BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c90194_g1_i1 len=656 path=[634:0-655]

Length=656
                                                                      Score     E

ref|XP_010095802.1|  hypothetical protein L484_022158                 87.8    4e-18   
emb|CDP14741.1|  unnamed protein product                              85.5    2e-17   
ref|XP_010323730.1|  PREDICTED: putative cell wall protein            79.7    2e-15   
ref|XP_004306014.1|  PREDICTED: putative cell wall protein-like       77.8    1e-14   
gb|EYU26135.1|  hypothetical protein MIMGU_mgv1a016067mg              66.2    1e-10   
gb|AAM63440.1|  putative cell wall protein                            64.7    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409025.1|  hypothetical protein EUTSA_v10002109mg           63.9    1e-09   
ref|XP_010467758.1|  PREDICTED: putative cell wall protein            63.2    2e-09   
ref|XP_008379898.1|  PREDICTED: putative cell wall protein            62.8    2e-09   
ref|XP_009399895.1|  PREDICTED: putative cell wall protein            62.4    2e-09   
ref|XP_007216421.1|  hypothetical protein PRUPE_ppa023037mg           62.4    3e-09   
emb|CAA52404.1|  putative cell wall protein                           62.8    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EYU26136.1|  hypothetical protein MIMGU_mgv1a021468mg              62.4    4e-09   
ref|XP_002886312.1|  hypothetical protein ARALYDRAFT_900466           62.0    4e-09   
ref|NP_565490.1|  putative cell wall protein                          61.6    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298774.1|  hypothetical protein CARUB_v10014876mg           61.6    8e-09   
ref|XP_010488981.1|  PREDICTED: putative cell wall protein            60.8    1e-08   
gb|AAF29528.1|AF213504_1  putative cell-wall P4 protein               60.8    1e-08   Brassica napus [oilseed rape]
gb|AAF29529.1|AF213505_1  putative cell-wall P8 protein               60.8    1e-08   Brassica napus [oilseed rape]
ref|XP_009117464.1|  PREDICTED: putative cell wall protein            60.5    2e-08   
gb|KFK40465.1|  hypothetical protein AALP_AA3G376500                  60.1    2e-08   
ref|XP_010924064.1|  PREDICTED: putative cell wall protein            58.9    3e-08   
ref|XP_010069894.1|  PREDICTED: putative cell wall protein            58.9    4e-08   
gb|AFL91222.1|  cell wall protein                                     58.2    6e-08   
ref|XP_009409726.1|  PREDICTED: putative cell wall protein            58.2    7e-08   
gb|KHN41142.1|  Putative cell wall protein                            58.5    7e-08   
gb|AFL91218.1|  cell wall protein                                     57.4    9e-08   
gb|AFL91221.1|  cell wall protein                                     57.4    1e-07   
gb|EYU26134.1|  hypothetical protein MIMGU_mgv11b013521mg             57.8    1e-07   
ref|XP_003527446.1|  PREDICTED: putative cell wall protein-like       57.8    1e-07   
gb|AFL91220.1|  cell wall protein                                     57.0    2e-07   
ref|XP_010657269.1|  PREDICTED: putative cell wall protein            57.0    2e-07   
emb|CAN68917.1|  hypothetical protein VITISV_000181                   57.0    2e-07   Vitis vinifera
ref|XP_008230254.1|  PREDICTED: putative cell wall protein            56.6    3e-07   
dbj|BAJ34926.1|  hypothetical protein                                 56.6    4e-07   
ref|XP_006657849.1|  PREDICTED: putative cell wall protein-like       56.2    4e-07   
ref|NP_001236803.1|  uncharacterized protein LOC100305796 precursor   56.2    5e-07   
gb|KDP24168.1|  hypothetical protein JCGZ_25825                       55.8    6e-07   
ref|XP_010268764.1|  PREDICTED: putative cell wall protein            55.5    8e-07   
gb|AFL91217.1|  cell wall protein                                     55.1    8e-07   
ref|XP_002517961.1|  conserved hypothetical protein                   55.5    1e-06   Ricinus communis
gb|AFL91219.1|  cell wall protein                                     54.7    1e-06   
gb|ABI48859.1|  LLA-115                                               54.7    1e-06   Lilium longiflorum [Easter lily]
gb|AFL91216.1|  cell wall protein                                     54.3    1e-06   
ref|XP_010555133.1|  PREDICTED: putative cell wall protein            54.3    2e-06   
ref|XP_007149876.1|  hypothetical protein PHAVU_005G106200g           53.1    1e-05   
gb|EEE67428.1|  hypothetical protein OsJ_24772                        50.4    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001142886.1|  uncharacterized protein LOC100275299 precursor   48.9    2e-04   Zea mays [maize]
ref|NP_001060015.1|  Os07g0565800                                     48.5    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006841706.1|  hypothetical protein AMTR_s00003p00252710        47.8    5e-04   
gb|AFK34490.1|  unknown                                               47.8    6e-04   
dbj|BAJ92216.1|  predicted protein                                    47.0    9e-04   
ref|XP_006491637.1|  PREDICTED: putative cell wall protein-like       48.1    0.001   



>ref|XP_010095802.1| hypothetical protein L484_022158 [Morus notabilis]
 gb|EXB62270.1| hypothetical protein L484_022158 [Morus notabilis]
Length=144

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 78/132 (59%), Gaps = 20/132 (15%)
 Frame = -1

Query  533  MAVTLRFICAFL--SILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLL--YDGTVLIPG  366
            MA  ++ + AFL    ++LS ++ A AGR +P    K  AD KQPE+L+  +DG+VLIPG
Sbjct  1    MAFKVQSLIAFLFSLCILLSMANEAVAGRSVP----KEGADVKQPEWLVDHHDGSVLIPG  56

Query  365  FGRVVVP--------HKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGN  210
             GRV++P        HK  D   YNP+TG   +GTG       II S       +YIPG 
Sbjct  57   LGRVLLPPLHGHHGLHKDHDHLYYNPITGTYSSGTGRAPLGHGIIPS----TPRSYIPGG  112

Query  209  DDTIIPNPGFEV  174
            DDT++PNPGFEV
Sbjct  113  DDTLVPNPGFEV  124



>emb|CDP14741.1| unnamed protein product [Coffea canephora]
Length=131

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 71/118 (60%), Gaps = 11/118 (9%)
 Frame = -1

