BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8990_g1_i2 len=2987 path=[1:0-2049 2051:2050-2986]

Length=2987
                                                                      Score     E

ref|XP_009602255.1|  PREDICTED: probable protein phosphatase 2C 65      530   5e-175   
ref|XP_004249060.1|  PREDICTED: probable protein phosphatase 2C 65      528   2e-174   
ref|XP_006339274.1|  PREDICTED: probable protein phosphatase 2C 6...    528   3e-174   
ref|XP_006363628.1|  PREDICTED: probable protein phosphatase 2C 3...    527   4e-174   
ref|XP_009782883.1|  PREDICTED: probable protein phosphatase 2C 65      526   1e-173   
ref|XP_009774873.1|  PREDICTED: aldose reductase isoform X1             519   6e-173   
ref|XP_009622508.1|  PREDICTED: probable protein phosphatase 2C 65      522   4e-172   
ref|XP_009800840.1|  PREDICTED: probable protein phosphatase 2C 65      519   8e-171   
ref|XP_011095083.1|  PREDICTED: aldose reductase                        504   3e-167   
ref|XP_006360831.1|  PREDICTED: aldose reductase-like                   503   9e-167   
ref|XP_010423981.1|  PREDICTED: aldose reductase-like                   490   1e-161   
ref|XP_010683600.1|  PREDICTED: aldose reductase                        489   3e-161   
ref|XP_010451950.1|  PREDICTED: aldose reductase-like isoform X2        488   5e-161   
ref|XP_010490521.1|  PREDICTED: aldose reductase-like                   484   2e-159   
ref|XP_010257009.1|  PREDICTED: aldose reductase-like                   484   4e-159   
ref|XP_010451949.1|  PREDICTED: aldose reductase-like isoform X1        482   2e-158   
ref|XP_006290105.1|  hypothetical protein CARUB_v10003758mg             482   2e-158   
ref|XP_010325777.1|  PREDICTED: LOW QUALITY PROTEIN: aldose reduc...    482   3e-158   
ref|XP_009615561.1|  PREDICTED: aldose reductase                        479   3e-157   
ref|XP_002873000.1|  hypothetical protein ARALYDRAFT_486904             479   3e-157   
gb|KFK24642.1|  hypothetical protein AALP_AA8G006300                    478   1e-156   
ref|NP_195787.2|  putative aldose reductase                             476   2e-156   Arabidopsis thaliana [mouse-ear cress]
emb|CDP19942.1|  unnamed protein product                                474   3e-155   
ref|XP_006398594.1|  hypothetical protein EUTSA_v10016020mg             473   6e-155   
ref|XP_004249617.2|  PREDICTED: probable protein phosphatase 2C 65      475   1e-154   
ref|XP_009774874.1|  PREDICTED: aldose reductase isoform X2             471   1e-154   
ref|XP_004492510.1|  PREDICTED: aldose reductase-like                   469   1e-153   
emb|CAB82283.1|  aldose reductase-like protein                          468   4e-153   Arabidopsis thaliana [mouse-ear cress]
gb|AES79630.2|  aldo/keto reductase family oxidoreductase               468   5e-153   
emb|CDX80756.1|  BnaC03g00100D                                          467   9e-153   
emb|CDP19943.1|  unnamed protein product                                471   2e-152   
gb|KHN29558.1|  Aldose reductase                                        466   3e-152   
ref|XP_009130640.1|  PREDICTED: aldose reductase                        464   2e-151   
emb|CDY11185.1|  BnaA03g00210D                                          463   2e-151   
ref|XP_003623412.1|  Aldose reductase-like protein                      463   2e-151   
ref|XP_011077507.1|  PREDICTED: probable protein phosphatase 2C 65      467   5e-151   
ref|XP_010264523.1|  PREDICTED: aldose reductase-like                   462   5e-151   
ref|XP_003533681.1|  PREDICTED: aldose reductase-like                   462   7e-151   
ref|NP_850750.1|  putative aldose reductase                             463   8e-151   Arabidopsis thaliana [mouse-ear cress]
gb|EYU41970.1|  hypothetical protein MIMGU_mgv1a017784mg                465   3e-150   
gb|KCW88233.1|  hypothetical protein EUGRSUZ_A00624                     460   4e-150   
ref|XP_006654539.1|  PREDICTED: aldose reductase-like                   460   4e-150   
ref|XP_004137688.1|  PREDICTED: aldose reductase-like                   459   7e-150   
ref|XP_003551585.1|  PREDICTED: aldose reductase-like                   459   8e-150   
gb|EMS53537.1|  Aldose reductase                                        459   9e-150   
ref|XP_008442354.1|  PREDICTED: aldose reductase isoform X2             459   4e-149   
sp|P23901.1|ALDR_HORVU  RecName: Full=Aldose reductase; Short=AR;...    457   7e-149   Hordeum vulgare [barley]
ref|XP_011095082.1|  PREDICTED: probable protein phosphatase 2C 65      460   2e-148   
ref|XP_004156631.1|  PREDICTED: LOW QUALITY PROTEIN: aldose reduc...    456   2e-148   
ref|XP_010038232.1|  PREDICTED: aldose reductase                        455   5e-148   
ref|XP_006429499.1|  hypothetical protein CICLE_v10013844mg             455   5e-148   
emb|CAA88322.1|  aldose reductase                                       454   1e-147   Hordeum vulgare [barley]
ref|NP_001055826.1|  Os05g0474600                                       453   2e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568253.1|  PREDICTED: aldose reductase                        452   3e-147   
pdb|2BGQ|A  Chain A, Apo Aldose Reductase From Barley                   451   2e-146   
gb|EMT03679.1|  Aldose reductase                                        449   5e-146   
ref|XP_007140187.1|  hypothetical protein PHAVU_008G091300g             449   5e-146   
gb|AAC49138.1|  aldose reductase-related protein                        447   4e-145   Avena fatua
ref|XP_008799819.1|  PREDICTED: aldose reductase-like isoform X2        443   2e-143   
ref|XP_002264660.1|  PREDICTED: aldose reductase                        443   2e-143   Vitis vinifera
ref|XP_009420397.1|  PREDICTED: aldose reductase                        444   3e-143   
ref|XP_006828161.1|  hypothetical protein AMTR_s00023p00097750          442   3e-143   
ref|XP_010922651.1|  PREDICTED: aldose reductase-like isoform X1        440   3e-142   
ref|XP_010922658.1|  PREDICTED: aldose reductase-like                   438   2e-141   
ref|XP_004961766.1|  PREDICTED: aldose reductase-like                   433   1e-139   
ref|XP_008799821.1|  PREDICTED: aldose reductase                        432   2e-139   
gb|AAD22264.1|AF133841_1  aldose reductase ALDRXV4                      431   8e-139   Xerophyta viscosa
ref|XP_002526696.1|  protein phosphatase-2c, putative                   431   7e-137   Ricinus communis
ref|NP_001241850.1|  aldose reductase                                   426   9e-137   
gb|AAA21751.1|  aldose reductase-related protein                        425   1e-136   Bromus inermis [awnless brome grass]
ref|XP_008799818.1|  PREDICTED: aldose reductase-like isoform X1        425   5e-136   
gb|KDO63278.1|  hypothetical protein CISIN_1g045692mg                   424   1e-134   
gb|KDP22816.1|  hypothetical protein JCGZ_00403                         421   2e-133   
ref|XP_003623413.1|  Aldose reductase-like protein                      416   2e-133   
ref|XP_002264900.2|  PREDICTED: probable protein phosphatase 2C 65      421   3e-133   Vitis vinifera
gb|EPS62214.1|  hypothetical protein M569_12579                         416   1e-132   
dbj|BAJ89849.1|  predicted protein                                      414   1e-132   
ref|XP_008442353.1|  PREDICTED: aldose reductase isoform X1             416   1e-132   
emb|CAN65584.1|  hypothetical protein VITISV_019794                     418   3e-132   Vitis vinifera
gb|KHN40686.1|  Hypothetical protein glysoja_001184                     417   7e-132   
ref|XP_003533680.1|  PREDICTED: probable protein phosphatase 2C 7...    417   1e-131   
gb|KHN29557.1|  Hypothetical protein glysoja_005281                     416   3e-131   
ref|XP_004305101.1|  PREDICTED: probable protein phosphatase 2C 7...    416   3e-131   
ref|XP_002309165.2|  hypothetical protein POPTR_0006s10580g             416   7e-131   Populus trichocarpa [western balsam poplar]
ref|XP_011019056.1|  PREDICTED: probable protein phosphatase 2C 65      414   4e-130   
ref|XP_002323635.2|  hypothetical protein POPTR_0016s13560g             412   2e-129   Populus trichocarpa [western balsam poplar]
ref|XP_011032596.1|  PREDICTED: probable protein phosphatase 2C 65      410   9e-129   
ref|XP_007140186.1|  hypothetical protein PHAVU_008G091200g             408   2e-128   
ref|XP_010922653.1|  PREDICTED: aldose reductase-like isoform X2        403   2e-128   
ref|XP_006828159.1|  hypothetical protein AMTR_s00023p00095420          404   3e-127   
ref|XP_007026551.1|  Phosphatase 2C family protein, putative            407   5e-127   
ref|XP_008464241.1|  PREDICTED: probable protein phosphatase 2C 6...    404   1e-126   
ref|XP_008370206.1|  PREDICTED: probable protein phosphatase 2C 65      404   2e-126   
ref|XP_010093563.1|  putative protein phosphatase 2C 65                 403   4e-126   
ref|XP_007206493.1|  hypothetical protein PRUPE_ppa019111mg             402   1e-125   
ref|XP_009373099.1|  PREDICTED: probable protein phosphatase 2C 65      402   2e-125   
ref|XP_006429502.1|  hypothetical protein CICLE_v10013751mg             402   4e-125   
ref|XP_004492511.1|  PREDICTED: probable protein phosphatase 2C 6...    399   5e-125   
ref|XP_006481121.1|  PREDICTED: probable protein phosphatase 2C 6...    396   1e-124   
ref|XP_010683599.1|  PREDICTED: probable protein phosphatase 2C 73      399   1e-124   
ref|XP_004148601.1|  PREDICTED: probable protein phosphatase 2C 6...    398   2e-124   
ref|XP_010264518.1|  PREDICTED: probable protein phosphatase 2C 6...    396   8e-124   
ref|XP_010264516.1|  PREDICTED: probable protein phosphatase 2C 6...    396   1e-123   
ref|XP_008244796.1|  PREDICTED: probable protein phosphatase 2C 65      397   2e-123   
ref|XP_003623414.1|  hypothetical protein MTR_7g070510                  392   4e-122   
ref|XP_008799822.1|  PREDICTED: probable protein phosphatase 2C 73      389   2e-121   
ref|XP_009410548.1|  PREDICTED: probable protein phosphatase 2C 73      389   2e-121   
ref|XP_010264517.1|  PREDICTED: probable protein phosphatase 2C 6...    389   4e-121   
ref|XP_008464240.1|  PREDICTED: probable protein phosphatase 2C 6...    390   4e-121   
ref|XP_010038346.1|  PREDICTED: probable protein phosphatase 2C 65      388   8e-121   
ref|XP_010257126.1|  PREDICTED: probable protein phosphatase 2C 73      386   3e-119   
gb|KHG17181.1|  hypothetical protein F383_23069                         382   6e-119   
ref|XP_010931503.1|  PREDICTED: probable protein phosphatase 2C 73      382   2e-118   
ref|XP_010558395.1|  PREDICTED: probable protein phosphatase 2C 6...    378   4e-118   
ref|XP_010558393.1|  PREDICTED: probable protein phosphatase 2C 6...    378   5e-118   
ref|XP_010922660.1|  PREDICTED: probable protein phosphatase 2C 7...    381   7e-118   
ref|XP_010558391.1|  PREDICTED: probable protein phosphatase 2C 6...    379   1e-117   
gb|KHN44853.1|  Hypothetical protein glysoja_024424                     368   3e-114   
emb|CBI18095.3|  unnamed protein product                                379   5e-114   
ref|XP_002325473.1|  phosphatase 2C family protein                      369   9e-113   Populus trichocarpa [western balsam poplar]
ref|XP_002514837.1|  protein phosphatase-2c, putative                   368   2e-112   Ricinus communis
ref|XP_006847475.1|  hypothetical protein AMTR_s00163p00051750          367   2e-112   
ref|XP_004514257.1|  PREDICTED: probable protein phosphatase 2C 7...    363   3e-112   
gb|KEH28819.1|  phosphatase 2C family protein                           363   3e-112   
gb|EYU39712.1|  hypothetical protein MIMGU_mgv1a008325mg                362   1e-111   
ref|XP_008777864.1|  PREDICTED: probable protein phosphatase 2C 3...    365   2e-111   
ref|XP_010907919.1|  PREDICTED: probable protein phosphatase 2C 33      364   5e-111   
ref|XP_011013066.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    364   5e-111   
ref|XP_008792186.1|  PREDICTED: probable protein phosphatase 2C 73      360   9e-111   
ref|XP_007139720.1|  hypothetical protein PHAVU_008G053700g             363   1e-110   
ref|XP_006398591.1|  hypothetical protein EUTSA_v10013781mg             359   1e-110   
ref|NP_001065952.2|  Os12g0108600                                       362   3e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010247822.1|  PREDICTED: probable protein phosphatase 2C 33      362   3e-110   
ref|XP_010673906.1|  PREDICTED: probable protein phosphatase 2C 33      360   6e-110   
gb|KDP26876.1|  hypothetical protein JCGZ_18034                         361   8e-110   
ref|XP_009406352.1|  PREDICTED: probable protein phosphatase 2C 33      357   9e-110   
ref|XP_007026553.1|  NAD(P)-linked oxidoreductase superfamily pro...    352   2e-109   
gb|ABA96190.1|  protein phosphatase 2c, putative, expressed             362   2e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011077163.1|  PREDICTED: probable protein phosphatase 2C 33      358   1e-108   
ref|XP_008441722.1|  PREDICTED: probable protein phosphatase 2C 33      357   1e-108   
ref|XP_008218455.1|  PREDICTED: probable protein phosphatase 2C 33      358   2e-108   
emb|CDY40298.1|  BnaA10g27700D                                          353   2e-108   
ref|XP_009125400.1|  PREDICTED: probable protein phosphatase 2C 6...    352   2e-108   
gb|KHG03244.1|  putative phosphatase 2C 33 -like protein                356   5e-108   
ref|XP_009122857.1|  PREDICTED: probable protein phosphatase 2C 6...    351   6e-108   
ref|XP_010463699.1|  PREDICTED: probable protein phosphatase 2C 33      356   7e-108   
ref|XP_007134631.1|  hypothetical protein PHAVU_010G063200g             350   1e-107   
gb|KDO54036.1|  hypothetical protein CISIN_1g011218mg                   354   1e-107   
ref|XP_008388813.1|  PREDICTED: probable protein phosphatase 2C 33      355   1e-107   
gb|EAY82001.1|  hypothetical protein OsI_37184                          363   1e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_010485598.1|  PREDICTED: probable protein phosphatase 2C 3...    355   1e-107   
ref|XP_006286518.1|  hypothetical protein CARUB_v10001181mg             351   2e-107   
ref|XP_006665077.1|  PREDICTED: probable protein phosphatase 2C 7...    351   2e-107   
ref|XP_009340340.1|  PREDICTED: probable protein phosphatase 2C 33      355   2e-107   
ref|XP_009340399.1|  PREDICTED: probable protein phosphatase 2C 33      355   2e-107   
ref|XP_010272535.1|  PREDICTED: probable protein phosphatase 2C 66      355   2e-107   
gb|KHG26837.1|  putative phosphatase 2C 33 -like protein                354   2e-107   
ref|XP_004302165.1|  PREDICTED: probable protein phosphatase 2C 3...    355   2e-107   
ref|XP_010451945.1|  PREDICTED: probable protein phosphatase 2C 65      350   3e-107   
dbj|BAJ88930.1|  predicted protein                                      352   3e-107   
ref|XP_007205041.1|  hypothetical protein PRUPE_ppa004533mg             355   3e-107   
ref|XP_004296680.1|  PREDICTED: probable protein phosphatase 2C 3...    352   3e-107   
gb|KDO54033.1|  hypothetical protein CISIN_1g011218mg                   354   3e-107   
ref|XP_009629131.1|  PREDICTED: probable protein phosphatase 2C 33      353   4e-107   
ref|XP_010500496.1|  PREDICTED: probable protein phosphatase 2C 33      354   4e-107   
emb|CDP04194.1|  unnamed protein product                                354   4e-107   
ref|XP_009783863.1|  PREDICTED: probable protein phosphatase 2C 33      353   4e-107   
ref|XP_006480437.1|  PREDICTED: probable protein phosphatase 2C 3...    353   5e-107   
ref|XP_010549876.1|  PREDICTED: probable protein phosphatase 2C 33      356   5e-107   
ref|XP_003552448.1|  PREDICTED: probable protein phosphatase 2C 3...    353   9e-107   
ref|XP_009416608.1|  PREDICTED: probable protein phosphatase 2C 33      351   9e-107   
ref|XP_010490517.1|  PREDICTED: probable protein phosphatase 2C 65      349   1e-106   
ref|XP_009766317.1|  PREDICTED: probable protein phosphatase 2C 52      352   1e-106   
ref|NP_001031819.1|  putative protein phosphatase 2C 65                 348   1e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870903.1|  protein phosphatase type 2C                        348   1e-106   
gb|EAZ17162.1|  hypothetical protein OsJ_32667                          350   1e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009415101.1|  PREDICTED: probable protein phosphatase 2C 33      350   1e-106   
ref|XP_007029293.1|  Phosphatase 2C family protein isoform 1            352   1e-106   
gb|ABR16400.1|  unknown                                                 353   1e-106   Picea sitchensis
ref|XP_006857543.1|  hypothetical protein AMTR_s00061p00041440          353   1e-106   
ref|NP_001065550.1|  Os11g0109000                                       350   2e-106   Oryza sativa Japonica Group [Japonica rice]
gb|ACN40371.1|  unknown                                                 353   2e-106   Picea sitchensis
ref|XP_004239696.1|  PREDICTED: probable protein phosphatase 2C 33      351   2e-106   
gb|ABR16508.1|  unknown                                                 353   2e-106   Picea sitchensis
ref|XP_008370833.1|  PREDICTED: probable protein phosphatase 2C 33      352   2e-106   
ref|XP_011084661.1|  PREDICTED: probable protein phosphatase 2C 33      352   2e-106   
ref|XP_009390619.1|  PREDICTED: probable protein phosphatase 2C 66      353   2e-106   
ref|XP_008244425.1|  PREDICTED: probable protein phosphatase 2C 33      348   3e-106   
gb|EYU39458.1|  hypothetical protein MIMGU_mgv1a005481mg                351   4e-106   
gb|EAY79673.1|  hypothetical protein OsI_34819                          348   4e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_002987553.1|  hypothetical protein SELMODRAFT_183192             350   4e-106   
ref|XP_010245945.1|  PREDICTED: probable protein phosphatase 2C 33      350   5e-106   
ref|XP_002319268.2|  phosphatase 2C family protein                      350   6e-106   Populus trichocarpa [western balsam poplar]
ref|XP_002992818.1|  hypothetical protein SELMODRAFT_187001             350   7e-106   
ref|XP_010423984.1|  PREDICTED: probable protein phosphatase 2C 65      347   7e-106   
ref|XP_006345821.1|  PREDICTED: probable protein phosphatase 2C 3...    349   1e-105   
ref|XP_004170792.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    346   2e-105   
ref|XP_009394985.1|  PREDICTED: probable protein phosphatase 2C 66      351   2e-105   
ref|XP_004140875.1|  PREDICTED: probable protein phosphatase 2C 3...    346   3e-105   
ref|XP_003534509.1|  PREDICTED: probable protein phosphatase 2C 3...    349   3e-105   
ref|XP_004977606.1|  PREDICTED: probable protein phosphatase 2C 7...    347   3e-105   
emb|CBI17615.3|  unnamed protein product                                348   3e-105   
ref|XP_010069369.1|  PREDICTED: probable protein phosphatase 2C 33      345   4e-105   
ref|XP_007222732.1|  hypothetical protein PRUPE_ppa006494mg             345   4e-105   
ref|NP_001067763.2|  Os11g0417400                                       346   4e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009118526.1|  PREDICTED: probable protein phosphatase 2C 33      347   5e-105   
gb|EEE68422.1|  hypothetical protein OsJ_26787                          345   7e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002277393.1|  PREDICTED: probable protein phosphatase 2C 33      348   7e-105   Vitis vinifera
emb|CDY53743.1|  BnaAnng12710D                                          347   8e-105   
ref|XP_006366012.1|  PREDICTED: probable protein phosphatase 2C 5...    347   9e-105   
emb|CDX88554.1|  BnaC06g39980D                                          347   1e-104   
ref|XP_010278294.1|  PREDICTED: probable protein phosphatase 2C 52      347   1e-104   
ref|XP_008445704.1|  PREDICTED: probable protein phosphatase 2C 33      344   1e-104   
ref|XP_006662878.1|  PREDICTED: probable protein phosphatase 2C 7...    345   1e-104   
ref|XP_010264521.1|  PREDICTED: probable protein phosphatase 2C 7...    343   1e-104   
ref|XP_002986464.1|  hypothetical protein SELMODRAFT_235030             346   1e-104   
ref|XP_002978948.1|  hypothetical protein SELMODRAFT_153020             346   2e-104   
ref|XP_006350422.1|  PREDICTED: probable protein phosphatase 2C 3...    350   2e-104   
ref|XP_004237585.1|  PREDICTED: probable protein phosphatase 2C 33      352   2e-104   
gb|AAV73837.1|  protein phosphatase 2c                                  347   2e-104   Medicago sativa [alfalfa]
emb|CDY33350.1|  BnaC05g12330D                                          346   2e-104   
ref|XP_010928162.1|  PREDICTED: probable protein phosphatase 2C 66      349   2e-104   
ref|XP_003624186.1|  Protein phosphatase 2c                             347   2e-104   
ref|XP_004159488.1|  PREDICTED: probable protein phosphatase 2C 6...    347   2e-104   
ref|XP_010111089.1|  putative protein phosphatase 2C 33                 346   2e-104   
ref|XP_009413563.1|  PREDICTED: probable protein phosphatase 2C 3...    347   3e-104   
ref|XP_010908969.1|  PREDICTED: probable protein phosphatase 2C 33      346   3e-104   
ref|XP_009371152.1|  PREDICTED: probable protein phosphatase 2C 33      343   3e-104   
ref|XP_009147325.1|  PREDICTED: probable protein phosphatase 2C 33      345   4e-104   
ref|XP_010529005.1|  PREDICTED: probable protein phosphatase 2C 74      349   4e-104   
emb|CDY28706.1|  BnaCnng05920D                                          347   4e-104   
ref|XP_009379076.1|  PREDICTED: probable protein phosphatase 2C 6       347   6e-104   
gb|EMS48353.1|  putative protein phosphatase 2C 73                      345   6e-104   
ref|XP_008384641.1|  PREDICTED: probable protein phosphatase 2C 6       347   6e-104   
ref|XP_009609263.1|  PREDICTED: probable protein phosphatase 2C 33      346   7e-104   
ref|XP_003539901.1|  PREDICTED: probable protein phosphatase 2C 5...    344   8e-104   
ref|XP_007023520.1|  Phosphatase 2C family protein isoform 1            345   1e-103   
ref|XP_004492843.1|  PREDICTED: probable protein phosphatase 2C 3...    345   1e-103   
ref|XP_008337529.1|  PREDICTED: probable protein phosphatase 2C 33      342   1e-103   
ref|XP_007132652.1|  hypothetical protein PHAVU_011G113300g             343   1e-103   
ref|XP_010913240.1|  PREDICTED: probable protein phosphatase 2C 66      346   1e-103   
ref|XP_009106686.1|  PREDICTED: probable protein phosphatase 2C 18      344   1e-103   
ref|XP_011039750.1|  PREDICTED: probable protein phosphatase 2C 52      343   1e-103   
ref|XP_004147974.1|  PREDICTED: probable protein phosphatase 2C 6...    345   2e-103   
