  GAT C +P ++++
Sbjct  282  ADFYSPIIKILRNPSHFGVAEADALRACCGAGG-PYNWNGSAICGMPGATACENPSAFVN  340

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPFSEMV  915
            WDG+H + A N ++A+  LN  + +PP   +V
Sbjct  341  WDGVHYTEATNGYIADWWLNGPFADPPIMSVV  372



>gb|KHN08453.1| GDSL esterase/lipase [Glycine soja]
Length=296

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 145/271 (54%), Gaps = 9/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  +++       + WTN  LN Q  + WF K L+   C+   D  C +
Sbjct  29   GVNFAVAGATALDAKFFIEAGLAKYLWTNNSLNIQ--LGWFKK-LKPSLCTTKQD--CDS  83

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
                +LF +G +G +DY +   + ++  ++      +   T  +  ++ EGA+ ++V G 
Sbjct  84   YFKRSLFLVGEIGGNDYNYAAIAGNVTQLQSTVPPVVEAITMAINGLIAEGARELLVPGN  143

Query  478  PPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYA  648
             PIGC  + ++   S   +  D+ GC    N   + HN+ L+  +E  R++ P   I+YA
Sbjct  144  FPIGCSALYLTLFRSENKEDYDESGCLKTFNGFAEYHNRELKLALETLRKKNPHARILYA  203

Query  649  NYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDG  828
            +Y+ A    F+ PG++ F       C GGGG FNF+ ++  G +G+  C+DP +Y +WDG
Sbjct  204  DYYGAAKRFFHAPGHHGFTNGALRACCGGGGPFNFNISARCGHTGSKACADPSTYANWDG  263

Query  829  IHLSGAMNKHLAELLLNKDYCEPPFSEMVNK  921
            IHL+ A  +++A+ L+   +  PP     NK
Sbjct  264  IHLTEAAYRYIAKGLIYGPFSYPPLKTSPNK  294



>ref|XP_010912585.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=396

 Score =   150 bits (379),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 147/269 (55%), Gaps = 13/269 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG T+L  E++ + K  + TW    L   +QI WF + L S  CS  +D  C++
Sbjct  119  GVNFAVAGVTALDGEFFKA-KGMALTWPQYSLG--TQIQWFKELLPSF-CSYKSD--CES  172

Query  301  DIDNALFWLGALGVSDYFQIHS--KSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +L  +G +G +DY Q  +  +++  +R      I+ T   + +++  GAK +VV G
Sbjct  173  FLSKSLVLMGEIGGNDYNQPFAQFRTLDEIRTYVPSVINITGWAINSLIELGAKTLVVPG  232

Query  475  LPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            + P+GC    ++    Q+ +    Q GC   +N   + HN LL+  ++R R   P  TII
Sbjct  233  IFPLGCVSAYLTIHQSQRKEDYDPQTGCIKRLNEFSEYHNNLLKAEVDRLRGLHPYTTII  292

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y++A + I+ +P  Y       ACCGGGG  +NF+   M G  G T CSDP  ++ W
Sbjct  293  YADYYEAAMDIYRHPLKYGIDAPLAACCGGGG-RYNFNLAVMCGAPGGTVCSDPSKHVCW  351

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            DG+HL+ A+ K +A  LL   Y   P ++
Sbjct  352  DGMHLTDAVYKIIARGLLEGSYATAPIAQ  380



>ref|XP_006654152.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=362

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 140/267 (52%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+TS+   ++ S       W N PL+  +QI WF + L      N     C++
Sbjct  101  GANMAIIGATSMDAAFFKSIGLSDKIWNNGPLD--TQIQWFRQLL-----PNVCGRDCRS  153

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +S+  +R      +    + L+T++  GA  +VV G
Sbjct  154  YLSKSLFVVGEFGGNDYNAPLFAGRSMSEVRDYVPQVVSKIIRGLETLVRMGAVDVVVPG  213

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D+ GC    NS    HN LL++ +   ++ +P   I+Y
Sbjct  214  VLPIGCFPIYLTLYGTSNGADYDRNGCLRSYNSLSSYHNTLLKRSLSNLQKTYPHARIMY  273

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+++    A+  +P N+  K     CCG GG G++N++  +  G +G++ CSDP +Y+ W
Sbjct  274  ADFYSQVTAMVRSPQNFGLKYGLTVCCGAGGQGKYNYNNKARCGMAGSSACSDPANYLIW  333

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  + +A+  LN  YC PP 
Sbjct  334  DGIHLTEAAYRSIADGWLNGPYCNPPI  360



>ref|XP_008777731.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=396

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 148/269 (55%), Gaps = 13/269 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG T+L  +++  +K  + TW    L   +QI WF K L S  CS+ +D  C++
Sbjct  119  GVNFAVAGVTALDGKFF-RDKGMALTWPQYSL--ATQIQWFKKLLPSL-CSSKSD--CES  172

Query  301  DIDNALFWLGALGVSDYFQIHS--KSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +L  +G +G +DY    +  K+I  +R      ++ T+  + +++  GAK +VV G
Sbjct  173  FFSKSLVLMGEIGGNDYNHPFAQLKAIDEIRTYVPSVVNITSWAINSLIELGAKTLVVPG  232

Query  475  LPPIGCFPVSIS---SCPPQQLD-QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            + P+GC    ++   S   +  D Q GC   +N   + HN LLQ  ++R RR  P+ TII
Sbjct  233  IFPLGCVSAYLTVHQSGRREDYDPQTGCIKWLNEFSEYHNSLLQTELDRLRRLHPRITII  292

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YANY+ A + I+ +P  Y F     ACC GGGG +NF+  +M G    T CSDP  ++ W
Sbjct  293  YANYYDAAMDIYRHPLKYGFDAPLAACC-GGGGPYNFNLTAMCGAREDTVCSDPSKHVCW  351

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            DG+HL+ A  + +A  LL   Y   P ++
Sbjct  352  DGMHLTDAAYEIIARGLLQGSYASAPITQ  380



>ref|NP_001149411.1| esterase precursor [Zea mays]
 gb|ACG35357.1| esterase precursor [Zea mays]
Length=377

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 142/273 (52%), Gaps = 14/273 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLN--FQSQIAWFHKFLQSKGCSNAADARC  294
            G NFA+ G+T+L  +Y+  N      W+  P N     Q+ WF +  +S  C +   A C
Sbjct  105  GANFAVMGATALDLKYFKDNN----VWSIPPFNTSMGVQLEWFQEVKRSI-CPDDP-AAC  158

Query  295  KADIDNALFWLGALGVSDY-FQIHSK-SIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
            +A    ALF  G  G +DY F   +  S+  ++ +    +      ++ +L EGA+H+VV
Sbjct  159  RALFGRALFVFGEFGGNDYSFAWKADWSLEKVKTMVPAVVASLVGGVERLLDEGARHVVV  218

Query  469  QGLPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT  636
             G  P GC P++++  P +   +     GC    NS    HN +L+  ++R +R+ P+  
Sbjct  219  PGNLPAGCIPITLTMYPSEDRSEYDPRTGCLKKYNSVALYHNAMLRVALDRLQRRRPESR  278

Query  637  IIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            ++YA+Y+  ++     P  Y +K      C GGGG +N++ ++  G  GAT C DPD+++
Sbjct  279  VVYADYYTPYIQFARTPHLYGYKRGALRACCGGGGPYNYNVSASCGLPGATTCEDPDAHV  338

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMV  915
            SWDGIHL+ A  + +A   +   Y  PP + +V
Sbjct  339  SWDGIHLTEAPYRFIANTWVKGPYAHPPLATVV  371



>gb|ACF87885.1| unknown [Zea mays]
 gb|AFW77540.1| esterase [Zea mays]
Length=377

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 142/273 (52%), Gaps = 14/273 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLN--FQSQIAWFHKFLQSKGCSNAADARC  294
            G NFA+ G+T+L  +Y+  N      W+  P N     Q+ WF +  +S  C +   A C
Sbjct  105  GANFAVMGATALDLKYFKDNN----VWSIPPFNTSMGVQLEWFQEVKRSI-CPDDP-AAC  158

Query  295  KADIDNALFWLGALGVSDY-FQIHSK-SIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
            +A    ALF  G  G +DY F   +  S+  ++ +    +      ++ +L EGA+H+VV
Sbjct  159  RALFGRALFVFGEFGGNDYSFAWKADWSLEKVKTMVPAVVASLVGGVERLLDEGARHVVV  218

Query  469  QGLPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT  636
             G  P GC P++++  P +   +     GC    NS    HN +L+  ++R +R+ P+  
Sbjct  219  PGNLPAGCIPITLTMYPSEDRSEYDPRTGCLKKYNSVALYHNAMLRVALDRLQRRRPESR  278

Query  637  IIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            ++YA+Y+  ++     P  Y +K      C GGGG +N++ ++  G  GAT C DPD+++
Sbjct  279  VVYADYYTPYIQFARTPHLYGYKRGALRACCGGGGPYNYNVSASCGLPGATTCEDPDAHV  338

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMV  915
            SWDGIHL+ A  + +A   +   Y  PP + +V
Sbjct  339  SWDGIHLTEAPYRFIANTWVKGPYAHPPLATVV  371



>ref|XP_004960619.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=367

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 139/267 (52%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T+++ +++ S       W N PL+  +QI WF + L S          CK 
Sbjct  106  GANMAIIGATTMNFDFFNSIGLSDKIWNNGPLD--TQIQWFRQLLPS-----VCGKDCKN  158

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +++  +RG     +    + L+T++  GA  +VV G
Sbjct  159  YLSKSLFVVGEFGGNDYNAALFSGRTMAEVRGYVPRVVSKLIRGLETIIRSGAVDVVVPG  218

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ I+   +      D  GC    N     HN LL++ +   +R +P+  I+Y
Sbjct  219  VLPIGCFPIYITLYGTSNAADYDGDGCLRSYNGLSSYHNSLLKRSLGSLQRTYPRTRIMY  278

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+++     +   P N+  K   K CCG GG G++N++  +  G +GA+ C+DP +Y+ W
Sbjct  279  ADFYSQVTHMIRAPQNFGLKYGLKVCCGAGGQGKYNYNNKARCGMAGASACADPGNYLIW  338

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  + +A+  L   YC PP 
Sbjct  339  DGIHLTEAAYRSIADGWLKGPYCNPPI  365



>ref|XP_003568743.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=367

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/265 (33%), Positives = 139/265 (52%), Gaps = 13/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++  +++ S       W N PL+  +QI WF + L S     A    C+ 
Sbjct  106  GANMAIIGATTMDFDFFKSIGLSDSIWNNGPLD--TQIQWFRQLLPS-----ACGRDCRR  158

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +S+  + G     + H  + L+T++  GA  IVV G
Sbjct  159  HLSKSLFVVGEFGGNDYNAALFSGRSMADVTGYVPRVVSHIIRGLETMIRLGAMDIVVPG  218

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D  GC    NS    HN LL++ I + +R +P+  I+Y
Sbjct  219  VLPIGCFPIYLTLYGTSNAGDYDGDGCLKSYNSLSYHHNSLLKRSIAKLQRTYPRTRIMY  278

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+++   + +   P N+  K   K CCG  G G++N++  +  G +GA+ CSDP +Y+ W
Sbjct  279  ADFYTQVIQMIRAPQNFGLKYGLKVCCGASGQGKYNYNNKARCGMAGASACSDPQNYLIW  338

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DGIHL+ A  + +A   L   YC P
Sbjct  339  DGIHLTEAAYRSIANGWLKGPYCSP  363



>ref|XP_010241274.1| PREDICTED: acetylajmalan esterase-like [Nelumbo nucifera]
Length=372

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/262 (34%), Positives = 144/262 (55%), Gaps = 18/262 (7%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+L   Y   +K  +   TN  L+ Q  + WF   LQS   +      C  
Sbjct  110  GVNFAVAGSTALDTSYLAKSKIIA-PVTNSSLSVQ--LGWFKDHLQSICYTQT---ECAH  163

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             ++ ALF +G +G +DY    FQ  +K I  ++      +       + V+  GAK ++V
Sbjct  164  KLEKALFLVGEIGGNDYNYAFFQ--AKRIGEIQSYVPHIVQKIKDAARKVIDHGAKTVIV  221

Query  469  QGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G  PIGC P+ ++   S  P   D++ C   +N+    HN  LQ+ +++ R+++P  TI
Sbjct  222  PGNFPIGCLPIYLTAFRSDDPAAYDELKCLEGLNNMAMFHNDHLQRALKQLRKEYPDVTI  281

Query  640  IYANYWKAFLAIFNNPGNYNFKET--KKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
            +YA+Y+ A   + ++  +  F+E   +KACCG GG ++NFD   M G  G   C DP+++
Sbjct  282  VYADYYTALQWVLSHAPSLGFEEKSLQKACCGTGG-DYNFDLTKMCGAPGVPVCPDPETH  340

Query  814  ISWDGIHLSGAMNKHLAELLLN  879
            ISWDGIHL+    K++A+ L++
Sbjct  341  ISWDGIHLTEKAYKYMADFLMH  362



>ref|NP_001168581.1| hypothetical protein precursor [Zea mays]
 gb|ACN26426.1| unknown [Zea mays]
 gb|ACN28745.1| unknown [Zea mays]
 gb|AFW75582.1| hypothetical protein ZEAMMB73_865053 [Zea mays]
Length=372

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/265 (32%), Positives = 136/265 (51%), Gaps = 8/265 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSK-GCSNAADARCK  297
            G N AI G+T++   ++ S       W N P++FQ  + WF +   +  G   A  A CK
Sbjct  105  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQ--LEWFQQVASAVCGGGQAQQADCK  162

Query  298  ADIDNALFWLGALGVSDYFQIHSKSIVAMRG--ISQLCIHHttqllqtvltEGAKHIVVQ  471
            + + N+LF  G  G +DY  +   +  A +    +   +      ++ ++  GA  IVV 
Sbjct  163  SYLANSLFVFGEFGGNDYNAMLFGNYSADQASTYTPQVVAAVASGVEKLVAMGATDIVVP  222

Query  472  GLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            G+ PIGCFP+ ++   +      D +GC    N     HN  LQ  I   + ++    I+
Sbjct  223  GVLPIGCFPIYLTFYGTSSSADYDSLGCLRKFNDLSTNHNNQLQAQISGLQAKYKSARIM  282

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+++ A   +  NPG+Y F    + CCG GGG++N+  ++  G  GA+ CS+P +++SW
Sbjct  283  YADFYSAVYDMVKNPGSYGFSTAFQTCCGSGGGKYNYQNSARCGMPGASACSNPAAHLSW  342

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DGIHL+ A  K + +  LN  YC P
Sbjct  343  DGIHLTEAAYKQITDGWLNGPYCHP  367



>ref|XP_004963669.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Setaria italica]
Length=374

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/274 (31%), Positives = 145/274 (53%), Gaps = 14/274 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+N A+ G+T++   ++ +N    F   N  L+ Q  + WF + ++   C N A   C  
Sbjct  107  GVNLAVGGATAIEVAFFETNGLVPFKLLNNSLDVQ--LGWFEQ-IKPSVCDNGA-LDC--  160

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  ALF++G LGV+DY    +  K+   ++      +   +  ++ ++ EGA +IVV G
Sbjct  161  -LGKALFFVGELGVNDYNFIWMAGKTDDQVKTYVPKVVDTISMAVERLINEGAVYIVVPG  219

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
             PP GC P  ++   S    + D +GC  D+N+    HN LL+  +   R ++P   I++
Sbjct  220  NPPTGCSPAILTFRLSPNKTEYDHIGCLRDVNAVARYHNLLLRAAVGSLRGRYPHARIVF  279

Query  646  ANYWKAFLAIFNNPGNYNFK-ETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+++   + I  NPG + F  +  KACCG GG  +N+D ++  G  G   C +P +Y+SW
Sbjct  280  ADFYDPIIRILENPGQFGFAGDALKACCGTGGA-YNWDPSAFCGMPGVAACENPAAYVSW  338

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            DG+H + A N+++AE  L   Y +PP    +  +
Sbjct  339  DGVHYTEATNRYVAEGWLRGPYADPPILSALQPR  372



>gb|EMT16237.1| GDSL esterase/lipase [Aegilops tauschii]
Length=382

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/269 (34%), Positives = 147/269 (55%), Gaps = 15/269 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFL-QSKGCSNAADARCK  297
            G NFAI G T+L   ++  + + S       L  ++QI WF K + QS  C+  A  +C+
Sbjct  112  GANFAIVGGTALDVGFFLRHNSGSVPPFRSSL--RAQIGWFRKVVKQSLSCNTTA--QCR  167

Query  298  ADIDNALFWLGALGVSDYFQIHS--KSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
              +  +LF +G LG++DY  I S  KS+   +      +    + ++ ++ EGA+++VV 
Sbjct  168  ERLARSLFVVGELGLTDYSYILSGGKSLQEAKSFVPDVVQAIIRGVERLVEEGARYVVVS  227

Query  472  GLPPIGCFPVSIS----SCPPQQLDQ-MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT  636
            G PP+GC P++++    +    + D+  GC   +N     HN +LQ+ + R R ++P  T
Sbjct  228  GTPPMGCTPMALTKYAVAANATEYDRRTGCLRRLNGLSQYHNWMLQESVRRARVKYPGTT  287

Query  637  IIYANYWKAFLAIFNNPGNYNFK-ETKKACCGGGGGEFNFDRN-SMRGTSGATKCSDPDS  810
            ++YA+Y K    +   PG   F  E  +ACCGGGG  +N++ + S  G  GAT CSDP +
Sbjct  288  LVYADYHKPVARLIRRPGKLGFTAEPLRACCGGGG-RYNYNMDGSACGLPGATACSDPST  346

Query  811  YISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            ++ WDGIH + A NK++A   L   Y  P
Sbjct  347  HLFWDGIHYTEAANKYIAHGWLTGLYAHP  375



>ref|XP_006655809.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=339

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 136/264 (52%), Gaps = 12/264 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF +       S+   + CK+
Sbjct  78   GANMAITGATAMDASFFRSLGLSDKIWNNGPISFQLQ--WFQQI-----SSSVCGSSCKS  130

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQL--CIHHttqllqtvltEGAKHIVVQG  474
             + N+LF  G  G +DY  +      A +  +     +   +  ++ ++  GA  +VV G
Sbjct  131  YLANSLFVFGEFGGNDYNAMLFGGYSADQASTYTPQIVDTISSGVEKLIAMGAVDVVVPG  190

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D +GC    N     HN  L+  I   + ++    I+Y
Sbjct  191  VLPIGCFPIYLTIYGTSSSSDYDALGCLKKFNDLSTNHNNQLKTKISALQTKYKSARIMY  250

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+++     +  +PG+Y F    + CCG GGG+FN++ N+  G SGA+ CS+P S++SWD
Sbjct  251  ADFYSGVYDMVRSPGSYGFSTAFETCCGSGGGKFNYNNNARCGMSGASACSNPASHLSWD  310

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            GIHL+ A  K + +  LN  YC P
Sbjct  311  GIHLTEAAYKQITDGWLNGPYCSP  334



>ref|XP_002437861.1| hypothetical protein SORBIDRAFT_10g003930 [Sorghum bicolor]
 gb|EER89228.1| hypothetical protein SORBIDRAFT_10g003930 [Sorghum bicolor]
Length=367

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/264 (33%), Positives = 137/264 (52%), Gaps = 12/264 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF + + S  C N     CK+
Sbjct  106  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQ--WFQQ-ISSAVCGN----DCKS  158

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRG--ISQLCIHHttqllqtvltEGAKHIVVQG  474
             + N+LF  G  G +DY  +   +  A +    +   +      ++ ++  GA  IVV G
Sbjct  159  YLGNSLFVFGEFGGNDYNAMLFGNYNADQASTYTPQIVSTIANGVEKLIAMGATDIVVPG  218

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D +GC    N     HN  LQ  I   + ++    I+Y
Sbjct  219  VLPIGCFPIYLTIYGTSNSGDYDSLGCLKKFNDLSTNHNNQLQTQISSLQAKYKSARIMY  278

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+++ A   +  NPG+Y F    + CCG GGG++N+  ++  G SGA+ CS+P +++SWD
Sbjct  279  ADFYSAVYDMVKNPGSYGFSTVFQTCCGAGGGKYNYQNSARCGMSGASACSNPAAHLSWD  338

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            GIHL+ A  K + +  LN  YC P
Sbjct  339  GIHLTEAAYKQITDGWLNGPYCRP  362



>gb|KDO77809.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=362

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 142/264 (54%), Gaps = 10/264 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L    +   K  S  WTN  L+ Q  I WF K L+S  CS   D  C+ 
Sbjct  101  GVNFAVAGATALRSVIFYKQKIGSRLWTNDSLSVQ--IDWFKK-LKSSICSTRKD--CET  155

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF++G +G +DY       +SI  +R    L +   T   + ++ EGA  +VV G
Sbjct  156  YFKKSLFFVGEIGGNDYNYRAFVGESINQLRASVPLVVKAITNATRLLIEEGAVELVVPG  215

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC  V ++   S      D+ GC    N+    HN +L+  + + R+++P   IIY
Sbjct  216  NFPIGCSAVYLTLFQSLNEMDYDRNGCLKAPNAFARYHNTMLKAELHKLRQKYPHANIIY  275

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+Y+ A +  ++ PG+Y F       C GGGG +NF+ ++  G +G+  C +P ++ +WD
Sbjct  276  ADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNNSARCGHTGSRACENPSTHANWD  335

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            GIHL+ +  +H+A  L++  +  P
Sbjct  336  GIHLTESAYRHVANGLIHGPFATP  359



>ref|XP_008671733.1| PREDICTED: uncharacterized protein LOC100191771 isoform X1 [Zea 
mays]
 gb|ACN28123.1| unknown [Zea mays]
 tpg|DAA52445.1| TPA: hypothetical protein ZEAMMB73_922902 [Zea mays]
Length=399

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 148/270 (55%), Gaps = 11/270 (4%)
 Frame = +1

Query  124  MNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKAD  303
            +NFA+AG+T++  +++  N   + +    P +  +Q+ WF   L       ++ +   A 
Sbjct  132  VNFAVAGATAIEHDFFARN---NLSIDVTPQSIMTQLGWFDAHLL-----RSSSSSSAAA  183

Query  304  IDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGLP  480
              +ALFW+G +G +DY + + ++  +  + +  + +   T  ++ +L  GAK+++VQGLP
Sbjct  184  AADALFWVGEIGANDYAYTVVARDTIPPKLVRTMAVQRVTAFVEGLLERGAKYVIVQGLP  243

Query  481  PIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYANYWK  660
              GC P++++       D +GC + +N     HN+ L   +   RR+ P   + YA+Y+ 
Sbjct  244  LTGCLPLAMTLARADDRDAVGCAASVNRQSYAHNRRLLAALRALRRRHPAAVLAYADYYA  303

Query  661  AFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK-CSDPDSYISWDGIHL  837
            A LA+  +P  + F E  + CCG GGG +NFD  +  G+   T  C+ P  Y++WDG+H+
Sbjct  304  AHLAVMRSPARHGFAEPFRTCCGSGGGAYNFDLFATCGSPQVTTACARPAEYVNWDGVHM  363

Query  838  SGAMNKHLAELLLNKD-YCEPPFSEMVNKK  924
            + AM K +A +  + D YC P F +++  K
Sbjct  364  TEAMYKVVAGMFFSGDGYCRPAFKDLLAMK  393



>ref|XP_002453668.1| hypothetical protein SORBIDRAFT_04g010100 [Sorghum bicolor]
 gb|EES06644.1| hypothetical protein SORBIDRAFT_04g010100 [Sorghum bicolor]
Length=365

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 138/266 (52%), Gaps = 13/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF + + +  C  +    CK+
Sbjct  103  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQ--WFQQ-IATAVCGQS----CKS  155