Query  512  ICAFLSIL--VLSSSHPAFAGRGMPNADSKNVADKKQPE-FLLYDGTVLIPGFGRVVVPH  342
            I AFL IL  +LS +  AF+GR +P  DSKN+ +K QPE F+  DG+VLIPG GR + P 
Sbjct  8    IAAFLFILNVLLSLTGVAFSGREIPMKDSKNL-EKIQPESFIGNDGSVLIPGMGRYMFPR  66

Query  341  KKV--DPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
                 DP NYNP+TG +G      N +  I   G    G +YIPG DDT +P PG EV
Sbjct  67   PGTHFDPINYNPITGTNGG-----NGLPGIGSFGGPFPGQSYIPGGDDTFVPIPGVEV  119



>ref|XP_010323730.1| PREDICTED: putative cell wall protein [Solanum lycopersicum]
Length=126

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 68/113 (60%), Gaps = 15/113 (13%)
 Frame = -1

Query  500  LSILVLSSSHPAFAGRGMPNADSKNVADK-KQPE-FLLYDGTVLIPGFGRVVVPHK--KV  333
            ++I+ LS S    AGR     D   + DK K P+ F  YDGTVLIPG GRVVVP K   V
Sbjct  15   INIIFLSFSCYTLAGR-----DIAKINDKIKHPDTFFPYDGTVLIPGIGRVVVPPKGTHV  69

Query  332  DPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
            +PF YNP+TG S  G G + PI    GSG      +YIPG DDT IPNPG +V
Sbjct  70   NPFTYNPITG-SNNGNGLVIPIP---GSGTGIG--SYIPGGDDTFIPNPGVKV  116



>ref|XP_004306014.1| PREDICTED: putative cell wall protein-like [Fragaria vesca subsp. 
vesca]
Length=118

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 18/110 (16%)
 Frame = -1

Query  494  ILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLL-YDGTVLIPGFGRVVVPHKKVDPFNY  318
            +++L+ +  AFAGR  P   +K+  +KK+P+FL  +DG+ LIPGFGRV  P+K    F Y
Sbjct  18   VILLTVTGQAFAGRNAPKQTNKD--EKKEPQFLFGHDGSFLIPGFGRVAKPYKF---FPY  72

Query  317  NP--VTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
             P     R+G  TG          +G +  G  Y+PG DDT +PNPGFEV
Sbjct  73   RPPYTAPRTGGSTG----------TGASPPGRNYVPGGDDTFVPNPGFEV  112



>gb|EYU26135.1| hypothetical protein MIMGU_mgv1a016067mg [Erythranthe guttata]
Length=135

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 67/117 (57%), Gaps = 13/117 (11%)
 Frame = -1

Query  512  ICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFL-LYDGTVLIPGFGRVVVPHKK  336
            +  FLS+ +    H +   R +P AD+K      +PE+   YD +VLIPG GRV++P K 
Sbjct  11   LMVFLSVSLALVVHTSVGARNIP-ADAK-----LEPEWFGHYDRSVLIPGIGRVMLPPKG  64

Query  335  VD-PFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGS--TYIPGNDDTIIPNPGFEV  174
                FNYNP+TG S  G G    I  + G   A +GS   Y+PG DDT++PNPG EV
Sbjct  65   SHLNFNYNPITG-SPNGNGVS--IPRVGGGDPAGSGSPRNYVPGGDDTLLPNPGVEV  118



>gb|AAM63440.1| putative cell wall protein [Arabidopsis thaliana]
Length=140

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 66/129 (51%), Gaps = 17/129 (13%)
 Frame = -1

Query  545  QASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLY---DGTVL  375
             ASS+ +T   I   LS LVL S       R +P   S    D K P+FL+      T+L
Sbjct  1    MASSL-ITSAVIFVVLS-LVLGSVEQVSGLRHVPK--SPKTTDVKHPDFLVTIEPKPTIL  56

Query  374  IPGFGRVVVPHKKVDPF-NYNPVTGR--SGAGTGAINPIDDIIGSGNAAAGSTYIPGNDD  204
            IPG GR ++P K   PF  YNPVTG   +G G  + N        G  A   T +PG DD
Sbjct  57   IPGVGRFLLPPKCKKPFYPYNPVTGAPLTGGGIPSYN-------GGQGAGPHTQLPGGDD  109

Query  203  TIIPNPGFE  177
            T++PNPGFE
Sbjct  110  TLVPNPGFE  118



>ref|XP_006409025.1| hypothetical protein EUTSA_v10002109mg [Eutrema salsugineum]
 gb|ESQ50478.1| hypothetical protein EUTSA_v10002109mg [Eutrema salsugineum]
Length=166

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 69/142 (49%), Gaps = 11/142 (8%)
 Frame = -1

Query  590  HHFAHPALIHSSVFSQASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKK  411
            H       + ++  + ASS+      +   L  L+L S+      R MP   S    D K
Sbjct  10   HSLPSSTFLTATRTNMASSLLTPAVAVTLVLLSLLLGSAEQVSGLRHMPK--SHKTTDVK  67

Query  410  QPEFLLY---DGTVLIPGFGRVVVPHKKVDPFN-YNPVTGRSGAGTGAINPIDDIIGSGN  243
             P+FL+      TVLIPG GR ++P K   PF  YNPVTG    G G+I       G G 
Sbjct  68   HPDFLVTIEPKPTVLIPGVGRFLLPPKCKKPFYPYNPVTGAPLTG-GSI----PSYGGGQ  122

Query  242  AAAGSTYIPGNDDTIIPNPGFE  177
             A   T +PG DDT++PNPG+E
Sbjct  123  GAGTRTQLPGGDDTLVPNPGYE  144



>ref|XP_010467758.1| PREDICTED: putative cell wall protein [Camelina sativa]
Length=140

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 52/92 (57%), Gaps = 13/92 (14%)
 Frame = -1

Query  434  SKNVADKKQPEFLLY---DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGR--SGAGTGAIN  273
            S+   D K P+FL+      T+LIPG GR+++P K   PF  YNPVTG   +G G  + N
Sbjct  34   SRKTTDVKHPDFLVTIEPKPTILIPGVGRLLLPPKCKKPFYPYNPVTGAPLTGGGIPSYN  93

Query  272  PIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFE  177
                    G  A   T +PG DDT++PNPG+E
Sbjct  94   -------GGQGAGPRTQLPGGDDTLVPNPGYE  118