ref|XP_009374430.1|  PREDICTED: probable protein phosphatase 2C 6       346   2e-103   
ref|XP_009766558.1|  PREDICTED: probable protein phosphatase 2C 33      345   2e-103   
ref|XP_011009964.1|  PREDICTED: probable protein phosphatase 2C 33      344   2e-103   
ref|XP_010268762.1|  PREDICTED: probable protein phosphatase 2C 1       343   2e-103   
gb|KEH21866.1|  phosphatase 2C family protein                           341   2e-103   
gb|KHG02830.1|  hypothetical protein F383_26202                         344   2e-103   
ref|XP_004506557.1|  PREDICTED: probable protein phosphatase 2C 5...    342   4e-103   
ref|XP_008246536.1|  PREDICTED: probable protein phosphatase 2C 6       344   4e-103   
emb|CDX92009.1|  BnaC03g33110D                                          342   4e-103   
ref|XP_008354142.1|  PREDICTED: probable protein phosphatase 2C 6       345   4e-103   
ref|XP_010440790.1|  PREDICTED: probable protein phosphatase 2C 74      342   4e-103   
ref|XP_010435503.1|  PREDICTED: probable protein phosphatase 2C 74      342   4e-103   
ref|XP_002517960.1|  protein phosphatase-2c, putative                   342   5e-103   Ricinus communis
ref|XP_006371587.1|  phosphatase 2C family protein                      342   5e-103   
ref|XP_001764662.1|  predicted protein                                  339   6e-103   
ref|XP_003605716.1|  hypothetical protein MTR_4g037470                  342   6e-103   
ref|XP_009122858.1|  PREDICTED: probable protein phosphatase 2C 6...    336   6e-103   
ref|XP_008806175.1|  PREDICTED: probable protein phosphatase 2C 66      344   6e-103   
ref|XP_008448968.1|  PREDICTED: probable protein phosphatase 2C 6       344   6e-103   
ref|XP_006283724.1|  hypothetical protein CARUB_v10004792mg             341   6e-103   
ref|XP_010070158.1|  PREDICTED: probable protein phosphatase 2C 33      343   7e-103   
ref|NP_198474.1|  putative protein phosphatase 2C 74                    341   7e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AAL31255.1|  AT5g36250/T30G6_11                                      341   7e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KHN41141.1|  Hypothetical protein glysoja_017185                     341   7e-103   
ref|XP_003621670.1|  Protein phosphatase 2c                             341   7e-103   
ref|XP_003527445.1|  PREDICTED: probable protein phosphatase 2C 5...    342   9e-103   
emb|CDY53741.1|  BnaAnng12690D                                          341   1e-102   
ref|XP_008341905.1|  PREDICTED: probable protein phosphatase 2C 52      341   1e-102   
ref|XP_009134702.1|  PREDICTED: probable protein phosphatase 2C 33      342   1e-102   
gb|KHN31949.1|  Hypothetical protein glysoja_025783                     341   1e-102   
ref|XP_010450435.1|  PREDICTED: probable protein phosphatase 2C 74      340   1e-102   
ref|XP_006659550.1|  PREDICTED: probable protein phosphatase 2C 6...    341   1e-102   
ref|XP_011085339.1|  PREDICTED: probable protein phosphatase 2C 52      341   1e-102   
ref|XP_004294864.1|  PREDICTED: probable protein phosphatase 2C 6...    343   1e-102   
ref|XP_006416840.1|  hypothetical protein EUTSA_v10007474mg             342   1e-102   
ref|XP_004138909.1|  PREDICTED: probable protein phosphatase 2C 3...    342   1e-102   
emb|CDY51537.1|  BnaA05g33370D                                          343   1e-102   
ref|XP_002868461.1|  hypothetical protein ARALYDRAFT_493662             340   2e-102   
emb|CAB82286.1|  putative protein                                       335   2e-102   
emb|CBI39869.3|  unnamed protein product                                339   2e-102   
gb|KFK30642.1|  hypothetical protein AALP_AA6G008500                    339   3e-102   
gb|KDP29523.1|  hypothetical protein JCGZ_19236                         342   3e-102   
ref|XP_006408386.1|  hypothetical protein EUTSA_v10020601mg             340   3e-102   
emb|CDP14742.1|  unnamed protein product                                340   4e-102   
ref|XP_002319366.1|  phosphatase 2C family protein                      340   4e-102   
ref|XP_011035437.1|  PREDICTED: probable protein phosphatase 2C 66      340   6e-102   
ref|XP_008676760.1|  PREDICTED: putative protein phosphatase 2C f...    341   6e-102   
emb|CDX87369.1|  BnaA07g35040D                                          340   7e-102   
ref|XP_003562890.1|  PREDICTED: probable protein phosphatase 2C 64      337   8e-102   
ref|XP_010644704.1|  PREDICTED: probable protein phosphatase 2C 6       340   8e-102   
ref|XP_010095801.1|  putative protein phosphatase 2C 52                 339   8e-102   
ref|XP_002444805.1|  hypothetical protein SORBIDRAFT_07g028300          340   9e-102   
ref|XP_007043535.1|  Phosphatase 2C 52 isoform 1                        339   9e-102   
ref|XP_010543881.1|  PREDICTED: LOW QUALITY PROTEIN: aldose reduc...    331   9e-102   
emb|CDX74239.1|  BnaA03g28080D                                          339   1e-101   
ref|XP_011045478.1|  PREDICTED: probable protein phosphatase 2C 52      338   1e-101   
ref|XP_004243332.1|  PREDICTED: probable protein phosphatase 2C 52      338   1e-101   
ref|XP_006648631.1|  PREDICTED: probable protein phosphatase 2C 1...    336   1e-101   
gb|KHG11990.1|  hypothetical protein F383_16619                         338   1e-101   
ref|XP_010100647.1|  putative protein phosphatase 2C 33                 337   1e-101   
ref|NP_195790.4|  putative protein phosphatase 2C 65                    333   1e-101   
ref|NP_001060016.1|  Os07g0566200                                       337   2e-101   
ref|XP_006395907.1|  hypothetical protein EUTSA_v10004207mg             337   2e-101   
gb|EAY76091.1|  hypothetical protein OsI_04016                          337   2e-101   
gb|AAL32574.1|  putative protein phosphatase-2C (PP2C)                  339   2e-101   
ref|XP_003576070.2|  PREDICTED: probable protein phosphatase 2C 75      337   2e-101   
ref|NP_186924.1|  putative protein phosphatase 2C 33                    338   2e-101   
emb|CDY04832.1|  BnaAnng00140D                                          350   2e-101   
gb|KDP24167.1|  hypothetical protein JCGZ_25824                         338   2e-101   
ref|XP_006357501.1|  PREDICTED: probable protein phosphatase 2C 5...    338   2e-101   
ref|XP_009623039.1|  PREDICTED: probable protein phosphatase 2C 52      337   2e-101   
emb|CDY63003.1|  BnaAnng18490D                                          337   2e-101   
ref|XP_009619304.1|  PREDICTED: probable protein phosphatase 2C 52      338   3e-101   
ref|XP_004973821.1|  PREDICTED: probable protein phosphatase 2C 6...    339   3e-101   
gb|AFW83059.1|  putative protein phosphatase 2C family protein          338   3e-101   
tpg|DAA47842.1|  TPA: putative protein phosphatase 2C family protein    339   3e-101   
ref|XP_009413564.1|  PREDICTED: probable protein phosphatase 2C 3...    338   3e-101   
ref|XP_009124235.1|  PREDICTED: probable protein phosphatase 2C 74      336   3e-101   
ref|XP_009149058.1|  PREDICTED: probable protein phosphatase 2C 6       338   3e-101   
emb|CDY35072.1|  BnaA06g10820D                                          338   3e-101   
ref|XP_004978569.1|  PREDICTED: probable protein phosphatase 2C 7...    339   3e-101   
ref|XP_004975270.1|  PREDICTED: probable protein phosphatase 2C 1...    339   3e-101   
ref|NP_001147784.1|  LOC100281394                                       338   4e-101   
ref|XP_010556832.1|  PREDICTED: probable protein phosphatase 2C 52      337   4e-101   
ref|XP_004136816.1|  PREDICTED: probable protein phosphatase 2C 5...    337   5e-101   
ref|XP_008455336.1|  PREDICTED: probable protein phosphatase 2C 5...    337   5e-101   
gb|EPS70212.1|  hypothetical protein M569_04548                         337   6e-101   
ref|XP_006658703.1|  PREDICTED: probable protein phosphatase 2C 6...    335   6e-101   
ref|NP_001152031.1|  LOC100285668                                       338   6e-101   
emb|CDY37649.1|  BnaC04g29910D                                          335   7e-101   
ref|XP_010089720.1|  putative protein phosphatase 2C 6                  337   7e-101   
ref|XP_002884336.1|  phosphatase 2C family protein                      337   7e-101   
ref|NP_001130320.1|  uncharacterized protein LOC100191414               335   8e-101   
ref|XP_010472827.1|  PREDICTED: probable protein phosphatase 2C 18      337   9e-101   
ref|XP_010689685.1|  PREDICTED: probable protein phosphatase 2C 52      336   1e-100   
ref|XP_004248152.1|  PREDICTED: probable protein phosphatase 2C 52      335   1e-100   
ref|XP_009415964.1|  PREDICTED: probable protein phosphatase 2C 33      334   1e-100   
gb|EYU26137.1|  hypothetical protein MIMGU_mgv1a005757mg                335   2e-100   
ref|XP_007149875.1|  hypothetical protein PHAVU_005G106100g             335   2e-100   
gb|KDO40767.1|  hypothetical protein CISIN_1g012129mg                   335   2e-100   
ref|XP_010657270.1|  PREDICTED: probable protein phosphatase 2C 52      335   2e-100   
ref|XP_011095667.1|  PREDICTED: probable protein phosphatase 2C 6       337   2e-100   
ref|XP_002305698.2|  phosphatase 2C family protein                      335   3e-100   
emb|CBI28905.3|  unnamed protein product                                334   3e-100   
ref|XP_011007021.1|  PREDICTED: probable protein phosphatase 2C 6       336   3e-100   
ref|XP_010924065.1|  PREDICTED: probable protein phosphatase 2C 64      335   3e-100   
ref|XP_006447330.1|  hypothetical protein CICLE_v10015132mg             334   4e-100   
dbj|BAJ88000.1|  predicted protein                                      332   4e-100   
ref|XP_008230255.1|  PREDICTED: probable protein phosphatase 2C 52      334   5e-100   
ref|XP_004952485.1|  PREDICTED: probable protein phosphatase 2C 1...    336   5e-100   
ref|XP_007215329.1|  hypothetical protein PRUPE_ppa005246mg             334   6e-100   
ref|XP_006297511.1|  hypothetical protein CARUB_v10013536mg             335   6e-100   
gb|KEH29533.1|  catalytic/protein phosphatase type 2C                   334   6e-100   
ref|XP_010429862.1|  PREDICTED: probable protein phosphatase 2C 1...    335   7e-100   
ref|NP_173072.1|  putative protein phosphatase 2C 6                     334   7e-100   
ref|XP_009776219.1|  PREDICTED: probable protein phosphatase 2C 52      333   8e-100   
ref|XP_010061374.1|  PREDICTED: probable protein phosphatase 2C 6       335   9e-100   
ref|XP_002889260.1|  phosphatase 2C family protein                      334   1e-99    
ref|XP_006301326.1|  hypothetical protein CARUB_v10021735mg             334   1e-99    
ref|XP_009401502.1|  PREDICTED: probable protein phosphatase 2C 66      335   1e-99    
ref|XP_002300600.2|  hypothetical protein POPTR_0001s47730g             335   1e-99    
ref|XP_006306059.1|  hypothetical protein CARUB_v10011374mg             333   1e-99    
gb|KCW84581.1|  hypothetical protein EUGRSUZ_B01420                     332   1e-99    
gb|KDO73929.1|  hypothetical protein CISIN_1g011968mg                   333   1e-99    
ref|XP_010476727.1|  PREDICTED: probable protein phosphatase 2C 6       333   2e-99    
ref|XP_003552650.1|  PREDICTED: probable protein phosphatase 2C 3...    332   2e-99    
dbj|BAJ88611.1|  predicted protein                                      331   2e-99    
gb|KDO73930.1|  hypothetical protein CISIN_1g011968mg                   332   2e-99    
ref|XP_008799820.1|  PREDICTED: aldose reductase-like isoform X3        325   3e-99    
ref|XP_003543347.1|  PREDICTED: probable protein phosphatase 2C 5...    332   3e-99    
gb|KHN13836.1|  Hypothetical protein glysoja_016120                     331   3e-99    
ref|XP_004958055.1|  PREDICTED: probable protein phosphatase 2C 6...    330   4e-99    
gb|EMT27153.1|  Putative protein phosphatase 2C 64                      330   4e-99    
gb|EPS66665.1|  hypothetical protein M569_08112                         333   4e-99    
ref|XP_007205060.1|  hypothetical protein PRUPE_ppa004458mg             333   4e-99    
ref|XP_010928896.1|  PREDICTED: probable protein phosphatase 2C 66      334   4e-99    
ref|NP_178081.2|  putative protein phosphatase 2C 18                    333   4e-99    
ref|XP_009128377.1|  PREDICTED: probable protein phosphatase 2C 1...    332   5e-99    
ref|XP_002463038.1|  hypothetical protein SORBIDRAFT_02g036610          330   5e-99    
ref|XP_002529215.1|  protein phosphatase-2c, putative                   332   6e-99    
gb|EAZ04367.1|  hypothetical protein OsI_26509                          330   6e-99    
emb|CDP13625.1|  unnamed protein product                                333   8e-99    
ref|XP_006474744.1|  PREDICTED: probable protein phosphatase 2C 6...    332   8e-99    
ref|XP_006452792.1|  hypothetical protein CICLE_v10007997mg             333   8e-99    
ref|XP_008782938.1|  PREDICTED: probable protein phosphatase 2C 6...    333   1e-98    
ref|XP_008678656.1|  PREDICTED: probable protein phosphatase 2C 75      330   1e-98    
ref|XP_002890154.1|  phosphatase 2C family protein                      331   1e-98    
gb|KEH39098.1|  catalytic/protein phosphatase type 2C                   330   1e-98    
ref|XP_002892170.1|  predicted protein                                  330   1e-98    
ref|NP_001046835.1|  Os02g0471500                                       332   1e-98    
ref|XP_010045969.1|  PREDICTED: probable protein phosphatase 2C 33      332   2e-98    
ref|NP_001141275.1|  putative protein phosphatase 2C family protein     330   2e-98    
ref|XP_009618055.1|  PREDICTED: probable protein phosphatase 2C 6       331   2e-98    
ref|XP_010457365.1|  PREDICTED: probable protein phosphatase 2C 1       330   3e-98    
dbj|BAK00637.1|  predicted protein                                      331   3e-98    
ref|XP_004487307.1|  PREDICTED: probable protein phosphatase 2C 5...    328   3e-98    
ref|XP_002448876.1|  hypothetical protein SORBIDRAFT_05g000750          329   4e-98    
emb|CDX89881.1|  BnaA10g02010D                                          327   4e-98    
ref|XP_006418222.1|  hypothetical protein EUTSA_v10007577mg             328   6e-98    
ref|XP_009357075.1|  PREDICTED: probable protein phosphatase 2C 52      328   6e-98    
ref|XP_006307438.1|  hypothetical protein CARUB_v10009068mg             328   8e-98    
dbj|BAB84699.1|  protein phosphatase 2C                                 326   8e-98    
ref|XP_010474982.1|  PREDICTED: probable protein phosphatase 2C 1       328   1e-97    
ref|XP_004304122.1|  PREDICTED: probable protein phosphatase 2C 5...    327   2e-97    
ref|XP_010921096.1|  PREDICTED: probable protein phosphatase 2C 6...    329   2e-97    
ref|XP_010238816.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    327   2e-97    
ref|XP_010482259.1|  PREDICTED: probable protein phosphatase 2C 1       327   2e-97    
ref|XP_003540353.1|  PREDICTED: probable protein phosphatase 2C 5...    327   2e-97    
ref|XP_008379553.1|  PREDICTED: probable protein phosphatase 2C 52      327   3e-97    
gb|KHN04271.1|  Hypothetical protein glysoja_037951                     327   3e-97    
gb|AFK36323.1|  unknown                                                 326   3e-97    
ref|XP_001764661.1|  predicted protein                                  327   3e-97    
ref|XP_008777865.1|  PREDICTED: probable protein phosphatase 2C 3...    326   3e-97    
emb|CDY51389.1|  BnaC08g46260D                                          325   3e-97    
gb|KHG10565.1|  hypothetical protein F383_11203                         327   3e-97    
ref|XP_002283583.1|  PREDICTED: probable protein phosphatase 2C 34      323   4e-97    
ref|XP_004492043.1|  PREDICTED: probable protein phosphatase 2C 3...    326   4e-97    
gb|KHG21938.1|  putative phosphatase 2C 73 -like protein                322   6e-97    
ref|NP_171856.4|  putative protein phosphatase 2C 1                     325   6e-97    
ref|NP_001150759.1|  LOC100284392                                       325   6e-97    
emb|CDY15466.1|  BnaA08g27500D                                          324   7e-97    
ref|XP_006346061.1|  PREDICTED: probable protein phosphatase 2C 6...    327   9e-97    
gb|KGN45988.1|  hypothetical protein Csa_6G041730                       322   1e-96    
gb|EYU27523.1|  hypothetical protein MIMGU_mgv1a004849mg                327   1e-96    
ref|XP_010035700.1|  PREDICTED: probable protein phosphatase 2C 52      325   1e-96    
emb|CDY69821.1|  BnaCnng65520D                                          322   2e-96    
ref|XP_002458047.1|  hypothetical protein SORBIDRAFT_03g026120          324   2e-96    
ref|XP_004497423.1|  PREDICTED: probable protein phosphatase 2C 3...    320   2e-96    
ref|XP_008348116.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    324   2e-96    
ref|XP_008800138.1|  PREDICTED: probable protein phosphatase 2C 64      324   3e-96    
ref|XP_009627195.1|  PREDICTED: probable protein phosphatase 2C 6       325   4e-96    
ref|XP_010459160.1|  PREDICTED: probable protein phosphatase 2C 6       324   4e-96    
gb|KHG02727.1|  putative phosphatase 2C 73 -like protein                319   5e-96    
ref|XP_008668080.1|  PREDICTED: LOC100284392 isoform X1                 322   5e-96    
ref|XP_009121881.1|  PREDICTED: probable protein phosphatase 2C 52      323   5e-96    
emb|CDY21964.1|  BnaC09g00700D                                          322   8e-96    
emb|CDY48559.1|  BnaA09g01550D                                          322   8e-96    
ref|XP_010522631.1|  PREDICTED: probable protein phosphatase 2C 52      323   8e-96    
ref|XP_009793154.1|  PREDICTED: probable protein phosphatase 2C 6       324   9e-96    
ref|XP_003574715.1|  PREDICTED: probable protein phosphatase 2C 66      324   1e-95    
ref|NP_001062155.1|  Os08g0500300                                       324   1e-95    
ref|XP_004248325.1|  PREDICTED: probable protein phosphatase 2C 6       325   1e-95    
ref|XP_004243998.1|  PREDICTED: probable protein phosphatase 2C 6       323   1e-95    
ref|XP_009119530.1|  PREDICTED: probable protein phosphatase 2C 1       321   2e-95    
gb|EAY93570.1|  hypothetical protein OsI_15356                          317   2e-95    
gb|EMS49236.1|  putative protein phosphatase 2C 66                      324   2e-95    
ref|XP_002872779.1|  hypothetical protein ARALYDRAFT_490221             322   2e-95    
ref|XP_009411656.1|  PREDICTED: probable protein phosphatase 2C 73      317   2e-95    
ref|XP_001753087.1|  predicted protein                                  322   3e-95    
ref|XP_002453807.1|  hypothetical protein SORBIDRAFT_04g018090          323   3e-95    
ref|XP_009787955.1|  PREDICTED: probable protein phosphatase 2C 6...    322   4e-95    
ref|XP_008775900.1|  PREDICTED: probable protein phosphatase 2C 34      317   4e-95    
ref|XP_006396571.1|  hypothetical protein EUTSA_v10028637mg             321   4e-95    
emb|CAH66334.1|  OSIGBa0097I24.2                                        320   5e-95    
ref|NP_001052465.1|  Os04g0321800                                       320   5e-95    
ref|XP_002512471.1|  protein phosphatase 2c, putative                   317   6e-95    
ref|XP_006573387.1|  PREDICTED: probable protein phosphatase 2C 3...    313   7e-95    
ref|XP_010537844.1|  PREDICTED: probable protein phosphatase 2C 6       322   8e-95    
emb|CDY49740.1|  BnaA02g19320D                                          339   8e-95    
gb|EAZ30201.1|  hypothetical protein OsJ_14258                          319   9e-95    
ref|XP_006433478.1|  hypothetical protein CICLE_v10001565mg             315   2e-94    
ref|XP_003554628.1|  PREDICTED: probable protein phosphatase 2C 7...    315   2e-94    
ref|XP_009384412.1|  PREDICTED: probable protein phosphatase 2C 34      314   3e-94    
ref|XP_006352576.1|  PREDICTED: probable protein phosphatase 2C 6...    321   3e-94    
ref|NP_001030625.1|  putative protein phosphatase 2C 33                 320   4e-94    
ref|XP_008679738.1|  PREDICTED: probable protein phosphatase 2C 1...    319   4e-94    
ref|XP_010259459.1|  PREDICTED: probable protein phosphatase 2C 73      314   5e-94    
ref|XP_006472147.1|  PREDICTED: probable protein phosphatase 2C 7...    314   5e-94    
gb|KDO81764.1|  hypothetical protein CISIN_1g015633mg                   314   6e-94    
ref|XP_010431054.1|  PREDICTED: probable protein phosphatase 2C 52      317   7e-94    
ref|XP_002441691.1|  hypothetical protein SORBIDRAFT_08g000810          317   8e-94    
ref|XP_007031061.1|  Phosphatase 2C family protein isoform 1            314   9e-94    
ref|XP_008775678.1|  PREDICTED: probable protein phosphatase 2C 34      313   9e-94    
ref|XP_010235433.1|  PREDICTED: probable protein phosphatase 2C 14      318   1e-93    
ref|XP_006287679.1|  hypothetical protein CARUB_v10000888mg             316   2e-93    
ref|NP_680572.4|  putative protein phosphatase 2C 52                    316   2e-93    
gb|KHN15576.1|  Hypothetical protein glysoja_039360                     316   2e-93    
ref|XP_009418745.1|  PREDICTED: probable protein phosphatase 2C 64      316   2e-93    
ref|XP_009111151.1|  PREDICTED: probable protein phosphatase 2C 1       315   3e-93    
ref|XP_010455891.1|  PREDICTED: probable protein phosphatase 2C 52      315   4e-93    
gb|AAF68125.1|AC010793_20  F20B17.6                                     317   4e-93    
ref|NP_001169432.1|  putative protein phosphatase 2C family protein     317   5e-93    
ref|XP_010422463.1|  PREDICTED: probable protein phosphatase 2C 52      315   6e-93    
gb|KHN03955.1|  Hypothetical protein glysoja_022641                     311   6e-93    
ref|XP_003591185.1|  hypothetical protein MTR_1g083690                  311   7e-93    
gb|KHG01784.1|  hypothetical protein F383_10634                         310   2e-92    
ref|XP_010921599.1|  PREDICTED: probable protein phosphatase 2C 73      309   2e-92    
ref|XP_002315485.1|  hypothetical protein POPTR_0010s00840g             310   2e-92    
gb|EMS65364.1|  putative protein phosphatase 2C 14                      310   4e-92    
ref|XP_006389865.1|  hypothetical protein EUTSA_v10018625mg             311   5e-92    
gb|KDO54035.1|  hypothetical protein CISIN_1g011218mg                   310   6e-92    
ref|XP_007035669.1|  Phosphatase 2C family protein isoform 1            309   6e-92    
ref|XP_004494566.1|  PREDICTED: probable protein phosphatase 2C 7...    309   6e-92    
ref|XP_011010711.1|  PREDICTED: probable protein phosphatase 2C 72      308   7e-92    
ref|XP_007142603.1|  hypothetical protein PHAVU_007G001500g             310   7e-92    
ref|XP_008799206.1|  PREDICTED: probable protein phosphatase 2C 6...    311   1e-91    