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + N+LF  G  G +DY        +I   R  +   ++  ++ +  ++  GA  IVV G
Sbjct  156  YLANSLFVFGEFGGNDYNAMIFGGYTIEQARKYTPKIVNTISRGIDKLIGLGATDIVVPG  215

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFR-RQFPQCTII  642
            + PIGCFP+ ++   S      D +GC    N     HN LLQK ++  + R      I+
Sbjct  216  VLPIGCFPIYLTIYQSSNSSDYDDLGCLKSFNDLSTYHNTLLQKRVDIIQSRHRKTARIM  275

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+++ A   +  NP  Y F    + CCG GGG++N+  ++  G SGA+ C++P +++SW
Sbjct  276  YADFYSAVYDMVRNPQTYGFSSVFETCCGSGGGKYNYQNSARCGMSGASACANPATHLSW  335

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPP  900
            DGIHL+ A  K + +  L   YC PP
Sbjct  336  DGIHLTEAAYKQITDGWLKGPYCRPP  361



>ref|XP_008783908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=413

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/266 (31%), Positives = 141/266 (53%), Gaps = 11/266 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA++G+T+L  E++   +  +    N  L+ Q  + WF   ++   C++     C+ 
Sbjct  101  GANFAVSGATALDIEFFQQRRLGNLAGVNESLSVQ--LRWFEG-MKPSLCNSTKS--CRD  155

Query  301  DIDNALFWLGALGVSDYFQI--HSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G LGV+DY       +S+  +R      +   +   + ++  GA  ++V G
Sbjct  156  YFSKSLFMIGELGVNDYITPLRARRSLKEVRSYVPKVVDKISMATERLIELGAADLMVAG  215

Query  475  LPPIGCFPVSISSC-PPQQLDQ---MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            +PP+GCFPV ++    P + D     GC  ++N+    HN+LL++ +++ R ++P+  + 
Sbjct  216  IPPMGCFPVCLTLLMSPNKEDYEPGTGCLKEVNNLTRYHNRLLRRSLDQLRIKYPRLRLT  275

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+ A + + +NP  Y F       C GGGG +NF+     G  G+T C DP +Y+SW
Sbjct  276  YADYYGAAIRLASNPKRYGFSNGALRACCGGGGPYNFNSTVFCGQPGSTVCKDPSTYVSW  335

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPP  900
            D IHL+ A    +A  LL   Y +PP
Sbjct  336  DSIHLTEAAYHSMAMGLLQGPYADPP  361



>ref|NP_001242505.1| uncharacterized protein LOC100815771 precursor [Glycine max]
 gb|ACU18018.1| unknown [Glycine max]
Length=375

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 145/271 (54%), Gaps = 9/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  +++       + WTN  LN Q  + WF K L+   C+   D  C +
Sbjct  108  GVNFAVAGATALDAKFFIEAGLAKYLWTNNSLNIQ--LGWFKK-LKPSLCTTKQD--CDS  162

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
                +LF +G +G +DY +   + ++  ++      +   T  +  ++ EGA+ ++V G 
Sbjct  163  YFKRSLFLVGEIGGNDYNYAAIAGNVTQLQSTVPPVVEAITMAINGLIAEGARELLVPGN  222

Query  478  PPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYA  648
             PIGC  + ++   S   +  D+ GC    N   + HN+ L+  +E  R++ P   I+YA
Sbjct  223  FPIGCSALYLTLFRSENKEDYDESGCLKTFNGFAEYHNRELKLALETLRKKNPHARILYA  282

Query  649  NYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDG  828
            +Y+ A    F+ PG++ F       C GGGG FNF+ ++  G +G+  C+DP +Y +WDG
Sbjct  283  DYYGAAKRFFHAPGHHGFTNGALRACCGGGGPFNFNISARCGHTGSKACADPSTYANWDG  342

Query  829  IHLSGAMNKHLAELLLNKDYCEPPFSEMVNK  921
            IHL+ A  +++A+ L+   +  PP     NK
Sbjct  343  IHLTEAAYRYIAKGLIYGPFSYPPLKTSPNK  373



>ref|XP_010231603.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=394

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/273 (34%), Positives = 140/273 (51%), Gaps = 16/273 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFL-QSKGC-SNAADARC  294
            G NFAI G T+L   ++      S   +   L  ++QIAWF   L QS  C S    A C
Sbjct  117  GANFAIVGGTALDAGFFLRYNPGSVPPSRSSL--RAQIAWFRGLLKQSLICGSGITAAGC  174

Query  295  KADIDNALFWLGALGVSDYFQI---HSKSIVAMRGISQLCIHHttqllqtvltEGAKHIV  465
            +A +  +LF +G  GV+DY  I     KS+   + +    +    + ++ ++ EGA+++V
Sbjct  175  RAHLARSLFVVGEFGVTDYSYILCGGRKSLQDAKSLVPRVVQAIVRGVEMLVEEGARYVV  234

Query  466  VQGLPPIGCFPVSISSC-------PPQQLDQ-MGCNSDINSAIDLHNKLLQKMIERFRRQ  621
            V G PP GC P+ ++           +Q D+  GC    N     HN +LQ+ + R R +
Sbjct  235  VTGTPPAGCLPMVLAKYGVDQGNETTEQYDRRTGCLRRFNGLSQYHNWMLQEAVRRMRAK  294

Query  622  FPQCTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFD-RNSMRGTSGATKCS  798
            +   T++YA+Y K    +   PG + F E     C GGGG++N++   +  G  GAT C 
Sbjct  295  YQGTTLVYADYHKPVSRLIRRPGKFGFAEDPLRACCGGGGQYNYNPMGAACGLPGATACI  354

Query  799  DPDSYISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            DP ++I WDGIH + A NK++AE  LN  Y  P
Sbjct  355  DPTNHIYWDGIHYTEAANKYIAEGWLNGVYAHP  387



>ref|XP_006286793.1| hypothetical protein CARUB_v10003448mg, partial [Capsella rubella]
 gb|EOA19691.1| hypothetical protein CARUB_v10003448mg, partial [Capsella rubella]
Length=306

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 141/261 (54%), Gaps = 17/261 (7%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA++GST+L+  ++ +   H    TNIPL+  +Q+AWF   L S  C  A  + C  
Sbjct  53   GVNFAVSGSTALNSSFFAARNLH-VPATNIPLS--TQLAWFKSHLLST-CQGAPSSDC--  106

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             +  +LF +G +G +DY    FQ   K +  +R      +   T   + V+  GA ++VV
Sbjct  107  -LKQSLFMMGEIGGNDYNYGFFQ--GKPMEEIRSYIPHVVGAITAAAREVIRTGAVNVVV  163

Query  469  QGLPPIGCFPVSISSCP---PQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G  P+GCFP+ ++S P   P+  D  GC   +N     HN  LQ+ I   R++FP   I
Sbjct  164  PGNFPVGCFPIYLTSFPVKDPKAYDDQGCLKHLNEFAMDHNNQLQEAIASLRKEFPHVAI  223

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            +Y +Y+ AF  +  + G ++     K+CCG GG  +N+D     G +G   C +P+ +IS
Sbjct  224  VYGDYYNAFQNVLRSEGRFDKSVALKSCCGIGGA-YNYDGKRPCGAAGVPVCQNPNKFIS  282

Query  820  WDGIHLSGAMNKHLAELLLNK  882
            WDG+HL+    + +++ L N+
Sbjct  283  WDGVHLTQKAYRFMSKFLNNQ  303



>ref|XP_004971993.1| PREDICTED: GDSL esterase/lipase At1g28590-like, partial [Setaria 
italica]
Length=355

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 94/270 (35%), Positives = 140/270 (52%), Gaps = 16/270 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L+  ++        TWT  P +   QI WF K L S   S       ++
Sbjct  63   GANFAVGGATALNGSFFRERGVEP-TWT--PHSLYEQIQWFKKLLPSIAPSETE----RS  115

Query  301  DI-DNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
            DI  N+LF++G +G +DY    +  KS+  +  +    +   +  +  + + GA  +VV 
Sbjct  116  DIMSNSLFFVGEVGGNDYNHLIVRDKSLDELHELVPNVVGAISSAITDLTSLGANKLVVP  175

Query  472  GLPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            G  PIGC P+ +S  P Q+ D    Q GC   +N   + HN +LQ+ +ER R  +P  TI
Sbjct  176  GNFPIGCVPLYLSIFPSQKEDYYDEQTGCIKWLNEFAEYHNSMLQEELERLRNLYPDVTI  235

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            IYA+Y+ A L IF  P  + F     ACC G    +N   + + G  G+T CSDP  YIS
Sbjct  236  IYADYYGASLNIFRAPLQFGFTVPLNACC-GSDAPYNCSPSILCGRPGSTVCSDPSKYIS  294

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            WDG+H + A  + + + +L   Y  PP SE
Sbjct  295  WDGLHFTEASYRVVIQGVLGG-YAIPPLSE  323



>ref|XP_008812188.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=377

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 143/267 (54%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L+ +++++ K  + TWT   L  Q  I  F + L S  CS  +D+ C  
Sbjct  88   GANFAVGGATALANDFFSA-KGLNVTWTKYSLGIQ--IEQFKQLLPSL-CS--SDSGCHD  141

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             ++N LF +G +G +DY    I  +++  +       I   +  ++ ++  GAK +VV G
Sbjct  142  FLNNTLFLMGEIGGNDYNHPFIQGRTVEEITTYVPSVISAISSSIKVLIDLGAKTLVVPG  201

Query  475  LPPIGCFPVSIS----SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              PIGC P+ ++    S       Q GC + +N   + HN+LL   + + R+  P  TII
Sbjct  202  NFPIGCVPLYLALFQNSSKGNYDPQTGCINWLNKFSEYHNRLLMDELNKLRQLHPDATII  261

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YANY++A L+I  +PG Y  + T+ ACC G  G  N     + G   AT CSDP  YISW
Sbjct  262  YANYYEALLSIVRSPGQYGIEVTEAACC-GPSGPVNVTSPVLCGDPAATVCSDPSKYISW  320

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DG+HL+ A   ++A  LL   Y  PP 
Sbjct  321  DGVHLTEAAYGNIARGLLEGPYTAPPM  347



>ref|XP_006382478.1| hypothetical protein POPTR_0005s02510g [Populus trichocarpa]
 gb|ERP60275.1| hypothetical protein POPTR_0005s02510g [Populus trichocarpa]
Length=373

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 137/260 (53%), Gaps = 16/260 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+L  E  +S    +   TN  L+  +Q+ W   +  +  CS      C  
Sbjct  113  GVNFAVAGSTALPAEVLSSKNIMNIV-TNESLS--TQLEWMFSYFNTT-CSK----DCAK  164

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +I ++LF +G +G +DY    + +K+   +  +    +      +   +  GA+ +VV G
Sbjct  165  EIKSSLFMVGEIGGNDYNYAFMFNKTTEEISALVPEVVRAIKDAVAKAIGRGARRVVVPG  224

Query  475  LPPIGCFPVSISSCPPQQ---LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGCFPV +S   P      D+  C   +NS    HN+LL++ +E  +  +P   I+Y
Sbjct  225  NFPIGCFPVYLSQFHPNDAAAYDEFHCLKGLNSLASYHNELLKQTVEGLKTNYPDVIIVY  284

Query  646  ANYWKAFLAIFNNPGNYNF--KETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
             +Y+KAF++I+ N  +  F  K  +KACCG GG + NF    M G      C  PD YIS
Sbjct  285  GDYYKAFMSIYQNAQSLGFDTKSMQKACCGTGG-DHNFSLMRMCGAPDVPVCPKPDQYIS  343

Query  820  WDGIHLSGAMNKHLAELLLN  879
            WDG+HL+    +H+AE L+N
Sbjct  344  WDGVHLTQKAYQHMAEWLIN  363



>ref|XP_008658948.1| PREDICTED: uncharacterized protein LOC100501088 isoform X1 [Zea 
mays]
 gb|ACN31616.1| unknown [Zea mays]
Length=366

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/264 (33%), Positives = 136/264 (52%), Gaps = 12/264 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF + + S  C       CK+
Sbjct  105  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQ--WFQQ-VTSAVCGQ----DCKS  157

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRG--ISQLCIHHttqllqtvltEGAKHIVVQG  474
             + N+LF  G  G +DY  +   +  A +    +   +      ++ +L  GA  +VV G
Sbjct  158  YLANSLFVFGEFGGNDYNAMLFGNYNADQASTYTPQIVSAIAAGVEKLLAMGATDVVVPG  217

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D +GC    N     HN  LQ  I   + ++    I+Y
Sbjct  218  VLPIGCFPIYLTVYGTSNSADYDALGCLKKFNDLSTNHNAQLQAQISALQAKYKSARIMY  277

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+++ A   +  NPG+Y F    +ACCG GGG++N+  ++  G SGA+ CS P S++SWD
Sbjct  278  ADFYSAVYDMVKNPGSYGFSSVFQACCGSGGGKYNYQNSARCGMSGASACSSPASHLSWD  337

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            GIHL+ A  K + +  LN  YC P
Sbjct  338  GIHLTEAAYKQITDGWLNGPYCRP  361



>ref|XP_006828268.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
 gb|ERM95684.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
Length=377

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 93/267 (35%), Positives = 138/267 (52%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L+  Y+T  K   F WTN  LN Q  + WF+  L S  C    DA CK+
Sbjct  113  GVNFAVAGATALNSSYFT-KKNIGFLWTNSSLNVQ--LGWFYHLLPSL-CRT--DAACKS  166

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  ++F +G +G +DY    I  KSI  ++      I+        ++  GAK +VV G
Sbjct  167  YLKKSVFLVGEIGGNDYNYAFIQGKSIEQVKSYVPDVINAIMNAASVLIRIGAKTLVVPG  226

Query  475  LPPIGCFPVSISSCPPQQLDQM----GCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              P+GC    ++       ++     GC    N     HN  L K I+  R +FP   II
Sbjct  227  NLPVGCSASILTGFLTTDKNEYDPRNGCLIRFNEFAQYHNSKLHKAIQAMRERFPHINII  286

Query  643  YANYWKAFLAIFNNPGNYNF-KETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            YA+Y+ A +     P  + F KET    C GGGG +NF+     G  GA  C++P  Y++
Sbjct  287  YADYYNAAIRFVQTPEMFGFRKETVLRACCGGGGPYNFNITDRCGHPGAHACANPARYVN  346

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPP  900
            WDGIHL+ A  + +A+ +LN ++  PP
Sbjct  347  WDGIHLTEAAYEFIAKAMLNGEFMHPP  373



>ref|XP_009615529.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Nicotiana tomentosiformis]
Length=379

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/259 (32%), Positives = 136/259 (53%), Gaps = 15/259 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG T+LS  ++T+       W N PL   +Q+ WF   LQS   SN     C  
Sbjct  110  GVNFAVAGGTALSTPFWTARNIRLPAW-NTPL--PAQLNWFKSHLQSTCGSN-----CTQ  161

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + N+L  +G  G +DY+     +K I  +R      +    + ++ V+  GA  ++V G
Sbjct  162  TLSNSLIVMGEFGGNDYYNCFFQNKKIPEIRTYVPFVVAGIIRGIKDVIQLGATRVLVPG  221

Query  475  LPPIGCFPVSISSCP---PQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + P GC P+ +++ P       DQ+GC  + N     HN+ L + +   RR+FP   I+Y
Sbjct  222  VYPFGCLPLYLTTFPDTNANAYDQLGCLRNYNEFASYHNRYLNRALVNLRREFPNVGIVY  281

Query  646  ANYWKAFLAIFNNPG-NYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
              Y++A L +  +P   +N      ACCG GG ++NF   ++ G++G   CSDP  Y+ W
Sbjct  282  GGYYEALLTVLGSPSFGFNQSALLSACCGTGG-QYNFSFRTVCGSTGVGVCSDPARYVHW  340

Query  823  DGIHLSGAMNKHLAELLLN  879
            DGIHL+   ++ +  ++++
Sbjct  341  DGIHLTDETHRRMTNIIVS  359



>ref|XP_006844513.1| hypothetical protein AMTR_s00016p00145970 [Amborella trichopoda]
 gb|ERN06188.1| hypothetical protein AMTR_s00016p00145970 [Amborella trichopoda]
Length=387

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 139/269 (52%), Gaps = 17/269 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+T+L   Y+ S K     WTN  L  Q  + WFH+ L S  C   +D  CK 
Sbjct  105  GVNFAVGGATALDSSYFIS-KGFEQHWTNYSLGVQ--LEWFHQLLPSL-CKPYSD--CKE  158

Query  301  DIDNALFWLGALGVSD----YFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             +  ++F +G +G +D    +FQ   KS   ++      I+   +     + EG + +V+
Sbjct  159  FMKKSMFLVGEIGGNDCNFAFFQ--GKSTEEVKAFVPSIINTIMKAASEFINEGVETLVI  216

Query  469  QGLPPIGC---FPVSISSCPPQQLD-QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT  636
             G  PIGC   +     +   Q+ D   GC    N     +N  LQ  I+  R++FP  T
Sbjct  217  PGNLPIGCSTAYLTMFQTQDKQEYDPDTGCLKRFNDFAIYYNSKLQDAIQVMRQKFPHAT  276

Query  637  IIYANYWKAFLAIFNNPGNYNF-KETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
             IYA+Y+ A L  F +P  +   KET  + C G G  +NF+ N M GTSG T CSDP SY
Sbjct  277  TIYADYYNAALRFFKSPEAFGLAKETVHSACCGVGDRYNFNFNRMCGTSGVTACSDPASY  336

Query  814  ISWDGIHLSGAMNKHLAELLLNKDYCEPP  900
            ISWDG+HL+    K +   LL+ ++ +PP
Sbjct  337  ISWDGMHLTETAYKFITASLLSGEFTDPP  365



>ref|XP_003593742.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63993.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=374

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/265 (32%), Positives = 142/265 (54%), Gaps = 10/265 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  E++ + +     WTN  LN Q  + WF K L+   C+   D  C +
Sbjct  108  GVNFAVAGATALGVEFF-NKEMGKLLWTNHSLNIQ--LGWFKK-LKPSFCTTKQD--CDS  161

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
                +LF +G +G +DY +   +  I  +R    L +    + +  ++ EGA  ++V G 
Sbjct  162  YFKRSLFVVGEIGGNDYNYAAFAGDITHLRDTVPLVVQTIAKAIDELIAEGAVELLVPGN  221

Query  478  PPIGCFPVSISSCPPQQL---DQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYA  648
             P+GC  V ++    + +   D+ GC    N   + HN  L   ++  R + P   I+YA
Sbjct  222  LPVGCNAVYLTLFSSKNISDYDENGCLKAFNGLANYHNMQLNFALQTLRTKNPHARIMYA  281

Query  649  NYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDG  828
            +Y+ A +  F++P  Y F     + C GGGG +NF+ ++  G+ G+  C+DP +Y +WDG
Sbjct  282  DYFGAAMRFFHSPRQYGFTNGALSVCCGGGGRYNFNDSAECGSKGSKVCADPSTYTNWDG  341

Query  829  IHLSGAMNKHLAELLLNKDYCEPPF  903
            IHL+ A  +H+A+ L+N  +  PP 
Sbjct  342  IHLTEAAYRHIAKGLINGPFSIPPL  366



>ref|XP_010042460.1| PREDICTED: GDSL esterase/lipase At3g48460-like, partial [Eucalyptus 
grandis]
Length=167

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 92/160 (58%), Gaps = 1/160 (1%)
 Frame = +1

Query  445  EGAKHIVVQGLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQF  624
             GAK++VVQGLP  GC P+++   P    D +GC   +N     HN  L   I   R++F
Sbjct  5    RGAKYMVVQGLPVSGCLPLTMYLAPENDRDDIGCVKSVNDRTHAHNAALLAKISDLRKRF  64

Query  625  PQCTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDP  804
            P   I+YA+YW A+  +   P  Y FKE  KACC G G  ++++  +  GT     C  P
Sbjct  65   PDSVIVYADYWNAYHLVMKTPAKYGFKEPFKACC-GTGDPYHYNPFATCGTPSTDLCPRP  123

Query  805  DSYISWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
              YI+WDG+HL+ AM K +A++ LN  Y +PPFS ++ KK
Sbjct  124  SEYINWDGVHLTEAMYKVIADMFLNGRYSQPPFSYLLGKK  163



>ref|XP_006382477.1| hypothetical protein POPTR_0005s02500g [Populus trichocarpa]
 gb|ERP60274.1| hypothetical protein POPTR_0005s02500g [Populus trichocarpa]
Length=373

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 137/260 (53%), Gaps = 16/260 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+L  E  +S    +   TN  L+  +Q+ W   +  +  CS      C  
Sbjct  113  GVNFAVAGSTALPAEVLSSKNIMNIV-TNESLS--TQLEWMFSYFNTT-CSK----DCAK  164

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            +I ++LF +G +G +DY    + +K+   +  +    +      +   +  GA+ +VV G
Sbjct  165  EIKSSLFMVGEIGGNDYNYAFMFNKTTEEISALVPEVVRAIKDAVAKAIGRGARRVVVPG  224

Query  475  LPPIGCFPVSISSCPPQQ---LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGCFPV +S   P      D+  C   +NS    HN+LL++ +E  +  +P   I+Y
Sbjct  225  NFPIGCFPVYLSQFHPNDAAAYDEFHCLKGLNSLASYHNELLKQTVEGLKTNYPDVIIVY  284

Query  646  ANYWKAFLAIFNNPGNYNF--KETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
             +Y+KAF++I+ N  +  F  K  +KACCG GG + NF    M G      C  PD YIS
Sbjct  285  GDYYKAFMSIYQNAQSLGFDTKSMQKACCGTGG-DHNFSLMRMCGAPDIPVCPKPDQYIS  343

Query  820  WDGIHLSGAMNKHLAELLLN  879
            WDG+HL+    +H+AE L+N
Sbjct  344  WDGVHLTQKAYQHMAEWLIN  363



>ref|XP_004966154.1| PREDICTED: acetylajmalan esterase-like [Setaria italica]
Length=378

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/272 (32%), Positives = 145/272 (53%), Gaps = 24/272 (9%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQS-----QIAWFHKFLQSKGCSNAAD  285
            G+NFA+AG+T++       + A  F  T +P+ F S     Q+ WF  F++S   S   D
Sbjct  106  GVNFAVAGATAV-------DPADQFNLT-VPMPFASNSLKVQLRWFKDFMKS---SFGTD  154

Query  286  ARCKADIDNALFWLGALGVSDY-FQIHS-KSIVAMRGISQLCIHHttqllqtvltEGAKH  459
               +  + ++L  +G +G +DY ++  + K +  +  +    I       + VL  GA  
Sbjct  155  EEIRKKLQSSLVLVGEIGGNDYNYEFFANKPMTEVEKLIPGVIKTIIDAAKEVLDMGAGK  214

Query  460  IVVQGLPPIGCFP----VSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFP  627
            +++ G  PIGC P    ++  +  P   D  GC  ++N     HN  LQ+ +   +   P
Sbjct  215  VIIPGNFPIGCVPGYLAMNAGTSEPADYDAYGCLRELNRFAAKHNSRLQRAVAELQASRP  274

Query  628  QCTIIYANYWKAFLAIFNNPGNYNFK--ETKKACCGGGGGEFNFDRNSMRGTSGATKCSD  801
              ++ YA+Y+ +FLA+ +N  +  F    T+KACCG GGGE+NFD   M G +GAT C++
Sbjct  275  GASVAYADYFNSFLALLHNASSLGFDAASTRKACCGAGGGEYNFDWRRMCGFAGATACAE  334

Query  802  PDSYISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            P +Y+SWDGIH++ A  + ++ L+ +  Y EP
Sbjct  335  PAAYLSWDGIHMTQAAYRAMSRLIYHGKYLEP  366