>ref|XP_008379898.1| PREDICTED: putative cell wall protein [Malus domestica]
Length=122

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 17/111 (15%)
 Frame = -1

Query  500  LSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLL-YDGTVLIPGFGRVVVPH-KKVDP  327
            +S+++L+    A +GR +P   +K+  DKKQP++ L +D + +IPG GRV++P    V P
Sbjct  15   ISVILLALVGRAVSGRNVPTTSNKD--DKKQPQWFLDHDRSFVIPGIGRVMLPPLYNVSP  72

Query  326  FNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
            +   P  G  G   G+ +  D             Y+PG DDT IPNPG+EV
Sbjct  73   YAPPPSIGSPGGSVGSPSSDD-------------YVPGGDDTYIPNPGYEV  110



>ref|XP_009399895.1| PREDICTED: putative cell wall protein [Musa acuminata subsp. 
malaccensis]
Length=108

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 64/126 (51%), Gaps = 30/126 (24%)
 Frame = -1

Query  551  FSQASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLYDGTVLI  372
            FS  SS+ + + F+       +LS +    AGR +P A+S    DKK+ E +  +GTVLI
Sbjct  4    FSSCSSLPLVILFLG------LLSFAQVTLAGRSVP-ANS----DKKETECVGQEGTVLI  52

Query  371  PGFGRVVVPHKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIP  192
            PG GR  +                   G+  +  +  +  SG AAA   Y+PGNDDT +P
Sbjct  53   PGVGRYKI-------------------GSHEMPALRGLDHSGPAAAHGQYLPGNDDTFVP  93

Query  191  NPGFEV  174
            NPGFEV
Sbjct  94   NPGFEV  99



>ref|XP_007216421.1| hypothetical protein PRUPE_ppa023037mg [Prunus persica]
 gb|EMJ17620.1| hypothetical protein PRUPE_ppa023037mg [Prunus persica]
Length=130

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 64/117 (55%), Gaps = 22/117 (19%)
 Frame = -1

Query  503  FLSILV--LSSSHPAFAGRGMPNADSKNVADKKQPEFLL-YDGTVLIPGFGRVVVP--HK  339
             +SILV  L+ +  A AGR +P  D     DKKQPE+ + +DG+ LIPG GRV++P  H 
Sbjct  12   LISILVVLLAITGQAVAGRSVPTKD-----DKKQPEWFIGHDGSYLIPGLGRVLIPPRHN  66

Query  338  KV--DPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
             V   PF  N  TG +G       P          + G  Y+PG DDT +PNPG+EV
Sbjct  67   VVPQTPFPNNGRTGSTGGSGSGQTP----------STGHDYVPGGDDTFVPNPGYEV  113



>emb|CAA52404.1| putative cell wall protein [Arabidopsis thaliana]
Length=140

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 51/93 (55%), Gaps = 13/93 (14%)
 Frame = -1

Query  437  DSKNVADKKQPEFLLY---DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGR--SGAGTGAI  276
             S  + D K P+FL+      T+LIPG GR ++P K   PF  YNPVTG   +G G  + 
Sbjct  33   KSPKITDVKHPDFLVTIEPKPTILIPGVGRFLLPPKCKKPFYPYNPVTGAPLTGGGIPSY  92

Query  275  NPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFE  177
            N        G  A   T +PG DDT++PNPGFE
Sbjct  93   N-------GGQGAGPHTQLPGGDDTLVPNPGFE  118



>gb|EYU26136.1| hypothetical protein MIMGU_mgv1a021468mg [Erythranthe guttata]
Length=133

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 70/128 (55%), Gaps = 14/128 (11%)
 Frame = -1

Query  545  QASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLL-YDGTVLIP  369
             AS     L F+  FLSI +    +     R +P AD+K      +PE+   YD +VLIP
Sbjct  1    MASHTGAFLGFLV-FLSISMAVLHNSTAGARNIP-ADAK-----LEPEWFGHYDRSVLIP  53

Query  368  GFGRVVVPHKKVD-PFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGS--TYIPGNDDTI  198
            G GRV++P K      NYNP+TG S  G G    I  + G   A +GS  +Y+PG DDT+
Sbjct  54   GIGRVMLPPKGSHFNLNYNPITG-SPNGNGVS--IPGVGGGDPAGSGSPRSYVPGGDDTL  110

Query  197  IPNPGFEV  174
            +PNPG EV
Sbjct  111  LPNPGVEV  118



>ref|XP_002886312.1| hypothetical protein ARALYDRAFT_900466 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62571.1| hypothetical protein ARALYDRAFT_900466 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 50/93 (54%), Gaps = 13/93 (14%)
 Frame = -1

Query  437  DSKNVADKKQPEFLLY---DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGR--SGAGTGAI  276
             S    D K P+FL+      T+LIPG GR ++P K   PF  YNPVTG   +G G  + 
Sbjct  33   KSPKTTDVKHPDFLVTIEPKPTILIPGVGRFLLPPKCKKPFYPYNPVTGAPLTGGGIPSY  92

Query  275  NPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFE  177
            N        G  A   T +PG DDT++PNPGFE
Sbjct  93   N-------GGQGAGPRTQLPGGDDTLVPNPGFE  118



>ref|NP_565490.1| putative cell wall protein [Arabidopsis thaliana]
 sp|P47925.2|CWPX_ARATH RecName: Full=Putative cell wall protein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD20908.1| expressed protein [Arabidopsis thaliana]
 gb|ABR46230.1| At2g20870 [Arabidopsis thaliana]
 gb|AEC07089.1| putative cell wall protein [Arabidopsis thaliana]
Length=140

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 50/93 (54%), Gaps = 13/93 (14%)
 Frame = -1

Query  437  DSKNVADKKQPEFLLY---DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGR--SGAGTGAI  276
             S    D K P+FL+      T+LIPG GR ++P K   PF  YNPVTG   +G G  + 
Sbjct  33   KSPKTTDVKHPDFLVTIEPKPTILIPGVGRFLLPPKCKKPFYPYNPVTGAPLTGGGIPSY  92

Query  275  NPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFE  177
            N        G  A   T +PG DDT++PNPGFE
Sbjct  93   N-------GGQGAGPHTQLPGGDDTLVPNPGFE  118



>ref|XP_006298774.1| hypothetical protein CARUB_v10014876mg [Capsella rubella]
 gb|EOA31672.1| hypothetical protein CARUB_v10014876mg [Capsella rubella]
Length=140