>ref|XP_009602255.1| PREDICTED: probable protein phosphatase 2C 65 [Nicotiana tomentosiformis]
Length=450

 Score =   530 bits (1365),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 257/401 (64%), Positives = 321/401 (80%), Gaps = 15/401 (4%)
 Frame = +2

Query  452   MGACCTCQRVKK--REVYRVknaenkeereadeeHD-----GIVGRGDFGARVRLHGSSR  610
             MGACCTCQRV+   +E YR    E KEE++     D        G+GDFGA +RLHG S+
Sbjct  1     MGACCTCQRVRHFDQENYRHHFVEEKEEKDIIIVEDDNYNGNFAGKGDFGAHIRLHGYSK  60

Query  611   FVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSV  790
             FVSMYSQQGKKG+NQDAMTVWE+FGG+KG FFCGVFDGHGPSGH+VA+++RD LP+K+S 
Sbjct  61    FVSMYSQQGKKGINQDAMTVWENFGGQKGTFFCGVFDGHGPSGHKVARYVRDLLPAKISS  120

Query  791   ASKDN-------SQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAV  949
             + K++       S + + +   +PLF+  K+ F +SFK++D  LE E  I+S+SSGTTAV
Sbjct  121   SLKESNDVSDQRSTENDDETDQNPLFATLKAAFLKSFKEMDEELEKEPSIESYSSGTTAV  180

Query  950   TLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMAT  1129
             TL K+GEHL+IGNLGDSRAI+CTRD+ +QL+ EQLTVDLKP++P E ERIKSCKGRVMA 
Sbjct  181   TLFKKGEHLLIGNLGDSRAIICTRDEKNQLISEQLTVDLKPHIPSEYERIKSCKGRVMAM  240

Query  1130  AEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGV  1309
              +EPNV+RVWMP++DCPGLAMARAFGDFCLKD+G+ISVPE++YRK++ERDEFVVLA+DGV
Sbjct  241   EQEPNVYRVWMPDEDCPGLAMARAFGDFCLKDFGLISVPEVYYRKLTERDEFVVLATDGV  300

Query  1310  WDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPML  1489
             WDVLSN EVI+ VATA+KRSMAARL+VE AVR WK KYP +K DDCAVVCLF KR +P+L
Sbjct  301   WDVLSNDEVIRIVATARKRSMAARLLVECAVRAWKYKYPRAKIDDCAVVCLFLKRQRPLL  360

Query  1490  LKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLNFK  1612
              K+MS+   L+ ++ E   N++N     +TDDGLDTLLNF+
Sbjct  361   TKSMSEVTQLSFNYTELA-NDQNYPDNTKTDDGLDTLLNFQ  400



>ref|XP_004249060.1| PREDICTED: probable protein phosphatase 2C 65 [Solanum lycopersicum]
Length=436

 Score =   528 bits (1360),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 257/400 (64%), Positives = 319/400 (80%), Gaps = 14/400 (4%)
 Frame = +2

Query  452   MGACCTCQRVKKRE----------VYRVknaenkeereadeeHDGIVGRGDFGARVRLHG  601
             MGACCTCQR  K E           +  KN  N E +E D+++  IVGRGD GA +RL G
Sbjct  1     MGACCTCQRGHKLEGKNHHKNHHSYFEEKNNNNGEHKEGDDDYQSIVGRGDLGANIRLCG  60

Query  602   SSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSK  781
              S+FVSMYSQQGKKG+NQDAMTVWE+FGG+KG  FCGVFDGHGPSGH+VA+++RD LPSK
Sbjct  61    FSKFVSMYSQQGKKGINQDAMTVWENFGGQKGMIFCGVFDGHGPSGHKVARYVRDTLPSK  120

Query  782   LSVAS--KDNSQDFEKDIH-HHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVT  952
             LS ++    N  D EKD   ++P+F  WK  F  SFK++D  LEG+  I+S+ SGTTAVT
Sbjct  121   LSSSNVISANRWDAEKDDESNNPVFDAWKDKFIMSFKEMDEELEGDGSIESYCSGTTAVT  180

Query  953   LIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATA  1132
             L+KQGEHLI+GNLGDSRAI+CTRDD ++LV +QLTVDLKPNLP E ERIKSC+GRVMA  
Sbjct  181   LVKQGEHLIVGNLGDSRAIICTRDDKNELVAKQLTVDLKPNLPAEYERIKSCEGRVMAME  240

Query  1133  EEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVW  1312
             EEPN++RVWMP+QDCPGLAMARAFGDFCLKD+G+ISVPE++YRK++E+DEF+VLASDG+W
Sbjct  241   EEPNIYRVWMPDQDCPGLAMARAFGDFCLKDFGLISVPEVYYRKLTEKDEFIVLASDGLW  300

Query  1313  DVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLL  1492
             DVLSN EVI+ VA+A+KRS+AARLVV  AVR WK KYPC+K DDCAVVCLF KR KP+L 
Sbjct  301   DVLSNNEVIRIVASARKRSIAARLVVHHAVRAWKYKYPCAKVDDCAVVCLFLKRQKPLLT  360

Query  1493  KTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLNFK  1612
             K++S+   L++++ E     +N +  ++ DDGLDTLLN++
Sbjct  361   KSLSEVTELSLNYSEIA-TSKNYSPNSKIDDGLDTLLNYQ  399



>ref|XP_006339274.1| PREDICTED: probable protein phosphatase 2C 65-like [Solanum tuberosum]
Length=452

 Score =   528 bits (1360),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 251/404 (62%), Positives = 317/404 (78%), Gaps = 18/404 (4%)
 Frame = +2

Query  452   MGACCTCQRVKK-------REVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSR  610
             MGACC+CQRV+        R    +   + ++    +++H G+VG+GDFGA +RLHG S+
Sbjct  1     MGACCSCQRVRHFDHQGNYRHHNYINGDDKEDNIIVEDDHHGVVGKGDFGANIRLHGYSK  60

Query  611   FVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSV  790
             FVSMYSQQGKKG+NQDAMTVWE+FGGEKGAFFCGVFDGHGPSGH+VA+++RD LPSK+S+
Sbjct  61    FVSMYSQQGKKGINQDAMTVWENFGGEKGAFFCGVFDGHGPSGHKVARYVRDLLPSKISI  120

Query  791   ASKD----------NSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGT  940
             + K+          N ++ E+   + PLF  WKS + +SFK++D  L  E  I+S+SSGT
Sbjct  121   SLKESDINENEIIRNIENDEESNQNFPLFDAWKSAYLKSFKEMDEQLGREPSIESYSSGT  180

Query  941   TAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRV  1120
             TAVTL KQGEHL IGNLGDSRAI+CTRD+ +QLV +QLTVDLKP+L  E ERIKSCKGRV
Sbjct  181   TAVTLFKQGEHLFIGNLGDSRAIICTRDEKNQLVSQQLTVDLKPHLLNEYERIKSCKGRV  240

Query  1121  MATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLAS  1300
             MA  +EPNV+RVWMP++DCPGLAMARAFGDFCLKDYG+IS PE++YRK++E DEFVVLA+
Sbjct  241   MAMEQEPNVYRVWMPDEDCPGLAMARAFGDFCLKDYGLISTPEVYYRKLTENDEFVVLAT  300

Query  1301  DGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPK  1480
             DGVWDVL+N EVI+ V+T +KRSMAA+ +VE AVR WK KYP +K DDC VVCLFFKR K
Sbjct  301   DGVWDVLTNDEVIRIVSTTRKRSMAAKTLVECAVRAWKYKYPRAKIDDCGVVCLFFKRQK  360