>ref|XP_006656659.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Oryza brachyantha]
Length=427

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/270 (32%), Positives = 132/270 (49%), Gaps = 14/270 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T+L  ++  S       W N  +N Q Q  WF + L S      A   C+A
Sbjct  161  GANMAIVGATALDFDFLKSIGLGYPIWNNGAMNVQLQ--WFRRLLPSI---CGAPQSCRA  215

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF  G+LG +DY        ++   +  +   +      ++ ++  GA  IVV G
Sbjct  216  HLSKSLFVFGSLGGNDYNAMLFFGFTVDQAKNYTPKIVDAIATGVEKLVAMGAAEIVVPG  275

Query  475  LPPIGCFPVSISSCPPQ---QLDQMGCNSDINSAIDLHNKLLQKMIE----RFRRQFPQC  633
            + P+GCFPV ++  P       D++GC   +N+    HN LLQ  I     R+ R  P  
Sbjct  276  VMPVGCFPVYLAILPSSNKADYDELGCLRPLNALSVYHNALLQSRIAGLQARYIRSSPPA  335

Query  634  TIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
             I+YA+Y+     + + P  + F+    ACCG GGGE+N++ ++  G  GA  C  P S+
Sbjct  336  RIMYADYYTLVAQMLHTPARFGFRSGITACCGAGGGEYNYEFDARCGMKGAAACPVPSSH  395

Query  814  ISWDGIHLSGAMNKHLAELLLNKDYCEPPF  903
            + WDG H + A N+ +A   L   YC PP 
Sbjct  396  VCWDGAHTTEAANRLIAGGWLRGPYCHPPI  425



>ref|XP_006398857.1| hypothetical protein EUTSA_v10015547mg [Eutrema salsugineum]
 gb|ESQ40310.1| hypothetical protein EUTSA_v10015547mg [Eutrema salsugineum]
Length=316

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/270 (33%), Positives = 148/270 (55%), Gaps = 23/270 (9%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+L+  ++ +   H    TN PL+  +Q+AWF   L+S  C  ++ + C  
Sbjct  55   GVNFAVAGSTALNSSFFAARNLH-VPATNTPLS--TQLAWFKSHLRST-CHGSSSSDC--  108

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             +  +LF +G +G +DY    FQ   KS+  +R      +       + V+  GA ++V+
Sbjct  109  -LKQSLFMVGEIGGNDYNYGFFQ--GKSMEEIRSYIPHVVGAIAAAARDVIRAGAVNVVI  165

Query  469  QGLPPIGCFPVSISSCP---PQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G  P+GCFP+ ++S P   P+  D  GC   +N     HN  LQ+ I   +++FP   I
Sbjct  166  PGNFPVGCFPIYLTSFPVKDPKAYDDKGCLKHLNEFAMDHNNQLQEAIASLKKEFPDVVI  225

Query  640  IYANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
            +Y +Y+KAF ++  +  +  F ++   K+CCG GG  +N+D     G +G   C +PD +
Sbjct  226  VYGDYYKAFQSVLRSSKSAGFDKSVALKSCCGIGGA-YNYDGKRQCGAAGVPVCQNPDKF  284

Query  814  ISWDGIHLSGA----MNKHLAELLLNKDYC  891
            ISWDG+HL+      M+K L  ++L++  C
Sbjct  285  ISWDGVHLTQKAYRFMSKFLNNIILSQIKC  314



>ref|XP_006398909.1| hypothetical protein EUTSA_v10015988mg [Eutrema salsugineum]
 gb|ESQ40362.1| hypothetical protein EUTSA_v10015988mg [Eutrema salsugineum]
Length=325

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/270 (33%), Positives = 148/270 (55%), Gaps = 23/270 (9%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+L+  ++ +   H    TN PL+  +Q+AWF   L+S  C  ++ + C  
Sbjct  64   GVNFAVAGSTALNSSFFAARNLH-VPATNTPLS--TQLAWFKSHLRST-CHGSSSSDC--  117

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             +  +LF +G +G +DY    FQ   KS+  +R      +       + V+  GA ++V+
Sbjct  118  -LKQSLFMVGEIGGNDYNYGFFQ--GKSMEEIRSYIPHVVGAIAAAARDVIRAGAVNVVI  174

Query  469  QGLPPIGCFPVSISSCP---PQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G  P+GCFP+ ++S P   P+  D  GC   +N     HN  LQ+ I   +++FP   I
Sbjct  175  PGNFPVGCFPIYLTSFPVKDPKAYDDKGCLKHLNEFAMDHNNQLQEAIASLKKEFPDVVI  234

Query  640  IYANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
            +Y +Y+KAF ++  +  +  F ++   K+CCG GG  +N+D     G +G   C +PD +
Sbjct  235  VYGDYYKAFQSVLRSSKSAGFDKSVALKSCCGIGGA-YNYDGKRQCGAAGVPVCQNPDKF  293

Query  814  ISWDGIHLSGA----MNKHLAELLLNKDYC  891
            ISWDG+HL+      M+K L  ++L++  C
Sbjct  294  ISWDGVHLTQKAYRFMSKFLNNIILSQIKC  323



>ref|XP_010912640.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X2 [Elaeis 
guineensis]
Length=386

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/269 (33%), Positives = 145/269 (54%), Gaps = 14/269 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  +++   K    +WT   L   +QI WF + L S  CS+ +D  CK 
Sbjct  110  GVNFAVAGATALDNDFF-REKGLDISWTEYSLG--TQIEWFKQLLPSL-CSSGSD--CKG  163

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + ++LF +G +G +DY       K++  +R      I   +  +  ++  GAK +VV G
Sbjct  164  ILSSSLFLMGEIGGNDYNHPFFQGKTVDEIRTFVPSIISAISSAINALIQLGAKTLVVPG  223

Query  475  LPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              PIGC    + +   ++ +    Q GC   +N   + HN+LL   ++  ++  P  TII
Sbjct  224  NFPIGCVSWYLQAFQSRRKEDYDSQTGCIKWLNEFAEYHNRLLVDELDHLQQLHPHVTII  283

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+KA L IF +P  + FK+   A C GGGG +N       G   AT C+DP +Y+ W
Sbjct  284  YADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNISVPC--GGRAATVCNDPSTYVCW  341

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            DG+HL+ A  + +A+ LL   +  PP ++
Sbjct  342  DGMHLTEAAYRTIAQGLLEGPHTAPPITQ  370



>gb|EAZ15955.1| hypothetical protein OsJ_31400 [Oryza sativa Japonica Group]
Length=384

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 133/268 (50%), Gaps = 15/268 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L         A     + +P++  ++  WF   LQ    S  A  R   
Sbjct  97   GTNFAVGGATALEPAVL----ARMGIVSAVPVSLSNETRWFQDALQLLASSINARRRIA-  151

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLC---IHHttqllqtvltEGAKHIVVQ  471
              + +LF+ G +GV+DYF   + +    +  + L    +      +   +  GA+ +V+ 
Sbjct  152  --ETSLFFFGEIGVNDYFLALASNHTVEQAAATLVPDIVGVIRSAVIDAIVAGARTVVIT  209

Query  472  GLPPIGCFPVSISSCPPQQL----DQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            G+ P+GC P  ++  P           GCN+  N   ++HN+ L +M+ + RR FP   +
Sbjct  210  GMIPLGCEPQLLALFPAGSAADYDPDTGCNARFNKLAEVHNRELTRMLRQLRRAFPAAAV  269

Query  640  IYANYWKAFLAIFNNPGNYNFKETK-KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
             YA++++   AI  +P  Y F +T   ACCGGGG  +NFD  +      +T C+DP  Y+
Sbjct  270  HYADFYRPVTAIIASPAKYGFGDTPLAACCGGGGNPYNFDFAAFCTLRASTLCADPSKYV  329

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPP  900
            SWDGIH + A+NK +A  +L +     P
Sbjct  330  SWDGIHYTEAVNKFVARSMLRRALIPMP  357



>emb|CDO96755.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 146/268 (54%), Gaps = 12/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  E++   K     WTN  L+ Q  + WF K ++S  CS   +  CK 
Sbjct  108  GVNFAVAGATALDPEFFYHQKLGPILWTNDSLSVQ--LGWFKK-VKSTLCSTPQE--CKN  162

Query  301  DIDNALFWLGALGVSDY---FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
                +LF +G +G +DY   F I   +I  ++    + +      +  ++ EGA  +VV 
Sbjct  163  FFKKSLFLVGEIGGNDYNYPFFI-GGTIKQVKATVPVVVEAIAATISALIDEGAVELVVP  221

Query  472  GLPPIGCFPVSIS--SCPPQQ-LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            G  PIGC  V ++    P +   D+ GC    N+    HN  L+  +E+ R+++PQ  II
Sbjct  222  GNFPIGCSAVYLTLFETPNKAAYDEHGCLKVYNAFAKYHNAQLRLGLEKLRQKYPQAKII  281

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+ A     ++P +Y F + +   C GGGG +NF+ ++  G +G+T C+ P ++ +W
Sbjct  282  YADYYGAAKRFVHSPKHYGFSKDRLVACCGGGGPYNFNNSARCGHTGSTTCTSPSAHANW  341

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFS  906
            DGIHL+ A  +++A  L+N  +  P  S
Sbjct  342  DGIHLTEAAYRYVAMGLINGPFSSPSLS  369



>ref|XP_010231604.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brachypodium 
distachyon]
Length=366

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 141/271 (52%), Gaps = 11/271 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L  +++  N   S    N  +N   Q+ WF +  Q+  CS+  +  CK 
Sbjct  95   GANFAVMGATALDLKFFRDNNVWSIPPFNTSMN--CQLEWFQEVKQTI-CSSPQE--CKE  149

Query  301  DIDNALFWLGALGVSDY-FQIHSK-SIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                ALF  G  G +DY F   +  +   ++G+    +      ++ VL EGA+H+VV G
Sbjct  150  YFGKALFVFGEFGGNDYSFAWKADWTNEQVKGMVPKVVASMIGGIEAVLDEGARHVVVPG  209

Query  475  LPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              P GC P++++    +   +     GC    NS    HN LL+  ++R +R+ P+  II
Sbjct  210  NLPAGCIPITLTVYATEDASEYDPRTGCLKRFNSVALYHNALLRIELDRLQRRRPESRII  269

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+  ++     P  Y +K      C GGGG +N++ ++  G  GAT C DPD+++SW
Sbjct  270  YADYYTPYIHFARTPHLYGYKRGALRVCCGGGGPYNYNMSASCGLPGATVCEDPDAHVSW  329

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSEMV  915
            DG+HL+ A  + +A   L   Y  PP + ++
Sbjct  330  DGVHLTEAPYRFIANTWLKGPYAHPPLASII  360



>gb|AFW85778.1| hypothetical protein ZEAMMB73_678347 [Zea mays]
Length=383

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 139/277 (50%), Gaps = 21/277 (8%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAA------  282
            G N AI G+T++   ++ S       W N P++FQ Q  WF + + S  C  A+      
Sbjct  105  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQ--WFQQ-VTSAVCGQASVPSLTT  161

Query  283  -------DARCKADIDNALFWLGALGVSDYFQIHSKSIVAMRG--ISQLCIHHttqllqt  435
                    A CK+ + N+LF  G  G +DY  +   +  A +    +   +      ++ 
Sbjct  162  INHHHHPHADCKSYLANSLFVFGEFGGNDYNAMLFGNYNADQASTYTPQIVSAIAAGVEK  221

Query  436  vltEGAKHIVVQGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIE  606
            +L  GA  +VV G+ PIGCFP+ ++   +      D +GC    N     HN  LQ  I 
Sbjct  222  LLAMGATDVVVPGVLPIGCFPIYLTVYGTSNSADYDALGCLKKFNDLSTNHNAQLQAQIS  281

Query  607  RFRRQFPQCTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGA  786
              + ++    I+YA+++ A   +  NPG+Y F    +ACCG GGG++N+  ++  G SGA
Sbjct  282  ALQAKYKSARIMYADFYSAVYDMVKNPGSYGFSSVFQACCGSGGGKYNYQNSARCGMSGA  341

Query  787  TKCSDPDSYISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            + CS P S++SWDGIHL+ A  K + +  LN  YC P
Sbjct  342  SACSSPASHLSWDGIHLTEAAYKQITDGWLNGPYCRP  378



>ref|NP_001054913.1| Os05g0210100 [Oryza sativa Japonica Group]
 gb|AAT01388.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16827.1| Os05g0210100 [Oryza sativa Japonica Group]
Length=370

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 141/271 (52%), Gaps = 11/271 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L  +Y+  N   S    N  +N Q Q  WF +  Q+  CS+  +  C+ 
Sbjct  99   GANFAVMGATALDLKYFKDNNVWSIPPFNTSMNVQLQ--WFDEVKQTI-CSSPQE--CRE  153

Query  301  DIDNALFWLGALGVSDY-FQIHSK-SIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                ALF  G  G +DY F   ++ S+  ++ +    +      ++ +L EGA+H+VV G
Sbjct  154  FFSKALFVFGEFGGNDYSFAWKAEWSLEKVKTMVPSVVASMAGGIERLLDEGARHVVVPG  213

Query  475  LPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              P GC P++++    +   +     GC    NS    HN +L+  +++ +R+ P   I+
Sbjct  214  NLPAGCIPITLTMYATEDRSEYDPRTGCLKKYNSVALYHNAMLRIALDQLQRRHPDSRIV  273

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+  ++     P  Y +K      C GGGG +N++ ++  G  GAT C DPD+++SW
Sbjct  274  YADYYTPYIQFARTPHLYGYKRGALRACCGGGGPYNYNMSASCGLPGATTCEDPDAHVSW  333

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSEMV  915
            DGIHL+ A  + +A   +   Y  PP + +V
Sbjct  334  DGIHLTEAPYRFIANTWIRGPYAHPPLASVV  364



>gb|EEE54108.1| hypothetical protein OsJ_00868 [Oryza sativa Japonica Group]
Length=347

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 142/265 (54%), Gaps = 13/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T+++ +++ S    +  W N PL+  +QI WF + L S  C N     CK+
Sbjct  86   GANMAIIGATTMNFDFFQSLGLGNSIWNNGPLD--TQIQWFQQLLPSI-CGN----DCKS  138

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       KS+  ++G     I   T  + T++  GA  IVV G
Sbjct  139  YLSKSLFIVGEFGGNDYNAPLFGGKSMDEVKGYVPQIIAKITSGVDTLIGLGAVDIVVPG  198

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   S      D  GC    NS    HN LL++ +   + ++P   ++Y
Sbjct  199  VMPIGCFPLYLTLYQSSNSDDYDGNGCLKSYNSLSVYHNGLLKQGLAGVQAKYPAVRLMY  258

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
             N++     +  +PG++  +   K CCG GG G +N++  +  G SGA+ C DP++Y+ W
Sbjct  259  GNFYDQVTQMVQSPGSFGLQYGLKVCCGAGGQGSYNYNNKARCGMSGASACGDPENYLVW  318

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DGIHL+ A  + +A+  L+  YC P
Sbjct  319  DGIHLTEAAYRSIADGWLSGPYCSP  343



>ref|NP_001064517.1| Os10g0392900 [Oryza sativa Japonica Group]
 gb|AAM22743.1|AC092388_27 putative lipase [Oryza sativa Japonica Group]
 gb|AAP53573.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26431.1| Os10g0392900 [Oryza sativa Japonica Group]
Length=409

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 133/268 (50%), Gaps = 15/268 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L         A     + +P++  ++  WF   LQ    S  A  R   
Sbjct  122  GTNFAVGGATALEPAVL----ARMGIVSAVPVSLSNETRWFQDALQLLASSINARRRIA-  176

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLC---IHHttqllqtvltEGAKHIVVQ  471
              + +LF+ G +GV+DYF   + +    +  + L    +      +   +  GA+ +V+ 
Sbjct  177  --ETSLFFFGEIGVNDYFLALASNHTVEQAAATLVPDIVGVIRSAVIDAIVAGARTVVIT  234

Query  472  GLPPIGCFPVSISSCPPQQL----DQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            G+ P+GC P  ++  P           GCN+  N   ++HN+ L +M+ + RR FP   +
Sbjct  235  GMIPLGCEPQLLALFPAGSAADYDPDTGCNARFNKLAEVHNRELTRMLRQLRRAFPAAAV  294

Query  640  IYANYWKAFLAIFNNPGNYNFKETK-KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
             YA++++   AI  +P  Y F +T   ACCGGGG  +NFD  +      +T C+DP  Y+
Sbjct  295  HYADFYRPVTAIIASPAKYGFGDTPLAACCGGGGNPYNFDFAAFCTLRASTLCADPSKYV  354

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPP  900
            SWDGIH + A+NK +A  +L +     P
Sbjct  355  SWDGIHYTEAVNKFVARSMLRRALIPMP  382



>ref|XP_010251983.1| PREDICTED: acetylajmalan esterase-like [Nelumbo nucifera]
Length=367

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 137/266 (52%), Gaps = 12/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+L+  ++        +  NIPL+ Q  + WF   L+S          C  
Sbjct  106  GVNFAVAGSTALNNTFFMKRNLF-VSPGNIPLSVQ--LNWFKTHLKST--CRTLSGYCSK  160

Query  301  DIDNALFWLGALGVSDYF-QIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
             +  AL ++G +G +DYF     K I   R      +    + ++ V+  GA +++V G+
Sbjct  161  RLTRALVFMGEIGTNDYFYSFGGKPIEETRTYVPYVVRAIKEGVREVVRAGAVNVIVPGI  220

Query  478  PPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYA  648
            PPIGC P S++   S   +  D MGC  D+N     HN  L   ++  RR++PQ  I+YA
Sbjct  221  PPIGCVPTSLTFFQSNDTRSYDDMGCLKDLNEFAMYHNTHLHLALKDLRREYPQAAILYA  280

Query  649  NYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            +++   L+I        FK+    KACCG GG ++NF  +   G+ G   CS P  Y+SW
Sbjct  281  DFYAVSLSIIRRAMALGFKKDVLLKACCGVGG-DYNFSLDRPCGSPGVPVCSKPAQYLSW  339

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPP  900
            DG HL+   NK LA+ +++    + P
Sbjct  340  DGTHLTQEANKKLADWMIDNVLTKIP  365



>ref|XP_006656658.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=362

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 142/267 (53%), Gaps = 16/267 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N PLN  +QI WF + L S        + CK+
Sbjct  102  GANMAIIGATTMDSNFFQSLGIGDKIWNNGPLN--TQIQWFQQLLPS-----VCGSSCKS  154

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             +  +LF LG  G +DY    F  +S    A  G S   +    + +  +++ GA ++VV
Sbjct  155  YLSKSLFVLGEFGGNDYNAQLFGGYSPEQAA--GQSATIVDAIGRGVDQLVSLGAMYVVV  212

Query  469  QGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G+ P+GCFP+ ++   +  P   DQ GC +  NS    HN LLQ  +   + ++P   I
Sbjct  213  PGVLPVGCFPIYLTLYGTSNPGDYDQHGCLTRFNSLSVRHNSLLQSKVSSLQSKYPWARI  272

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            +YA+++     +  +P NY F    +ACCG GGG++N+   +  G +GA  CS+P S +S
Sbjct  273  MYADFYSHVYDMVKSPANYGFSTNLRACCGAGGGKYNYQNGARCGMAGAYACSNPSSSLS  332

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPP  900
            WDGIHL+ A  K +A+  +N  YC PP
Sbjct  333  WDGIHLTEAAYKQIADGWVNGPYCHPP  359



>ref|XP_002439450.1| hypothetical protein SORBIDRAFT_09g006590 [Sorghum bicolor]
 gb|EES17880.1| hypothetical protein SORBIDRAFT_09g006590 [Sorghum bicolor]
Length=383

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/273 (30%), Positives = 138/273 (51%), Gaps = 13/273 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L  +Y+  N   S    N  +N Q  + WF +  QS   S+ +   C+A
Sbjct  110  GANFAVMGATALDLKYFKDNNVWSIPPFNTSMNVQ--LEWFQEVKQSICPSDPST--CRA  165

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQLCIHHttqllqtvlt----EGAKHIVV  468
                +LF  G  G +DY     K+  ++  +    +      L + +     EGA+H+VV
Sbjct  166  LFAKSLFVFGEFGGNDY-SFAWKADWSLEKVKTTLVPAVVASLVSGVERLLDEGARHVVV  224

Query  469  QGLPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT  636
             G  P GC P++++  P +   +     GC    N+    HN +L+  ++R +R+ P+  
Sbjct  225  PGNLPAGCIPITLTMYPSEDRSEYDPRTGCLKKYNAVALYHNAMLRIALDRLQRRRPESR  284

Query  637  IIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            I+Y +Y+  ++     P  Y +K      C GGGG +N++ ++  G  GAT C DPD+++
Sbjct  285  IVYGDYYTPYIQFARTPHLYGYKRGALRACCGGGGPYNYNMSASCGLPGATTCEDPDAHV  344

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMV  915
            SWDGIHL+ A  + +A   +   Y  PP + +V
Sbjct  345  SWDGIHLTEAPYRFIANTWVKGPYAHPPLATVV  377



>gb|EAZ37226.1| hypothetical protein OsJ_21564 [Oryza sativa Japonica Group]
Length=379

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 138/267 (52%), Gaps = 12/267 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFAI G+T+L   ++  +      W    +N  +QI W    ++   C   +D  CK 
Sbjct  115  GANFAITGATALEYSFFKQHGIDQRIWNTGSIN--TQIGWLQD-MKPSLCK--SDQECKD  169

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G  G +DY        +   ++    L        ++ ++  GAK ++V G
Sbjct  170  YFGKSLFVVGEFGGNDYNAPLFSGVAFSEVKTYVPLVAKAIANGVEKLIELGAKDLLVPG  229

Query  475  LPPIGCFPVSIS----SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            + PIGCFP+ ++    S       + GC    N     HN+ L++ ++  ++++P+  I+
Sbjct  230  VLPIGCFPLYLTLYNTSSKADYNARTGCLRRYNRLAFHHNRELKQQLDELQKKYPETKIM  289

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYIS  819
            Y +Y+KA +    +PGN+ F  T +ACCG GG G +NF+     G  GA+ CS+P SY+S
Sbjct  290  YGDYFKAAMQFVVSPGNFGFSSTMQACCGAGGQGNYNFNLKKKCGEEGASVCSNPSSYVS  349

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPP  900
            WDGIH++ A  +++A   LN  Y EPP
Sbjct  350  WDGIHMTEAAYRYVANGWLNGPYAEPP  376



>dbj|BAK05475.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/275 (32%), Positives = 142/275 (52%), Gaps = 18/275 (7%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLN--FQSQIAWFHKFLQSKGCSNAADARC  294
            G NFA+ G+T+L  +Y+  N      W+  P N   + Q+ WF + ++   CS+  +  C
Sbjct  133  GANFAVMGATALELKYFRDNN----VWSIPPFNTSMKCQLEWFQE-VKETVCSSPQE--C  185

Query  295  KADIDNALFWLGALGVSDY-FQIHSK---SIVAMRGISQLCIHHttqllqtvltEGAKHI  462
            K     ALF  G  G +DY F   ++     V    + ++ +      ++ +L EGA+H+
Sbjct  186  KEFFGKALFVFGEFGGNDYSFAWKAEWSLDKVKTEMVPKV-VESMIGGIEAILDEGARHV  244

Query  463  VVQGLPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQ  630
            VV G  P GC P++++  P +       + GC    NS    HN +L+  +++ +R+ P 
Sbjct  245  VVPGNLPAGCIPITLTMYPSEDRSDYDPRTGCLKKFNSVALYHNAMLRIALDQLQRRRPD  304