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 50/93 (54%), Gaps = 13/93 (14%)
 Frame = -1

Query  437  DSKNVADKKQPEFLLY---DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGR--SGAGTGAI  276
             S   AD K P+FL+      T+LIPG GR ++P K   PF  YNPVTG   +G G  + 
Sbjct  33   KSPKTADVKHPDFLVTIEPKPTILIPGVGRFLLPPKCKKPFYPYNPVTGAPLTGGGIPSY  92

Query  275  NPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFE  177
            N        G      T +PG DDT++PNPG+E
Sbjct  93   N-------GGQGTGPRTQLPGGDDTLVPNPGYE  118



>ref|XP_010488981.1| PREDICTED: putative cell wall protein [Camelina sativa]
Length=140

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 13/92 (14%)
 Frame = -1

Query  434  SKNVADKKQPEFLLY---DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGR--SGAGTGAIN  273
            S    D K P+FL+      T+LIPG GR ++P K   PF  YNPVTG   +G G  + N
Sbjct  34   SPKTTDVKHPDFLVTIEPKPTILIPGVGRFLLPPKCKKPFYPYNPVTGAPLTGGGIPSYN  93

Query  272  PIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFE  177
                    G  A   T +PG DDT++PNPG+E
Sbjct  94   -------GGQGAGPRTQLPGGDDTLVPNPGYE  118



>gb|AAF29528.1|AF213504_1 putative cell-wall P4 protein [Brassica napus]
 emb|CDX81985.1| BnaC08g36160D [Brassica napus]
Length=147

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 69/134 (51%), Gaps = 13/134 (10%)
 Frame = -1

Query  566  IHSSVFSQASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLY-  390
            + SS+ + A++ AVT+  +      L+L  +      R +P   S    D K PEFL+  
Sbjct  1    MASSLLTLAAA-AVTVMILS-----LLLGPAEQVSGLRHIPK--SHKTTDVKHPEFLVTI  52

Query  389  --DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYI  219
                T+LIPG GR ++P K   PF  YNPVTG    G G+I       G G      T +
Sbjct  53   EPKPTILIPGVGRFLLPPKCKKPFYPYNPVTGAPLTG-GSIGGQIPSFGGGQGGGARTQL  111

Query  218  PGNDDTIIPNPGFE  177
            PG DDT++PNPGFE
Sbjct  112  PGGDDTLVPNPGFE  125



>gb|AAF29529.1|AF213505_1 putative cell-wall P8 protein [Brassica napus]
 emb|CDY13854.1| BnaA09g43560D [Brassica napus]
Length=147

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 69/134 (51%), Gaps = 13/134 (10%)
 Frame = -1

Query  566  IHSSVFSQASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLY-  390
            + SS+ + A++ AVT+  +      L+L  +      R +P   S    D K PEFL+  
Sbjct  1    MASSLLTLAAA-AVTVMLLS-----LLLGPAEQVSGLRHVPK--SHKTTDVKHPEFLVTI  52

Query  389  --DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYI  219
                T+LIPG GR ++P K   PF  YNPVTG    G G+I       G G      T +
Sbjct  53   EPKPTILIPGVGRFLLPPKCKKPFYPYNPVTGAPLTG-GSIGGQIPSFGGGQGGGTRTQL  111

Query  218  PGNDDTIIPNPGFE  177
            PG DDT++PNPGFE
Sbjct  112  PGGDDTLVPNPGFE  125



>ref|XP_009117464.1| PREDICTED: putative cell wall protein [Brassica rapa]
Length=147

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 69/134 (51%), Gaps = 13/134 (10%)
 Frame = -1

Query  566  IHSSVFSQASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLY-  390
            + SS+ + A++ AVT+  +      L+L  +      R +P   S    D K PEFL+  
Sbjct  1    MASSLLTLAAA-AVTVMLLS-----LLLGPAEQVSGLRHVPK--SHKTTDVKHPEFLVTI  52

Query  389  --DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYI  219
                T+LIPG GR ++P K   PF  YNPVTG    G G+I       G G      T +
Sbjct  53   EPRPTILIPGVGRFLLPPKCKKPFYPYNPVTGAPLTG-GSIGGKIPSFGGGQGGGTRTQL  111

Query  218  PGNDDTIIPNPGFE  177
            PG DDT++PNPGFE
Sbjct  112  PGGDDTLVPNPGFE  125



>gb|KFK40465.1| hypothetical protein AALP_AA3G376500 [Arabis alpina]
Length=145

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 49/92 (53%), Gaps = 7/92 (8%)
 Frame = -1

Query  437  DSKNVADKKQPEFLLY---DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGRSGAGTGAINP  270
             S    D K PEFL+      T+LIPG GR ++P K   PF  YNPVTG    G G+I+ 
Sbjct  33   KSHKTTDVKHPEFLVTIEPKPTILIPGVGRFLLPPKCKKPFFPYNPVTGAPLTG-GSIS-  90

Query  269  IDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
               I   G      T +PG DDT++PNPG E 
Sbjct  91   -GSIPSYGGGQGTRTQLPGGDDTLVPNPGVET  121



>ref|XP_010924064.1| PREDICTED: putative cell wall protein [Elaeis guineensis]
Length=105

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 50/101 (50%), Gaps = 32/101 (32%)
 Frame = -1

Query  464  FAGRGMPNADSKNVADKKQPEFLLYDGTVLIPGFGRVVV-PHKKVDPFNYNPVTGRSGAG  288
             AGR +P +      DKKQPE    +GTVLIPG GR  +  H+K                
Sbjct  24   IAGRQVPAS-----TDKKQPECFDQEGTVLIPGIGRYTIGSHEK----------------  62

Query  287  TGAINPIDDIIG---SGNAAAGSTYIPGNDDTIIPNPGFEV  174
                    +I+G   SG AAA   YIPG DDT +PNPGFEV
Sbjct  63   -------PEIVGLDHSGPAAANGRYIPGVDDTFVPNPGFEV  96



>ref|XP_010069894.1| PREDICTED: putative cell wall protein [Eucalyptus grandis]
 gb|KCW89502.1| hypothetical protein EUGRSUZ_A01793 [Eucalyptus grandis]
Length=110

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 59/124 (48%), Gaps = 24/124 (19%)
 Frame = -1