Query  1481  PMLLKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLNFK  1612
             P+L K+MS+   L+ ++ E   N++N     +TDDGLDTLLN++
Sbjct  361   PLLTKSMSEVTQLSFNYAELA-NDQNYPDNTKTDDGLDTLLNYQ  403



>ref|XP_006363628.1| PREDICTED: probable protein phosphatase 2C 33-like [Solanum tuberosum]
Length=445

 Score =   527 bits (1358),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 258/409 (63%), Positives = 322/409 (79%), Gaps = 23/409 (6%)
 Frame = +2

Query  452   MGACCTCQRVKKRE-----------------VYRVknaenkeereadeeHDGIVGRGDFG  580
             MGACCTCQR +K E                     KN  N E +E ++++  IVGRGD G
Sbjct  1     MGACCTCQRGQKLEDKNHHHHNHHHNNHHSYFGENKNNNNGEHKEGEDDYQSIVGRGDLG  60

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
             A VRL G S+FVSMYSQQGKKG+NQDAMTVWE+FGG+KG FFCGVFDGHGPSGH+VA+++
Sbjct  61    ANVRLCGFSKFVSMYSQQGKKGINQDAMTVWENFGGQKGMFFCGVFDGHGPSGHKVARYV  120

Query  761   RDRLPSKLS----VASKDNSQDFEKDIH-HHPLFSKWKSTFPQSFKDIDNALEGEEKIDS  925
             RD LPSKLS    +++ D   D EKD   ++P+F  WK  F +SFK++D  LEG+  I+S
Sbjct  121   RDSLPSKLSSSNVISANDIRWDAEKDDESNNPIFDAWKDKFIKSFKEMDEELEGDGSIES  180

Query  926   FSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKS  1105
             + SGTTAVTL+KQGEHLI+GNLGDSRAI+CTRDD ++LV +QLTVDLKPNLP E ERIKS
Sbjct  181   YCSGTTAVTLVKQGEHLIVGNLGDSRAIICTRDDKNELVAKQLTVDLKPNLPAEYERIKS  240

Query  1106  CKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEF  1285
             C+GRVMA  EEPN++RVWMP+QDCPGLAMARAFGDFCLKD+G+ISVPE++YRK++E+DEF
Sbjct  241   CEGRVMAMEEEPNIYRVWMPDQDCPGLAMARAFGDFCLKDFGLISVPEVYYRKLTEKDEF  300

Query  1286  VVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLF  1465
             +VLASDG+WDVLSN EVI+ VA+A+KRS+AARLVV  AVR WK KYPC+K DDCAVVCLF
Sbjct  301   IVLASDGLWDVLSNDEVIRIVASARKRSIAARLVVHHAVRAWKYKYPCAKVDDCAVVCLF  360

Query  1466  FKRPKPMLLKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLNFK  1612
              KR KP+L K++S+   L++++ E     +N +  ++ DDGLDTLLN++
Sbjct  361   LKRQKPLLTKSLSEVTELSLNYSEIA-TSKNYSPNSKIDDGLDTLLNYQ  408



>ref|XP_009782883.1| PREDICTED: probable protein phosphatase 2C 65 [Nicotiana sylvestris]
Length=451

 Score =   526 bits (1356),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 258/401 (64%), Positives = 320/401 (80%), Gaps = 15/401 (4%)
 Frame = +2

Query  452   MGACCTCQRVKKREV--YRVknaenkeereadeeHD-----GIVGRGDFGARVRLHGSSR  610
             MGACC+CQRV+  +   YR    E KEE++     D       VG+GDFGA +RLHG S+
Sbjct  1     MGACCSCQRVRHFDQGNYRHHFVEEKEEKDIINVEDDNYNGNFVGKGDFGAHIRLHGYSK  60

Query  611   FVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSV  790
             FVSMYSQQGKKG+NQDAMTVWE+FGG+KGAFFCGVFDGHGPSGH+VA+++RD LPSK+S 
Sbjct  61    FVSMYSQQGKKGINQDAMTVWENFGGQKGAFFCGVFDGHGPSGHKVARYVRDSLPSKISS  120

Query  791   ASKDNSQDFE-------KDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAV  949
               K+++   E        +   +PLF+  K+ F +SFK++D  LE E  I+S+SSGTTAV
Sbjct  121   LLKESNNVSEITSTENGDESDQNPLFAATKAAFLKSFKEMDEELEKEPSIESYSSGTTAV  180

Query  950   TLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMAT  1129
             TL KQ EHL+IGNLGDSRAI+CTRD+ +QL+ EQLTVDLKP++P E ERIKSCKGRVMA 
Sbjct  181   TLFKQEEHLLIGNLGDSRAIICTRDEKNQLISEQLTVDLKPHIPSEYERIKSCKGRVMAM  240

Query  1130  AEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGV  1309
              +EPNV+RVWMP++DCPGLAMARAFGDFCLKDYG+ISVPE++YRK++ERDEFVVLA+DGV
Sbjct  241   EQEPNVYRVWMPDEDCPGLAMARAFGDFCLKDYGLISVPEVYYRKLTERDEFVVLATDGV  300

Query  1310  WDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPML  1489
             WDVLSN EVI+ VATA+KRSMAA+L+VE AVR WK KYP +K DDCAVVCLF KR +P+L
Sbjct  301   WDVLSNDEVIRIVATARKRSMAAKLLVECAVRAWKYKYPRAKIDDCAVVCLFLKRQRPLL  360

Query  1490  LKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLNFK  1612
              K+MS+   L+ ++ E    ++N+   A+TDDGLDTLLNF+
Sbjct  361   TKSMSEVTQLSFNYTELA-TDQNNPENAKTDDGLDTLLNFQ  400



>ref|XP_009774873.1| PREDICTED: aldose reductase isoform X1 [Nicotiana sylvestris]
Length=319

 Score =   519 bits (1337),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 242/318 (76%), Positives = 278/318 (87%), Gaps = 0/318 (0%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKVQHPRDNVYAAIVEGGYRHVDTAAQYG  2741
             MAQMT+  +NEK+  F LLSGH IPAIGLGTW+ ++ +D+VY AIVE GYRHVDTAA+YG
Sbjct  1     MAQMTIDPQNEKIEYFELLSGHKIPAIGLGTWRAENAKDSVYTAIVEAGYRHVDTAAEYG  60

Query  2740  VQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIH  2561
             VQ+ VG G+KAAI AGVER +LF+TSKL CTDLSP+RVRPALM TL ELQ DYLDL+LIH
Sbjct  61    VQEEVGRGIKAAIQAGVERSSLFLTSKLCCTDLSPERVRPALMKTLNELQQDYLDLYLIH  120

Query  2560  WPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAK  2381
             WPF LK+GASRPPKAGEVS F+ EGVWREMEKLV DKLVRDIGVCN TV KLNKLL IA+
Sbjct  121   WPFRLKDGASRPPKAGEVSDFNWEGVWREMEKLVRDKLVRDIGVCNLTVRKLNKLLDIAQ  180

Query  2380  IKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKSP  2201
             I PSVCQMEMHPGWRN+KM +ACK NNIHVTAYSPLGS E DL+H+ +VE+VA K+NKS 
Sbjct  181   IMPSVCQMEMHPGWRNEKMFEACKKNNIHVTAYSPLGSREIDLLHHTVVERVARKVNKSA  240

Query  2200  GQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMF  2021
             GQVLV+W IQRGTSTIPKS+H+ RIKENI VF WEIP+QDF+AL  IPDQ RVLDGE++F
Sbjct  241   GQVLVRWGIQRGTSTIPKSDHSERIKENIKVFSWEIPEQDFQALCDIPDQARVLDGEELF  300

Query  2020  VNKTDGPFKNVADLWDHE  1967
             VNKTDGP+++VAD+WDHE
Sbjct  301   VNKTDGPYRSVADIWDHE  318



>ref|XP_009622508.1| PREDICTED: probable protein phosphatase 2C 65 [Nicotiana tomentosiformis]
Length=447

 Score =   522 bits (1345),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 252/405 (62%), Positives = 321/405 (79%), Gaps = 19/405 (5%)
 Frame = +2

Query  452   MGACCTCQRVKKRE-----------VYRVknaenkeereadeeHDGIVGRGDFGARVRLH  598
             MGACCTCQR +  E            +      N E++E ++++  IVGRGD GA VRL 
Sbjct  1     MGACCTCQRGQNFEGKHHNHNHNNNHHNYYEENNGEQKEIEDDYQSIVGRGDLGANVRLC  60

Query  599   GSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPS  778
             G S+FVSMYSQQGKKG+NQDAMTVWE+FGG+KG FFCGVFDGHGPSGH+VA+++RD LPS
Sbjct  61    GFSKFVSMYSQQGKKGINQDAMTVWENFGGQKGMFFCGVFDGHGPSGHKVARYVRDFLPS  120

Query  779   KLSVASKDNSQ-----DFEKDIH--HHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSG  937
             K+S  + + S      D EKD    ++P F+ WK  F +SFK++D  LEG+  I+S+ SG
Sbjct  121   KISSYNNEISTNSIRWDVEKDDDEAYNPYFAAWKDKFLKSFKEMDQELEGDGSIESYCSG  180

Query  938   TTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGR  1117
             TTAVTL+KQGEHLI+GNLGDSRAI+CTRDD ++LV +QLTVDLKPNLP E ERI+SC+GR
Sbjct  181   TTAVTLVKQGEHLIVGNLGDSRAIICTRDDKNELVSQQLTVDLKPNLPAEYERIRSCEGR  240

Query  1118  VMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLA  1297
             VMA  EEP+V+RVWMP+QDCPGLAMARAFGDFCLKD+G+ISVPE++YRK++E+DEF+VLA
Sbjct  241   VMAMEEEPSVYRVWMPDQDCPGLAMARAFGDFCLKDFGLISVPEVYYRKLTEKDEFIVLA  300

Query  1298  SDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRP  1477
             +DG+WDVLSN EVI+ VATA+KRS+AARLVV  AVR WK KYPC+K DDCAVVCLF KR 
Sbjct  301   TDGLWDVLSNDEVIRIVATARKRSIAARLVVHHAVRAWKYKYPCAKIDDCAVVCLFLKRQ  360

Query  1478  KPMLLKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLNFK  1612
             +P+L K++S+   L++++ E   ++ N+   ++ DDGLDTLLN++
Sbjct  361   RPLLTKSLSEVTELSLNYTELASSQNNTP-NSKIDDGLDTLLNYQ  404



>ref|XP_009800840.1| PREDICTED: probable protein phosphatase 2C 65 [Nicotiana sylvestris]
Length=446

 Score =   519 bits (1336),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 253/405 (62%), Positives = 318/405 (79%), Gaps = 19/405 (5%)
 Frame = +2

Query  452   MGACCTCQRVKKRE-----------VYRVknaenkeereadeeHDGIVGRGDFGARVRLH  598
             MGACCTCQR +  E            +      N E++E ++++  IVGRGD GA VRL 
Sbjct  1     MGACCTCQRGQNFEGKHHNHNHNHNHHNYYEENNGEQKEIEDDYQSIVGRGDLGANVRLC  60

Query  599   GSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPS  778
             G S+FVSMYSQQGKKG+NQDAMTVWE+FGG+KG FFCGVFDGHGPSGH+VA+++RD LPS
Sbjct  61    GFSKFVSMYSQQGKKGINQDAMTVWENFGGQKGMFFCGVFDGHGPSGHKVARYVRDFLPS  120

Query  779   KLSVASKDNSQ-----DFEKDIHH--HPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSG  937
             K+S  + + S      D EKD     +P F  W+  F +SFK++D  LEG+  I+S+ SG
Sbjct  121   KISSYNNEISTNSIRWDVEKDDSEADNPYFVAWRDKFLKSFKEMDEELEGDGSIESYCSG  180

Query  938   TTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGR  1117
             TTAVTL+KQGEHLI+GNLGDSRAI+CTRDD ++LV EQLTVDLKPNLP E ERI+SC+GR
Sbjct  181   TTAVTLVKQGEHLIVGNLGDSRAIICTRDDKNELVSEQLTVDLKPNLPAEYERIRSCEGR  240

Query  1118  VMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLA  1297
             VMA  EEP+V+RVWMP+QDCPGLAMARAFGDFCLKD+G+ISVPE++YRK++E+DEF+VLA
Sbjct  241   VMAMEEEPSVYRVWMPDQDCPGLAMARAFGDFCLKDFGLISVPEVYYRKLTEKDEFIVLA  300

Query  1298  SDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRP  1477
             SDG+WDVLSN EVI+ VATA+KRS+AARLVV  AVR WK KYPC+K DDCAVVCLF KR 
Sbjct  301   SDGLWDVLSNDEVIRIVATARKRSIAARLVVHHAVRAWKYKYPCAKVDDCAVVCLFLKRQ  360

Query  1478  KPMLLKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLNFK  1612
             +P+L K++S+   L++++ E   + +N    ++ DDGLDTLLN++
Sbjct  361   RPLLTKSLSEVTELSLNYTEL-VSSQNYTPNSKIDDGLDTLLNYQ  404



>ref|XP_011095083.1| PREDICTED: aldose reductase [Sesamum indicum]
Length=321

 Score =   504 bits (1299),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 244/321 (76%), Positives = 287/321 (89%), Gaps = 2/321 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKVQHPRDNVYAAIVEGGYRHVDTAAQYG  2741
             MAQ T+T   EKV +FRLLSGH+IPA+GLGTWK + PR++V  A+V+ GYRHVDTAAQYG
Sbjct  1     MAQATLTPHGEKVETFRLLSGHLIPAVGLGTWKSETPRESVCNALVQAGYRHVDTAAQYG  60

Query  2740  VQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIH  2561
             VQ+ VG G+K AIHAG++RKTLFVTSKLWCT+LSP+RVRPAL+NTL ELQLDYLDL+LIH
Sbjct  61    VQKEVGAGIKEAIHAGIDRKTLFVTSKLWCTELSPERVRPALLNTLGELQLDYLDLYLIH  120

Query  2560  WPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAK  2381
             WPF L++GA+RPPKAG+V  FDMEGVW+EMEKLV + LVRDIGVCNFT+ KLNKLL  A+
Sbjct  121   WPFRLRDGATRPPKAGDVLDFDMEGVWKEMEKLVKENLVRDIGVCNFTMKKLNKLLSFAE  180

Query  2380  IKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLNK  2207
             IKPSVCQMEMHPGWRNDKML+ACK N IHVTAYSPLGS +  RDL+H+PMVE+VA KLNK
Sbjct  181   IKPSVCQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSQDQGRDLIHDPMVERVAMKLNK  240

Query  2206  SPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGED  2027
             SPGQVLV+WAIQRGTSTIPKSNH  RI+ENI VF+WEIP++DF+AL +I DQ+RVLDGE+
Sbjct  241   SPGQVLVRWAIQRGTSTIPKSNHHERIRENIHVFEWEIPERDFQALCTISDQKRVLDGEE  300

Query  2026  MFVNKTDGPFKNVADLWDHED  1964
             +FVNKTDGPF++ AD+WDHED
Sbjct  301   LFVNKTDGPFRSTADVWDHED  321



>ref|XP_006360831.1| PREDICTED: aldose reductase-like [Solanum tuberosum]
Length=319

 Score =   503 bits (1296),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 247/318 (78%), Positives = 279/318 (88%), Gaps = 0/318 (0%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKVQHPRDNVYAAIVEGGYRHVDTAAQYG  2741
             MAQ+T+  + EK+ SF LLSGH IPAIGLGTW+  + RD+VY AIVE GYRHVDTAA+YG
Sbjct  1     MAQITIDPQGEKIESFVLLSGHKIPAIGLGTWRAHNARDSVYTAIVEAGYRHVDTAAEYG  60

Query  2740  VQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIH  2561
             VQ  VG G+KAAIHAGVER  LFVTSKLWC DLS +RVRPALM TL ELQLDYLDL+LIH
Sbjct  61    VQDEVGHGIKAAIHAGVERSALFVTSKLWCYDLSLERVRPALMKTLNELQLDYLDLYLIH  120

Query  2560  WPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAK  2381
             WPF LK+GASRPPKAGEVS FD EGVWREMEKLV DKLVRDIGVCNFTV KLNKLL IA+
Sbjct  121   WPFRLKDGASRPPKAGEVSDFDWEGVWREMEKLVKDKLVRDIGVCNFTVKKLNKLLDIAQ  180

Query  2380  IKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKSP  2201
             I PSVCQMEMHPGWRN+KML+ACK NNIHVTAYSPLGS E DL+H+P+VE+VA KLNK+P
Sbjct  181   IMPSVCQMEMHPGWRNEKMLEACKKNNIHVTAYSPLGSREVDLIHHPVVERVAGKLNKTP  240

Query  2200  GQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMF  2021
             GQVLV+WAIQRGTSTIPKS+H+ RIKENI VF WEIP+ DF+A+  IPDQ RVLDGE++F
Sbjct  241   GQVLVRWAIQRGTSTIPKSDHSERIKENIKVFSWEIPELDFQAICDIPDQMRVLDGEELF  300

Query  2020  VNKTDGPFKNVADLWDHE  1967
             VNK+DGP+K+V D+WDHE
Sbjct  301   VNKSDGPYKSVTDIWDHE  318



>ref|XP_010423981.1| PREDICTED: aldose reductase-like [Camelina sativa]
Length=322

 Score =   490 bits (1262),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 270/322 (84%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T TA  + + SFRLLSGH IPA+GLGTW+        V  A+VEGGYRH+DTA +Y
Sbjct  1     MAHATFTAEGQNMESFRLLSGHKIPAVGLGTWRSGSQATHAVVTALVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q+ VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP+RVRPAL NTL+ELQL+YLDL+LI
Sbjct  61    GDQKEVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQNTLKELQLEYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L+EGASRPPKAG+V  FDMEGVWREMEKL  D LVR+IGVCNFTV KLNKLL  A
Sbjct  121   HWPFRLREGASRPPKAGDVLDFDMEGVWREMEKLAKDNLVRNIGVCNFTVTKLNKLLGFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ PSVCQMEMHPGWRND ML+ CK N IHVTAYSPLGS E  RDL+H+  V+++A KLN
Sbjct  181   ELIPSVCQMEMHPGWRNDTMLELCKKNQIHVTAYSPLGSQEGGRDLIHDQTVDRIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKW IQRGTS IPKS +  RIKENI VFDW IP+QDF+AL+SIPDQ+RVLDGE
Sbjct  241   KTPGQVLVKWGIQRGTSAIPKSQNPDRIKENIKVFDWVIPEQDFQALNSIPDQKRVLDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNKT+GP++ VADLWDHED
Sbjct  301   DLFVNKTEGPYRTVADLWDHED  322