Query  631  CTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDS  810
              IIYA+Y+  ++     P  Y +K      C GGGG +N++ +S  G  GAT C DPD+
Sbjct  305  SRIIYADYYTPYIQFARTPHLYGYKRGALRACCGGGGPYNYNMSSSCGLPGATVCDDPDA  364

Query  811  YISWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMV  915
            ++SWDGIHL+ A  + +A   L   Y  PP + +V
Sbjct  365  HVSWDGIHLTEAPYRFIANTWLKGPYAHPPLASVV  399



>ref|XP_003546024.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Glycine max]
 gb|KHN18920.1| GDSL esterase/lipase [Glycine soja]
Length=374

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 144/271 (53%), Gaps = 9/271 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  +++       + WTN  L+ Q  + WF K L+   C+   D  C +
Sbjct  107  GVNFAVAGATALDAKFFIEAGLAKYLWTNNSLSIQ--LGWFKK-LKPSLCTTKQD--CDS  161

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
                +LF +G +G +DY +   + +I  ++      +   T  +  ++ EGA+ ++V G 
Sbjct  162  YFKRSLFLVGEIGGNDYNYAAIAGNITQLQATVPPVVEAITAAINELIAEGARELLVPGN  221

Query  478  PPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYA  648
             PIGC  + ++   S   +  D  GC    N   + HNK L+  +E  R++ P   I+YA
Sbjct  222  FPIGCSALYLTLFRSENKEDYDDSGCLKTFNGFAEYHNKELKLALETLRKKNPHARILYA  281

Query  649  NYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDG  828
            +Y+ A    F+ PG++ F       C GGGG +NF+ ++  G +G+  C+DP +Y +WDG
Sbjct  282  DYYGAAKRFFHAPGHHGFTNGALRACCGGGGPYNFNISARCGHTGSKACADPSTYANWDG  341

Query  829  IHLSGAMNKHLAELLLNKDYCEPPFSEMVNK  921
            IHL+ A  +++A+ L+   +  PP     NK
Sbjct  342  IHLTEAAYRYIAKGLIYGPFSYPPLKISPNK  372



>ref|XP_008785157.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=360

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 134/265 (51%), Gaps = 10/265 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA  G T L   ++         +T   LN  +QI+WF + ++   CS      CK 
Sbjct  98   GANFATTGGTVLEYSFFQRRGLTKSIFTTDNLN--TQISWFEQ-MKPSLCSTTQG--CKD  152

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY  F    KS+  +R  +   +    + ++ +++ GA  +VV G
Sbjct  153  YVGKSLFVVGEFGGNDYNAFLFSGKSMAEVRANTPTIVDGLAKGVERLISNGAVDLVVPG  212

Query  475  LPPIGCFPVSI---SSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ +    S      DQ GC    N+    HN+LL+  +++ ++++P   +IY
Sbjct  213  ILPIGCFPLYLQLYKSTSKDDYDQFGCLKKYNNVAFYHNQLLKIKLQQLQQRYPGTRVIY  272

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
             +++ A +    NP  Y F       C GGGG +N + +   G  G+  C+DP +Y SWD
Sbjct  273  GDFYNAAMQFVTNPQKYGFSNGALKACCGGGGPYNVNLDYRCGQKGSNVCNDPSTYASWD  332

Query  826  GIHLSGAMNKHLAELLLNKDYCEPP  900
            GIH + A N+++A  LL   Y  PP
Sbjct  333  GIHFTEAANRYVANGLLRGPYANPP  357



>ref|XP_004952371.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=371

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 135/267 (51%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF +   S  C  +    CK+
Sbjct  109  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQ--WFQQIATSI-CGQS----CKS  161

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + N+LF  G  G +DY        +    R  +   ++  ++ +  ++  GA  IVV G
Sbjct  162  YLANSLFVFGEFGGNDYNAMIFGGYTTEQARKYTPKIVNTISRGIDKLIAMGATDIVVPG  221

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFR-RQFPQCTII  642
            + PIGCFP+ ++   S      D +GC +  N     HN LL+K ++  + R      I+
Sbjct  222  VLPIGCFPIYLTIYQSSNSSDYDDLGCLNKFNDLSTYHNTLLKKRVDIIQSRHRKTVRIM  281

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+++     +  NP NY F    + CCG GGG++N+  ++  G  GA+ C+ P S++SW
Sbjct  282  YADFYSGVYDMVRNPQNYGFSSVFETCCGSGGGKYNYQNSARCGMQGASACASPASHLSW  341

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  K + +  L   YC PP 
Sbjct  342  DGIHLTEAAYKQITDGWLKGPYCRPPM  368



>ref|XP_010052211.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76147.1| hypothetical protein EUGRSUZ_D00523 [Eucalyptus grandis]
Length=367

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/268 (32%), Positives = 147/268 (55%), Gaps = 15/268 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+++++  ++++ K     WTN  L+ Q  + WF K L+S  C+   +  C  
Sbjct  106  GVNFAVAGASAINSSFFSAQKIA--LWTNDSLSVQ--LGWF-KNLKSSLCTT--EQECDE  158

Query  301  DIDNALFWLGALGVSDYF--QIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G +G +DY    +  +SI  +R +  L +   T+ +  ++ EGA  ++V G
Sbjct  159  YFKKSLFLVGEIGENDYNFPALSGQSIKQLRALVPLVVGAITRAVSMLIEEGAVDLMVPG  218

Query  475  LPPIGC---FPVSISSCPPQQLD-QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              P+GC   F     S      D + GC    ++    HN  L++ ++  R Q+P   I+
Sbjct  219  QLPVGCTSMFLTVFQSANESAYDNRTGCLKAYDAFFKYHNNYLKQELQNLREQYPHARIM  278

Query  643  YANYWKAFLAIFNNPGNYNF-KETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            YA+Y+ A + I+ +P +Y F   T +ACCGGGG   NF+  ++ G +GAT C DP +++ 
Sbjct  279  YADYYGAAMTIYRSPKHYGFYGGTPRACCGGGGPH-NFNTTAVCGQTGATACKDPSAFMD  337

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPF  903
            WDGIH + +   H+A+ ++N  +  PP 
Sbjct  338  WDGIHFTESAYHHIAKGMINGGFTSPPL  365



>ref|XP_004251965.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Solanum lycopersicum]
Length=369

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/259 (30%), Positives = 140/259 (54%), Gaps = 16/259 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   ++T+      TW N PL+  +Q+ WF   L+S        ++C  
Sbjct  109  GVNFAVAGATALDTSFWTARNIRLPTW-NTPLS--NQLTWFKSHLKS-----TCGSKCAE  160

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
            ++ N++  +G  G +DY+      K I  +R      +    + ++ V+  GA  ++V  
Sbjct  161  NLKNSIVIMGEWGGNDYYNCFFQRKQISEVRSYVPFVVAGIMRGIKEVIQLGATRVLVPS  220

Query  475  LPPIGCFPVSISSCPPQQ---LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + P+GC P+ ++S P       DQ+GC    N     HN+ + + +   +RQFP  +I+Y
Sbjct  221  IYPLGCLPLYLTSFPDNNTSGYDQLGCLKSFNDFASYHNRFVVRAMANLQRQFPNVSIVY  280

Query  646  ANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
             +++ + L++  NP ++ F +     ACCG GG   NF+  ++ G +G   CS+P  Y+ 
Sbjct  281  GDFYGSILSLIRNPSSFGFNQNTLLSACCGTGGTH-NFNFRTVCGGAGINACSNPAKYVH  339

Query  820  WDGIHLSGAMNKHLAELLL  876
            WDGIHL+   ++ ++E+L+
Sbjct  340  WDGIHLTDEAHRRISEVLV  358



>ref|NP_001057786.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAD54230.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF19700.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAG87915.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 138/267 (52%), Gaps = 12/267 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFAI G+T+L   ++  +      W    +N  +QI W    ++   C   +D  CK 
Sbjct  131  GANFAITGATALEYSFFKQHGIDQRIWNTGSIN--TQIGWLQD-MKPSLCK--SDQECKD  185

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G  G +DY        +   ++    L        ++ ++  GAK ++V G
Sbjct  186  YFGKSLFVVGEFGGNDYNAPLFSGVAFSEVKTYVPLVAKAIANGVEKLIELGAKDLLVPG  245

Query  475  LPPIGCFPVSIS----SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            + PIGCFP+ ++    S       + GC    N     HN+ L++ ++  ++++P+  I+
Sbjct  246  VLPIGCFPLYLTLYNTSSKADYNARTGCLRRYNRLAFHHNRELKQQLDELQKKYPETKIM  305

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYIS  819
            Y +Y+KA +    +PGN+ F  T +ACCG GG G +NF+     G  GA+ CS+P SY+S
Sbjct  306  YGDYFKAAMQFVVSPGNFGFSSTMQACCGAGGQGNYNFNLKKKCGEEGASVCSNPSSYVS  365

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPP  900
            WDGIH++ A  +++A   LN  Y EPP
Sbjct  366  WDGIHMTEAAYRYVANGWLNGPYAEPP  392



>dbj|BAK01308.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/278 (31%), Positives = 143/278 (51%), Gaps = 14/278 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L  +Y+  N   S    N  +N   Q+ WFH+ ++   CS+  +  CK 
Sbjct  100  GANFAVMGATALDLKYFKDNNVWSIPPFNTSMN--CQLEWFHE-VKETICSSPQE--CKD  154

Query  301  DIDNALFWLGALGVSDY-FQIH---SKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
                ALF  G LG +DY F      S   V  + + ++ +      ++ +L EGA+H++V
Sbjct  155  FFTKALFVFGELGGNDYSFAAKADWSTDKVKTKMVPKV-VESIISGIEALLDEGARHVLV  213

Query  469  QGLPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT  636
                P+GCFP+ ++  P +   +     GC    N     HN  L+  +++ +R+ P   
Sbjct  214  PSNLPVGCFPIMLTLFPFEDRSEYDPRTGCIKKFNGVALYHNARLRVALDQLQRRRPDSR  273

Query  637  IIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            IIYA+++  ++     P  Y +K      C GGGG +N++ ++  G  GAT C DPD+++
Sbjct  274  IIYADFYTPYIQFARTPYLYGYKRGALRACCGGGGPYNYNMSASCGLPGATVCDDPDAHV  333

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKKTS  930
            SWDGIHL+ A  + +A   L   Y  PP + +V +  +
Sbjct  334  SWDGIHLTEAPYRFIANTWLKGPYAHPPLASVVREDMA  371



>gb|EEC70166.1| hypothetical protein OsI_00887 [Oryza sativa Indica Group]
Length=397

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 143/265 (54%), Gaps = 13/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T+++ +++ S    +  W N PL+  +QI WF + L S  C N     CK+
Sbjct  136  GANMAIIGATTMNFDFFQSLGLGNSIWNNGPLD--TQIQWFQQLLPSI-CGN----DCKS  188

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       KS+  ++G     I   T  ++T++  GA  IVV G
Sbjct  189  YLSKSLFIVGEFGGNDYNAPLFGGKSMDEVKGYVPQIIAKITSGVETLIGLGAVDIVVPG  248

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   S      D  GC    NS    HN LL++ +   + ++P   ++Y
Sbjct  249  VMPIGCFPLYLTLYQSSNSDDYDGNGCLKSYNSLSVYHNGLLKQGLAGVQAKYPAVRLMY  308

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
             N++     +  +PG++  +   K CCG GG G +N++  +  G SGA+ C DP++Y+ W
Sbjct  309  GNFYDQVTQMVQSPGSFGLQYGLKVCCGAGGQGSYNYNNKARCGMSGASACGDPENYLVW  368

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DGIHL+ A  + +A+  L+  YC P
Sbjct  369  DGIHLTEAAYRSIADGWLSGPYCSP  393



>ref|XP_010251328.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Nelumbo nucifera]
Length=372

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 139/260 (53%), Gaps = 15/260 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+L   ++++   H    +N PL+  +Q+ WF   L S   ++  D     
Sbjct  107  GVNFAVAGSTALDASFFSARNLH-VPLSNSPLS--TQLNWFRTHLNSLCHTDQTDCGNNN  163

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             ++ AL  +G +G +DY    FQ   K I  +R      +   T  ++ V+  G   IVV
Sbjct  164  RLERALVLVGEIGGNDYNYAFFQ--GKPIEEIRTYVPYVVGAITNAVREVIGMGGIRIVV  221

Query  469  QGLPPIGCFPVSISSC---PPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G  PIGC P+ ++S     P+  D MGC S +N    LHN  LQ+ ++  RR +P   I
Sbjct  222  PGNFPIGCIPIYLTSFRNNDPRAYDDMGCLSGLNDFAMLHNNYLQRALDGLRRDYPNVVI  281

Query  640  IYANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
            +YA+Y+ AF ++     +  F  +   KACC G GGE+NFD + M G+ G   C +P + 
Sbjct  282  LYADYYTAFQSVLRRAPSLGFVASSLLKACC-GIGGEYNFDGSRMCGSPGVPVCPNPANR  340

Query  814  ISWDGIHLSGAMNKHLAELL  873
            I WDG+HL+    +H+A+ L
Sbjct  341  IHWDGVHLTQEAYRHMADWL  360



>gb|EMT32479.1| GDSL esterase/lipase [Aegilops tauschii]
Length=315

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 87/276 (32%), Positives = 141/276 (51%), Gaps = 18/276 (7%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLN--FQSQIAWFHKFLQSKGCSNAADARC  294
            G NFA+ G+T+L  +Y+  N      W+  P N   + Q+ WF + ++   CS+  +  C
Sbjct  43   GANFAVMGATALELKYFRDNN----VWSIPPFNTSMKCQLEWFQE-VKETVCSSPQE--C  95

Query  295  KADIDNALFWLGALGVSDY-FQIHSK---SIVAMRGISQLCIHHttqllqtvltEGAKHI  462
            K     ALF  G  G +DY F   ++     V    + ++ +      ++ VL EGA+H+
Sbjct  96   KEFFGKALFVFGEFGGNDYSFAWKAEWSLDKVKTEMVPKV-VESMIGGIEAVLDEGARHV  154

Query  463  VVQGLPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQ  630
            VV G  P GC P++++    +       + GC    NS    HN +L+  +++ +R+ P 
Sbjct  155  VVPGNLPAGCIPITLTMYASEDRSDYDPRTGCLKKFNSVALYHNAMLRIALDQLQRRRPD  214

Query  631  CTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDS  810
              IIYA+Y+  ++     P  Y +K      C GGGG +N++ +S  G  GAT C DPD+
Sbjct  215  ARIIYADYYTPYIQFARTPHLYGYKRGALRACCGGGGPYNYNMSSSCGLPGATVCDDPDA  274

Query  811  YISWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMVN  918
            ++SWDGIHL+ A  + +A   L   Y  PP + +V 
Sbjct  275  HVSWDGIHLTEAPYRFIANTWLKGPYAHPPLASVVR  310



>ref|XP_010052216.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76154.1| hypothetical protein EUGRSUZ_D00533 [Eucalyptus grandis]
Length=386

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 90/268 (34%), Positives = 145/268 (54%), Gaps = 13/268 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   ++ + K     WTN  L+ Q  + WF K L+S  C+     +C  
Sbjct  123  GVNFAVAGATALDSSFFYAKKIGPLMWTNDSLSVQ--LRWF-KNLKSSLCTT--KQQCDE  177

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
              + +LF +G +G +DY        SI  +  +  L +   T+ +  ++ EGA ++VV G
Sbjct  178  YFNRSLFLVGEIGGNDYNYPSFVGASIKQLHALVPLVVGAITRAVGMLIEEGAVNLVVPG  237

Query  475  LPPIGCFPVSIS---SCPPQQLDQ-MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              P+GC  V ++   S      D   GC    N     HN  L++ ++  R Q+P   I+
Sbjct  238  NLPVGCSAVYLTLFHSPDKSAYDPGTGCLKAYNVFAKYHNNYLKQELQNLREQYPHARIM  297

Query  643  YANYWKAFLAIFNNPGNYNF-KETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            YA+Y+ A L I++ P +Y F   T +ACCGGGG  FNF+ ++  G +G+T C DP ++ +
Sbjct  298  YADYYGAALPIYHTPKHYGFYGGTLRACCGGGG-PFNFNNSARCGHTGSTACRDPSAFAN  356

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPF  903
            WDGIHL+ +   H+A+ L+   +  PP 
Sbjct  357  WDGIHLTESAYHHIAKRLIYGGFISPPL  384



>dbj|BAJ90120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/266 (32%), Positives = 140/266 (53%), Gaps = 13/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++         W N P++ Q  I WF + + S  C +AA   CK 
Sbjct  112  GANMAITGATAMDAPFFRGLGLSDKIWNNGPISLQ--IQWFQQ-ITSTVCGDAA--ACKR  166

Query  301  DIDNALFWLGALGVSDYFQI---HSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
             + ++L   G  G +DY  +   +  +  A R  +++ ++   + ++ V+  GA+ +VV 
Sbjct  167  YLRDSLVVFGEFGGNDYNAMLFGNYSAGQASRYTTKI-VNTIIRGVEKVVGMGARDVVVP  225

Query  472  GLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT-I  639
            G+ PIGCFP+ ++   +      D +GC    N     HN LLQ  I R R+++ +   +
Sbjct  226  GVLPIGCFPIYLTVYGTNSSADYDTLGCLRKFNDLSTFHNNLLQAKIARLRKRYGRAARV  285

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            +Y +++ A   +  NP  Y F    +ACCG GGG++N+  ++  G  GA  C+ P  ++S
Sbjct  286  MYGDFYSAVYDMVQNPSKYGFNAVFEACCGSGGGKYNYANSARCGMQGAAACASPADHLS  345

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEP  897
            WDGIHL+ A  KH+ +  LN  YC P
Sbjct  346  WDGIHLTEAAYKHITDGWLNGPYCSP  371



>gb|EMT23758.1| GDSL esterase/lipase [Aegilops tauschii]
Length=376

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 139/267 (52%), Gaps = 15/267 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++         W N P++FQ  I WF + + +  C N     CK 
Sbjct  114  GANMAITGATAMDAPFFRGLGLSDKIWNNGPISFQ--IQWFQQ-IAATVCGN----DCKR  166

Query  301  DIDNALFWLGALGVSDYFQI---HSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
             +  +L   G  G +DY  +   +     A R  +++ ++   + ++ V+  GA+ +VV 
Sbjct  167  YLRESLVVFGEFGGNDYNAMLFGNYNPDQASRYTTKI-VNTIIRGVEKVVAMGARDVVVP  225

Query  472  GLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT-I  639
            G+ PIGCFP+ ++   +      D +GC    N     HN LLQ  I R R+++ +   I
Sbjct  226  GVLPIGCFPIYLTVYGTNSSADYDALGCLRKFNDLSTFHNNLLQAKIARLRKRYGRAARI  285

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            +YA+++ A   +  NP  Y F    +ACCG GGG++N+  ++  G  GA  C++P  ++S
Sbjct  286  MYADFYSAVYDMVQNPKKYGFNAAFEACCGSGGGKYNYANSARCGMQGAAACANPADHLS  345

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPP  900
            WDGIHL+ A  K + +  LN  YC PP
Sbjct  346  WDGIHLTEAAYKQITDGWLNGPYCSPP  372



>ref|XP_009383158.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/268 (34%), Positives = 138/268 (51%), Gaps = 18/268 (7%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+L   ++     ++    N PL  Q  + WF   L S  CS+  +  C  
Sbjct  106  GVNFAVAGSTALDSSFFVQRSIYT-PVANSPLGVQ--LEWFKTHLNST-CSSPTE--CAR  159

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             ++ AL  +G +G +DY    FQ   ++I  ++    L +       + V+  GA  +VV
Sbjct  160  KLERALILMGEIGGNDYNNAFFQ--GRTIADVKSFVPLVVQRIISAAEEVIDLGAAQLVV  217

Query  469  QGLPPIGCFPVSI---SSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G  PIGC P  +   ++      D   C  + NS    HN  LQ  +E  RR  P+ TI
Sbjct  218  PGNFPIGCAPSYLAMFTTANATAYDADNCLKNFNSFAVYHNDHLQAALEGLRRAHPRVTI  277

Query  640  IYANYWKAFLAIFNNPGNYNFKE--TKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
            +YA+Y++AF+ + N+  +  F E    KACCG GG  +NFD N M G  G   C++P  Y
Sbjct  278  MYADYYQAFMYLLNHAADLGFDEGSLHKACCGAGG-PYNFDINLMCGLPGTETCTEPSKY  336

Query  814  ISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            +SWDGIHL+    + +A+ L+ + +  P
Sbjct  337  VSWDGIHLTQEAYRVMAQSLIMQGFAYP  364



>gb|ABL11233.1| UCW116, putative lipase [Hordeum vulgare subsp. vulgare]
Length=362

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/272 (30%), Positives = 135/272 (50%), Gaps = 22/272 (8%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF         S+   + CK+
Sbjct  102  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQ--WFQTIT-----SSVCGSSCKS  154

Query  301  DIDNALFWLGALGVSDY-------FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKH  459
             + N+LF  G  G +DY       +     S  A + +  +     +  ++ ++  GA  
Sbjct  155  YLANSLFIFGEFGGNDYNAMLFGNYNTDQASTYAPQIVDTI-----SAGVEKLVAMGATD  209

Query  460  IVVQGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQ  630
            +VV G+ PIGCFP+ ++   +      D +GC    N     HN LLQ  +   + ++  
Sbjct  210  VVVPGVLPIGCFPIYLTIYGTSSAADYDSLGCLKKFNDLSTYHNSLLQAKVSTLQAKYKS  269

Query  631  CTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDS  810
              I+YA+++     +  +P  Y F    +ACCG GGG++N+  ++  G SGA+ C+ P S
Sbjct  270  ARIMYADFYAGVYDMVRSPSKYGFSSVFEACCGSGGGKYNYANSARCGMSGASACASPAS  329

Query  811  YISWDGIHLSGAMNKHLAELLLNKDYCEPPFS  906
            ++SWDGIHL+ A  K + +  LN  +C P  +
Sbjct  330  HLSWDGIHLTEAAYKQITDGWLNGAFCHPAIT  361



>dbj|BAJ90380.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90406.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 134/269 (50%), Gaps = 22/269 (8%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF         S+   + CK+
Sbjct  109  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQ--WFQTIT-----SSVCGSSCKS  161

Query  301  DIDNALFWLGALGVSDY-------FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKH  459
             + N+LF  G  G +DY       +     S  A + +  +     +  ++ ++  GA  
Sbjct  162  YLANSLFIFGEFGGNDYNAMLFGNYNTDQASTYAPQIVDTI-----SAGVEKLVAMGATD  216

Query  460  IVVQGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQ  630
            +VV G+ PIGCFP+ ++   +      D +GC    N     HN LLQ  +   + ++  
Sbjct  217  VVVPGVLPIGCFPIYLTIYGTSSAADYDSLGCLKKFNDLSTYHNSLLQAKVSTLQAKYKS  276

Query  631  CTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDS  810
              I+YA+++     +  +P  Y F    +ACCG GGG++N+  ++  G SGA+ C+ P S
Sbjct  277  ARIMYADFYAGVYDMVRSPSKYGFSSVFEACCGSGGGKYNYANSARCGMSGASACASPAS  336

Query  811  YISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            ++SWDGIHL+ A  K + +  LN  +C P
Sbjct  337  HLSWDGIHLTEAAYKQITDGWLNGAFCHP  365



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/270 (33%), Positives = 141/270 (52%), Gaps = 20/270 (7%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+AG+T+L  +++ + K  + TWT   L  Q    WF + L S  CS   D+ CK 
Sbjct  123  GANFAVAGATALDNDFFRA-KGLNVTWTEYSLGVQ--FNWFKQLLPSL-CST--DSDCKG  176