Query  545  QASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLYDGTVLIPG  366
             AS    +L      +SIL+   S  A  GR +P   SK+V  KK    L  DG+V IPG
Sbjct  1    MASVACHSLLTWVLVVSILITVLSGHAVVGREVPKG-SKDVDMKKPDCNLGQDGSVTIPG  59

Query  365  FGRVVVPHKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNP  186
             GRV+VP     PF  +   GR+G                       YIPGNDDT+IPNP
Sbjct  60   IGRVMVPP----PFE-DASIGRAGG------------------TPRRYIPGNDDTLIPNP  96

Query  185  GFEV  174
            G+EV
Sbjct  97   GYEV  100



>gb|AFL91222.1| cell wall protein, partial [Helianthus annuus]
Length=91

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 8/79 (10%)
 Frame = -1

Query  404  EFLLYDGTVLIPGFGRVVVP--HKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAG  231
              L YD   LIPG GR + P  ++  +P  YNP+TG +    G   P    +G GN    
Sbjct  2    SLLYYDRGYLIPGVGRGITPKPNEGFNPVTYNPITGSNNGFPGITVPSVGGLGGGN----  57

Query  230  STYIPGNDDTIIPNPGFEV  174
              Y+PG DDT+IPNPGFEV
Sbjct  58   --YLPGGDDTLIPNPGFEV  74



>ref|XP_009409726.1| PREDICTED: putative cell wall protein [Musa acuminata subsp. 
malaccensis]
Length=108

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 56/104 (54%), Gaps = 24/104 (23%)
 Frame = -1

Query  485  LSSSHPAFAGRGMPNADSKNVADKKQPEFLLYDGTVLIPGFGRVVVPHKKVDPFNYNPVT  306
            +S +  A AGR +P A+S    D K+ EFL ++GTVLIPG GR ++   ++  F      
Sbjct  20   ISVAQVALAGRKVP-ANS----DTKETEFLGHEGTVLIPGIGRYMIGSHEMPGFRG----  70

Query  305  GRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
                        +D  I    AAA   Y+PGNDDT +PNPG+EV
Sbjct  71   ------------LDHSI---PAAATGKYLPGNDDTFVPNPGYEV  99



>gb|KHN41142.1| Putative cell wall protein [Glycine soja]
Length=127

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 66/125 (53%), Gaps = 18/125 (14%)
 Frame = -1

Query  533  MAVTLRFICAFL---SILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLL-YDGTVLIPG  366
            MA  + F  A +   +IL+L ++    AGR +   ++ N  +KK+PEFL  ++G V IPG
Sbjct  1    MAFKVSFFLALVLVSNILLLDTTA---AGRSI--GENSNTEEKKEPEFLFKHEGGVYIPG  55

Query  365  FGRVVVPHK-KVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPN  189
             G V  PHK  + P N  P    +G    A            +  GS+Y+PG DDT +PN
Sbjct  56   IGPVGFPHKFHLTPQNPLPGGNGNGGAGTAT--------GSGSPPGSSYVPGGDDTFVPN  107

Query  188  PGFEV  174
            PG+EV
Sbjct  108  PGYEV  112



>gb|AFL91218.1| cell wall protein, partial [Helianthus annuus]
 gb|AFL91224.1| cell wall protein, partial [Helianthus annuus]
Length=91

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 8/77 (10%)
 Frame = -1

Query  398  LLYDGTVLIPGFGRVVVP--HKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGST  225
            L YD   LIPG GR + P  ++  +P  YNP+TG +    G   P    +G GN      
Sbjct  4    LYYDRGYLIPGVGRGITPKPNEGFNPVTYNPITGSNNGFPGITVPSVGGLGGGN------  57

Query  224  YIPGNDDTIIPNPGFEV  174
            Y+PG DDT+IPNPGFEV
Sbjct  58   YLPGGDDTLIPNPGFEV  74



>gb|AFL91221.1| cell wall protein, partial [Helianthus annuus]
Length=88

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 8/77 (10%)
 Frame = -1

Query  398  LLYDGTVLIPGFGRVVVP--HKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGST  225
            L YD   LIPG GR + P  ++  +P  YNP+TG +    G   P    +G GN      
Sbjct  1    LYYDRGYLIPGVGRGITPKPNEGFNPVTYNPITGSNNGFPGITVPSVGGLGGGN------  54

Query  224  YIPGNDDTIIPNPGFEV  174
            Y+PG DDT+IPNPGFEV
Sbjct  55   YLPGGDDTLIPNPGFEV  71



>gb|EYU26134.1| hypothetical protein MIMGU_mgv11b013521mg [Erythranthe guttata]
Length=132

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 61/115 (53%), Gaps = 10/115 (9%)
 Frame = -1

Query  512  ICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFL-LYDGTVLIPGFGRVVVPHKK  336
               FLSI  L   H     R +P AD+K      QPE+   +D +VLIPG GRV++P K 
Sbjct  11   FVVFLSIY-LVVHHATVEARNIP-ADAK-----LQPEWFGHFDRSVLIPGIGRVMLPPKG  63

Query  335  VD-PFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
                FNY+P+TG +  G G   P           +  +Y+PG DDT++PNPG EV
Sbjct  64   SHFNFNYDPITG-APNGNGVSIPGVGGGDPAGGGSPRSYVPGGDDTLLPNPGVEV  117



>ref|XP_003527446.1| PREDICTED: putative cell wall protein-like [Glycine max]
Length=127

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 66/125 (53%), Gaps = 18/125 (14%)
 Frame = -1

Query  533  MAVTLRFICAFL---SILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLL-YDGTVLIPG  366
            MA  + F  A +   +IL+L ++    AGR +   ++ N  +KK+PEFL  ++G V IPG
Sbjct  1    MAFKVSFFLALVLVSNILLLDTTA---AGRSI--GENSNSEEKKEPEFLFKHEGGVYIPG  55

Query  365  FGRVVVPHK-KVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPN  189
             G V  PHK  + P N  P    +G    A            +  GS+Y+PG DDT +PN
Sbjct  56   IGPVGFPHKFHLTPQNPLPGGNGNGGAGTAT--------GSGSPPGSSYVPGGDDTFVPN  107

Query  188  PGFEV  174
            PG+EV
Sbjct  108  PGYEV  112



>gb|AFL91220.1| cell wall protein, partial [Helianthus annuus]
 gb|AFL91225.1| cell wall protein, partial [Helianthus annuus]
Length=87