>ref|XP_010683600.1| PREDICTED: aldose reductase [Beta vulgaris subsp. vulgaris]
Length=324

 Score =   489 bits (1259),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 232/324 (72%), Positives = 276/324 (85%), Gaps = 5/324 (2%)
 Frame = -2

Query  2920  MAQMTVTA--RNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAA  2750
             MAQ T T   +++++  F L+SGH IPA+GLGTWK      ++V+ AI E GY HVDTA+
Sbjct  1     MAQATSTTAPQHKEMEYFPLISGHKIPAVGLGTWKSGSQAINSVFTAITEVGYMHVDTAS  60

Query  2749  QYGVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLF  2570
             QYGVQ+ VG  +KAA+ AG+ERK LF+TSKLWCTDLSP+RVRPA  NTLQELQL+YLDL+
Sbjct  61    QYGVQEEVGHAVKAAMQAGIERKHLFITSKLWCTDLSPERVRPAFNNTLQELQLEYLDLY  120

Query  2569  LIHWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLR  2390
             LIHWPFHLK+GASRPPKAGEV  FDMEGVWREMEKLV +KLVRDIGVCNFT+ KLNKLL 
Sbjct  121   LIHWPFHLKDGASRPPKAGEVMEFDMEGVWREMEKLVKEKLVRDIGVCNFTIKKLNKLLD  180

Query  2389  IAKIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANK  2216
             IA+I PSVCQMEMHPGWRNDKML+AC+ NN+HVTAYSPLGS E  RDLVH+P+V++VA K
Sbjct  181   IAQIMPSVCQMEMHPGWRNDKMLEACRKNNLHVTAYSPLGSQEGGRDLVHDPVVDRVAKK  240

Query  2215  LNKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLD  2036
             LNKSPGQ+LVKWA+QRGTS IPKS +   ++ENI VFDWEIP+QDFEAL +I +QRR LD
Sbjct  241   LNKSPGQILVKWALQRGTSVIPKSTNPDHLQENIHVFDWEIPEQDFEALCTIKNQRRELD  300

Query  2035  GEDMFVNKTDGPFKNVADLWDHED  1964
             GE++FVNK++GP  +VAD+WDHED
Sbjct  301   GENLFVNKSEGPLTSVADVWDHED  324



>ref|XP_010451950.1| PREDICTED: aldose reductase-like isoform X2 [Camelina sativa]
Length=322

 Score =   488 bits (1257),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 271/322 (84%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T TA  + + SFRLLSGH IPA+GLGTW+        V  A+VEGGYRH+DTA +Y
Sbjct  1     MAHATFTAEGQNMESFRLLSGHKIPAVGLGTWRSGSQATHAVVTALVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q+ VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP+RVRPAL NTL+ELQL+YLDL+LI
Sbjct  61    GDQKEVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQNTLKELQLEYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L+EGASRPPKAG+V  FDMEGVWREMEKL  D LVR+IGVCNFTV KLNKLL  A
Sbjct  121   HWPFRLREGASRPPKAGDVLDFDMEGVWREMEKLAKDNLVRNIGVCNFTVTKLNKLLGFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ PSVCQMEMHPGWRND ML+ CK N+IHVTAYSPLGS E  RDL+H+  V+++A KLN
Sbjct  181   ELIPSVCQMEMHPGWRNDTMLELCKKNHIHVTAYSPLGSQEGGRDLIHDQTVDRIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKW IQRGTS IPKS +  RIKENI VFDW IP+QDF+AL+SIPDQ+RVLDGE
Sbjct  241   KTPGQVLVKWGIQRGTSVIPKSLNPDRIKENIKVFDWVIPEQDFQALNSIPDQKRVLDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNKT+GP++ VADLWDHED
Sbjct  301   DLFVNKTEGPYRTVADLWDHED  322



>ref|XP_010490521.1| PREDICTED: aldose reductase-like [Camelina sativa]
Length=322

 Score =   484 bits (1247),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 228/322 (71%), Positives = 268/322 (83%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T TA  + + SFRLLSGH IPA+GLGTW+        V  A+VEGGYRH+DTA +Y
Sbjct  1     MAHATFTAEGQNMESFRLLSGHKIPAVGLGTWRSGSQATHAVVTALVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q+ VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP+RVRPAL NTL+ELQL+YLDL+LI
Sbjct  61    GDQKEVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQNTLKELQLEYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L+EGASRPPKAG+V  FDMEGVWREMEKL  D LVR IGVCNFTV KLNKLL  A
Sbjct  121   HWPFRLREGASRPPKAGDVLDFDMEGVWREMEKLAKDNLVRSIGVCNFTVTKLNKLLGFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ PSVCQMEMHPGWRND ML+ CK N IHVTAYSPLGS E  RDL+H+  V+++A KLN
Sbjct  181   ELIPSVCQMEMHPGWRNDTMLELCKRNQIHVTAYSPLGSQEGGRDLIHDQTVDRIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKW IQRGTS IPKS +  RIKENI VFDW IP+QDF+AL+SIPDQ+RV+ GE
Sbjct  241   KTPGQVLVKWGIQRGTSVIPKSQNPDRIKENIKVFDWVIPEQDFQALNSIPDQKRVMGGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVN+T+GP++ VADLWDHED
Sbjct  301   DLFVNETEGPYRTVADLWDHED  322



>ref|XP_010257009.1| PREDICTED: aldose reductase-like [Nelumbo nucifera]
Length=321

 Score =   484 bits (1245),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 269/322 (84%), Gaps = 4/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKVQHPRDN-VYAAIVEGGYRHVDTAAQY  2744
             MAQ T  A+ E   SFRLLSGHIIPA+GLGTWK      N V+ AIVE GYRHVDTA+QY
Sbjct  1     MAQSTFVAQ-EVSQSFRLLSGHIIPAVGLGTWKSGSDASNSVFTAIVEAGYRHVDTASQY  59

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQQ VG  LK AI AGV+RK LF+TSKLWC+DLSP RVRPAL NTL+ELQL+YLDL+LI
Sbjct  60    GVQQEVGYALKKAIQAGVDRKHLFITSKLWCSDLSPDRVRPALNNTLKELQLEYLDLYLI  119

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA RPP+AG+V  FDME VWREMEKLV D LVRDIG+CNF+  KL+KLL+ A
Sbjct  120   HWPFRLKDGAERPPRAGDVLEFDMEAVWREMEKLVKDNLVRDIGICNFSRTKLDKLLKFA  179

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             +IKPSVCQMEMHPGWRNDKML+AC+ N IHVTAYSPLGS E  ++LVH+P V K+A  LN
Sbjct  180   EIKPSVCQMEMHPGWRNDKMLEACRKNGIHVTAYSPLGSSEGGKELVHDPTVNKIAKNLN  239

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             KS GQVLVKW +QRGTS IPKS++  RIKENI VF WEIP QDFE LS++ DQRR+LDGE
Sbjct  240   KSSGQVLVKWGLQRGTSVIPKSSNPDRIKENIQVFGWEIPAQDFEVLSNLGDQRRILDGE  299

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             ++FVNK+DGP+++VA+LWD+ED
Sbjct  300   NLFVNKSDGPYRSVAELWDNED  321



>ref|XP_010451949.1| PREDICTED: aldose reductase-like isoform X1 [Camelina sativa]
Length=329

 Score =   482 bits (1241),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 271/329 (82%), Gaps = 10/329 (3%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T TA  + + SFRLLSGH IPA+GLGTW+        V  A+VEGGYRH+DTA +Y
Sbjct  1     MAHATFTAEGQNMESFRLLSGHKIPAVGLGTWRSGSQATHAVVTALVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q+ VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP+RVRPAL NTL+ELQL+YLDL+LI
Sbjct  61    GDQKEVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQNTLKELQLEYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L+EGASRPPKAG+V  FDMEGVWREMEKL  D LVR+IGVCNFTV KLNKLL  A
Sbjct  121   HWPFRLREGASRPPKAGDVLDFDMEGVWREMEKLAKDNLVRNIGVCNFTVTKLNKLLGFA  180

Query  2383  KIKPSVC-------QMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVE  2231
             ++ PSVC       QMEMHPGWRND ML+ CK N+IHVTAYSPLGS E  RDL+H+  V+
Sbjct  181   ELIPSVCQSVILGTQMEMHPGWRNDTMLELCKKNHIHVTAYSPLGSQEGGRDLIHDQTVD  240

Query  2230  KVANKLNKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQ  2051
             ++A KLNK+PGQVLVKW IQRGTS IPKS +  RIKENI VFDW IP+QDF+AL+SIPDQ
Sbjct  241   RIAKKLNKTPGQVLVKWGIQRGTSVIPKSLNPDRIKENIKVFDWVIPEQDFQALNSIPDQ  300

Query  2050  RRVLDGEDMFVNKTDGPFKNVADLWDHED  1964
             +RVLDGED+FVNKT+GP++ VADLWDHED
Sbjct  301   KRVLDGEDLFVNKTEGPYRTVADLWDHED  329



>ref|XP_006290105.1| hypothetical protein CARUB_v10003758mg [Capsella rubella]
 gb|EOA23003.1| hypothetical protein CARUB_v10003758mg [Capsella rubella]
Length=322

 Score =   482 bits (1240),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 226/322 (70%), Positives = 270/322 (84%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T TA  + + SFRLLSGH IPA+GLGTW+        V  A+VEGGYRH+DTA +Y
Sbjct  1     MAHATFTAEGQTMESFRLLSGHKIPAVGLGTWRSGSQATHAVVTALVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q+ VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP+RVRPAL NTL+ELQL+YLDL+LI
Sbjct  61    GDQEEVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQNTLKELQLEYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L+EGAS+PPKAG+V  FDM+GVWREME L  D LVR+IGVCNFTV KLNKLL  A
Sbjct  121   HWPFRLREGASKPPKAGDVLDFDMQGVWREMENLAKDDLVRNIGVCNFTVTKLNKLLGFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ PSVCQMEMHPGWRND ML+ C+ NNIHVTAYSPLGS E  RDL+H+  V+++A KLN
Sbjct  181   ELIPSVCQMEMHPGWRNDTMLELCRKNNIHVTAYSPLGSQEGGRDLIHDQTVDRIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKW IQRGTS IPKS +  RIKENI VFDW IP+QDF+AL+SI DQ+RV+DGE
Sbjct  241   KTPGQVLVKWGIQRGTSVIPKSLNPDRIKENIKVFDWVIPEQDFQALNSITDQKRVMDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNKT+GP+++VADLWDHED
Sbjct  301   DIFVNKTEGPYRSVADLWDHED  322



>ref|XP_010325777.1| PREDICTED: LOW QUALITY PROTEIN: aldose reductase [Solanum lycopersicum]
Length=349

 Score =   482 bits (1241),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 244/348 (70%), Positives = 279/348 (80%), Gaps = 30/348 (9%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKVQHPRDNVYAAIVEGGYRHVDTAAQYG  2741
             MAQMT+  + EK+ SF LLSGH IPAIGLGTW+  + RD+V+ AI+E GYRHVDTAA+YG
Sbjct  1     MAQMTIDPQGEKIESFVLLSGHKIPAIGLGTWRAHNARDSVFTAILEAGYRHVDTAAEYG  60

Query  2740  VQQGVGEGLKAAIHAGVERKTLFVTSKLW------------------------------C  2651
             VQ  VG G+KAAIH GVER TLF+TSKLW                              C
Sbjct  61    VQDEVGHGIKAAIHTGVERSTLFITSKLWYSLQLILNLSDFVHPPFDETNXVDFINCFRC  120

Query  2650  TDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPPKAGEVSGFDMEGVWREM  2471
              DLS +RVRPALM TL ELQLDYLDL+LIHWPF LK+GASRPPKAGEVS FD EGVW EM
Sbjct  121   CDLSTERVRPALMKTLNELQLDYLDLYLIHWPFRLKDGASRPPKAGEVSDFDWEGVWIEM  180

Query  2470  EKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQMEMHPGWRNDKMLDACKDNNIHV  2291
             EKLV DKLVRDIGVCNFTV KLNKLL IA+I PSVCQMEMHPGWRN+KML+ACK NNIHV
Sbjct  181   EKLVKDKLVRDIGVCNFTVKKLNKLLDIAEIMPSVCQMEMHPGWRNEKMLEACKKNNIHV  240

Query  2290  TAYSPLGSDERDLVHNPMVEKVANKLNKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENIS  2111
             TAYSPLGS E DL+H+P+VE+VA KLNK+ GQVLV+WAIQRGTSTIPKS+H+ RIKENI 
Sbjct  241   TAYSPLGSREVDLIHHPVVERVAGKLNKTAGQVLVRWAIQRGTSTIPKSDHSERIKENIK  300

Query  2110  VFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNVADLWDHE  1967
             VF WEIP++DF+A+  IPDQ RVLDGE++FVNK+DGP+K+VAD+WDHE
Sbjct  301   VFSWEIPEKDFQAICDIPDQMRVLDGEELFVNKSDGPYKSVADIWDHE  348



>ref|XP_009615561.1| PREDICTED: aldose reductase [Nicotiana tomentosiformis]
Length=314

 Score =   479 bits (1232),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 229/318 (72%), Positives = 266/318 (84%), Gaps = 5/318 (2%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKVQHPRDNVYAAIVEGGYRHVDTAAQYG  2741
             MAQMT+  +NEK+  F LLSGH IPAIGLGTW+ ++ +D+VY AIVE GYRHVDTAA Y 
Sbjct  1     MAQMTIDPQNEKIEYFELLSGHKIPAIGLGTWRAENAKDSVYTAIVEAGYRHVDTAAGYE  60

Query  2740  VQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIH  2561
             VQ+ V   L +AI AGVER +LFVTSKLWC DL   RV PALM +L ELQ DYLDL+L+H
Sbjct  61    VQEEVL--LISAIQAGVERSSLFVTSKLWCNDL---RVLPALMKSLNELQQDYLDLYLVH  115

Query  2560  WPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAK  2381
             WPF LK+GASRPPK GEV  FD EGVWREMEKLV DKLVRDIGVCNFTV KLNKLL IA+
Sbjct  116   WPFRLKDGASRPPKVGEVLDFDWEGVWREMEKLVTDKLVRDIGVCNFTVKKLNKLLDIAQ  175

Query  2380  IKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKSP  2201
             I PSV QMEMHPGWRN+KM +ACK N+IHVT YSPLGS E DL+H+P+VE+VA K+NKS 
Sbjct  176   IMPSVYQMEMHPGWRNEKMFEACKKNSIHVTVYSPLGSREIDLIHHPVVERVARKVNKSA  235

Query  2200  GQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMF  2021
             G+VLV+WAIQRGTSTIPKS+H+ RIKEN+ VF W IPK DF+AL  IPDQ RVLDGE++F
Sbjct  236   GKVLVRWAIQRGTSTIPKSDHSERIKENLKVFSWGIPKHDFQALCDIPDQARVLDGEELF  295

Query  2020  VNKTDGPFKNVADLWDHE  1967
             VNKTDGP+++VAD+W+HE
Sbjct  296   VNKTDGPYRSVADIWNHE  313



>ref|XP_002873000.1| hypothetical protein ARALYDRAFT_486904 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49259.1| hypothetical protein ARALYDRAFT_486904 [Arabidopsis lyrata subsp. 
lyrata]
Length=322

 Score =   479 bits (1232),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 224/322 (70%), Positives = 268/322 (83%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T T+  + + SFRLLSGH IPA+GLGTW+        V  A+VEGGYRH+DTA +Y
Sbjct  1     MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQATHAVVTALVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q+ VG+G+K A+H G+ER+ LFVTSKLWCT+LSP+RVRPAL NTL+ELQL+YLDL+LI
Sbjct  61    GDQREVGQGIKRAMHTGLERRDLFVTSKLWCTELSPERVRPALQNTLKELQLEYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L+EGAS+PPKAG+V  FDMEGVWREME L  D LVR+IGVCNFTV KLNKLL  A
Sbjct  121   HWPFRLREGASKPPKAGDVLDFDMEGVWREMENLAKDNLVRNIGVCNFTVTKLNKLLEFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ PSVCQMEMHPGWRND ML+ CK N IHVTAYSPLGS E  RDL+H+  V+++A KLN
Sbjct  181   ELIPSVCQMEMHPGWRNDTMLEFCKKNEIHVTAYSPLGSQEGGRDLIHDQTVDRIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKW +QRGTS IPKS +  RIKENI VFDW IP++DF+AL+SI DQ+RV+DGE
Sbjct  241   KTPGQVLVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPEKDFQALNSITDQKRVMDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNKT+GPF++VADLWDHED
Sbjct  301   DIFVNKTEGPFRSVADLWDHED  322



>gb|KFK24642.1| hypothetical protein AALP_AA8G006300 [Arabis alpina]
Length=322

 Score =   478 bits (1229),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 226/322 (70%), Positives = 265/322 (82%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T T   +K  SFRL SGH IPA+GLGTW+        V+ A+VEGGYRH+DTA +Y
Sbjct  1     MAHDTFTPEGQKTESFRLSSGHKIPAVGLGTWRSGSEATHAVFTALVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q  VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP RVRP L +TLQELQL+YLDLFLI
Sbjct  61    GDQTEVGQGIKRAMHAGIERRDLFVTSKLWCTELSPGRVRPVLQHTLQELQLEYLDLFLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L+ GAS+PPK G+V  FDMEGVWREMEKLV D LVR IGVCNFT+ KL KLL  A
Sbjct  121   HWPFRLRGGASKPPKEGDVLDFDMEGVWREMEKLVKDNLVRSIGVCNFTITKLYKLLEFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++KPSVCQMEMHPGWRND+ML+ CK N IHVTAYSPLGS E  RDL+H+  V+++A KLN
Sbjct  181   EVKPSVCQMEMHPGWRNDQMLEFCKMNEIHVTAYSPLGSQEGGRDLIHDQTVDRIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKW +QRGTS IP S +  RIKENI VFDWEIP+QDF+ALSSIPDQ+RV+DGE
Sbjct  241   KTPGQVLVKWGLQRGTSVIPMSLNPERIKENIKVFDWEIPEQDFKALSSIPDQKRVMDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNKT+GPF++VADLWD ED
Sbjct  301   DIFVNKTEGPFRSVADLWDRED  322



>ref|NP_195787.2| putative aldose reductase [Arabidopsis thaliana]
 dbj|BAC42643.1| putative aldose reductase [Arabidopsis thaliana]
 gb|ABN04834.1| At5g01670 [Arabidopsis thaliana]
 gb|AED90374.1| putative aldose reductase [Arabidopsis thaliana]
Length=322