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQL------CIHHttqllqtvltEGAKHI  462
             + N+LF +G +G +D    HS S    R   ++       +   + ++  ++  GAK  
Sbjct  177  IMSNSLFLVGEIGWND----HSHSFEQGRTTDEIRTFIPNIVEVISSVIDDLIKLGAKTF  232

Query  463  VVQGLPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQ  630
            VV G+ P GC    +++   +  +      GC   +N     HN LLQ  ++R RR  P 
Sbjct  233  VVPGIFPSGCVSTYLTAFQSEDAEDYDPDTGCIRWVNEFSAYHNHLLQNELDRLRRLHPH  292

Query  631  CTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDS  810
             TIIYA+Y++A ++IF++P  + FK+     C GGGG +N + + + G    T C DP  
Sbjct  293  VTIIYADYYEALMSIFHSPQKFGFKKAPLDACCGGGGPYNVNFSLLCGAPMTTVCRDPSM  352

Query  811  YISWDGIHLSGAMNKHLAELLLNKDYCEPP  900
            ++ WDG HL+ A ++ +A  LL   Y +PP
Sbjct  353  FVFWDGTHLTDAASEIVARGLLEGPYADPP  382



>ref|XP_010912598.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=410

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/269 (35%), Positives = 142/269 (53%), Gaps = 15/269 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+AG+T+L  +++ + K  + TW+   L    Q  WF + L S  CS   D+ CK 
Sbjct  123  GANFAVAGATALDNDFFRA-KGLNVTWSEYSL--VVQFNWFKQLLPSL-CST--DSDCKG  176

Query  301  DIDNALFWLGALGVSD--YFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             I N+LF +G +G +D  Y     ++   +R      I   + ++  ++  GAK +VV G
Sbjct  177  IISNSLFLVGEIGWNDHGYSFNEGRTADEIRTFIPNIIEVISSVIDDLIKLGAKTLVVPG  236

Query  475  LPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            + P GC PV ++    + ++      GC   +N     HN+LLQ  ++R RR  P  TII
Sbjct  237  IFPSGCVPVYLTWMQSEIVEDYDPDTGCIKWVNEFSAYHNQLLQNELDRIRRLHPHVTII  296

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y++A +++F +P  + F++   ACCGGGG     +     G  G T CSDP  Y+SW
Sbjct  297  YADYYEALMSVFRSPEKFGFEKPFDACCGGGGPN---NCAIQCGDPGFTVCSDPSKYVSW  353

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            DG HL+ A  + +A  LL   Y  P  S 
Sbjct  354  DGSHLTEAAYRAIALGLLQGSYTTPSMSR  382



>ref|NP_001172233.1| Os01g0216900 [Oryza sativa Japonica Group]
 dbj|BAH90963.1| Os01g0216900 [Oryza sativa Japonica Group]
Length=383

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 135/267 (51%), Gaps = 12/267 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+++L   ++  N   +    NI L+ Q  + WF K L+   C  A +  C+ 
Sbjct  115  GANFAVVGASALDLAFFLKNNITNVPPLNISLSVQ--LEWFQK-LKPTLCQTAQE--CRE  169

Query  301  DIDNALFWLGALGVSDYFQIHS--KSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF++G  G +DY  I +  K++  +       +   +  ++ V+ EGA+++VV G
Sbjct  170  YFKRSLFFMGEFGGNDYVFILAAGKTLEELVPYVPKVVQAISAGIEAVIKEGARYVVVPG  229

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              P GC P+ ++   S      D  GC    N+    HN  L + + R R ++P   I+Y
Sbjct  230  ELPNGCVPIILTLYASKSRGDYDARGCLKKQNALARYHNSALFEAVSRLRHRYPWVKIVY  289

Query  646  ANYWKAFLAIFNNPGNYNF--KETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            A+Y+K  +     P  + F    T +ACCG GGG +N+D  +  G  GA  C DP ++IS
Sbjct  290  ADYYKPVIDFIKKPARFGFNGSSTLRACCGAGGGPYNYDATAACGLPGAAACPDPAAFIS  349

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPP  900
            WDGIHL+ A    ++   L+  Y  PP
Sbjct  350  WDGIHLTEAAYARISAGWLHGPYAHPP  376



>gb|EAZ01210.1| hypothetical protein OsI_23235 [Oryza sativa Indica Group]
Length=379

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 137/267 (51%), Gaps = 12/267 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFAI G+T+L   ++  +      W    +N  +QI W    ++   C   +D  CK 
Sbjct  115  GANFAITGATALEYSFFKQHGIDQRIWNTGSIN--TQIGWLQD-MKPSLCK--SDQECKD  169

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G  G +DY        +   ++    L        ++ ++  GAK ++V G
Sbjct  170  YFGKSLFVVGEFGGNDYNAPLFSGVAFSEVKTYVPLVAKAIANGVEKLIELGAKDLLVPG  229

Query  475  LPPIGCFPVSIS----SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            + PIGCFP+ ++    S       + GC    N     HN+ L++ ++  ++++P+  I+
Sbjct  230  VLPIGCFPLYLTLYNTSSKADYNARTGCLRRYNRLAFHHNRELKQQLDELQKKYPETKIM  289

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYIS  819
            Y +Y+KA +    +PGN+ F    +ACCG GG G +NF+     G  GA+ CS+P SY+S
Sbjct  290  YGDYFKAAMQFVVSPGNFGFSSAMQACCGAGGQGNYNFNLKKKCGEEGASVCSNPSSYVS  349

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPP  900
            WDGIH++ A  +++A   LN  Y EPP
Sbjct  350  WDGIHMTEAAYRYVANGWLNGPYAEPP  376



>ref|XP_002299039.1| hypothetical protein POPTR_0001s46820g [Populus trichocarpa]
 gb|EEE83844.1| hypothetical protein POPTR_0001s46820g [Populus trichocarpa]
Length=367

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/256 (34%), Positives = 137/256 (54%), Gaps = 15/256 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L RE         F   NI L+ Q Q  W+  +  +K   N +   CK 
Sbjct  108  GVNFAVAGATALPREALEKFNLQPFI--NISLDIQLQ--WWGNY--AKSLCNNSKVDCKE  161

Query  301  DIDNALFWLGALGVSDYF--QIHSKSIVAMRG---ISQLCIHHttqllqtvltEGAKHIV  465
             + ++LF + A+G +DY    +  K+I  ++    +SQ+ I    + ++ ++  GA  ++
Sbjct  162  KLKSSLFSIEAMGANDYLTAMLRGKTIEELKKMDLVSQV-IKANEEGVRKIIGYGATQVL  220

Query  466  VQGLPPIGCFP--VSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            V G   +GC P  +++ S      DQ GC  D N  I  HN LL++ I R R++ P   I
Sbjct  221  VTGYLHVGCAPSLLAMRSNSSDARDQFGCLKDYNDFIKYHNDLLREAISRLRKEHPDVHI  280

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            +  +Y+ A  ++ +N     F+    ACCG GG ++NFD     GT G   CSDP  YIS
Sbjct  281  LIGDYYTAMQSVLDNHQKLGFESVLVACCGTGG-KYNFDHRKKCGTQGVQSCSDPRKYIS  339

Query  820  WDGIHLSGAMNKHLAE  867
            WDG+H++   +KH+A+
Sbjct  340  WDGLHMTQESHKHIAK  355



>ref|XP_007148063.1| hypothetical protein PHAVU_006G177400g, partial [Phaseolus vulgaris]
 gb|ESW20057.1| hypothetical protein PHAVU_006G177400g, partial [Phaseolus vulgaris]
Length=370

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 141/265 (53%), Gaps = 9/265 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  +++       F WTN  LN Q  + WF K L+   CS   D  C +
Sbjct  103  GVNFAVAGATALDAKFFIEAGLGRFLWTNSSLNVQ--LGWFKK-LKPSLCSTKQD--CGS  157

Query  301  DIDNALFWLGALGVSDY-FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQGL  477
              + +LF +G +G +DY +   + +I  ++      +   T  +  ++ EGA+ ++V G 
Sbjct  158  YFERSLFLVGEIGGNDYNYAAIAGNITQLQATVPPVVETITTAINELIAEGARELLVPGN  217

Query  478  PPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYA  648
             PIGC  + ++   S   +  D  GC    N   + HNK L+  ++  R++ P   I+YA
Sbjct  218  LPIGCSALYLTLYGSGNKEDYDGDGCLKGFNDFAEYHNKELKLALKTLRQKNPHARILYA  277

Query  649  NYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWDG  828
            +Y+      F+ PG+Y F       C GGGG +NF+ ++  G  G+  C+DP ++ +WDG
Sbjct  278  DYYDVAKRFFHAPGHYGFSSGALRACCGGGGAYNFNMSARCGHIGSKVCADPSTHANWDG  337

Query  829  IHLSGAMNKHLAELLLNKDYCEPPF  903
            IHL+ A  +++A+ L+   +  PP 
Sbjct  338  IHLTEAAYRYIAKGLIYGPFSYPPL  362



>gb|AFW69252.1| alpha-L-fucosidase 2 [Zea mays]
Length=431

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 139/274 (51%), Gaps = 27/274 (10%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQS-----QIAWFHKFLQSKGCSNAAD  285
            G+NFA+AG+T++       + A  F    +P+ F S     Q+ WF  FL+    +   D
Sbjct  158  GVNFAVAGATAV-------DPADQFNLPAVPVPFASKSLKVQLRWFKDFLKY---TFGTD  207

Query  286  ARCKADIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGA  453
               +  +  +L  +G +G +DY    FQ  +K +  +  +    +       + VL  GA
Sbjct  208  EEIRRRLQASLVLVGEIGGNDYNYAFFQ--AKPVAEVEKLIPGVVKTIVGAAKEVLDMGA  265

Query  454  KHIVVQGLPPIGCFP----VSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQ  621
              ++V G  PIGC P    ++ +S  P   D  GC  ++N     HN  L++ +   +  
Sbjct  266  TRVIVPGNFPIGCVPGYLAMNAASSEPADYDSAGCLRELNDFAAKHNSRLRRAVADLQAS  325

Query  622  FPQCTIIYANYWKAFLAIFNNPGNYNFK--ETKKACCGGGGGEFNFDRNSMRGTSGATKC  795
            +P   + YA+Y+ +FL + +N  ++ F    T+KACCG G GE+NFD   M G  G   C
Sbjct  326  YPGAAVAYADYFDSFLTLLHNASSFGFDAASTRKACCGAGAGEYNFDWRRMCGFPGTAAC  385

Query  796  SDPDSYISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            +DP +Y+SWDGIH++ A  + ++ L+ +  Y +P
Sbjct  386  ADPSTYLSWDGIHMTQAAYRAMSRLIYHGKYLQP  419



>ref|XP_003564303.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=362

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 138/269 (51%), Gaps = 22/269 (8%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF + + S  C+++    CK+
Sbjct  101  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQMQ--WFQQ-ITSSVCASS----CKS  153

Query  301  DIDNALFWLGALGVSDY-------FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKH  459
             +  +LF  G  G +DY       +     S  A + +  +     +  ++ ++  GA  
Sbjct  154  YLAKSLFVFGEFGGNDYNAMLFGGYNTDQASTYAPQIVDTI-----SSGVEKLIAMGAVD  208

Query  460  IVVQGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQ  630
            +VV G+ PIGCFP+ +S   +      D +GC    N     HN LL+  I   + ++  
Sbjct  209  VVVPGVLPIGCFPIYLSIYGTSSAADYDSLGCLKKFNDLSTYHNGLLKTKIAGLQAKYAS  268

Query  631  CTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDS  810
              I+YA+++     +  NP +Y F    +ACCG GGG++N+  ++  G SGA+ C+ P S
Sbjct  269  ARIMYADFYAGVYDMVRNPSSYGFSSVVEACCGSGGGKYNYANSARCGMSGASACASPAS  328

Query  811  YISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            ++SWDGIHL+ A  K + +  L+  YC P
Sbjct  329  HLSWDGIHLTEAAYKQITDGWLSGAYCHP  357



>ref|XP_006655093.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Oryza brachyantha]
Length=372

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 142/273 (52%), Gaps = 15/273 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLN--FQSQIAWFHKFLQSKGCSNAADARC  294
            G NFA+ G+T+L  +Y+  N      W+  P N     Q+ WF +  Q+  CS+  +  C
Sbjct  101  GANFAVMGATALDLKYFKDNN----VWSIPPFNTSMSVQLQWFDEVKQTV-CSSPQE--C  153

Query  295  KADIDNALFWLGALGVSDY-FQIHSK-SIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
            +     ALF  G  G +DY F   +  S+  ++ +    +      ++ +L EGA+H+VV
Sbjct  154  REFFSKALFVFGEFGGNDYSFAWKADWSLEKVKTMVPRVVASMVGGIERLLDEGARHVVV  213

Query  469  QGLPPIGCFPVSIS---SCPPQQLD-QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT  636
             G  P GC P++++   S    + D + GC    NS    HN +L+  +++ +R+ P   
Sbjct  214  PGNLPAGCIPITLTMYASDDRSEYDPRTGCLKKYNSVALYHNAMLRIALDQLQRRRPDSR  273

Query  637  IIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            I+YA+Y+  ++     P  Y +K      C GGGG +N++ ++  G  GAT C DPD+++
Sbjct  274  IVYADYYTPYIQFARTPHLYGYKRGALRACCGGGGPYNYNMSASCGLPGATTCEDPDAHV  333

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMV  915
            SWDGIHL+ A  + +A   +   Y  PP + +V
Sbjct  334  SWDGIHLTEAPYRFIANTWIRGPYAHPPLASVV  366



>ref|XP_007212730.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
 gb|EMJ13929.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
Length=377

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/271 (34%), Positives = 146/271 (54%), Gaps = 14/271 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   +       S + TN  L+ Q  + WF + L S  C+ ++D  C  
Sbjct  109  GVNFAVAGATALDAAF-LEEMGDSVSCTNDSLSIQ--LEWFKQMLPSL-CNTSSD--CNK  162

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +L  +G +G +DY    +  KSI  ++    L I      +  ++  GA  ++V G
Sbjct  163  VLSTSLILMGEIGGNDYNDALLAGKSIEKVQAYVPLVIETIASTINELIELGAATLLVPG  222

Query  475  LPPIGCFPVSIS---SCPPQQLD-QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              PIGC P  ++   S    Q D   GC + +N     HN  LQ  + R RR  PQ TII
Sbjct  223  NFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNKFSGYHNDQLQIALSRIRRLHPQVTII  282

Query  643  YANYWKAFLAIFNNPGNYNF-KETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            YA+Y+ A L ++ +P  + F  ET KACCGGGG  +N++ +++ G +GA+ C +P  +IS
Sbjct  283  YADYYNAMLQLYQSPDQFGFIGETSKACCGGGG-PYNYNASALCGDAGASACENPAQFIS  341

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPFSEM  912
            WDG+H + A ++ + + +L  +Y  P  S +
Sbjct  342  WDGLHSTEAAHRWITKAILQGNYTVPRVSTL  372



>ref|XP_002436507.1| hypothetical protein SORBIDRAFT_10g003900 [Sorghum bicolor]
 gb|EER87874.1| hypothetical protein SORBIDRAFT_10g003900 [Sorghum bicolor]
Length=388

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/268 (32%), Positives = 130/268 (49%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADA--RC  294
            G + AI  +T+L  E+  S       W N  +N Q Q  WF   L S   + A     RC
Sbjct  117  GASMAIVAATALDFEFLKSIGVGYPVWNNGAMNVQIQ--WFRDLLPSICGAGAPPGGQRC  174

Query  295  KADIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
            K  +  +LF  G  G +DY    +   ++   R  +   +      ++ ++  GA  IVV
Sbjct  175  KDYLARSLFLFGPFGGNDYNAMVLFGLTMDHARNYTPNIVDTVASGVEQLIQLGAVDIVV  234

Query  469  QGLPPIGCFPVSISSCP---PQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G  P GCF + ++S P   P   D+ GC    N      N LLQ  +   R ++P   I
Sbjct  235  PGALPAGCFAIYLTSLPSDNPADYDEYGCLKAFNELSVYQNSLLQGRLAGLRARYPSARI  294

Query  640  IYANYWKAFLAIFNNPGNYNFKE-TKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            +YA+Y+     +  +P  + F      ACCG GGG++NF+ +++ G  GAT C +P ++ 
Sbjct  295  VYADYYTHIDRLVRSPARFGFSTGAVPACCGAGGGKYNFELDALCGMKGATACREPSTHE  354

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPP  900
            SWDG+H + A+N+ +AE  L   YC PP
Sbjct  355  SWDGVHFTEAVNRLVAEGWLRGPYCHPP  382



>ref|NP_001147763.1| esterase precursor [Zea mays]
 gb|ACG28614.1| esterase precursor [Zea mays]
 gb|AFW68832.1| esterase [Zea mays]
Length=414

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/255 (31%), Positives = 134/255 (53%), Gaps = 15/255 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA  G+T+L   ++ S    SF    +P++ ++Q  WFH  L+  G +       + 
Sbjct  134  GVNFAFGGATALDLHFFVSRGLGSF----VPVSLRNQTVWFHNVLRLLGSAREQ----RK  185

Query  301  DIDNALFWLGALGVSDYF--QIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G +GV+DYF     ++++  +R      +     ++  V++ GA  +VV G
Sbjct  186  TMATSLFLVGEIGVNDYFIGLNENRTVGEVRTFVPHVVGAIRSVITDVISAGAGTVVVPG  245

Query  475  LPPIGCFPVSIS----SCPPQQLD-QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            + P+GC P  ++    S      D + GC + +N    LHN+ L++M+   RR  P   I
Sbjct  246  MIPLGCEPQLLTLYRGSVDAAGYDPESGCITRLNDLAQLHNRELRRMLAGLRRAHPGTAI  305

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            +YA+ ++A   I  +P  Y F+      C GGGG +N+D  S  G +G   C+DP  Y+S
Sbjct  306  VYADLYRAVTDIVVSPRAYGFRHMPLDACCGGGGAYNYDDASFCGAAGTAPCADPSEYVS  365

Query  820  WDGIHLSGAMNKHLA  864
            WDG+H + A N+ +A
Sbjct  366  WDGVHYTEAANRLIA  380



>ref|XP_010912577.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Elaeis guineensis]
Length=393

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 140/265 (53%), Gaps = 12/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+AG+T+L  ++Y + K     W    L  Q  I WF + L S  CS  +D+ CK+
Sbjct  125  GANFAVAGATALDNDFYRA-KGLKVVWPEYSLGIQ--IKWFKQLLPSL-CS--SDSDCKS  178

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + N+LF +G +G +DY    +   +I  +R +    IH  +  +  ++  GAK +VV G
Sbjct  179  FMSNSLFLVGEIGWNDYNHPFVQGMTIEEIRKLVPDIIHVISSAITDLIQLGAKTLVVPG  238

Query  475  LPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            + P GC  + ++    Q+ +    + GC    N   + HN+L+ + ++R RR  P  TII
Sbjct  239  IVPSGCVSLYLTVFQSQKGEDYDPRTGCIKWANEFSEEHNRLISEELDRLRRLHPHATII  298

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            +ANY+ A ++IF +P  + FK++    C GG G +N + +   G    T C DP  ++ W
Sbjct  299  HANYYDALMSIFRSPQQFGFKKSPLDACCGGDGPYNMNISLRCGDPKTTVCRDPAKFVFW  358

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DG HL+ A  + ++  LL   Y  P
Sbjct  359  DGTHLTEAAYEVISRGLLEGPYATP  383



>emb|CDY30822.1| BnaC05g21980D [Brassica napus]
Length=401

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/266 (33%), Positives = 133/266 (50%), Gaps = 11/266 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+T+L R +      H F++TN+ L  Q  +  F   L  K C + +D  C+ 
Sbjct  118  GVNFAVGGATALERSFLEERGIH-FSYTNVSLGVQ--LKSFKDAL-PKLCGSPSD--CRE  171

Query  301  DIDNALFWLGALGVSDYFQIH--SKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             I NAL  +G +G +DY  +    K+I  +R    L I   +  +  ++  G +  +V G
Sbjct  172  MIKNALILMGEIGGNDYNYVFFVGKTIEEVREFVPLVISTISSAITELIGMGGRTFLVPG  231

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC    ++   +   ++ D  GC   +N     H+  LQ  + + R  +P   IIY
Sbjct  232  EFPIGCSVTYLTLYQTSNKEEYDPSGCLKWLNKFAKYHSDQLQAELNKLRELYPHVNIIY  291

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+Y+ A L +F  PGN+ F +     C G GG +NF      G  G   CSDP  YI WD
Sbjct  292  ADYYNALLRLFQEPGNFGFIDRPLHACCGFGGPYNFTFGRKCGFKGVESCSDPSKYICWD  351

Query  826  GIHLSGAMNKHLAELLLNKDYCEPPF  903
            G+H++ A  + +AE +L   Y  PPF
Sbjct  352  GVHMTEATYRLMAEGILKGPYAIPPF  377



>ref|XP_004966744.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=382

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 127/268 (47%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQS--KGCSNAADARC  294
            G N AI G T+L   +  S       W N  +N Q Q  W    L S   G +     RC
Sbjct  113  GANMAIVGGTALDFAFLESIGLGYPVWNNGAMNVQIQ--WLRDILPSVCGGGAPPGGPRC  170

Query  295  KADIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
            +A +  +LF  G  G +DY        +    R  +   +      ++ ++  GA  I+V
Sbjct  171  RAHLAKSLFVFGPFGGNDYNAMLFFGFTTEHARNYTPKIVDTVASGVEQLIQLGAVDIIV  230

Query  469  QGLPPIGCFPVSISSCP---PQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G  P+GCF V ++  P   P   D+ GC   +N      N LLQ+ +   R + P   I
Sbjct  231  PGALPVGCFAVYLTFLPSSNPADYDEYGCLKPLNELSVYQNALLQRRLAGIRERHPAARI  290

Query  640  IYANYWKAFLAIFNNPGNYNFKE-TKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            IYA+Y+     +  +P  + F++    ACCG GGG FNF+ ++  G  GA  C DP ++ 
Sbjct  291  IYADYYGHVERMIRSPARFGFRDGAVPACCGAGGGRFNFELDARCGMKGAAACPDPSTHE  350

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPP  900
            SWDG+H + A+N+ +AE  L   YC PP
Sbjct  351  SWDGVHFTEAVNRLIAEGWLRGPYCHPP  378



>ref|XP_004964800.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=366

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 135/269 (50%), Gaps = 22/269 (8%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N P++FQ Q  WF +       S+     CK+
Sbjct  106  GANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQ--WFQQIT-----SSVCGQNCKS  158

Query  301  DIDNALFWLGALGVSDY-------FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKH  459
             + N+LF  G  G +DY       +     S    + +S +        ++ ++  GA  
Sbjct  159  YLGNSLFVFGEFGGNDYNAMLFGNYNTDQASTYTPQIVSTI-----ANGIEKLIAMGATD  213

Query  460  IVVQGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQ  630
            IVV G+ PIGCFP+ ++   +      D +GC    N     HN  L+  I   + ++P 
Sbjct  214  IVVPGVLPIGCFPIYLTIYGTSNAGDYDGLGCLKKFNDLSTNHNNQLKTQIASLQSKYPN  273

Query  631  CTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDS  810
              I+YA+++     +  NPG+Y F    + CCG GGG++N+  ++  G SGA+ CS+P +
Sbjct  274  ARIMYADFYSGVYDMVKNPGSYGFSTAFQTCCGSGGGKYNYQNSARCGMSGASACSNPAA  333

Query  811  YISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            ++SWDGIHL+ A  K + +  L+  +C P
Sbjct  334  HLSWDGIHLTEAAYKQITDGWLSGAHCSP  362



>ref|XP_008225209.1| PREDICTED: GDSL esterase/lipase At5g45910 [Prunus mume]
Length=362