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 8/77 (10%)
 Frame = -1

Query  398  LLYDGTVLIPGFGRVVVP--HKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGST  225
            L YD   LIPG GR + P  ++  +P  YNP+TG +    G   P    +G GN      
Sbjct  1    LYYDRGYLIPGVGRGITPKPNEGFNPVTYNPITGSNNGFPGITVPSVGGLGGGN------  54

Query  224  YIPGNDDTIIPNPGFEV  174
            Y+PG DDT+IPNPGFEV
Sbjct  55   YLPGGDDTLIPNPGFEV  71



>ref|XP_010657269.1| PREDICTED: putative cell wall protein [Vitis vinifera]
Length=122

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 66/125 (53%), Gaps = 19/125 (15%)
 Frame = -1

Query  545  QASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLY-DGTVLIP  369
             A S+  +L  +    ++L+      A A R +PN DSK V DKKQPE+ +  DG++LIP
Sbjct  1    MAHSLQASLIALLVIFNVLLGQ----AIAAREVPN-DSKKV-DKKQPEWFIEPDGSLLIP  54

Query  368  GFGRVVVPHKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPN  189
            G GRV+VP       +Y P  G   +G+            G+     +YIPG DDT +PN
Sbjct  55   GLGRVMVPGYG----SYTPYDGSIPSGSSGS--------DGSTGGTGSYIPGGDDTFVPN  102

Query  188  PGFEV  174
            PG E+
Sbjct  103  PGVEI  107



>emb|CAN68917.1| hypothetical protein VITISV_000181 [Vitis vinifera]
Length=122

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 66/125 (53%), Gaps = 19/125 (15%)
 Frame = -1

Query  545  QASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLY-DGTVLIP  369
             A S+  +L  +    ++L+      A A R +PN DSK V DKKQPE+ +  DG++LIP
Sbjct  1    MAHSLQASLIALLVIFNVLLGQ----AIAAREVPN-DSKKV-DKKQPEWFIEPDGSLLIP  54

Query  368  GFGRVVVPHKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPN  189
            G GRV+VP       +Y P  G   +G+            G+     +YIPG DDT +PN
Sbjct  55   GLGRVMVPGYG----SYTPYDGSIPSGSSGS--------DGSTGGTGSYIPGGDDTFVPN  102

Query  188  PGFEV  174
            PG E+
Sbjct  103  PGVEI  107



>ref|XP_008230254.1| PREDICTED: putative cell wall protein [Prunus mume]
Length=129

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 62/114 (54%), Gaps = 20/114 (18%)
 Frame = -1

Query  500  LSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLL-YDGTVLIPGFGRVVVP--HKKV-  333
            L +++L+ +  A AGR +P  D     DKKQPE+ + +DG+ LIPG GRV+ P  H  V 
Sbjct  15   LLVVLLAITGQAVAGRSVPTKD-----DKKQPEWFIGHDGSHLIPGIGRVIFPPLHNVVP  69

Query  332  -DPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
              PF  N  TG +G       P          + G  Y+PG DDT +PNPG+EV
Sbjct  70   QTPFPDNGSTGNTGGSGSGEAP----------STGHDYVPGGDDTFVPNPGYEV  113



>dbj|BAJ34926.1| hypothetical protein [Vitis hybrid cultivar]
Length=122

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 66/125 (53%), Gaps = 19/125 (15%)
 Frame = -1

Query  545  QASSMAVTLRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLY-DGTVLIP  369
             A S+  +L  +    ++L+      A A R +PN DSK V DKKQPE+ +  DG++LIP
Sbjct  1    MAHSLQASLIALLVIFNVLLGQ----AIAAREVPN-DSKKV-DKKQPEWFIEPDGSLLIP  54

Query  368  GFGRVVVPHKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPN  189
            G GRV+VP       +Y P  G   +G+            G+     +YIPG DDT +PN
Sbjct  55   GVGRVMVPGYG----SYTPYGGSIPSGSSGS--------DGSTGGTGSYIPGGDDTFVPN  102

Query  188  PGFEV  174
            PG E+
Sbjct  103  PGVEI  107



>ref|XP_006657849.1| PREDICTED: putative cell wall protein-like [Oryza brachyantha]
Length=118

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 50/103 (49%), Gaps = 30/103 (29%)
 Frame = -1

Query  461  AGRGMPNADSKNVA----DKKQPEFLLYDGTVLIPGFGRVVVPHKKVDPFNYNPVTGRSG  294
            A R +P  + K  A    D KQPE LL++GTVL+PG GR  +        NY P      
Sbjct  28   AARSVPAEEKKTAAAGGEDVKQPE-LLHEGTVLVPGLGRFELGS------NYVP------  74

Query  293  AGTGAINPIDDIIG---SGNAAAGSTYIPGNDDTIIPNPGFEV  174
                      DI G   S  AA    Y+PG DDT +PNPGFEV
Sbjct  75   ----------DITGFDHSVPAAESGQYLPGADDTWVPNPGFEV  107



>ref|NP_001236803.1| uncharacterized protein LOC100305796 precursor [Glycine max]
 gb|ACU13656.1| unknown [Glycine max]
 gb|KHN36616.1| Putative cell wall protein [Glycine soja]
Length=124

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 46/90 (51%), Gaps = 24/90 (27%)
 Frame = -1

Query  428  NVADKKQPEFLLY-DGTVLIPGFGRVVVPHKKVDPF----NYNPVTGRSGAGTGAINPID  264
            N  DKK+P+FL   +G    PGFG V +P     PF      NP TG SG G+G      
Sbjct  37   NNGDKKEPQFLFPPEGNFHFPGFGGVGLP-----PFFGFTPQNPNTGGSGLGSGP-----  86

Query  263  DIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
                     AG  Y+PG DDT +PNPGFEV
Sbjct  87   ---------AGRGYVPGGDDTFVPNPGFEV  107



>gb|KDP24168.1| hypothetical protein JCGZ_25825 [Jatropha curcas]
Length=117

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 60/121 (50%), Gaps = 29/121 (24%)
 Frame = -1

Query  521  LRFICAFLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLYDGTVLIPGFGRVVVPH  342
            L  I  F+   +L+ S  A  GR  P   SK+V D KQPE+L  D + LIPG GR ++P 
Sbjct  7    LSLIALFI---LLAISGQALGGRHTPKK-SKDV-DVKQPEWLTSDRSFLIPGIGREMLPP  61