 Score =   476 bits (1226),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 269/322 (84%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T T+  + + SFRLLSGH IPA+GLGTW+        V  AIVEGGYRH+DTA +Y
Sbjct  1     MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQAAHAVVTAIVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q+ VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP+RVRPAL NTL+ELQL+YLDL+LI
Sbjct  61    GDQREVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQNTLKELQLEYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWP  L+EGAS+PPKAG+V  FDMEGVWREME L  D LVR+IGVCNFTV KLNKLL  A
Sbjct  121   HWPIRLREGASKPPKAGDVLDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLGFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ P+VCQMEMHPGWRND++L+ CK N IHVTAYSPLGS E  RDL+H+  V+++A KLN
Sbjct  181   ELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLGSQEGGRDLIHDQTVDRIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQ+LVKW +QRGTS IPKS +  RIKENI VFDW IP+QDF+AL+SI DQ+RV+DGE
Sbjct  241   KTPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPEQDFQALNSITDQKRVIDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNKT+GPF++VADLWDHED
Sbjct  301   DLFVNKTEGPFRSVADLWDHED  322



>emb|CDP19942.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   474 bits (1219),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 237/323 (73%), Positives = 279/323 (86%), Gaps = 4/323 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKVQHPRDN--VYAAIVEGGYRHVDTAAQ  2747
             MAQ+T T   E++ SF+LLSGH IPA+GLGTWK   P+    VY+AIVE GYRHVDTAA+
Sbjct  1     MAQVTFTTHGERMQSFKLLSGHAIPAVGLGTWKSTSPQAQHPVYSAIVEAGYRHVDTAAE  60

Query  2746  YGVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFL  2567
             YGVQ+ VG  +  A+HAGV+RK+LFVTSKLWC DLSP+RVRPAL  +L+EL LDYLDL+L
Sbjct  61    YGVQEEVGLAINRAVHAGVDRKSLFVTSKLWCADLSPERVRPALEKSLRELHLDYLDLYL  120

Query  2566  IHWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRI  2387
             IHWPFHLKEGAS+PPK G+V  F+MEGVWREMEKLV D LVRDIGVCNFT+ KL+KLL +
Sbjct  121   IHWPFHLKEGASKPPKQGDVMEFNMEGVWREMEKLVKDNLVRDIGVCNFTLKKLSKLLGL  180

Query  2386  AKIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKL  2213
             A+I PSVCQMEMHPGWRNDKML+ACK N IHVTAYSPLGS +  RDL+H+P+VEK A KL
Sbjct  181   AQIMPSVCQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSQDHGRDLIHDPIVEKAARKL  240

Query  2212  NKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDG  2033
             NKSPGQVLV+WAIQRGTSTIPKS H  RIKENI VF+WEIP++DF+AL  +PDQ+RVLDG
Sbjct  241   NKSPGQVLVRWAIQRGTSTIPKSTHLDRIKENIRVFEWEIPEEDFQALCRVPDQKRVLDG  300

Query  2032  EDMFVNKTDGPFKNVADLWDHED  1964
             E++FVN+TDGP+K+VAD+WDHED
Sbjct  301   ENLFVNETDGPYKSVADVWDHED  323



>ref|XP_006398594.1| hypothetical protein EUTSA_v10016020mg [Eutrema salsugineum]
 gb|ESQ40047.1| hypothetical protein EUTSA_v10016020mg [Eutrema salsugineum]
Length=322

 Score =   473 bits (1217),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 232/322 (72%), Positives = 275/322 (85%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T T   ++  SFRLLSGH IPA+GLGTW+   H   +V+ A+VEGGYRH+DTA +Y
Sbjct  1     MAHATFTPEGQQTESFRLLSGHKIPAVGLGTWRSGSHATHSVFTALVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q+ VG+G+K A+HAG+ER+ LFVTSKLWCT+LSPQRVRPAL NTLQELQLDYLDL+LI
Sbjct  61    GDQKEVGQGMKRAMHAGIERRDLFVTSKLWCTELSPQRVRPALQNTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L+EGASRPPKAG+V  FDMEGVWREMEKLV D LVR+IGVCNFT+ KLNKLL +A
Sbjct  121   HWPFRLREGASRPPKAGDVLDFDMEGVWREMEKLVKDNLVRNIGVCNFTITKLNKLLGMA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ PSVCQMEMHPGWRND+ML  CK+N IHVTAYSPLGS +  RDL+H+  V+++A KLN
Sbjct  181   ELIPSVCQMEMHPGWRNDQMLQLCKENEIHVTAYSPLGSQQGGRDLIHDQTVDRIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKW +QRGTS IPKS +  RIKENI VFDW IP+QDF+ALSSI DQ+RV+DGE
Sbjct  241   KTPGQVLVKWGLQRGTSVIPKSLNPDRIKENIKVFDWVIPEQDFQALSSITDQKRVMDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNKT+GPF++VADLWDHED
Sbjct  301   DIFVNKTEGPFRSVADLWDHED  322



>ref|XP_004249617.2| PREDICTED: probable protein phosphatase 2C 65 [Solanum lycopersicum]
Length=389

 Score =   475 bits (1222),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 223/341 (65%), Positives = 276/341 (81%), Gaps = 11/341 (3%)
 Frame = +2

Query  620   MYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK  799
             MYSQQGKKG+NQDAMTVWE+FGGEKGAFFCGVFDGHGP GH+VA+++RD LPSK+S++ K
Sbjct  1     MYSQQGKKGINQDAMTVWENFGGEKGAFFCGVFDGHGPLGHKVARYVRDMLPSKISISLK  60

Query  800   D----------NSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAV  949
             +          N ++ E+   + PLF  WKS + +SFK++D  L  E  I+S+SSGTTAV
Sbjct  61    ECDINKNKIIENIENDEEFDQNFPLFDAWKSAYLKSFKEMDEQLGSEPSIESYSSGTTAV  120

Query  950   TLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMAT  1129
             TL KQ EHL IGNLGDSRAI+CTRD+ +QLV +QLTVDLKP+LP E ERIKSCKGRVMA 
Sbjct  121   TLFKQREHLFIGNLGDSRAIICTRDEKNQLVSKQLTVDLKPHLPNEYERIKSCKGRVMAM  180

Query  1130  AEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGV  1309
              +EPNV+RVWMP++DCPGLAMARAFGDFCLKDYG+ISVPE++YRK++E DEFVVLA+DG+
Sbjct  181   EQEPNVYRVWMPDEDCPGLAMARAFGDFCLKDYGLISVPEVYYRKLTENDEFVVLATDGI  240

Query  1310  WDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPML  1489
             WDVL+N EVI+ V+T +KRSMAA+ +VE AVR WK KYP +K DDC VVCLFFKR KP+L
Sbjct  241   WDVLTNDEVIRIVSTTRKRSMAAKTLVECAVRAWKYKYPRAKIDDCGVVCLFFKRQKPLL  300

Query  1490  LKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLNFK  1612
              K+MS+   L+ ++ E   N +N     +TDDGLDTLLN++
Sbjct  301   TKSMSEVTQLSFNYAELANN-QNYPDNTKTDDGLDTLLNYQ  340



>ref|XP_009774874.1| PREDICTED: aldose reductase isoform X2 [Nicotiana sylvestris]
Length=296

 Score =   471 bits (1212),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 221/290 (76%), Positives = 251/290 (87%), Gaps = 0/290 (0%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKVQHPRDNVYAAIVEGGYRHVDTAAQYG  2741
             MAQMT+  +NEK+  F LLSGH IPAIGLGTW+ ++ +D+VY AIVE GYRHVDTAA+YG
Sbjct  1     MAQMTIDPQNEKIEYFELLSGHKIPAIGLGTWRAENAKDSVYTAIVEAGYRHVDTAAEYG  60

Query  2740  VQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIH  2561
             VQ+ VG G+KAAI AGVER +LF+TSKL CTDLSP+RVRPALM TL ELQ DYLDL+LIH
Sbjct  61    VQEEVGRGIKAAIQAGVERSSLFLTSKLCCTDLSPERVRPALMKTLNELQQDYLDLYLIH  120

Query  2560  WPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAK  2381
             WPF LK+GASRPPKAGEVS F+ EGVWREMEKLV DKLVRDIGVCN TV KLNKLL IA+
Sbjct  121   WPFRLKDGASRPPKAGEVSDFNWEGVWREMEKLVRDKLVRDIGVCNLTVRKLNKLLDIAQ  180

Query  2380  IKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKSP  2201
             I PSVCQMEMHPGWRN+KM +ACK NNIHVTAYSPLGS E DL+H+ +VE+VA K+NKS 
Sbjct  181   IMPSVCQMEMHPGWRNEKMFEACKKNNIHVTAYSPLGSREIDLLHHTVVERVARKVNKSA  240

Query  2200  GQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQ  2051
             GQVLV+W IQRGTSTIPKS+H+ RIKENI VF WEIP+QDF+AL  IPDQ
Sbjct  241   GQVLVRWGIQRGTSTIPKSDHSERIKENIKVFSWEIPEQDFQALCDIPDQ  290



>ref|XP_004492510.1| PREDICTED: aldose reductase-like [Cicer arietinum]
Length=321

 Score =   469 bits (1207),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 234/322 (73%), Positives = 275/322 (85%), Gaps = 4/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ  V     K  SF LLSG+ IPAIGLGTWK      ++V+ AIVE GYRHVDTAAQY
Sbjct  1     MAQ-NVKPHEPKTQSFNLLSGNSIPAIGLGTWKSGSQAINSVFTAIVEAGYRHVDTAAQY  59

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ+ VG  L++AI AGVERK LF+TSK+WCTDL+P+RVRPAL NTLQELQLDYLDL+LI
Sbjct  60    GVQEEVGHALQSAIQAGVERKDLFITSKIWCTDLTPERVRPALNNTLQELQLDYLDLYLI  119

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GASRPPKAGEV  FDMEGVWREMEKLV + LV+DIG+CNFT+ KL+KLL +A
Sbjct  120   HWPFRLKDGASRPPKAGEVMEFDMEGVWREMEKLVKENLVKDIGICNFTLTKLDKLLNVA  179

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             +I PSVCQMEMHPGWRNDKML+ACK+N IHVTAYSPLGS +  RDL+H+  V+++A KLN
Sbjct  180   QILPSVCQMEMHPGWRNDKMLEACKNNGIHVTAYSPLGSSDGGRDLIHDQTVDRIAKKLN  239

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             KSPGQVLVKWAIQRGTS IPKS ++ RIKEN+ VF+W++P+QDF+ LS+I DQRRVLDGE
Sbjct  240   KSPGQVLVKWAIQRGTSVIPKSTNSDRIKENVVVFNWQVPEQDFKNLSNIQDQRRVLDGE  299

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             ++FVNK DGPFK+VAD+WDHED
Sbjct  300   ELFVNKNDGPFKSVADIWDHED  321



>emb|CAB82283.1| aldose reductase-like protein [Arabidopsis thaliana]
Length=320

 Score =   468 bits (1204),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 267/322 (83%), Gaps = 5/322 (2%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T T+  + + SFRLLSGH IPA+GLGTW+        V  AIVEGGYRH+DTA +Y
Sbjct  1     MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQAAHAVVTAIVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q+ VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP+RVRPAL NTL+ELQL+YLDL+LI
Sbjct  61    GDQREVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQNTLKELQLEYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWP  L+EGAS+PPKAG+V  FDMEGVWREME L  D LVR+IGVCNFTV KLNKLL  A
Sbjct  121   HWPIRLREGASKPPKAGDVLDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLGFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ P+VCQMEMHPGWRND++L+ CK N IH  AYSPLGS E  RDL+H+  V+++A KLN
Sbjct  181   ELIPAVCQMEMHPGWRNDRILEFCKKNEIH--AYSPLGSQEGGRDLIHDQTVDRIAKKLN  238

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQ+LVKW +QRGTS IPKS +  RIKENI VFDW IP+QDF+AL+SI DQ+RV+DGE
Sbjct  239   KTPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPEQDFQALNSITDQKRVIDGE  298

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNKT+GPF++VADLWDHED
Sbjct  299   DLFVNKTEGPFRSVADLWDHED  320



>gb|AES79630.2| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=321

 Score =   468 bits (1204),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 232/322 (72%), Positives = 272/322 (84%), Gaps = 4/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ TV     K  SF LLSGH IPAIGLGTWK      ++V+ AI E GYRH+DTAAQY
Sbjct  1     MAQ-TVKPHEPKTKSFDLLSGHSIPAIGLGTWKSGSQAINSVFTAITEAGYRHIDTAAQY  59

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ+ VG  L++A+ AGVERK LF+TSK+WCTDL+P+RVRPAL NTLQELQLDYLDL+L+
Sbjct  60    GVQEEVGHALQSAMQAGVERKDLFITSKIWCTDLTPERVRPALNNTLQELQLDYLDLYLV  119

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GASRPPKAGEVS FDMEGVWREMEKLV + LVRDIG+CNFT+ KL+KL+ IA
Sbjct  120   HWPFLLKDGASRPPKAGEVSEFDMEGVWREMEKLVKENLVRDIGICNFTLTKLDKLVNIA  179

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ PSVCQMEMHPGWRNDKML+ACK N IHVTAYSPLGS +  RDL+H+  V+++A KLN
Sbjct  180   QVMPSVCQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSQDGGRDLIHDQTVDRIAKKLN  239

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             KSPGQVLVKWA+QRGTS IPKS + +RIKEN+ VF+WE+P  DF  LS IPDQRRVLDGE
Sbjct  240   KSPGQVLVKWAMQRGTSVIPKSTNPNRIKENVVVFNWELPDNDFNKLSKIPDQRRVLDGE  299

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNK++GPFK+V D+WDHED
Sbjct  300   DLFVNKSEGPFKSVEDIWDHED  321



>emb|CDX80756.1| BnaC03g00100D [Brassica napus]
Length=322

 Score =   467 bits (1202),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 269/322 (84%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T T   +K  SFRLLSGH IPA+GLGTW+        V+ A++EGGYRH+DTA +Y
Sbjct  1     MAHTTFTPEGQKTESFRLLSGHKIPAVGLGTWQSGSQASHAVFTALLEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q  VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP+RVRPAL NTLQELQLDYLDL+LI
Sbjct  61    GDQNEVGQGMKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQNTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L+EGAS+PPKAG+V  FDMEGVWREMEKLV D LVR IGVCNFT+ KLNKLLR A
Sbjct  121   HWPFRLREGASKPPKAGDVLEFDMEGVWREMEKLVKDNLVRSIGVCNFTITKLNKLLRFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ PSVCQMEMHPGWRND+ML  C+ N IHVTAYSPLGS E  R L+H+  VE++A KLN
Sbjct  181   ELIPSVCQMEMHPGWRNDQMLQLCRMNGIHVTAYSPLGSQEGGRGLIHDQTVERIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKW +QRGTS IPKS++  RIKENI VFDW IP QDFEAL+SI DQ+RV+DGE
Sbjct  241   KTPGQVLVKWGLQRGTSVIPKSSNPERIKENIKVFDWVIPDQDFEALNSISDQKRVMDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             DMFVNK++GPF++VADLWDHED
Sbjct  301   DMFVNKSEGPFRSVADLWDHED  322



>emb|CDP19943.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   471 bits (1211),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 230/402 (57%), Positives = 296/402 (74%), Gaps = 32/402 (8%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MGACC+CQR+++ + +    A ++   +  E+ D  V RGD GARVRL GSS+++S + Q
Sbjct  1     MGACCSCQRIERFDGF---YAADEAVEKTIEDEDLYVRRGDHGARVRLQGSSKYISTFIQ  57

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLP------------  775
             QGKKG NQDAMTVWE F GE+  FFCGVFDGHGPSGH VA+++RD LP            
Sbjct  58    QGKKGTNQDAMTVWESFTGERDMFFCGVFDGHGPSGHVVARYVRDLLPSKLSSSSSSSAS  117

Query  776   -----SKLSVASKDNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGT  940
                  S  S    +N+ +F              +   +SFK++D  LEG+  I+S+ SGT
Sbjct  118   KGFNISAASSGGDENAGNF------------GDARILKSFKEMDEELEGDAGIESYCSGT  165

Query  941   TAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRV  1120
             TAVT+IKQ EHLII NLGDSRA+MCTRDD D LV EQLTVDLKPNLP E+ERI+SC+GRV
Sbjct  166   TAVTVIKQREHLIIANLGDSRAVMCTRDDQDLLVAEQLTVDLKPNLPSEAERIRSCQGRV  225

Query  1121  MATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLAS  1300
             MA   EPNV+R+WMP++DCPGLAMARAFGDFCLKD+G+IS PE+FYRK++ERDEFVVLA+
Sbjct  226   MAMEGEPNVYRIWMPDEDCPGLAMARAFGDFCLKDFGLISTPEVFYRKLTERDEFVVLAT  285

Query  1301  DGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPK  1480
             DG+WDVLSN EV++ VA+A+KRS AA+L+V+RA+R W+ KYPC+K DDCAVVCLF KR +
Sbjct  286   DGIWDVLSNNEVVRIVASARKRSTAAKLLVDRAIRAWRYKYPCAKMDDCAVVCLFLKRQR  345

Query  1481  PMLLKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLN  1606
             P+L K++S+   L++++ E G    N    + +DDGLDT+LN
Sbjct  346   PLLTKSLSEVTELSLNYTELGPVSHNYVSSSRSDDGLDTVLN  387



>gb|KHN29558.1| Aldose reductase [Glycine soja]
Length=322

 Score =   466 bits (1198),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 228/322 (71%), Positives = 270/322 (84%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ+ V     K  SF LLSGH IPA+GLGTWK      ++V+ AIVE GYRH+DTA+QY
Sbjct  1     MAQVVVKRHEPKTQSFTLLSGHTIPAVGLGTWKAGSQAVNSVFTAIVEAGYRHIDTASQY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ+GVG+ L+AA+ AGVERK LFVTSKLWCTDL P+RVRPA+ NTLQELQLDYLDL+LI
Sbjct  61    GVQEGVGQALQAAMQAGVERKDLFVTSKLWCTDLIPERVRPAINNTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GASRPPK GEV  FDMEGVWREMEKLV + LVRDIG+CNFT+ KL KL+ IA
Sbjct  121   HWPFRLKDGASRPPKEGEVLEFDMEGVWREMEKLVKENLVRDIGICNFTLTKLEKLMSIA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             +I PSVCQMEMHPGWRNDKML ACK   IHVTAYSPLGS +  RDL+++  V+++ANK+N
Sbjct  181   QIMPSVCQMEMHPGWRNDKMLQACKKKAIHVTAYSPLGSSDGGRDLINDQKVDRIANKMN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKWAIQRGTS IPKS    RI EN+SVF+WE+P++DF+ LS++PDQRRVLDGE
Sbjct  241   KNPGQVLVKWAIQRGTSVIPKSTKPDRIMENVSVFNWELPERDFKTLSNMPDQRRVLDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNK+ GP ++V D+WDHED
Sbjct  301   DLFVNKSAGPLRSVEDIWDHED  322