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/267 (34%), Positives = 144/267 (54%), Gaps = 15/267 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  +++   K  S  WTN  L+  +Q+ WF K L+   C+   +  C  
Sbjct  102  GVNFAVAGATALDPQFFYQRKIGSVLWTNDSLS--TQLGWFKK-LKPSLCTTKQE--CDN  156

Query  301  DIDNALFWLGALGVSDY---FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
                ALF +G +G +DY   F +   +I  ++      +   TQ    ++ EGA  +VV 
Sbjct  157  YFKKALFLVGEIGGNDYNYAFFV-GGNIKQLKASVPFVVEAITQATSALIEEGAVELVVP  215

Query  472  GLPPIGCFPVSIS--SCPPQQL--DQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            G  PIGC  V ++    P + +   + GC    N     HN  L++ +   R ++P   I
Sbjct  216  GNLPIGCSAVYLTLFRSPNEAVYDKRNGCLKAFNGFSKYHNSELKRALGALRLKYPHARI  275

Query  640  IYANYWKAFLAIFNNPGNYNFKE-TKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            IYA+Y+ A +  ++ P +Y FK  T +ACCGGGG  +NF+ ++  G  G+T C DP SY 
Sbjct  276  IYADYYGAAMPFYHAPQHYGFKSGTLRACCGGGG-PYNFNNSARCGHIGSTACKDPSSYA  334

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEP  897
            +WDGIHL+ A   H+A+ L++  +  P
Sbjct  335  NWDGIHLTEAAYGHIAKGLIHGRFATP  361



>ref|NP_001132224.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACF80991.1| unknown [Zea mays]
 gb|AFW75577.1| alpha-L-fucosidase 2 [Zea mays]
Length=379

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 130/271 (48%), Gaps = 12/271 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADAR---  291
            G + AI G+T+L  E+  S       W N  +N Q Q  WF   L S  C  A  A    
Sbjct  107  GASMAIVGATALDFEFLKSIGLGYPIWNNGAMNVQIQ--WFRDLLPSI-CGAAPPAEGQG  163

Query  292  CKADIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIV  465
            CK  +  +LF  G  G +DY        ++   R  +   +      ++ ++  GA  IV
Sbjct  164  CKDYLARSLFVFGPFGGNDYNAMLFFGLTVDQARNYTPKIVDTVASGVEQLIQLGAVDIV  223

Query  466  VQGLPPIGCFPVSISSCP---PQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCT  636
            V G  P+GCF + ++  P   P   D  GC   +N      N LLQ  +   + ++P   
Sbjct  224  VPGALPVGCFAIYLTFLPSDDPADYDGHGCLRALNELSVYQNSLLQSRLAALQARYPSAR  283

Query  637  IIYANYWKAFLAIFNNPGNYNFKE-TKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
            I+YA+Y+     +  +P  + F      ACCG GGG++NF+ ++  G  GAT C DP  +
Sbjct  284  IVYADYYTHIDRLVRSPARFGFTTGAVPACCGAGGGKYNFELDARCGMKGATACRDPSRH  343

Query  814  ISWDGIHLSGAMNKHLAELLLNKDYCEPPFS  906
             SWDG+HL+ A+N+ +AE  L   YC PP +
Sbjct  344  ESWDGVHLTEAVNRLIAEGWLRGPYCHPPIA  374



>ref|XP_009352808.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Pyrus x bretschneideri]
Length=367

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 89/267 (33%), Positives = 145/267 (54%), Gaps = 15/267 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  E++   K     WTN  L+  +Q+ WF K L+   CS   +  C  
Sbjct  107  GVNFAVAGATALDPEFFYQRKIGLAMWTNDSLS--TQLGWFKK-LKPSLCSTKQE--CDN  161

Query  301  DIDNALFWLGALGVSDY---FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
                 LF +G +G +DY   F +   +I  ++      +   T     ++ EGA  ++V 
Sbjct  162  YFKKTLFLVGEIGGNDYNYAFFV-GGNIKQLKASVPYVVGAITNATSALIEEGAVELLVP  220

Query  472  GLPPIGCFPVSIS--SCPPQQL--DQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            G  PIGC  V ++    P +     + GC    N+    HN  L++ +   R+++P   I
Sbjct  221  GNLPIGCSAVYLTLFQTPNRSYYDKRNGCLKAFNTFSKYHNSELKRALATLRQKYPHVNI  280

Query  640  IYANYWKAFLAIFNNPGNYNFKE-TKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            IYA+Y+ A +  F+ P +Y FK  T +ACCGGGG  +NF+ ++  G  G+T C DP SY+
Sbjct  281  IYADYYGAAMPFFHAPQHYGFKSGTLRACCGGGG-PYNFNNSARCGHIGSTACKDPSSYV  339

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEP  897
            +WDGIHL+ A  +++A+ L++  + +P
Sbjct  340  NWDGIHLTEAAYRYIAKGLIHGQFTKP  366



>ref|XP_010929733.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Elaeis guineensis]
Length=376

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 145/266 (55%), Gaps = 14/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   ++      + T+TN PL+ Q  + WF   L S  CS  +  +C  
Sbjct  108  GVNFAVAGATALDNSFFLQRGIFT-TFTNNPLSVQ--LEWFKTHLNST-CS--SKTKCAQ  161

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQL--CIHHttqllqtvltEGAKHIVVQG  474
             +  ALF +G +G +DY    S+     + ++ +   +    +  + V++ GA  +VV G
Sbjct  162  SLKRALFLVGEIGGNDYNYAFSQGTSMKKVMTYVPEVVQSIIKAAKEVISMGAGQLVVPG  221

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC P  ++   S  P   D+  C  + N+    HNK LQ  ++  R  +P  TI+Y
Sbjct  222  NFPIGCMPSYLAMFYSLDPAAYDEKQCLKEYNAFAMHHNKQLQAALQDLRHAYPHVTIMY  281

Query  646  ANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            A+Y++AFL + +   +  F +    +ACCG GG ++NF+ N M G  GA+ CS+P  +IS
Sbjct  282  ADYYQAFLHLLDKAPDLGFDKDSLLQACCGVGG-QYNFNINIMCGMPGASTCSNPSKHIS  340

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEP  897
            WDGIHL+    K +A+ L+ + +  P
Sbjct  341  WDGIHLTQEAYKVMAQSLIMEGFAYP  366



>ref|XP_006656143.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=403

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 138/267 (52%), Gaps = 12/267 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFAI G+T+L   ++  +      W    +N  +QI W    ++   C   +++ CK 
Sbjct  139  GANFAITGATALEYSFFKQHGIDQRIWNTGSIN--TQIGWLQD-MKPSLCK--SESECKD  193

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G  G +DY        +   ++    L        ++ ++  GAK +VV G
Sbjct  194  YFGKSLFVVGEFGGNDYNAPLFSGVAFSEVKTYVPLVAKAIANGVEKLIELGAKDMVVPG  253

Query  475  LPPIGCFPVSIS----SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            + PIGCFP+ ++    S       + GC    N     HN+ L++ ++  ++++P+  I+
Sbjct  254  VLPIGCFPLYLTLYNTSNKADYNARTGCLRRYNRLAFHHNRELKQQLDELQKKYPETKIM  313

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYIS  819
            Y +Y+KA +    +PGN+ F    +ACCG GG G +NF+     G  GA+ CS+P SY+S
Sbjct  314  YGDYFKAAMQFVVSPGNFGFSSAMQACCGAGGEGNYNFNLKKKCGEDGASVCSNPSSYVS  373

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPP  900
            WDGIH++ A  +++A   LN  Y EPP
Sbjct  374  WDGIHMTEAAYRYVANGWLNGPYAEPP  400



>ref|XP_004971763.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=362

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 82/265 (31%), Positives = 139/265 (52%), Gaps = 13/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++  +++ S+   +  W N PL   +QI WF + + S   S+     CK+
Sbjct  101  GANMAIIGATTMDFDFFQSHGLGNSIWNNGPLG--TQIQWFQQLMPSICGSD-----CKS  153

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             ++N+LF +G  G +DY       K +  +R      I   T  L+ ++  GA  +VV G
Sbjct  154  YLNNSLFIVGEFGGNDYNAPLFGGKGMAEVRTYVPQIIDKITNSLEALIELGAVDVVVPG  213

Query  475  LPPIGCFPVSISSCPP---QQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++  P       D++GC    N+    HN LL++ +   R +     ++Y
Sbjct  214  VLPIGCFPLYLTLYPSSSKDDYDEIGCLKSFNNLSSYHNDLLKQAVSGLRSKHAGVRLMY  273

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGG-GEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+++     +  +P  +  K   + CCG GG G +N++  +  G +GA+ C+DP+ ++ W
Sbjct  274  ADFYAQVADMVRSPETFGLKYGLRVCCGAGGQGSYNYNNRARCGMTGASACADPEKHLVW  333

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DGIHL+ A    +A+  LN  YC P
Sbjct  334  DGIHLTDAAYHAVADGWLNGTYCTP  358



>gb|KCW63207.1| hypothetical protein EUGRSUZ_G00824, partial [Eucalyptus grandis]
Length=349

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 85/266 (32%), Positives = 136/266 (51%), Gaps = 14/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   ++ +    + T TN  LN Q  + WF K L+S  C+   D  C  
Sbjct  87   GVNFAVAGATALDPTFFAARGIPAMTMTNHSLNVQ--LDWFKK-LKSSLCTTQQD--CDT  141

Query  301  DIDNALFWLGALGVSDY---FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
                +LF +G +G +DY   F +   +   +R I    +         ++  GA  +VV 
Sbjct  142  YFKKSLFLVGEIGGNDYNLAFAL-GATFEQLRPIVPNVVGAIANATSMLIEHGAVELVVP  200

Query  472  GLPPIGCFPVSISSCPP----QQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            G  PIGC  + I++ PP          GC +  N     HN  LQ+ ++  R+++    I
Sbjct  201  GNLPIGCLTLYITTAPPFLKNNANTTTGCLNRYNEFAKYHNDYLQRELQVLRQKYNHARI  260

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            IYA+Y++  + +F +P  Y F ++    C G GG FNF+   M G S ++ C DP + I 
Sbjct  261  IYADYYEDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMMCG-SKSSVCKDPSASIL  319

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEP  897
            WDG+HL+ A  +H+A+ LL+  +  P
Sbjct  320  WDGVHLTEAAYRHMAKGLLDGPFTSP  345



>ref|XP_010918534.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X3 [Elaeis 
guineensis]
Length=387

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 136/268 (51%), Gaps = 14/268 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG T+L   ++   +     +TN  LN Q  + WF   L S  CS+  D  C  
Sbjct  110  GVNFAVAGGTALDVSFF-KERGIMMPYTNSSLNVQ--LEWFKSHLDSI-CSSQTD--CAE  163

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + +ALF +G +G +DY       KSI  +       +       + V+  GA  +V+ G
Sbjct  164  KLKHALFLVGEIGGNDYNYAFFGGKSITEVMNYVPHVVTSIINAAKEVINMGAIQLVIPG  223

Query  475  LPPIGCFP---VSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC P    +++S  P   D   C    N+   LHN  LQ+ I+  R  +P   I+Y
Sbjct  224  NFPIGCLPSYLTALNSSDPDAYDNRLCLKGPNTFAMLHNLKLQEAIQELRESYPHVVIMY  283

Query  646  ANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            A+Y+ AF+ + +N  +  F +    KACCGGGG E NFD   M G+ GA+ C +P  +IS
Sbjct  284  ADYYNAFMTLLDNALDLGFDKNSLMKACCGGGG-EHNFDATKMCGSPGASTCDNPAQHIS  342

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPF  903
            WDGIHL+      +A  L++  +  P +
Sbjct  343  WDGIHLTQEAYMIMARQLISGGFVYPSY  370



>ref|XP_008655072.1| PREDICTED: LOC100284848 isoform X1 [Zea mays]
 gb|AFW82123.1| hypothetical protein ZEAMMB73_197874 [Zea mays]
Length=369

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 134/267 (50%), Gaps = 12/267 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++  +++ S       W N PL+  +QI WF + L S        A CK 
Sbjct  107  GANMAIIGATTMDFDFFKSIGLSDKIWNNGPLD--TQIQWFRQLLPSV----CGKADCKN  160

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +S+  +RG   + +    + L+ ++  GA  +VV G
Sbjct  161  YLSKSLFVVGEFGGNDYNAALFSGRSMAEVRGYVPMVVSKLVRGLEAIVRSGAVDVVVPG  220

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D+ GC    N     HN LL++ +   RR +P   I+Y
Sbjct  221  VLPIGCFPIYLTLYGTSNAADYDRDGCLRAYNGLSSYHNALLRRSLSGLRRTYPHARIMY  280

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMR-GTSGATKCSDPDSYISW  822
            A+++     +   P N+  K   K CCG GG       N  R G +GA+ C+DP +Y+ W
Sbjct  281  ADFYTQVTHMIRAPHNFGLKYGLKVCCGAGGQGQYGYNNKARCGMAGASACADPGNYLIW  340

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  + +A+  L   YC PP 
Sbjct  341  DGIHLTEAAYRSIADGWLKGPYCSPPI  367



>ref|NP_001054914.2| Os05g0210400 [Oryza sativa Japonica Group]
 gb|AAT44175.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF16828.2| Os05g0210400 [Oryza sativa Japonica Group]
Length=380

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 86/272 (32%), Positives = 139/272 (51%), Gaps = 27/272 (10%)
 Frame = +1

Query  127  NFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQS----QIAWFHKFLQSKGCSNAADARC  294
            NFAI G T+L   ++      S     +P  FQS    QI W    L+  G + AA+   
Sbjct  113  NFAIVGGTALDVGFFIRRNNAS-----VP-PFQSSLRVQIGWLRSLLRRAGNATAAE---  163

Query  295  KADIDNALFWLGALGVSDYFQIHS--KSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
               +  ALF +G  G SDY  + S  KS+   +      +    + ++ ++ EGA+++VV
Sbjct  164  --RLATALFVVGEFGGSDYRYLLSGGKSLEQAKSFVPEVVRAICRGVERLVEEGARYVVV  221

Query  469  QGLPPIGCFPVSISSCPPQQL--------DQMGCNSDINSAIDLHNKLLQKMIERFRRQF  624
             G PP GC P+ ++                + GC   +N     HN LL++ +ER R ++
Sbjct  222  TGTPPAGCMPMELTKYAAANASSAAAAYDRRTGCLRRLNGLAQYHNWLLREAVERMRGKY  281

Query  625  PQCTIIYANYWKAFLAIFNNPGNYNF-KETKKACCGGGGGEFNFDRNSMRGTSGATKCSD  801
            P   ++YA+++K   ++   P  + F ++  KACCGGGG  +N++  +  G+ GA+ C D
Sbjct  282  PTTKLVYADFYKPVASLVRRPAKFGFTQQPLKACCGGGG-PYNYNPGAACGSPGASTCGD  340

Query  802  PDSYISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            P +Y++WDGIHL+ A  K++A   LN  Y  P
Sbjct  341  PSAYVNWDGIHLTEAAYKYVAGGWLNGVYAYP  372



>ref|XP_010068245.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 85/266 (32%), Positives = 136/266 (51%), Gaps = 14/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   ++ +    + T TN  LN Q  + WF K L+S  C+   D  C  
Sbjct  105  GVNFAVAGATALDPTFFAARGIPAMTMTNHSLNVQ--LDWFKK-LKSSLCTTQQD--CDT  159

Query  301  DIDNALFWLGALGVSDY---FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
                +LF +G +G +DY   F +   +   +R I    +         ++  GA  +VV 
Sbjct  160  YFKKSLFLVGEIGGNDYNLAFAL-GATFEQLRPIVPNVVGAIANATSMLIEHGAVELVVP  218

Query  472  GLPPIGCFPVSISSCPP----QQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            G  PIGC  + I++ PP          GC +  N     HN  LQ+ ++  R+++    I
Sbjct  219  GNLPIGCLTLYITTAPPFLKNNANTTTGCLNRYNEFAKYHNDYLQRELQVLRQKYNHARI  278

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            IYA+Y++  + +F +P  Y F ++    C G GG FNF+   M G S ++ C DP + I 
Sbjct  279  IYADYYEDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMMCG-SKSSVCKDPSASIL  337

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEP  897
            WDG+HL+ A  +H+A+ LL+  +  P
Sbjct  338  WDGVHLTEAAYRHMAKGLLDGPFTSP  363



>ref|NP_001151231.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACG42068.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=386

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 138/274 (50%), Gaps = 27/274 (10%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQS-----QIAWFHKFLQSKGCSNAAD  285
            G+NFA+AG+T++       + A  F    +P+ F S     Q+ WF  FL+    +   D
Sbjct  113  GVNFAVAGATAV-------DPADQFNLPAVPVPFASKSLKVQLRWFKDFLKY---TFGTD  162

Query  286  ARCKADIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGA  453
               +  +  +L  +G +G +DY    FQ  +K +  +  +    +       + VL  GA
Sbjct  163  EEIRRRLQASLVLVGEIGGNDYNYAFFQ--AKPVAEVEKLIPGVVKTIVGAAKEVLDMGA  220

Query  454  KHIVVQGLPPIGCFP----VSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQ  621
              ++V G  PIGC P    ++ +S  P   D  GC   +N     HN  L++ +   +  
Sbjct  221  TRVIVPGNFPIGCVPGYLAMNAASSEPADYDSAGCLRXLNDFAAKHNSRLRRAVADLQAS  280

Query  622  FPQCTIIYANYWKAFLAIFNNPGNYNFK--ETKKACCGGGGGEFNFDRNSMRGTSGATKC  795
            +P   + YA+Y+ +FL + +N  ++ F    T+KACCG G GE+NFD   M G  G   C
Sbjct  281  YPGAAVAYADYFDSFLTLXHNASSFGFDAASTRKACCGAGAGEYNFDWRRMCGFPGTAAC  340

Query  796  SDPDSYISWDGIHLSGAMNKHLAELLLNKDYCEP  897
            +DP +Y+SWDGIH++ A  + ++ L+ +  Y +P
Sbjct  341  ADPSTYLSWDGIHMTQAAYRAMSRLIYHGKYLQP  374



>ref|XP_010912608.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X2 [Elaeis 
guineensis]
Length=405

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/276 (33%), Positives = 143/276 (52%), Gaps = 12/276 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+AG+T+L  +++ + K  + TW+   L    Q  WF + L S  CS   D+ CK 
Sbjct  123  GANFAVAGATALDNDFFRA-KGLNVTWSEYSL--VVQFNWFKQLLPSL-CST--DSDCKG  176

Query  301  DIDNALFWLGALGVSD--YFQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             I N+LF +G +G +D  Y     ++   +R      I   + ++  ++  GAK +VV G
Sbjct  177  IISNSLFLVGEIGWNDHGYSFNEGRTADEIRTFIPNIIEVISSVIDDLIKLGAKTLVVPG  236

Query  475  LPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            + P GC PV ++    + ++      GC   +N     HN+LLQ  ++R RR  P  TII
Sbjct  237  IFPSGCVPVYLTWMQSEIVEDYDPDTGCIKWVNEFSAYHNQLLQNELDRIRRLHPHVTII  296

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y++A +++F +P  + FK+     C GGGG +N + +   G   AT C DP  ++ W
Sbjct  297  YADYYEALMSVFRSPEKFGFKKAPLDACCGGGGPYNVNFSLPCGGPMATVCKDPSKFVFW  356

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKKTS  930
            D  H + A  + +A  LL   Y  PP  +  +K  S
Sbjct  357  DDAHPTEAATEIVARGLLEGPYAYPPILQACSKVES  392



>ref|XP_002439451.1| hypothetical protein SORBIDRAFT_09g006600 [Sorghum bicolor]
 gb|EES17881.1| hypothetical protein SORBIDRAFT_09g006600 [Sorghum bicolor]
Length=395

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 141/281 (50%), Gaps = 17/281 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADAR---  291
            G NFAI G T+L   ++    A S       L  + QI WF +  +S  C+    A    
Sbjct  117  GANFAIVGGTALDVGFFLRRNAASVPPFRSSL--RVQIGWFRRLKRSLICNTTTAAAAAG  174

Query  292  CKADIDNALFWLGALGVSDYFQIHS--KSIVAMRGISQLCIHHttqllqtvltEGAKHIV  465
            CK  + N+LF +G LG +DY  I +  KSI   +      +    + ++ ++ EGA+++V
Sbjct  175  CKDRLANSLFVVGELGSNDYGYILAGGKSIQEAKSFVPEVVKAICRGIERLVEEGARYMV  234

Query  466  VQGLPPIGCFPVSISSC----------PPQQLDQMGCNSDINSAIDLHNKLLQKMIERFR  615
            V G  P GC P+ ++              +   + GC   +N   + HN +L++ + R R
Sbjct  235  VSGTLPAGCLPMELTKYGYGAAGKKGNATEYDRRTGCLRRLNGLAEYHNWMLREAVGRMR  294

Query  616  RQFPQCTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKC  795
            R++P   ++YA+++K    +   P  + F E     C GGGG +N++  +  G+ G+T C
Sbjct  295  RKYPTTKLVYADFYKPVARLLRRPARFGFTEEPIRACCGGGGPYNYNPGAACGSPGSTVC  354

Query  796  SDPDSYISWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMVN  918
             +P +++ WDGIHL+ A  K++A+  LN  Y  P   +++ 
Sbjct  355  REPSAHVHWDGIHLTEAAYKYIADGWLNGLYAYPSILDLLQ  395



>ref|XP_003577537.1| PREDICTED: acetylajmalan esterase [Brachypodium distachyon]
Length=374

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/273 (35%), Positives = 144/273 (53%), Gaps = 18/273 (7%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L R     N A   T  N+PL+  SQ+ WF   L +  C++  D  C  
Sbjct  106  GVNFAVAGATALDRTVLVQN-AIVMTPGNMPLS--SQLDWFKSHLNAT-CTSQED--CAK  159

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             +  ALF +G +G +DY    FQ   +SI A++      +   T + + ++  GA  I++
Sbjct  160  KLAGALFLVGEIGGNDYNYAFFQ--KRSIEAVKAYVPQVVQSITNVAKELIELGATQIMI  217

Query  469  QGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G  PIGC P  +S          D+ GC    NS    HN+ LQ  I+  R+     +I
Sbjct  218  PGNFPIGCSPSYLSLFSVAGSTDHDERGCLVSYNSFAAYHNEQLQAAIDGLRKANSDVSI  277

Query  640  IYANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSY  813
            +YA+Y+ AFL + ++     F E    KACCG GG  +NFD + M G  GA+ C+DP  +
Sbjct  278  VYADYYGAFLHLLDHASVLGFDEGSLLKACCGAGG-VYNFDMDMMCGGLGASTCADPARH  336

Query  814  ISWDGIHLSGAMNKHLAELLLNKDYCEPPFSEM  912
            +SWDGIHL+    + +A  LL + + +P  S +
Sbjct  337  VSWDGIHLTQQAYRAMALALLMEGFAQPAESVL  369



>ref|XP_010041182.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=366

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 142/267 (53%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T++   ++++       WTN  LN Q  + WF K L+S  C+   D  C  
Sbjct  105  GVNFAVAGATAIDGSFFSAQNIT--LWTNDSLNVQ--LGWF-KSLKSSLCTTKQD--CDE  157

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G +G +DY    +  ++I  +R +    +    + + T++ EGA ++VV G
Sbjct  158  YFKKSLFLVGEIGENDYNLPFLFGRTIEQLRPLVPQIVGAIIRAVSTLIEEGAVNLVVPG  217

Query  475  LPPIGCFPVSIS---SCPPQQLD-QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              P GC  + ++   S      D + GC    N+    HN  L++ +++ R Q+P   I+
Sbjct  218  QLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYHNNYLKQELQKLREQYPHARIM  277