Query  341  K-KVDPF----NYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFE  177
              ++ P+     Y+P  G  GAGTG                    +PG DDT IPNPG E
Sbjct  62   SIQIPPYLNVPAYDPYVGI-GAGTG------------------NDLPGGDDTTIPNPGVE  102

Query  176  V  174
            V
Sbjct  103  V  103



>ref|XP_010268764.1| PREDICTED: putative cell wall protein [Nelumbo nucifera]
Length=118

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (55%), Gaps = 23/113 (20%)
 Frame = -1

Query  506  AFLSI-LVLSSSHPAFAGRGMPNADSKNVADKKQPEFLL-YDGTVLIPGFGRVVVPHKKV  333
            +FL I ++L+++    A R +P     +V D+K P+F + +DG V+IPG GRV VP    
Sbjct  12   SFLVITILLATTQLTSAVRNLPTTTKTDV-DRKHPDFFVDHDGGVVIPGVGRVTVPS---  67

Query  332  DPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
                     GR G+   + +P    IG G   A + YIPG DDT +PNPG E+
Sbjct  68   --------LGRGGS---SFSP---YIGGG---ANNQYIPGLDDTFVPNPGVEI  103



>gb|AFL91217.1| cell wall protein, partial [Helianthus annuus]
 gb|AFL91223.1| cell wall protein, partial [Helianthus annuus]
Length=90

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = -1

Query  398  LLYDGTVLIPGFGRVVVP--HKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGST  225
            L YD    IPG GR + P  ++  +P  YNP+TG +    G   P    +G GN      
Sbjct  4    LYYDRGYXIPGVGRGITPKPNEGFNPVTYNPITGSNNGFPGITVPSVGGLGGGN------  57

Query  224  YIPGNDDTIIPNPGFEV  174
            Y+PG DDT+IPNPGFEV
Sbjct  58   YLPGGDDTLIPNPGFEV  74



>ref|XP_002517961.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44479.1| conserved hypothetical protein [Ricinus communis]
Length=120

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 53/107 (50%), Gaps = 32/107 (30%)
 Frame = -1

Query  467  AFAGRGMPNADSKNVADKKQPEFLLY-DGTVLIPGFGRVVVP--------HKKVDPFNYN  315
            A AGR +P  +SK++ D KQPEFL   D + LIPG GRV+VP        H  +   +Y+
Sbjct  22   ALAGRQLP-LNSKDI-DVKQPEFLFKSDRSFLIPGIGRVLVPPHPYLSIPHPHLSIPSYS  79

Query  314  PVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
            P                       +  G +YIPG DDT +PNPGFE 
Sbjct  80   PPA---------------------SIGGGSYIPGGDDTFVPNPGFET  105



>gb|AFL91219.1| cell wall protein, partial [Helianthus annuus]
Length=87

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = -1

Query  398  LLYDGTVLIPGFGRVVVP--HKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGST  225
            L YD    IPG GR + P  ++  +P  YNP+TG +    G   P    +G GN      
Sbjct  1    LYYDRGYXIPGVGRGITPKPNEGFNPVTYNPITGSNNGFPGITVPSVGGLGGGN------  54

Query  224  YIPGNDDTIIPNPGFEV  174
            Y+PG DDT+IPNPGFEV
Sbjct  55   YLPGGDDTLIPNPGFEV  71



>gb|ABI48859.1| LLA-115 [Lilium longiflorum]
 gb|ACD93462.1| tapetum-specific protein LLA-115 [Lilium longiflorum]
Length=112

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 50/97 (52%), Gaps = 19/97 (20%)
 Frame = -1

Query  461  AGRGMPNADSKNVA-DKKQPEFLLYDGTVLIPGFGRVVVPHKKVDPFNYNPVTGRSGAGT  285
            +GRG+P A + N   +K   E L  +G+VLIPG GR +                  G+  
Sbjct  24   SGRGVPVAAAANKKVEKVNKECLDQEGSVLIPGIGRYM-----------------KGSHE  66

Query  284  GAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
            G I    D+  SG AA    YIPGNDDT +PNPGFEV
Sbjct  67   G-IPSFIDLDHSGPAAVSGHYIPGNDDTFVPNPGFEV  102



>gb|AFL91216.1| cell wall protein, partial [Helianthus annuus]
Length=87

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = -1

Query  398  LLYDGTVLIPGFGRVVVP--HKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGST  225
            L YD    IPG GR + P  ++  +P  YNP+TG +    G   P    +G GN      
Sbjct  1    LYYDRGYXIPGVGRGITPKPNEGFNPVTYNPITGSNNGFPGITVPSVGGLGGGN------  54

Query  224  YIPGNDDTIIPNPGFEV  174
            Y+PG DDT+IPNPGFEV
Sbjct  55   YLPGGDDTLIPNPGFEV  71



>ref|XP_010555133.1| PREDICTED: putative cell wall protein [Tarenaya hassleriana]
Length=129

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 51/96 (53%), Gaps = 11/96 (11%)
 Frame = -1

Query  443  NADSKNVADKKQPEFLLY---DGTVLIPGFGRVVVPHKKVDPF-NYNPVTGR--SGAGTG  282
            N   K+  D K P+FL+      TVL+PG GR ++P K   PF  YNPVTG   +G   G
Sbjct  22   NGKRKD-PDVKHPDFLVTIEPQPTVLVPGLGRYLLPPKCKKPFYPYNPVTGAPLTGGSIG  80

Query  281  AINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
               P       G      T IPG DDT++PNPG+EV
Sbjct  81   GQIPYG----GGQGTGTRTQIPGGDDTLVPNPGYEV  112



>ref|XP_007149876.1| hypothetical protein PHAVU_005G106200g [Phaseolus vulgaris]
 gb|ESW21870.1| hypothetical protein PHAVU_005G106200g [Phaseolus vulgaris]
Length=158

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 71/152 (47%), Gaps = 41/152 (27%)
 Frame = -1

Query  533  MAVTLRFICAFLSI--LVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLY-DGTVLIPGF  363
            MA  L  + AFL I  ++L+++    A R     +S   ADKK+P+FL   DG   IPGF
Sbjct  1    MASKLSSLLAFLLITTILLATTWQGVARRHTKPKNSHK-ADKKEPQFLFPPDG--YIPGF  57

Query  362  GRVVVPHKKVDPF----NYNPVTGR---------SGAGTG-----------AINPIDDII  255
            GR+  P     PF      NP TG          SG G+G            + P   + 
Sbjct  58   GRLGFP-----PFFGFTPQNPNTGGGGVVEPEPVSGGGSGLEPAPVSGDGSGVEPAP-VS  111