>ref|XP_009130640.1| PREDICTED: aldose reductase [Brassica rapa]
Length=322

 Score =   464 bits (1194),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 228/322 (71%), Positives = 268/322 (83%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T +   +K  SFRLLSGH IPA+GLGTW+        V+ A++EGGYRH+DTA +Y
Sbjct  1     MAHTTFSPEGQKTESFRLLSGHKIPAVGLGTWQSGSQASHAVFTALLEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q  VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP+RVRPAL NTLQELQLDYLDL+LI
Sbjct  61    GDQNQVGQGMKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQNTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L++GAS+PPKAG+V  FDMEGVWREMEKLV D LVR IGVCNFT+ KLNKLL  A
Sbjct  121   HWPFRLRQGASKPPKAGDVLEFDMEGVWREMEKLVKDNLVRSIGVCNFTITKLNKLLAFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
              + PSVCQMEMHPGWRND+ML  C+ N IHVTAYSPLGS E  RDL+H+  VE++A KLN
Sbjct  181   DLIPSVCQMEMHPGWRNDQMLQLCRMNGIHVTAYSPLGSQEGGRDLIHDQTVERIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKW +QRGTS IPKS++  RIKENI VFDW IP QDFEAL+SI DQ+RV+DGE
Sbjct  241   KTPGQVLVKWGLQRGTSVIPKSSNPERIKENIKVFDWVIPDQDFEALNSISDQKRVMDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             DMFVNK++GPF++VADLWDHED
Sbjct  301   DMFVNKSEGPFRSVADLWDHED  322



>emb|CDY11185.1| BnaA03g00210D [Brassica napus]
Length=322

 Score =   463 bits (1192),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 228/322 (71%), Positives = 267/322 (83%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T T   +K  SFRLLSGH IPA+GLGTW+        V+ A++EGGYRH+DTA +Y
Sbjct  1     MAHTTFTPEGQKTESFRLLSGHKIPAVGLGTWQSGSQASHAVFTALLEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G Q  VG+G+K A+HAG+ER+ LFVTSKLWCT+LSP+RVRPAL NTLQELQLDYLDL+LI
Sbjct  61    GDQNQVGQGMKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQNTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF L++GAS+PPKAG+V  FDMEGVWREMEKLV D LVR IGVCNFT+ KLNKLL  A
Sbjct  121   HWPFRLRQGASKPPKAGDVLEFDMEGVWREMEKLVKDNLVRSIGVCNFTITKLNKLLAFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
              + PSVCQMEMHPGWRND+ML  C+ N IH TAYSPLGS E  RDL+H+  VE++A KLN
Sbjct  181   DLIPSVCQMEMHPGWRNDQMLQLCRMNGIHATAYSPLGSQEGGRDLIHDQTVERIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKW +QRGTS IPKS++  RIKENI VFDW IP QDFEAL+SI DQ+RV+DGE
Sbjct  241   KTPGQVLVKWGLQRGTSVIPKSSNPERIKENIKVFDWVIPDQDFEALNSISDQKRVMDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             DMFVNK++GPF++VADLWDHED
Sbjct  301   DMFVNKSEGPFRSVADLWDHED  322



>ref|XP_003623412.1| Aldose reductase-like protein [Medicago truncatula]
Length=322

 Score =   463 bits (1192),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 232/323 (72%), Positives = 272/323 (84%), Gaps = 5/323 (2%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ TV     K  SF LLSGH IPAIGLGTWK      ++V+ AI E GYRH+DTAAQY
Sbjct  1     MAQ-TVKPHEPKTKSFDLLSGHSIPAIGLGTWKSGSQAINSVFTAITEAGYRHIDTAAQY  59

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ+ VG  L++A+ AGVERK LF+TSK+WCTDL+P+RVRPAL NTLQELQLDYLDL+L+
Sbjct  60    GVQEEVGHALQSAMQAGVERKDLFITSKIWCTDLTPERVRPALNNTLQELQLDYLDLYLV  119

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GASRPPKAGEVS FDMEGVWREMEKLV + LVRDIG+CNFT+ KL+KL+ IA
Sbjct  120   HWPFLLKDGASRPPKAGEVSEFDMEGVWREMEKLVKENLVRDIGICNFTLTKLDKLVNIA  179

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ PSVCQMEMHPGWRNDKML+ACK N IHVTAYSPLGS +  RDL+H+  V+++A KLN
Sbjct  180   QVMPSVCQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSQDGGRDLIHDQTVDRIAKKLN  239

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQ-RRVLDG  2033
             KSPGQVLVKWA+QRGTS IPKS + +RIKEN+ VF+WE+P  DF  LS IPDQ RRVLDG
Sbjct  240   KSPGQVLVKWAMQRGTSVIPKSTNPNRIKENVVVFNWELPDNDFNKLSKIPDQVRRVLDG  299

Query  2032  EDMFVNKTDGPFKNVADLWDHED  1964
             ED+FVNK++GPFK+V D+WDHED
Sbjct  300   EDLFVNKSEGPFKSVEDIWDHED  322



>ref|XP_011077507.1| PREDICTED: probable protein phosphatase 2C 65 [Sesamum indicum]
Length=437

 Score =   467 bits (1202),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 228/403 (57%), Positives = 295/403 (73%), Gaps = 24/403 (6%)
 Frame = +2

Query  452   MGACCTCQR-VKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYS  628
             MGACC+C R     E   V+      E E     + I+ RGD GAR+ L GSSR+VSM++
Sbjct  1     MGACCSCHRGTGNFEGLYVEEEAEGREVE----DENIILRGDAGARICLQGSSRYVSMFT  56

Query  629   QQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLS-------  787
             QQG+KGVNQDAMTVWE F GE+  FFCGVFDGHGPSGH VA+++RD LP+K+S       
Sbjct  57    QQGRKGVNQDAMTVWESFSGERDMFFCGVFDGHGPSGHEVARYVRDLLPTKISLLYRQSS  116

Query  788   VASKDNSQDFEKDIHHH----------PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSG  937
             +  KD     + +   H          PLF  WK+   +SF+++D  LE +  IDS+ SG
Sbjct  117   IEGKDGVMRIDNNATDHDGSENPENKNPLFLSWKNRLIRSFQEMDEELEADSSIDSYCSG  176

Query  938   TTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGR  1117
             TT+VT++++GEHLII NLGDSRA++C RD+ +QLV EQLTVDLKPNLP E+ERI S +GR
Sbjct  177   TTSVTVVRKGEHLIIANLGDSRAVLCKRDENNQLVSEQLTVDLKPNLPAEAERIASRQGR  236

Query  1118  VMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLA  1297
             V AT E+P V+RVWMP+QDCPGLAMARAFGDFCLKDYG+IS P++  RK+SE DEFVVLA
Sbjct  237   VFATNEDPKVYRVWMPDQDCPGLAMARAFGDFCLKDYGLISTPQVTCRKLSENDEFVVLA  296

Query  1298  SDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRP  1477
             +DG+WDVLSN EV+K VA+A+KR MAA+L+ E+AVR W+ K+PC+K DDCAV+CL+FKR 
Sbjct  297   TDGIWDVLSNDEVVKIVASARKRCMAAKLLTEKAVRAWRCKFPCAKIDDCAVICLYFKRQ  356

Query  1478  KPMLLKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLN  1606
             +P L K+ S+   L++++ E   +  + A  A+TDDGLDT+LN
Sbjct  357   RPALTKSESEVTHLSLNYTEL--STHSYAASAKTDDGLDTVLN  397



>ref|XP_010264523.1| PREDICTED: aldose reductase-like [Nelumbo nucifera]
Length=322

 Score =   462 bits (1190),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 225/322 (70%), Positives = 270/322 (84%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ  +  R+    SFRL+SGH IPA+GLGTW+      ++V+ AIVE GYRHVDTA +Y
Sbjct  1     MAQDALVTRDVNTESFRLVSGHSIPAVGLGTWRSGSQAINSVFTAIVEAGYRHVDTALEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ+ VG  L AAI AGV+RK LF+TSKLWCTDLSP+RVR ALMNTLQELQLDYLDL+LI
Sbjct  61    GVQEEVGNALSAAIQAGVDRKDLFITSKLWCTDLSPERVRTALMNTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA++PP+AG+V  FDMEGVWREMEKLV D LVRDIGVCNFT+ KL KLL+ A
Sbjct  121   HWPFRLKDGATKPPRAGDVLEFDMEGVWREMEKLVKDNLVRDIGVCNFTITKLEKLLKFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             +  PSVCQ+EMHPGW+NDKML+ACK N IHVTAYSPLGS +  RDL+H+P V+++A KLN
Sbjct  181   QTMPSVCQIEMHPGWKNDKMLEACKRNGIHVTAYSPLGSSKGGRDLIHDPTVDRIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQ+LVKWA+QRGTS IPKS +  RIKENI V  WEIP QDF+AL ++P+Q+RVLDGE
Sbjct  241   KTPGQILVKWALQRGTSVIPKSTNPERIKENIQVCGWEIPAQDFKALCNLPNQKRVLDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNK+DGP+++ ADLWDHED
Sbjct  301   DVFVNKSDGPYRSAADLWDHED  322



>ref|XP_003533681.1| PREDICTED: aldose reductase-like [Glycine max]
Length=322

 Score =   462 bits (1189),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 227/322 (70%), Positives = 269/322 (84%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ+ V     K  SF LLSGH IPA+GLGTWK      ++V+ AIVE GYRH+DTA+QY
Sbjct  1     MAQVVVKRHEPKTQSFTLLSGHTIPAVGLGTWKAGSQAVNSVFTAIVEAGYRHIDTASQY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ+GVG+ L+AA+ A VERK LFVTSKLWCTDL P+RVRPA+ NTLQELQLDYLDL+LI
Sbjct  61    GVQEGVGQALQAAMQARVERKDLFVTSKLWCTDLIPERVRPAINNTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GASRPPK GEV  FDMEGVWREMEKLV + LVRDIG+CNFT+ KL KL+ IA
Sbjct  121   HWPFRLKDGASRPPKEGEVLEFDMEGVWREMEKLVKENLVRDIGICNFTLTKLEKLMSIA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             +I PSVCQMEMHPGWRNDKML ACK   IHVTAYSPLGS +  RDL+++  V+++ANK+N
Sbjct  181   QIMPSVCQMEMHPGWRNDKMLQACKKKAIHVTAYSPLGSSDGGRDLINDQKVDRIANKMN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKWAIQRGTS IPKS    RI EN+SVF+WE+P++DF+ LS++PDQRRVLDGE
Sbjct  241   KNPGQVLVKWAIQRGTSVIPKSTKPDRIMENVSVFNWELPERDFKTLSNMPDQRRVLDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNK+ GP ++V D+WDHED
Sbjct  301   DLFVNKSAGPLRSVEDIWDHED  322



>ref|NP_850750.1| putative aldose reductase [Arabidopsis thaliana]
 gb|AED90375.1| putative aldose reductase [Arabidopsis thaliana]
Length=349

 Score =   463 bits (1192),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 269/349 (77%), Gaps = 30/349 (9%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA  T T+  + + SFRLLSGH IPA+GLGTW+        V  AIVEGGYRH+DTA +Y
Sbjct  1     MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQAAHAVVTAIVEGGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLW---------------------------CTD  2645
             G Q+ VG+G+K A+HAG+ER+ LFVTSKLW                           CT+
Sbjct  61    GDQREVGQGIKRAMHAGLERRDLFVTSKLWYTLILRKMINLSSPLMNVLVGTCLNKRCTE  120

Query  2644  LSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPPKAGEVSGFDMEGVWREMEK  2465
             LSP+RVRPAL NTL+ELQL+YLDL+LIHWP  L+EGAS+PPKAG+V  FDMEGVWREME 
Sbjct  121   LSPERVRPALQNTLKELQLEYLDLYLIHWPIRLREGASKPPKAGDVLDFDMEGVWREMEN  180

Query  2464  LVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTA  2285
             L  D LVR+IGVCNFTV KLNKLL  A++ P+VCQMEMHPGWRND++L+ CK N IHVTA
Sbjct  181   LSKDSLVRNIGVCNFTVTKLNKLLGFAELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTA  240

Query  2284  YSPLGSDE--RDLVHNPMVEKVANKLNKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENIS  2111
             YSPLGS E  RDL+H+  V+++A KLNK+PGQ+LVKW +QRGTS IPKS +  RIKENI 
Sbjct  241   YSPLGSQEGGRDLIHDQTVDRIAKKLNKTPGQILVKWGLQRGTSVIPKSLNPERIKENIK  300

Query  2110  VFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNVADLWDHED  1964
             VFDW IP+QDF+AL+SI DQ+RV+DGED+FVNKT+GPF++VADLWDHED
Sbjct  301   VFDWVIPEQDFQALNSITDQKRVIDGEDLFVNKTEGPFRSVADLWDHED  349



>gb|EYU41970.1| hypothetical protein MIMGU_mgv1a017784mg [Erythranthe guttata]
Length=440

 Score =   465 bits (1197),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 226/402 (56%), Positives = 297/402 (74%), Gaps = 19/402 (5%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVkn-----aenkeereadeeHDGIVGRGDFGARVRLHGSSRFV  616
             MGACC+C R  + + Y V+                EE+  IV RGD GAR+RL GSS++V
Sbjct  1     MGACCSCHRGGRFDSYLVEEERDHHTGGGGGGGGGEENGDIVLRGDAGARIRLTGSSKYV  60

Query  617   SMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVAS  796
             SM+SQQG+KGVNQDAMTVWE+F G+K  FFCGVFDGHGPSGH+VA+++RD LP+K+S   
Sbjct  61    SMFSQQGRKGVNQDAMTVWENFSGDKDMFFCGVFDGHGPSGHKVARYMRDFLPAKISYLY  120

Query  797   KDN-SQDFEKD-----------IHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGT  940
             K     D E D              +PLF  WK+   + F ++D+ LEG+  I+S+ SGT
Sbjct  121   KQPIVVDIEADEPEDECGNVPEYSRNPLFLSWKARLTKCFHEMDDQLEGDASIESYCSGT  180

Query  941   TAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRV  1120
             T+V ++K+ EHLII NLGDSRA++CTRD+ D LV EQLTVDLKPNLP E+ RI+SC+GRV
Sbjct  181   TSVCVLKKAEHLIIANLGDSRAVLCTRDENDHLVSEQLTVDLKPNLPGEAHRIRSCEGRV  240

Query  1121  MATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLAS  1300
             +A  EEPNV+R+WMP +DCPGLAMARAFGDFCLKD+G+IS P++ YRK++++DEFVVLA+
Sbjct  241   LAMDEEPNVYRIWMPNEDCPGLAMARAFGDFCLKDFGLISTPQVTYRKLTQKDEFVVLAT  300

Query  1301  DGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPK  1480
             DG+WD LSN EV+K VA+A  RS+AA++VVERAVRTW+ KYP +K DDCAVVCLFFKR +
Sbjct  301   DGIWDALSNDEVVKVVASAGSRSVAAKMVVERAVRTWRYKYPRAKIDDCAVVCLFFKRQR  360

Query  1481  PMLLKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLN  1606
             P L K++S+   L++++   G +  +     ++DD LDT+LN
Sbjct  361   PALTKSVSEVTQLSLNY--NGIDARSCTESMKSDDALDTVLN  400



>gb|KCW88233.1| hypothetical protein EUGRSUZ_A00624 [Eucalyptus grandis]
Length=322

 Score =   460 bits (1184),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 267/322 (83%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ T+ A + K  SFRLLSGH IPA+GLGTW+        V+AAIVE GYRH+DTA +Y
Sbjct  1     MAQATLPAVDPKAQSFRLLSGHAIPAVGLGTWRSGSDASSAVHAAIVEAGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
              VQ+ VG GL++A+ AGV+RK LF+TSKLWCT+LSP RVRPAL NTLQELQLDYLDL+LI
Sbjct  61    KVQEEVGHGLQSAMQAGVDRKDLFITSKLWCTELSPDRVRPALNNTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+G+SRPP+AG+V  FDMEGVWREMEKLV D LVRDIGVCNFT+ KLNKLL  A
Sbjct  121   HWPFRLKDGSSRPPEAGQVLDFDMEGVWREMEKLVKDNLVRDIGVCNFTLKKLNKLLGFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             +  PSVCQMEMHPGWRNDKML+ CK N+IHVTAYSPLGS E  RDL+H+  VEKVA KLN
Sbjct  181   ETMPSVCQMEMHPGWRNDKMLEFCKKNSIHVTAYSPLGSSEGGRDLIHDRTVEKVARKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             KS GQVLVKWA+QRGTS IPKS H  RI+EN  VF WEIP+QDF+A   +P+Q+RVLDGE
Sbjct  241   KSAGQVLVKWAVQRGTSVIPKSTHPDRIRENTQVFGWEIPEQDFQAFCRMPNQKRVLDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             ++FVNK  GPF++VADLWDHED
Sbjct  301   ELFVNKEAGPFRSVADLWDHED  322



>ref|XP_006654539.1| PREDICTED: aldose reductase-like [Oryza brachyantha]
Length=318

 Score =   460 bits (1183),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 212/320 (66%), Positives = 263/320 (82%), Gaps = 3/320 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA     A++E    F L SGH IPA+GLGTW+       +V  AI+E GYRHVDTAAQY
Sbjct  1     MASAKAMAQDEH--QFVLKSGHAIPAVGLGTWRAGSDTAHSVQTAIIEAGYRHVDTAAQY  58

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GV+Q VG+GLKAAI AG+ RK LFVTSK+WCT+L+P++VRPAL NTL++LQLDY+DL+LI
Sbjct  59    GVEQEVGKGLKAAIEAGINRKDLFVTSKIWCTNLAPEKVRPALKNTLKDLQLDYIDLYLI  118

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA +PP+AGEV  FDMEGVWR ME+LV D LV+DIG+CNF+V KLN+LLR A
Sbjct  119   HWPFQLKDGAHQPPEAGEVLEFDMEGVWRGMERLVTDGLVKDIGICNFSVTKLNRLLRSA  178

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKS  2204
              I P+VCQMEMHPGW+NDK+ +ACK+  IHVTAYSPLGS E++L H+P+VEK+ANKLNK+
Sbjct  179   NIPPAVCQMEMHPGWKNDKIFEACKNQGIHVTAYSPLGSSEKNLAHDPVVEKIANKLNKT  238