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+ A ++I+  P  Y F       C GGGG +NF+ ++  G SG+T C DP +++ W
Sbjct  278  YADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNTSAYCGQSGSTVCKDPSAFVDW  337

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIH + A   ++A  L++  +  PP 
Sbjct  338  DGIHSTEAAYHYIARGLIDGGFISPPL  364



>ref|XP_008791125.1| PREDICTED: GDSL esterase/lipase At5g03980-like [Phoenix dactylifera]
Length=376

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/266 (35%), Positives = 141/266 (53%), Gaps = 14/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   ++   +A   T TN PL+ Q  + WF   L S  CS  +  +C  
Sbjct  108  GVNFAVAGATALDNSFFL-KRATFPTVTNSPLSVQ--LEWFKTHLNST-CS--SQTKCAK  161

Query  301  DIDNALFWLGALGVSDYFQIHSK--SIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  ALF +G +G +DY    ++  SI  +       +    +  + V+  GA  +VV G
Sbjct  162  LLKRALFLVGEIGGNDYNYAFTQGTSIKKVMTYVPQVVQSIIKTAKEVIDVGAVQLVVPG  221

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC P  ++   S  P   D+  C  + N+    HNK LQ  +E  R  +P  TI+Y
Sbjct  222  NFPIGCMPSYLTMFFSLDPGAYDEKKCLKEYNAFAMHHNKQLQAALEDLRHAYPHVTIMY  281

Query  646  ANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            A+Y++AFL + +      F +    +ACCG GG E NF+ N M G  GA+ CS+P  +IS
Sbjct  282  ADYYQAFLHLLDKAPELGFDKDSLLQACCGVGG-EHNFNMNIMCGMPGASTCSNPSKHIS  340

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEP  897
            WDGIHL+    K +A+ L+ + +  P
Sbjct  341  WDGIHLTQEAYKVMAQSLIMEGFAYP  366



>dbj|BAK07773.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=346

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 141/269 (52%), Gaps = 13/269 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+T++  ++Y  +K   F   N  LN Q  + WF + L+   C+       + 
Sbjct  77   GVNFAVGGATAIDVDFYERSKLVQFKLINNSLNVQ--LGWFEQ-LKPTICNKTLLGH-RE  132

Query  301  DIDNALFWLGALGVSDYFQI--HSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  ALF++G  GV+DY  +    K+   +R      + +    ++T++ EGA ++VV G
Sbjct  133  CLSKALFFVGEFGVNDYNFVWNAGKTEDEVRSYVPKVVKNIVMAVETLIKEGAVYVVVPG  192

Query  475  LPPIGCFPVSISS----CPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
             PP GC P  +++          D +GC SDIN     HN +L+  I+  R ++    II
Sbjct  193  SPPNGCSPTMLTTRSSLNKTMMYDHVGCLSDINRVAKYHNSMLRAAIDALRGKYSHAKII  252

Query  643  YANYWKAFLAIFNNPGNYNFK--ETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYI  816
            YA+++   + I  NP  +     +   ACCGGGG  +N++ +++ G  G   C DP +++
Sbjct  253  YADFYGPIITILENPSRFGVAGADALLACCGGGGA-YNWNASAVCGMPGVKACKDPSAFV  311

Query  817  SWDGIHLSGAMNKHLAELLLNKDYCEPPF  903
            +WDGIH + A  + +AE  L+  + +PP 
Sbjct  312  NWDGIHYTEATYRFIAEGWLHGPFADPPI  340



>ref|NP_001168439.1| uncharacterized protein LOC100382211 [Zea mays]
 gb|ACN28246.1| unknown [Zea mays]
 gb|AFW82120.1| hypothetical protein ZEAMMB73_915676 [Zea mays]
Length=304

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/284 (28%), Positives = 141/284 (50%), Gaps = 25/284 (9%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFAI G T+L   ++    A S        + + QI WF +  +   C+  A A  ++
Sbjct  28   GANFAIVGGTALDVGFFLRRNAASVP--PFRSSLRVQIGWFRRLKKRLLCNANATAPTRS  85

Query  301  DIDNALFWLGALGVSDYFQIHS--KSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                 LF +G LG +DY  I +  KS+   +      +      ++ ++ EGA+++VV G
Sbjct  86   -----LFVVGELGSNDYAYILAGGKSLREAKSFVPEVVKAICTGIERLVEEGARYVVVSG  140

Query  475  LPPIGCFPVSISS--CPPQQLD--------------QMGCNSDINSAIDLHNKLLQKMIE  606
              P GC P++++      +QL               + GC   +N   + HN +L++ + 
Sbjct  141  TLPAGCLPMALTKYGAEEKQLQAGTRGKNATEYYDRRTGCLRRLNGLAEYHNWMLREAVG  200

Query  607  RFRRQFPQCTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGA  786
            R RR++P   +++A++++    +   P  + F E     C GGGG +N++  +  G+ GA
Sbjct  201  RLRRKYPTTKLVFADFYRPVARLLRRPAKFGFTEEPIRACCGGGGPYNYNPGAACGSPGA  260

Query  787  TKCSDPDSYISWDGIHLSGAMNKHLAELLLNKDYCEPPFSEMVN  918
            T C DP +++ WDGIHL+ A  K++A+  L+  Y  PP  +++ 
Sbjct  261  TVCRDPSAHVHWDGIHLTEAAYKYIADGWLSGLYAYPPVLDLLQ  304



>gb|KDP21068.1| hypothetical protein JCGZ_21539 [Jatropha curcas]
Length=367

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/270 (33%), Positives = 141/270 (52%), Gaps = 12/270 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+LS E++   K     WTN  L+ Q  + WF K L++  C+   +  C  
Sbjct  102  GVNFAVAGATALSSEFFYDKKIGQVLWTNDSLSIQ--LGWF-KELKTSLCTTKQE--CDN  156

Query  301  DIDNALFWLGALGVSDY---FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
                +LF +G +G +DY   F +   SI  +R    L +   T+ +  ++ EGA  ++V 
Sbjct  157  YFKKSLFVVGEIGGNDYNYPFFV-GGSIKQLRASVPLVVGAITKAITVLIEEGAVELMVP  215

Query  472  GLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            G  PIGC  V ++   S      D+ GC    NS    HN  L+  +E  R ++P   II
Sbjct  216  GNLPIGCSAVYLTLFQSPNKADYDKNGCLKAYNSFSKYHNNQLKGALETLRNKYPNARII  275

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+ A    +++P +Y F       C GGGG +NF+  +  G  G+  C +P +Y +W
Sbjct  276  YADYYGAAKRFYHSPKHYGFYNGVLTACCGGGGSYNFNNFARCGHVGSKACVNPSTYANW  335

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSEM  912
            DGIHL+ A  + +A  L+N  +  PP ++ 
Sbjct  336  DGIHLTEAAYRIIAMGLINGSFSTPPLTKF  365



>ref|XP_010915611.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Elaeis 
guineensis]
 ref|XP_010915612.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Elaeis 
guineensis]
Length=346

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/267 (30%), Positives = 135/267 (51%), Gaps = 11/267 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA++G+T++  E++           N  L+ Q  + WF + L+   C++     CK 
Sbjct  43   GANFAVSGATAIDIEFFQGRGLGDIARVNQSLSVQ--LRWFEE-LKPSLCNSTRS--CKD  97

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G +GV+DY       +S+  +R      I   + + + ++  GA  +VV G
Sbjct  98   YFSKSLFMIGEIGVNDYSTPLRARRSLKEVRSYVPKVIEAVSTVTERLIENGAVDLVVAG  157

Query  475  LPPIGCFPVSIS---SCPPQQLD-QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
             PP+GCF V ++   S   +  D   GC + +N     HN++L++++E+FR ++ +    
Sbjct  158  DPPLGCFGVFLTLYMSSKKEDYDPSTGCLNKLNDLTRYHNRMLRRLLEQFRTKYARLRFT  217

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+   + +  NP  Y F       C GGGG +NF+        G   C DP +Y+ W
Sbjct  218  YADYYDPVIRLARNPTRYGFSNGALKVCCGGGGSYNFNATLFCSQPGFNVCKDPSTYVGW  277

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  + +A  LLN  + +PP 
Sbjct  278  DGIHLTEAAYRFIAMGLLNGPFADPPL  304



>ref|XP_010918532.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X1 [Elaeis 
guineensis]
Length=460

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 136/268 (51%), Gaps = 14/268 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG T+L   ++   +     +TN  LN Q  + WF   L S  CS+  D  C  
Sbjct  183  GVNFAVAGGTALDVSFF-KERGIMMPYTNSSLNVQ--LEWFKSHLDSI-CSSQTD--CAE  236

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + +ALF +G +G +DY       KSI  +       +       + V+  GA  +V+ G
Sbjct  237  KLKHALFLVGEIGGNDYNYAFFGGKSITEVMNYVPHVVTSIINAAKEVINMGAIQLVIPG  296

Query  475  LPPIGCFP---VSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC P    +++S  P   D   C    N+   LHN  LQ+ I+  R  +P   I+Y
Sbjct  297  NFPIGCLPSYLTALNSSDPDAYDNRLCLKGPNTFAMLHNLKLQEAIQELRESYPHVVIMY  356

Query  646  ANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            A+Y+ AF+ + +N  +  F +    KACCGGGG E NFD   M G+ GA+ C +P  +IS
Sbjct  357  ADYYNAFMTLLDNALDLGFDKNSLMKACCGGGG-EHNFDATKMCGSPGASTCDNPAQHIS  415

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPF  903
            WDGIHL+      +A  L++  +  P +
Sbjct  416  WDGIHLTQEAYMIMARQLISGGFVYPSY  443



>ref|XP_010918533.1| PREDICTED: GDSL esterase/lipase At5g03980-like isoform X2 [Elaeis 
guineensis]
Length=450

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 136/268 (51%), Gaps = 14/268 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG T+L   ++   +     +TN  LN Q  + WF   L S  CS+  D  C  
Sbjct  173  GVNFAVAGGTALDVSFF-KERGIMMPYTNSSLNVQ--LEWFKSHLDSI-CSSQTD--CAE  226

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + +ALF +G +G +DY       KSI  +       +       + V+  GA  +V+ G
Sbjct  227  KLKHALFLVGEIGGNDYNYAFFGGKSITEVMNYVPHVVTSIINAAKEVINMGAIQLVIPG  286

Query  475  LPPIGCFP---VSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC P    +++S  P   D   C    N+   LHN  LQ+ I+  R  +P   I+Y
Sbjct  287  NFPIGCLPSYLTALNSSDPDAYDNRLCLKGPNTFAMLHNLKLQEAIQELRESYPHVVIMY  346

Query  646  ANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            A+Y+ AF+ + +N  +  F +    KACCGGGG E NFD   M G+ GA+ C +P  +IS
Sbjct  347  ADYYNAFMTLLDNALDLGFDKNSLMKACCGGGG-EHNFDATKMCGSPGASTCDNPAQHIS  405

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPF  903
            WDGIHL+      +A  L++  +  P +
Sbjct  406  WDGIHLTQEAYMIMARQLISGGFVYPSY  433



>ref|XP_010912659.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Elaeis guineensis]
Length=387

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 137/269 (51%), Gaps = 14/269 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L  +++   K    +WT   L   +QI WF    Q      ++ + CK 
Sbjct  110  GVNFAVAGATALDNDFF-REKGLDISWTEYSLG--TQIEWFK---QLLPSLCSSSSDCKG  163

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + ++LF +G +G +DY       +++  +R      I   +  +  ++  GAK +VV G
Sbjct  164  ILSSSLFLMGEIGGNDYNHPFFQGRTVDEIRTFVPSVISAISSAINVLIQLGAKTMVVPG  223

Query  475  LPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              PIGC    + +   Q+ +    + GC   +N   + HN+LL   ++  R+  P  TII
Sbjct  224  NFPIGCVSRYLQTFQSQRKEDYDSETGCIKWLNEFAEYHNRLLVDELDHLRQLHPHVTII  283

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y++A L IF  P  + FKE   A C G GG +N       G   AT C+DP  Y+ W
Sbjct  284  YADYYEALLHIFRFPTQFGFKEPPLAACCGAGGPYNVFVAC--GDRAATVCNDPSKYVCW  341

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            DGIHL+ A    +A+ LL   Y  PP ++
Sbjct  342  DGIHLTEAAYGTIAQGLLEGSYATPPITQ  370



>ref|XP_004968628.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=378

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 130/270 (48%), Gaps = 8/270 (3%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L   Y+      S    N   +F  QI WF + L++  C+N A  +C  
Sbjct  109  GANFAVVGATALDLSYFMERNITSVPPFNS--SFSVQIGWFEQLLKTSLCNNTAKGKCDD  166

Query  301  DIDNALFWLGALGVSDYFQIHS--KSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY  + +  K++   +      +      ++ ++  GA+ IVV G
Sbjct  167  YLKKSLFVMGEFGGNDYVFLLAANKTVEQTKTYVPAVVKAIAGGVEKLIKHGARRIVVPG  226

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              P GC P+ ++   S      D+ GC   +N     HN  L++ +   R ++P   I Y
Sbjct  227  NLPTGCIPIMLTLYASPNKADYDRYGCLDKLNGLARYHNAFLRREVMALRIKYPGTKIAY  286

Query  646  ANYWKAFLAIFNNPGNYNFK-ETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            A+Y+   +    NP N  F   T    C G GG +N++  +  G  GAT C+DP   ++W
Sbjct  287  ADYFWPVVGFLQNPANSGFDGSTALVACCGAGGRYNYNVTAACGFPGATACADPSRAVNW  346

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSEM  912
            DGIHL+ A  + +A   L   + +PP   +
Sbjct  347  DGIHLTEAAYRDIAGGWLRGPFAQPPILSL  376



>ref|NP_001056855.1| Os06g0156600 [Oryza sativa Japonica Group]
 dbj|BAD69420.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAD69308.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF18769.1| Os06g0156600 [Oryza sativa Japonica Group]
 dbj|BAG96644.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97011.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00653.1| unnamed protein product [Oryza sativa Japonica Group]
Length=360

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/267 (33%), Positives = 140/267 (52%), Gaps = 16/267 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++   ++ S       W N PLN  +QI WF + + S        + CK 
Sbjct  100  GANMAIIGATTMDSGFFQSLGIGDKIWNNGPLN--TQIQWFQQLMPS-----ICGSSCKT  152

Query  301  DIDNALFWLGALGVSDY----FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVV  468
             +  +LF LG  G +DY    F  ++    A  G S   +    + ++ ++  GA ++VV
Sbjct  153  YLSKSLFVLGEFGGNDYNAQLFGGYTPEQAA--GQSGTIVDGIGKGVEQLIGLGAMYVVV  210

Query  469  QGLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
             G+ P+GCFP+ ++   +      DQ GC +  N+    HN LLQ  +   + ++P   I
Sbjct  211  PGVLPVGCFPIYLTLYGTSNAGDYDQYGCLTRFNTLSSRHNSLLQAKVSSLQSKYPWARI  270

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            +YA+++     +  +P NY F    +ACCG GGG++N+   +  G SGA  CS+P S +S
Sbjct  271  MYADFYSHVYDMVKSPSNYGFSTNLRACCGAGGGKYNYQNGARCGMSGAYACSNPSSSLS  330

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPP  900
            WDGIHL+ A  K +A+  +N  YC PP
Sbjct  331  WDGIHLTEAAYKQIADGWVNGPYCHPP  357



>ref|XP_004248464.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Solanum 
lycopersicum]
Length=378

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/269 (32%), Positives = 134/269 (50%), Gaps = 11/269 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ GS  +  ++Y     +    TN+ +    Q+ WF + L    C N++   CK 
Sbjct  103  GTNFAVVGSRVMDAQFYEKMGIYDIV-TNVSM--WDQLNWFKQMLPHL-CHNSSG--CKE  156

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             ++++LF LG  G +DY    +  K++  +  I  L           ++  GA+ I+V  
Sbjct  157  FLESSLFLLGEFGGNDYTHALLSHKTLNDILPIIPLVAQSIASGAHELVELGARTIIVPS  216

Query  475  LPPIGC---FPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + P+GC   +  +  S   +  D++GC    N     HN+LLQK + R R   P   IIY
Sbjct  217  VLPLGCSSSYLTNFESLNEEDYDELGCLIWPNELASYHNELLQKELHRLRELHPHVNIIY  276

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+Y+ A + I+  P  Y F ++    C GGGG +NF+ ++  GTS AT C DP  Y++WD
Sbjct  277  ADYYNASMKIYRAPRKYGFLKSVLVACCGGGGPYNFNVSAQCGTSQATSCEDPKQYVNWD  336

Query  826  GIHLSGAMNKHLAELLLNKDYCEPPFSEM  912
            G H S A  K + + LL   +  PP   +
Sbjct  337  GYHFSEAAYKWITKSLLEGLFSYPPMKNL  365



>ref|XP_011086014.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Sesamum indicum]
Length=373

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/268 (31%), Positives = 137/268 (51%), Gaps = 10/268 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSL-SREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCK  297
            G+NFA+AG+T+L ++ +Y+ N       TN  L+ Q  + WF K   +  CS   D  C 
Sbjct  103  GVNFAVAGATALDAKFFYSRNIGSQLLLTNDSLSVQ--LGWFSKLKSTLICSTKQD--CA  158

Query  298  ADIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
               + +LF +G +G +DY        +I  ++ +  L +         ++ EGA  ++V 
Sbjct  159  RRFEKSLFLVGEIGGNDYNYPFFAGGTIQQLKALVPLVVETIANATSVLIEEGAVELMVP  218

Query  472  GLPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            G  PIGC  V ++   +      D+ GC    NS    HN  L+  +E  R ++P   II
Sbjct  219  GNLPIGCNAVYLTLFRTPNKTAYDRNGCLKAYNSFSKYHNSNLKLALENLRHKYPHAKII  278

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+ A +  F+ P +Y F       C GGGG +NF+ +++ G+ G+  C DP +Y +W
Sbjct  279  YADYYAAAIKFFHAPHHYGFWNGALVACCGGGGPYNFNNSAICGSPGSKTCLDPTTYANW  338

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFS  906
            DGIHL+ +  + +   L+N  +  PP +
Sbjct  339  DGIHLTESAYRVITMGLVNGPFTHPPLT  366



>ref|XP_003560500.1| PREDICTED: acetylajmalan esterase-like [Brachypodium distachyon]
Length=380

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 139/275 (51%), Gaps = 13/275 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T++        ++ S  +T   L  Q  + WF  FL+S   S A D   + 
Sbjct  109  GVNFAVAGATAMDPAGLFGPRSFSMPFTVSSLKLQ--LRWFKDFLKS---SFATDEDIRK  163

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + +++  +G +G +DY      +K++  +  +    +       + VL  GA  +++ G
Sbjct  164  RLQSSIVLVGEIGGNDYNYAFFTNKNVSDVEKLIPAVVQTIIDAAKEVLDMGASRVIIPG  223

Query  475  LPPIGCFP---VSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC P    ++ S  P   D  GC  ++N     HN  LQ+ I   R  +P  +I Y
Sbjct  224  NFPIGCIPGYLTTMGSSEPSDYDSTGCLREMNLFAAKHNSKLQQAIAGLRSSYPNASIAY  283

Query  646  ANYWKAFLAIFNNPGNYNFK--ETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            A+Y+ +F +I  +  +  F    T+ ACCG GG ++N+D   M G  G T C++P +Y+S
Sbjct  284  ADYYNSFFSILKSASSLGFDANSTRMACCGAGG-KYNYDERKMCGMEGTTACAEPSAYLS  342

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            WDGIH++ A  K ++ L+ +  Y +P       KK
Sbjct  343  WDGIHMTQAAYKAMSRLIYHGRYLQPQILNFPEKK  377



>ref|XP_003542989.1| PREDICTED: GDSL esterase/lipase At1g28600 [Glycine max]
Length=400

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 140/267 (52%), Gaps = 10/267 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L R ++           N  L  Q  + WF + L S   S+++   CK 
Sbjct  117  GVNFAVAGATALDRGFFEEKGFAVDVTANFSLGVQ--LDWFKELLPSLCNSSSS---CKK  171

Query  301  DIDNALFWLGALGVSDYFQIHSKSIVAMRGISQL--CIHHttqllqtvltEGAKHIVVQG  474
             I ++LF +G +G +DY    S++      ++ +   I   T  ++ ++  GA   +V G
Sbjct  172  VIGSSLFIVGEIGGNDYGYPLSETTAFGDLVTYIPQVISVITSAIRELIDLGAVTFMVPG  231

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              P+GC P  ++   +   ++ DQ GC   +N+  + HN+LLQ  I R R  +P   IIY
Sbjct  232  SLPLGCNPAYLTIFATIDKEEYDQAGCLKWLNTFYEYHNELLQIEINRLRVLYPLTNIIY  291

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+Y+ A L  +N+P  + F       C GGGG +N++  +M G +G   C DP  Y+SWD
Sbjct  292  ADYFNAALEFYNSPEQFGFGGNVLKVCCGGGGPYNYNETAMCGDAGVVACDDPSQYVSWD  351

Query  826  GIHLSGAMNKHLAELLLNKDYCEPPFS  906
            G HL+ A  + + + LL+  Y  P F+
Sbjct  352  GYHLTEAAYRWMTKGLLDGPYTIPKFN  378



>ref|XP_006662321.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=407

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/265 (31%), Positives = 136/265 (51%), Gaps = 19/265 (7%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AGST+LS E+Y       F    +P++  +Q  WFH  +Q  G S+    +  A
Sbjct  120  GVNFAVAGSTALSPEFYAGRGLKPF----VPVSLANQTIWFHNVVQLLGSSDHDRRKVMA  175

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
               ++LF +G +GV+DY    + + ++  +       +     ++  V+  GA  +VV G
Sbjct  176  ---SSLFIVGEIGVNDYLVSLVGNLTVGEVESFVPHIVGAIRSVVNEVIAAGATTVVVPG  232

Query  475  LPPIGCFPVSI--------SSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQF--  624
            + P+GC P  +        SS       + GC + +N   + HN+ L+  +   RR    
Sbjct  233  MIPLGCEPQLLALYQGGAGSSDAGDYDPRSGCMARLNGLAERHNRELRCAVAELRRAHWG  292

Query  625  PQCTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDP  804
               +++YA+ ++A   I  +PG Y F +     C GG G +NF+  +  G SGAT C+DP
Sbjct  293  TSTSVVYADLYRAVTDIVVSPGRYGFGDMPLEACCGGAGSYNFNVTAFCGASGATACADP  352

Query  805  DSYISWDGIHLSGAMNKHLAELLLN  879
              Y+SWDG+H + A N+H+A  +L 
Sbjct  353  SVYVSWDGVHFTEAANRHIACAMLK  377



>ref|XP_010912632.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=398

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/279 (32%), Positives = 144/279 (52%), Gaps = 22/279 (8%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAAD-----  285
            G+NFA+AG+T+L  +++   K    +WT   L   +QI WF + L S  CS+ +      
Sbjct  110  GVNFAVAGATALDNDFF-REKGLDISWTEYSLG--TQIEWFKQLLPSL-CSSGSGYPFTH  165

Query  286  -----ARCKADIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvlt  444
                   CK  + ++LF +G +G +DY       K++  +R      I   +  +  ++ 
Sbjct  166  VMFTMVDCKGILSSSLFLMGEIGGNDYNHPFFQGKTVDEIRTFVPSIISAISSAINALIQ  225

Query  445  EGAKHIVVQGLPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERF  612
             GAK +VV G  PIGC    + +   ++ +    Q GC   +N   + HN+LL   ++  
Sbjct  226  LGAKTLVVPGNFPIGCVSWYLQAFQSRRKEDYDSQTGCIKWLNEFAEYHNRLLVDELDHL  285