Query  254  GSGNA-----AAGSTYIPGNDDTIIPNPGFEV  174
            G GN       +G  Y+PG DDT +PNPGFEV
Sbjct  112  GGGNGLDSPPVSGGGYVPGGDDTFVPNPGFEV  143



>gb|EEE67428.1| hypothetical protein OsJ_24772 [Oryza sativa Japonica Group]
Length=161

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 46/99 (46%), Gaps = 25/99 (25%)
 Frame = -1

Query  455  RGMPNADSKNVA-----DKKQPEFLLYDGTVLIPGFGRVVVPHKKVDPFNYNPVTGRSGA  291
            R +P  + K  A     D KQPE   ++GTVLIPG GR  +                   
Sbjct  72   RSVPAEEKKTAAPVAAADVKQPE-TFHEGTVLIPGLGRFEL-------------------  111

Query  290  GTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
            G+  +  I  +  S  AA    ++PG DDT +PNPGFEV
Sbjct  112  GSTYVPDITGVDHSVPAAEHGQFLPGADDTWVPNPGFEV  150



>ref|NP_001142886.1| uncharacterized protein LOC100275299 precursor [Zea mays]
 gb|ACG27311.1| hypothetical protein [Zea mays]
Length=110

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (49%), Gaps = 20/94 (21%)
 Frame = -1

Query  455  RGMPNADSKNVADKKQPEFLLYDGTVLIPGFGRVVVPHKKVDPFNYNPVTGRSGAGTGAI  276
            R +P    + V D K+P+  L++GTVLIPG GR  +                   G+  I
Sbjct  26   RPVPAQQQQAVEDVKRPD-TLHEGTVLIPGMGRYEI-------------------GSHYI  65

Query  275  NPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
              I  +  S  AA    ++PG DDT +PNPGFEV
Sbjct  66   PDIGGLDHSIPAATHGQFLPGADDTWVPNPGFEV  99



>ref|NP_001060015.1| Os07g0565800 [Oryza sativa Japonica Group]
 dbj|BAC79668.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21929.1| Os07g0565800 [Oryza sativa Japonica Group]
 dbj|BAG88461.1| unnamed protein product [Oryza sativa Japonica Group]
Length=117

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 46/99 (46%), Gaps = 25/99 (25%)
 Frame = -1

Query  455  RGMPNADSKNVA-----DKKQPEFLLYDGTVLIPGFGRVVVPHKKVDPFNYNPVTGRSGA  291
            R +P  + K  A     D KQPE   ++GTVLIPG GR  +                   
Sbjct  28   RSVPAEEKKTAAPVAAADVKQPE-TFHEGTVLIPGLGRFEL-------------------  67

Query  290  GTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
            G+  +  I  +  S  AA    ++PG DDT +PNPGFEV
Sbjct  68   GSTYVPDITGVDHSVPAAEHGQFLPGADDTWVPNPGFEV  106



>ref|XP_006841706.1| hypothetical protein AMTR_s00003p00252710 [Amborella trichopoda]
 gb|ERN03381.1| hypothetical protein AMTR_s00003p00252710 [Amborella trichopoda]
Length=120

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 44/84 (52%), Gaps = 14/84 (17%)
 Frame = -1

Query  422  ADKKQPEFLL-YDGTVLIPGFGRVVVPHKKVDPFNYNPVTGRSGAGTGAINPIDDIIGSG  246
            ADKK+PE+ +  DG+ LIPG GRV+VP      F   P        +G    +    G  
Sbjct  36   ADKKEPEWFIDKDGSKLIPGIGRVMVPS-----FGGFP--------SGIPGFLGGGNGIV  82

Query  245  NAAAGSTYIPGNDDTIIPNPGFEV  174
              ++   Y PG DDT +PNPG+EV
Sbjct  83   GGSSPGGYTPGGDDTSVPNPGYEV  106



>gb|AFK34490.1| unknown [Lotus japonicus]
Length=127

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 49/94 (52%), Gaps = 15/94 (16%)
 Frame = -1

Query  440  ADSKNVADKKQPEFLL-YDGTVLIPGFGRVVVPHKK----VDPFNYNPVTGRSGAGTGAI  276
            A + N  DKK+PEFL  +DG V IPG G V  P K      +PF        +GAG G+ 
Sbjct  29   AMNSNTQDKKEPEFLFKHDGRVYIPGVGPVGFPPKHGLIPQNPFTGGAGRAGTGAGAGSG  88

Query  275  NPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
            +             G +Y+PG DDT +PNPG+EV
Sbjct  89   S----------GRPGRSYVPGGDDTFVPNPGYEV  112



>dbj|BAJ92216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=108

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 52/110 (47%), Gaps = 23/110 (21%)
 Frame = -1

Query  503  FLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLYDGTVLIPGFGRVVVPHKKVDPF  324
             L++LV ++     A R +P A  +     K+PE    +GTVLIPG GR  +        
Sbjct  10   ILAVLVAAACS-GSAARDVPRASKEGAV--KRPE-TFQEGTVLIPGIGRYEL--------  57

Query  323  NYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
                       G+  +  I  +  S  AAA   +IPG DDT +PNPGFEV
Sbjct  58   -----------GSHHMPDIGGLDHSIPAAASGQFIPGADDTWVPNPGFEV  96



>ref|XP_006491637.1| PREDICTED: putative cell wall protein-like [Citrus sinensis]
Length=179

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 55/111 (50%), Gaps = 21/111 (19%)
 Frame = -1

Query  503  FLSILVLSSSHPAFAGRGMPNADSKNVADKKQPEFLLY-DGTVLIPGFGRVVVPHKKVDP  327
            F+  ++L+ +  A AGRG  N       D KQPE+LL  D ++LIPG GRV+ P      
Sbjct  77   FILSILLAIAGQALAGRG--NLKVARSEDMKQPEWLLKSDHSLLIPGIGRVLWP------  128

Query  326  FNYNPVTGRSGAGTGAINPIDDIIGSGNAAAGSTYIPGNDDTIIPNPGFEV  174
                      G GT A +P      +G   A   +IPG DDT  PNPG EV
Sbjct  129  ---------PGFGT-AHSPYTGS--TGGTGASGGHIPGGDDTFDPNPGTEV  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 957208515675