Query  613  RRQFPQCTIIYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATK  792
            ++  P  TIIYA+Y+KA L IF +P  + FK+   A C GGGG +N       G   AT 
Sbjct  286  QQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNISVPC--GGRAATV  343

Query  793  CSDPDSYISWDGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            C+DP +Y+ WDG+HL+ A  + +A+ LL   +  PP ++
Sbjct  344  CNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQ  382



>ref|NP_001042396.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAF04310.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAG87737.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 130/264 (49%), Gaps = 10/264 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+T++   ++    A    WTN+ L+ Q  + WF + L+   CS+  D  CK 
Sbjct  117  GVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQ--LGWFEQ-LKPSLCSSPKD--CKE  171

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G +G +DY       KS+   +              + ++  GA H+VV G
Sbjct  172  FFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAGAVADATERLIKAGAVHLVVPG  231

Query  475  LPPIGCFPVSISSCPPQ---QLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC    ++  P       D  GC    N     HN +LQ  +   RR +P+  I+Y
Sbjct  232  NLPIGCSSAYLTLHPSSNRSDYDSTGCLKTYNDFAQHHNAVLQDKLRLLRRSYPEARIMY  291

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+Y+ A ++   NP  + F+      C GGGG +NF+  +  G  G++ C+DP +Y +WD
Sbjct  292  ADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNPKASCGVRGSSVCTDPSAYANWD  351

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            G+HL+ A    +A  +LN  Y  P
Sbjct  352  GVHLTEAGYHAIANSILNGPYTSP  375



>ref|XP_008777735.1| PREDICTED: GDSL esterase/lipase At1g28580-like, partial [Phoenix 
dactylifera]
Length=396

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 138/265 (52%), Gaps = 12/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+AG+T+L  +++ + K  +  W    L   +QI WF + L S  CS  +D+ CK 
Sbjct  128  GANFAVAGATALDNDFFRA-KGLNVAWPEYSLG--AQIKWFKQLLPSL-CS--SDSDCKG  181

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + N+LF +G +G +DY    +   +I  +R      IH  +  +  ++  GAK +VV G
Sbjct  182  LMSNSLFLMGEIGWNDYNHPFVQGMTIDEIRTFVPDIIHIISSAITDLIELGAKTVVVPG  241

Query  475  LPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
            + P GC  + ++    Q+ +    Q GC    N   + H +LL + ++R RR  P   II
Sbjct  242  IVPSGCVSLYLTVFQSQKREDYDPQTGCIKWANEFSEHHGRLLSEELDRLRRLHPHAIII  301

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            +ANY+ A ++IF +P  + FK++    C GG G +N + +   G    T C DP  Y+ W
Sbjct  302  HANYYDALMSIFRSPQQFGFKKSPLDACCGGDGPYNLNISLRCGDPMTTVCHDPSKYVFW  361

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DG HL+ A  + ++  LL   Y  P
Sbjct  362  DGTHLTEAAYEVISRGLLEGPYATP  386



>ref|NP_001151215.1| LOC100284848 precursor [Zea mays]
 gb|ACG41997.1| esterase precursor [Zea mays]
Length=368

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 133/267 (50%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++  +++ S       W N PL+  +QI WF + L S          CK 
Sbjct  107  GANMAIIGATTMDFDFFKSIGLSDKIWNNGPLD--TQIQWFRQLLPS-----VCGKDCKN  159

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +S+  +RG   + +    + L+ ++  GA  +VV G
Sbjct  160  YLSKSLFVVGEFGGNDYNAALFSGRSMAEVRGYVPMVVSKLVRGLEAIVRSGAVDVVVPG  219

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D+ GC    N     HN LL++ +   RR +P   I+Y
Sbjct  220  VLPIGCFPIYLTLYGTSNAADYDRDGCLRGYNGLSSYHNALLRRSLSGLRRTYPHARIMY  279

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMR-GTSGATKCSDPDSYISW  822
            A+++     +   P N+  K   K CCG GG       N  R G +GA+ C+DP +Y+ W
Sbjct  280  ADFYTQVTHMIRAPHNFGLKYGLKVCCGAGGQGQYGYNNKARCGMAGASACADPGNYLIW  339

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  + +A+  L   YC PP 
Sbjct  340  DGIHLTEAAYRSIADGWLKGPYCSPPI  366



>gb|ACF83155.1| unknown [Zea mays]
 gb|ACN26853.1| unknown [Zea mays]
 gb|AFW82121.1| esterase isoform 1 [Zea mays]
 gb|AFW82122.1| esterase isoform 2 [Zea mays]
Length=368

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 133/267 (50%), Gaps = 13/267 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G N AI G+T++  +++ S       W N PL+  +QI WF + L S          CK 
Sbjct  107  GANMAIIGATTMDFDFFKSIGLSDKIWNNGPLD--TQIQWFRQLLPS-----VCGKDCKN  159

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G  G +DY       +S+  +RG   + +    + L+ ++  GA  +VV G
Sbjct  160  YLSKSLFVVGEFGGNDYNAALFSGRSMAEVRGYVPMVVSKLVRGLEAIVRSGAVDVVVPG  219

Query  475  LPPIGCFPVSIS---SCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + PIGCFP+ ++   +      D+ GC    N     HN LL++ +   RR +P   I+Y
Sbjct  220  VLPIGCFPIYLTLYGTSNAADYDRDGCLRAYNGLSSYHNALLRRSLSGLRRTYPHARIMY  279

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMR-GTSGATKCSDPDSYISW  822
            A+++     +   P N+  K   K CCG GG       N  R G +GA+ C+DP +Y+ W
Sbjct  280  ADFYTQVTHMIRAPHNFGLKYGLKVCCGAGGQGQYGYNNKARCGMAGASACADPGNYLIW  339

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPF  903
            DGIHL+ A  + +A+  L   YC PP 
Sbjct  340  DGIHLTEAAYRSIADGWLKGPYCSPPI  366



>gb|KCW63215.1| hypothetical protein EUGRSUZ_G00835, partial [Eucalyptus grandis]
Length=345

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/266 (32%), Positives = 134/266 (50%), Gaps = 14/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   ++ +    + T TN  LN Q  + WF K L+S  C+   D  C  
Sbjct  87   GVNFAVAGATALDPTFFAARGIPAMTMTNHSLNVQ--LDWFKK-LKSSLCTTQQD--CNT  141

Query  301  DIDNALFWLGALGVSDY---FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
                +LF +G +G +DY   F +   +   +R I    +         ++  GA  +VV 
Sbjct  142  YFKKSLFLVGEIGGNDYNLAFAL-GATFEQLRPIVPNVVGAIANATGMLIEHGAVELVVP  200

Query  472  GLPPIGCFPVSISSCPP----QQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            G  PIGC    I++ PP          GC +  N     HN  LQ+ ++  R+++    I
Sbjct  201  GNLPIGCLTSYITTAPPFLKNDANTATGCLNRYNEFAKYHNNYLQRELQVLRQKYSHARI  260

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            IYA+Y+   + +F +P  Y F ++    C G GG FNF+   M G++ +  C DP + I 
Sbjct  261  IYADYYGDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMMCGSTSSV-CKDPSASIL  319

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEP  897
            WDG+HL+ A  +H+A+ LL+  +  P
Sbjct  320  WDGVHLTEAAYRHMAKGLLDGPFTSP  345



>ref|NP_001140937.1| hypothetical protein [Zea mays]
 gb|ACF85001.1| unknown [Zea mays]
 tpg|DAA58957.1| TPA: hypothetical protein ZEAMMB73_908344 [Zea mays]
Length=433

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 136/269 (51%), Gaps = 14/269 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L+  ++        TWT  P +   Q+ WF K L S         +   
Sbjct  141  GANFAVGGATALNGSFFRERGVEP-TWT--PHSLDEQMQWFKKLLTSIAPLETEQNKI--  195

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             I  +LF++G +G +DY    +  KS+  +  +    +   +  +  ++  GAK +VV G
Sbjct  196  -ISKSLFFVGEVGGNDYNHLIVRDKSVDELHEVVPNVVGAISSAITDLINLGAKKLVVPG  254

Query  475  LPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              PIGC P+ ++    Q+ D    Q GC   +N   + HNK+LQ+ +E+ R   P  TII
Sbjct  255  NFPIGCVPLYLAIFQSQKEDYYEEQTGCIKWLNDFAEYHNKMLQEELEKLRNLHPDVTII  314

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+ A L IF  P  + F     ACC G    +N   + + G  G+T C DP  YISW
Sbjct  315  YADYYGAALNIFRAPLQFGFTVPLNACC-GSDAPYNCSPSILCGRPGSTVCPDPSKYISW  373

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            DG+H + A  K + + +L   Y +PP SE
Sbjct  374  DGLHFTEASYKVVIQGVLGG-YAKPPLSE  401



>ref|XP_007212863.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
 gb|EMJ14062.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
Length=393

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 142/284 (50%), Gaps = 27/284 (10%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+T L   +  + + HS +  N   + + Q+ WF + L S  C+ + D  CK 
Sbjct  112  GVNFAVIGATGLDASFLATMEIHSPSTNN---SLRIQLEWFKQMLPSL-CNTSLD--CKK  165

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltE---------  447
             +  +L  +G++G +DY    +  KSI  +R    L I      + +             
Sbjct  166  FLSTSLILMGSIGCNDYNDGLLGGKSIELVRSYLPLVIEAIASTINSFFLNFLWLHGLQE  225

Query  448  ----GAKHIVVQGLPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMI  603
                GA  I+V G  PIGC P  +S       +Q     GC   +N     HN+ LQ  +
Sbjct  226  LIELGAATILVPGNNPIGCLPAYLSKFETSDKNQYDPSTGCLKWLNEFAQYHNEQLQIEL  285

Query  604  ERFRRQFPQCTIIYANYWKAFLAIFNNPGNYNFK-ETKKACCGGGGGEFNFDRNSMRGTS  780
             R RR  PQ TI+YA+Y+ A L ++ +P  + F  ET KACCGGGG  +NF+ +   G +
Sbjct  286  SRIRRLHPQVTIVYADYYNALLQLYQSPHQFGFTGETSKACCGGGG-PYNFNPSLQCGNA  344

Query  781  GATKCSDPDSYISWDGIHLSGAMNKHLAELLLNKDYCEPPFSEM  912
            GAT C +P  +I+WDG+H + A  + + + LL  +Y  P  + +
Sbjct  345  GATVCENPSQFINWDGMHSTEAAYRLMTKALLQGNYTFPRLASL  388



>gb|KCW76155.1| hypothetical protein EUGRSUZ_D00534, partial [Eucalyptus grandis]
Length=362

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/266 (31%), Positives = 137/266 (52%), Gaps = 14/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   ++ +      T TN  LN Q  + WF K L+S  C+   D  CK 
Sbjct  100  GVNFAVAGATALDPTFFAARGIPVMTMTNHSLNVQ--LDWFKK-LKSSLCTTQQD--CKT  154

Query  301  DIDNALFWLGALGVSDY---FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
                +LF +G +G +DY   F + + +   +R I    +    +    ++ +GA  ++V 
Sbjct  155  YFKKSLFLVGEIGGNDYNLAFALGA-TFEQLRPIVPNVVGAIAKATSMLIEQGAVELIVP  213

Query  472  GLPPIGCFPVSISSCPPQQLDQ----MGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            G  PIGC    I++ PP   +      GC +  N     HN  LQ+ ++  R+++    I
Sbjct  214  GNLPIGCLTSYITTAPPFLKNDANATTGCLNRYNEFAKYHNDYLQRELQVLRQKYSHAKI  273

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            IY +Y+   + +F +P  Y F ++    C G GG FNF+   M G++ +  C DP + I 
Sbjct  274  IYVDYYGDTMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMMCGSTSSV-CKDPSASIL  332

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEP  897
            WDG+HL+ A  +H+A+ LL+  +  P
Sbjct  333  WDGVHLTEAAYRHMAKGLLDSPFTSP  358



>gb|EEE54111.1| hypothetical protein OsJ_00875 [Oryza sativa Japonica Group]
Length=374

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 130/264 (49%), Gaps = 10/264 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+T++   ++    A    WTN+ L+ Q  + WF + L+   CS+  D  CK 
Sbjct  113  GVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQ--LGWFEQ-LKPSLCSSPKD--CKE  167

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G +G +DY       KS+   +              + ++  GA H+VV G
Sbjct  168  FFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAGAVADATERLIKAGAVHLVVPG  227

Query  475  LPPIGCFPVSISSCPPQ---QLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC    ++  P       D  GC    N     HN +LQ  +   RR +P+  I+Y
Sbjct  228  NLPIGCSSAYLTLHPSSNRSDYDSTGCLKTYNDFAQHHNAVLQDKLRLLRRSYPEARIMY  287

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+Y+ A ++   NP  + F+      C GGGG +NF+  +  G  G++ C+DP +Y +WD
Sbjct  288  ADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNPKASCGVRGSSVCTDPSAYANWD  347

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            G+HL+ A    +A  +LN  Y  P
Sbjct  348  GVHLTEAGYHAIANSILNGPYTSP  371



>ref|XP_010068248.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/266 (32%), Positives = 134/266 (50%), Gaps = 14/266 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   ++ +    + T TN  LN Q  + WF K L+S  C+   D  C  
Sbjct  105  GVNFAVAGATALDPTFFAARGIPAMTMTNHSLNVQ--LDWFKK-LKSSLCTTQQD--CNT  159

Query  301  DIDNALFWLGALGVSDY---FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
                +LF +G +G +DY   F +   +   +R I    +         ++  GA  +VV 
Sbjct  160  YFKKSLFLVGEIGGNDYNLAFAL-GATFEQLRPIVPNVVGAIANATGMLIEHGAVELVVP  218

Query  472  GLPPIGCFPVSISSCPP----QQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            G  PIGC    I++ PP          GC +  N     HN  LQ+ ++  R+++    I
Sbjct  219  GNLPIGCLTSYITTAPPFLKNDANTATGCLNRYNEFAKYHNNYLQRELQVLRQKYSHARI  278

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            IYA+Y+   + +F +P  Y F ++    C G GG FNF+   M G++ +  C DP + I 
Sbjct  279  IYADYYGDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMMCGSTSSV-CKDPSASIL  337

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEP  897
            WDG+HL+ A  +H+A+ LL+  +  P
Sbjct  338  WDGVHLTEAAYRHMAKGLLDGPFTSP  363



>ref|XP_009782266.1| PREDICTED: acetylajmalan esterase-like [Nicotiana sylvestris]
Length=370

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 136/259 (53%), Gaps = 16/259 (6%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+AG+T+L   ++ +      TW N PL+  +Q+ WF   LQS   SN     C  
Sbjct  110  GVNFAVAGATALDSSFWAARGIRLPTW-NTPLS--AQLGWFKSHLQSTCGSN-----CAQ  161

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             + ++L  +G  G +DY+      K +  +R      +    + ++ V+  GA  I+V G
Sbjct  162  TLRSSLIVMGEWGGNDYYNGFFQRKQLPEVRTYVPFVVAGIMKSIKDVIQLGATRILVPG  221

Query  475  LPPIGCFPVSISSCPPQQ---LDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
            + P+GC P+ +++ P       DQ+GC  + N     HN+ L + +   +R+FP   I+Y
Sbjct  222  IYPLGCLPLYLTTFPDSNANGYDQLGCLRNYNDFASYHNRYLNRGLASLQREFPNVRIVY  281

Query  646  ANYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
             +Y+ A L +  +P ++ F +     ACC G GG +NF+  ++ G+     C +P  Y+ 
Sbjct  282  GDYYGALLTLLRSPSSFGFNQNTLLTACC-GTGGRYNFNFRTVCGSPSVKACPNPAQYVH  340

Query  820  WDGIHLSGAMNKHLAELLL  876
            WDGIHL+   ++ + ++++
Sbjct  341  WDGIHLTDEAHRRMTDIVV  359



>dbj|BAA94228.1| putative esterase [Oryza sativa Japonica Group]
 gb|EAY73022.1| hypothetical protein OsI_00894 [Oryza sativa Indica Group]
Length=374

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 130/264 (49%), Gaps = 10/264 (4%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G+NFA+ G+T++   ++    A    WTN+ L+ Q  + WF + L+   CS+  D  CK 
Sbjct  113  GVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQ--LGWFEQ-LKPSLCSSPKD--CKE  167

Query  301  DIDNALFWLGALGVSDYFQ--IHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
                +LF +G +G +DY       KS+   +              + ++  GA H+VV G
Sbjct  168  FFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAGAVADATERLIKAGAVHLVVPG  227

Query  475  LPPIGCFPVSISSCPPQ---QLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIY  645
              PIGC    ++  P       D  GC    N     HN +LQ  +   RR +P+  I+Y
Sbjct  228  NLPIGCSSAYLTLHPSSNRSDYDSTGCLKTYNDFAQHHNAVLQDKLRLLRRSYPEARIMY  287

Query  646  ANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISWD  825
            A+Y+ A ++   NP  + F+      C GGGG +NF+  +  G  G++ C+DP +Y +WD
Sbjct  288  ADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNPKASCGVRGSSVCTDPSAYANWD  347

Query  826  GIHLSGAMNKHLAELLLNKDYCEP  897
            G+HL+ A    +A  +LN  Y  P
Sbjct  348  GVHLTEAGYHAIANSILNGPYTSP  371



>ref|XP_010042817.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Eucalyptus grandis]
Length=158

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 88/155 (57%), Gaps = 1/155 (1%)
 Frame = +1

Query  460  IVVQGLPPIGCFPVSISSCPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTI  639
            +VVQGLP  GC P+++   P    D +GC   +N     HN  L   I   R++FP   I
Sbjct  1    MVVQGLPVSGCLPLTMYLAPENDRDDIGCVKSVNDRTHAHNAALLAKISDLRKRFPDSVI  60

Query  640  IYANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYIS  819
            +YA+YW A+ ++   P  Y FKE  KACC G G  ++++  +  GT     C  P  YI+
Sbjct  61   VYADYWNAYHSVMKTPAKYGFKEPFKACC-GTGEPYHYNPFATCGTPSTDLCPRPSEYIN  119

Query  820  WDGIHLSGAMNKHLAELLLNKDYCEPPFSEMVNKK  924
            WDG+HL+ AM K +A + LN  Y +PPFS ++ KK
Sbjct  120  WDGVHLTEAMYKVIAGMFLNGRYSQPPFSYLLGKK  154



>ref|NP_001152155.1| esterase precursor [Zea mays]
 gb|ACG46092.1| esterase precursor [Zea mays]
 tpg|DAA42003.1| TPA: esterase [Zea mays]
Length=386

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 138/265 (52%), Gaps = 12/265 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+AG+T+L R     +   +    ++PL+  SQ+ WF   L +  C +  D  C  
Sbjct  118  GANFAVAGATALDRAVLLQSGIMA-PPASVPLS--SQLDWFKAHLNATACPSLQD--CAK  172

Query  301  DIDNALFWLGALGVSDY---FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQ  471
             +  ALF +G +G +DY   F    +SI AM+      I+    + + V+  GA  IV+ 
Sbjct  173  KLAGALFLVGEIGGNDYNYGFLQGFRSIEAMKAYVPQVINAIMDVAKEVIELGATQIVIP  232

Query  472  GLPPIGCFPVSISS-CPPQQLDQMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTIIYA  648
            G  PIGC P  +S       LD  GC    N+    HN+ LQ  I+  R+     T++YA
Sbjct  233  GNFPIGCSPSYLSLFAASGDLDDRGCLRSYNAFAQHHNEQLQAAIDGLRKANTDVTVVYA  292

Query  649  NYWKAFLAIFNNPGNYNFKETK--KACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            +Y+ AF+ + ++     F++    +ACCG GG  +NF+ NSM G  G T C+DP   +SW
Sbjct  293  DYYGAFMHLLDHASLLGFEQGALLQACCGAGGA-YNFNMNSMCGAPGTTTCADPARNVSW  351

Query  823  DGIHLSGAMNKHLAELLLNKDYCEP  897
            DGIHL+    + +A  LL + + +P
Sbjct  352  DGIHLTQQAYRAIALSLLMEGFAQP  376



>ref|XP_002455947.1| hypothetical protein SORBIDRAFT_03g027770 [Sorghum bicolor]
 gb|EES01067.1| hypothetical protein SORBIDRAFT_03g027770 [Sorghum bicolor]
Length=437

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 88/269 (33%), Positives = 138/269 (51%), Gaps = 14/269 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L+  ++        TWT  P +   Q+ WF K L S   S   +   K 
Sbjct  145  GANFAVGGATALNGSFFRERGVEP-TWT--PHSLDEQMQWFKKLLPSIASS---ETEQKE  198

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF++G +G +DY    +  KS+  +  +    +   +  +  ++  GAK +VV G
Sbjct  199  IMSKSLFFVGEVGGNDYNHLIVRQKSLDELHEVVPNVVGAISSAIVDLINLGAKKLVVPG  258

Query  475  LPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              PIGC P+ ++    Q+ D    Q GC   +N   + HN++LQ+ +E+ R   P  TII
Sbjct  259  NFPIGCVPLYLAIFQSQKEDYYEEQTGCIKWLNEFAEYHNRMLQEELEKLRNLHPDVTII  318

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+ A L IF  P  + F     +CC G    +N   + + G  G+T C DP  YISW
Sbjct  319  YADYYGAALNIFRAPLQFGFTVPLNSCC-GSDAPYNCSPSILCGRPGSTVCPDPSKYISW  377

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            DG+H + A  K + + +L   Y +PP SE
Sbjct  378  DGLHFTEASYKVVIQGVLGG-YAKPPLSE  405



>gb|EEC71081.1| hypothetical protein OsI_02841 [Oryza sativa Indica Group]
Length=388

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 86/269 (32%), Positives = 141/269 (52%), Gaps = 14/269 (5%)
 Frame = +1

Query  121  GMNFAIAGSTSLSREYYTSNKAHSFTWTNIPLNFQSQIAWFHKFLQSKGCSNAADARCKA  300
            G NFA+ G+T+L+  ++  ++    TWT  P +   Q+ WF K L +    +++++    
Sbjct  96   GANFAVGGATALNGSFF-RDRGVEPTWT--PHSLDEQMQWFKKLLTT---VSSSESELND  149

Query  301  DIDNALFWLGALGVSDY--FQIHSKSIVAMRGISQLCIHHttqllqtvltEGAKHIVVQG  474
             +  +LF +G +G +DY    +  KS+  +  +    +   T  +  ++  GAK +VV G
Sbjct  150  IMTKSLFLVGEVGGNDYNHLIVRGKSLDELHELVPKVVGTITSAITELINLGAKKLVVPG  209

Query  475  LPPIGCFPVSISSCPPQQLD----QMGCNSDINSAIDLHNKLLQKMIERFRRQFPQCTII  642
              PIGC P+ +S  P Q+ D    + GC   +N   + HN+LLQ+ +E+ R  +P  +II
Sbjct  210  NFPIGCVPLYLSIFPSQKEDYYDEKTGCIKWLNEFTEYHNRLLQEELEKLRNLYPDVSII  269

Query  643  YANYWKAFLAIFNNPGNYNFKETKKACCGGGGGEFNFDRNSMRGTSGATKCSDPDSYISW  822
            YA+Y+ A L IF  P  + F     +CC G    +N   + + G  G+  CSDP  Y SW
Sbjct  270  YADYYGAALNIFLAPLQFGFTVPLNSCC-GSDAPYNCSPSILCGHPGSVVCSDPSKYTSW  328

Query  823  DGIHLSGAMNKHLAELLLNKDYCEPPFSE  909
            DG+H + A  K + + +L   Y  PP SE
Sbjct  329  DGLHFTEATYKIIIQGVLGS-YANPPLSE  356



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2472781746720