Query  2203  PGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDM  2024
              GQVL+KWA+QRGTS IPKS    RIKENI VF WEIP++DF+ L SI D++RVL GE++
Sbjct  239   SGQVLIKWALQRGTSVIPKSTKDERIKENIQVFGWEIPEEDFQVLCSIKDEKRVLTGEEL  298

Query  2023  FVNKTDGPFKNVADLWDHED  1964
             FVNKT GP+K+ ++LWD+ED
Sbjct  299   FVNKTHGPYKSASELWDNED  318



>ref|XP_004137688.1| PREDICTED: aldose reductase-like [Cucumis sativus]
 gb|KGN58712.1| hypothetical protein Csa_3G730760 [Cucumis sativus]
Length=323

 Score =   459 bits (1182),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 217/323 (67%), Positives = 257/323 (80%), Gaps = 4/323 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGS-FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQ  2747
             MAQ  VT++ +     F L+SGH IPA+GLGTW+      ++V+ A+VE GYRH+DTAA+
Sbjct  1     MAQAVVTSQVQDAERYFTLVSGHRIPAVGLGTWRSGSRANESVFNALVEAGYRHIDTAAE  60

Query  2746  YGVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFL  2567
             YGV + VG GL+AAI  G+ R+ +FVT+KLWC+DLSP RVR  L N LQELQ+DYLDL L
Sbjct  61    YGVHEEVGFGLQAAIKTGIRREDIFVTTKLWCSDLSPNRVRIGLNNALQELQVDYLDLLL  120

Query  2566  IHWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRI  2387
             IHWPFHLKEGASRPPK GEV   DMEGVWREMEKLV + LVRDIG+ NFT+ KL+ LL  
Sbjct  121   IHWPFHLKEGASRPPKEGEVLDLDMEGVWREMEKLVKENLVRDIGISNFTLKKLDNLLSF  180

Query  2386  AKIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKL  2213
             A+  PSVCQMEMHPGWRNDKML+ACK N IHVTAYSPLGS E  RDL+HN  VE++A KL
Sbjct  181   AQTMPSVCQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSSEGGRDLIHNETVERIAKKL  240

Query  2212  NKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDG  2033
             NK+PGQ+LVKWA+QRGTS IPKS H  RIKENI VF WEIP +DF+AL  IP Q+RVL G
Sbjct  241   NKTPGQILVKWALQRGTSAIPKSTHKERIKENIGVFGWEIPVEDFQALCRIPTQKRVLSG  300

Query  2032  EDMFVNKTDGPFKNVADLWDHED  1964
             E++FVNK  GP ++VAD+WDHED
Sbjct  301   EELFVNKEAGPLRSVADVWDHED  323



>ref|XP_003551585.1| PREDICTED: aldose reductase-like [Glycine max]
 gb|KHN40687.1| Aldose reductase [Glycine soja]
Length=321

 Score =   459 bits (1182),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 227/322 (70%), Positives = 271/322 (84%), Gaps = 4/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ+ V     K  SF+LLSGH IPA+GLGTWK      ++V  AIVE GYRH+DTA+QY
Sbjct  1     MAQV-VKPHEPKTQSFKLLSGHTIPAVGLGTWKSGSQAANSVITAIVEAGYRHIDTASQY  59

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ+ VG  L++A+ AGVERK LFVTSKLWCTDL+P+RVRPA+ NTLQELQLDYLDL+LI
Sbjct  60    GVQEEVGHALQSAMQAGVERKDLFVTSKLWCTDLTPERVRPAINNTLQELQLDYLDLYLI  119

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GASRPPK GEV   DMEGVWREMEKLV + LVRDIG+CNFT+ KL+KL+ IA
Sbjct  120   HWPFRLKDGASRPPKEGEVLELDMEGVWREMEKLVKENLVRDIGICNFTLTKLDKLMSIA  179

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             +I PSVCQMEMHPGWRNDKML ACK N IHVTAYSPLGS +  RDL+++  V+++ANK+N
Sbjct  180   QIMPSVCQMEMHPGWRNDKMLQACKKNAIHVTAYSPLGSSDGGRDLINDQKVDRIANKMN  239

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+PGQVLVKWAIQRGTS IPKS    RI EN+SVF+WE+P++DF+ LS++PDQRRVLDGE
Sbjct  240   KNPGQVLVKWAIQRGTSVIPKSTKPDRIMENVSVFNWELPERDFKTLSNMPDQRRVLDGE  299

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             D+FVNK+ GPF++V D+WDHED
Sbjct  300   DLFVNKSAGPFRSVEDIWDHED  321



>gb|EMS53537.1| Aldose reductase [Triticum urartu]
Length=320

 Score =   459 bits (1182),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 212/320 (66%), Positives = 262/320 (82%), Gaps = 1/320 (0%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA    T   EK   F L SGH +PA+GLGTW+       +V  AI E GYRHVDTAA+Y
Sbjct  1     MASAKATMGQEKQQHFVLKSGHSMPAVGLGTWRAGSDTAHSVQTAITEAGYRHVDTAAEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GV++ VG+GLKAA+ AG++RK LFVTSKLWCT+L P+RVRPAL NTL++LQLDY+DL+ I
Sbjct  61    GVEKEVGKGLKAAMEAGIDRKDLFVTSKLWCTNLVPERVRPALENTLKDLQLDYIDLYHI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA +PP+AGEV  FDMEGVW+EME LV D LV+DIGVCN+TV KL++LLR A
Sbjct  121   HWPFRLKDGAHKPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLDRLLRSA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKS  2204
             KI P+VCQMEMHPGW+NDKM +ACK   IHVTAYSPLGS E++L H+P+VEKVANKLNK+
Sbjct  181   KIPPAVCQMEMHPGWKNDKMFEACKKRGIHVTAYSPLGSSEKNLAHDPVVEKVANKLNKT  240

Query  2203  PGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDM  2024
             PGQVL++WA+QRGTS IPKS+   RIKENI VF WEIP++DF+ L SI D++RVL GE++
Sbjct  241   PGQVLIRWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIKDEKRVLTGEEL  300

Query  2023  FVNKTDGPFKNVADLWDHED  1964
             FVNKT GP+K+ +++WDHE+
Sbjct  301   FVNKTHGPYKSASEVWDHEN  320



>ref|XP_008442354.1| PREDICTED: aldose reductase isoform X2 [Cucumis melo]
 ref|XP_008442356.1| PREDICTED: aldose reductase isoform X2 [Cucumis melo]
Length=346

 Score =   459 bits (1180),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 217/324 (67%), Positives = 259/324 (80%), Gaps = 4/324 (1%)
 Frame = -2

Query  2923  KMAQMTVTARNEKVGS-FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAA  2750
             KMAQ  +T + +     F L+SGH IPA+GLGTW+      D+V+ AIVE GYRH+DTAA
Sbjct  23    KMAQAVMTPQVQDAERYFTLVSGHRIPAVGLGTWRSGSRADDSVFNAIVEAGYRHIDTAA  82

Query  2749  QYGVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLF  2570
             +YGV + VG GL+AAI AG+ R+ +FVT+KLWC+DLSP RVR  L N LQELQ+DYLDL 
Sbjct  83    EYGVHEEVGFGLQAAIKAGIRREDIFVTTKLWCSDLSPNRVRIGLNNALQELQVDYLDLL  142

Query  2569  LIHWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLR  2390
             LIHWPFHLKEGASRPPK GEV   DMEGVWREMEKLV + LVRDIG+ NFT+ KL+ LL 
Sbjct  143   LIHWPFHLKEGASRPPKEGEVLDLDMEGVWREMEKLVKENLVRDIGISNFTLKKLDNLLS  202

Query  2389  IAKIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANK  2216
              A+  PSVCQMEMHPGWRNDKML+ACK N IHVTAYSPLGS +  RDL+H+  VE++A K
Sbjct  203   FAQTMPSVCQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSSDGGRDLIHDEAVERIAKK  262

Query  2215  LNKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLD  2036
             LN++PGQ+LVKWA+QRGTS IPKS H  RIKENI+VF WEIP +DFEAL  IP Q+RVL 
Sbjct  263   LNRTPGQILVKWALQRGTSAIPKSTHLERIKENIAVFGWEIPVEDFEALCRIPTQKRVLS  322

Query  2035  GEDMFVNKTDGPFKNVADLWDHED  1964
             GE++FVN+  GP ++VAD+WDHED
Sbjct  323   GEELFVNEEAGPLRSVADVWDHED  346



>sp|P23901.1|ALDR_HORVU RecName: Full=Aldose reductase; Short=AR; AltName: Full=Aldehyde 
reductase [Hordeum vulgare]
 emb|CAA40747.1| aldose reductase-related protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02512.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   457 bits (1175),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 211/320 (66%), Positives = 262/320 (82%), Gaps = 1/320 (0%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA    T    +   F L SGH +PA+GLGTW+       +V  AI E GYRHVDTAA+Y
Sbjct  1     MASAKATMGQGEQDHFVLKSGHAMPAVGLGTWRAGSDTAHSVRTAITEAGYRHVDTAAEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GV++ VG+GLKAA+ AG++RK LFVTSK+WCT+L+P+RVRPAL NTL++LQLDY+DL+ I
Sbjct  61    GVEKEVGKGLKAAMEAGIDRKDLFVTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA  PP+AGEV  FDMEGVW+EME LV D LV+DIGVCN+TV KLN+LLR A
Sbjct  121   HWPFRLKDGAHMPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLRSA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKS  2204
             KI P+VCQMEMHPGW+NDK+ +ACK + IHVTAYSPLGS E++L H+P+VEKVANKLNK+
Sbjct  181   KIPPAVCQMEMHPGWKNDKIFEACKKHGIHVTAYSPLGSSEKNLAHDPVVEKVANKLNKT  240

Query  2203  PGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDM  2024
             PGQVL+KWA+QRGTS IPKS+   RIKENI VF WEIP++DF+ L SI D++RVL GE++
Sbjct  241   PGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIKDEKRVLTGEEL  300

Query  2023  FVNKTDGPFKNVADLWDHED  1964
             FVNKT GP+++ AD+WDHE+
Sbjct  301   FVNKTHGPYRSAADVWDHEN  320



>ref|XP_011095082.1| PREDICTED: probable protein phosphatase 2C 65 [Sesamum indicum]
Length=429

 Score =   460 bits (1184),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/400 (56%), Positives = 294/400 (74%), Gaps = 24/400 (6%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MGACC+C    + E         +E+ E + EH+ I+ RG  GARVR  GSS++VSMY+Q
Sbjct  1     MGACCSCHTGGRFEY-----PVEEEDEEREVEHEDIILRGHAGARVRHQGSSKYVSMYTQ  55

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASKDNSQ  811
             QGKKG NQDAMTVWE F G+K  FFC VFDGHGPSGH+VAQ++RD LP+K+S   K +S 
Sbjct  56    QGKKGTNQDAMTVWESFSGDKDMFFCAVFDGHGPSGHKVAQYVRDLLPAKISSLYKQSSV  115

Query  812   DFEKDI---------------HHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTA  946
             D +  +                 +PL   WK+   +SF+++D  L  +  ++++ SGTT+
Sbjct  116   DGKNAVLDIETGADDRNQNMESKNPLLLSWKARLTKSFQEMDEQLGADGSVETYCSGTTS  175

Query  947   VTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMA  1126
             V ++++GEHLII NLGDSRA++CTR+++ QLV EQLTVDLKP+LP E++RI SC+GR+MA
Sbjct  176   VCVLRKGEHLIIANLGDSRAVLCTRNESQQLVSEQLTVDLKPHLPAEAKRITSCQGRIMA  235

Query  1127  TAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDG  1306
               EEPNV+R+WMP +DCPGLAMARAFGDFCLKD+G+IS PE+ YRK++ERDEFVVLA+DG
Sbjct  236   MDEEPNVYRIWMPNEDCPGLAMARAFGDFCLKDFGLISTPEVTYRKLTERDEFVVLATDG  295

Query  1307  VWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPM  1486
             +WD LSN EV+K VA+A+KRSMA +L+VE+AVR WK K+P +K DDCAVVCLFFKR KP+
Sbjct  296   IWDALSNDEVVKIVASARKRSMAGKLLVEKAVRAWKYKFPRAKIDDCAVVCLFFKRQKPV  355

Query  1487  LLKTMSQAAGLNMSFPETGRNEENSAIIAETDDGLDTLLN  1606
             L K+ S+   L+ +F E     E  +I   TDD LDT+L+
Sbjct  356   LTKSASEVTELSFNFTEL----EAQSIAGRTDDALDTVLD  391



>ref|XP_004156631.1| PREDICTED: LOW QUALITY PROTEIN: aldose reductase-like [Cucumis 
sativus]
Length=323

 Score =   456 bits (1172),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 216/323 (67%), Positives = 255/323 (79%), Gaps = 4/323 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGS-FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQ  2747
             MAQ  VT++ +     F L+SGH IPA+GLGTW+      ++V+ A+VE GYRH+DTAA+
Sbjct  1     MAQAVVTSQVQDAERYFTLVSGHRIPAVGLGTWRSGSRANESVFNALVEAGYRHIDTAAE  60

Query  2746  YGVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFL  2567
             YGV + VG GL+AAI  G+ R+ +FVT+KLWC+DLSP RVR  L N LQELQ+DYLDL L
Sbjct  61    YGVHEEVGFGLQAAIKTGIRREDIFVTTKLWCSDLSPNRVRIGLNNALQELQVDYLDLLL  120

Query  2566  IHWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRI  2387
             IHWPFHLKEGASRPPK GEV   DMEGVWREMEKLV + LVRDIG+ NFT+ KL+ LL  
Sbjct  121   IHWPFHLKEGASRPPKEGEVLDLDMEGVWREMEKLVKENLVRDIGISNFTLKKLDNLLSF  180

Query  2386  AKIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKL  2213
             A+  PSVCQMEMHPGWRNDKML+ACK N IHVTAYSPLGS E  RDL+HN  VE++A KL
Sbjct  181   AQTMPSVCQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSSEGGRDLIHNETVERIAKKL  240

Query  2212  NKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDG  2033
             NK+PGQ LVKWA+QRGTS IP S H  RIKENI VF WEIP +DF+AL  IP Q+RVL G
Sbjct  241   NKTPGQXLVKWALQRGTSAIPXSTHKERIKENIGVFGWEIPVEDFQALCRIPTQKRVLSG  300

Query  2032  EDMFVNKTDGPFKNVADLWDHED  1964
             E++FVNK  GP ++VAD+WDHED
Sbjct  301   EELFVNKEAGPLRSVADVWDHED  323



>ref|XP_010038232.1| PREDICTED: aldose reductase [Eucalyptus grandis]
Length=323

 Score =   455 bits (1170),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 231/323 (72%), Positives = 266/323 (82%), Gaps = 4/323 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ T+ A + K  SFRLLSGH IPA+GLGTW+        V+AAIVE GYRH+DTA +Y
Sbjct  1     MAQATLPAVDPKAQSFRLLSGHAIPAVGLGTWRSGSDASSAVHAAIVEAGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
              VQ+ VG GL++A+ AGV+RK LF+TSKLWCT+LSP RVRPAL NTLQELQLDYLDL+LI
Sbjct  61    KVQEEVGHGLQSAMQAGVDRKDLFITSKLWCTELSPDRVRPALNNTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+G+SRPP+AG+V  FDMEGVWREMEKLV D LVRDIGVCNFT+ KLNKLL  A
Sbjct  121   HWPFRLKDGSSRPPEAGQVLDFDMEGVWREMEKLVKDNLVRDIGVCNFTLKKLNKLLGFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             +  PSVCQMEMHPGWRNDKML+ CK N+IHVTAYSPLGS E  RDL+H+  VEKVA KLN
Sbjct  181   ETMPSVCQMEMHPGWRNDKMLEFCKKNSIHVTAYSPLGSSEGGRDLIHDRTVEKVARKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQ-RRVLDG  2033
             KS GQVLVKWA+QRGTS IPKS H  RI+EN  VF WEIP+QDF+A   +P+Q  RVLDG
Sbjct  241   KSAGQVLVKWAVQRGTSVIPKSTHPDRIRENTQVFGWEIPEQDFQAFCRMPNQVNRVLDG  300

Query  2032  EDMFVNKTDGPFKNVADLWDHED  1964
             E++FVNK  GPF++VADLWDHED
Sbjct  301   EELFVNKEAGPFRSVADLWDHED  323



>ref|XP_006429499.1| hypothetical protein CICLE_v10013844mg [Citrus clementina]
 ref|XP_006481120.1| PREDICTED: aldose reductase-like [Citrus sinensis]
 gb|ESR42739.1| hypothetical protein CICLE_v10013844mg [Citrus clementina]
 gb|KDO63276.1| hypothetical protein CISIN_1g041428mg [Citrus sinensis]
Length=322

 Score =   455 bits (1170),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 227/322 (70%), Positives = 257/322 (80%), Gaps = 3/322 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ  +   N K  SF+LLSGH IPA+GLGTWK       +V+ AIVEGGYRH+DTA QY
Sbjct  1     MAQSNIEPTNHKAESFKLLSGHTIPAVGLGTWKSGDEAFKSVFTAIVEGGYRHIDTAKQY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ+ +G  LK A+  G++RK LFVTSKLWC DLSP RVR AL NTLQELQLDYLDL+LI
Sbjct  61    GVQENIGLALKEAMQTGIQRKDLFVTSKLWCADLSPDRVRSALNNTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LKEGASRPPK GEV  FDMEGVWREMEKLV D LVRD+GVCNFT+ KLNKLL  A
Sbjct  121   HWPFRLKEGASRPPKDGEVLEFDMEGVWREMEKLVKDGLVRDVGVCNFTLKKLNKLLNFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSD--ERDLVHNPMVEKVANKLN  2210
             K KPSVCQMEMHPGWRNDK+L+ACK N IHVTAYSPLGS    RDL+H+P VE++A KLN
Sbjct  181   KTKPSVCQMEMHPGWRNDKILEACKKNGIHVTAYSPLGSQGAGRDLIHDPTVERIAKKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             KSPGQ+L+KW I RGTS IPKS H  RIKENI  F WEIP+ DF+ L S+ DQ+R+L GE
Sbjct  241   KSPGQILLKWGIHRGTSVIPKSTHPDRIKENIKAFGWEIPEHDFQTLCSMTDQKRLLHGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
              +FVN + GPF+ VADLWDHED
Sbjct  301   ILFVNSSAGPFRCVADLWDHED  322



>emb|CAA88322.1| aldose reductase [Hordeum vulgare]
Length=320

 Score =   454 bits (1167),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 261/320 (82%), Gaps = 1/320 (0%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA    T    +   F L SGH +PA+GLGTW+       +V  AI E GYRHVDTAA+Y
Sbjct  1     MASAKATMGQGEQDHFVLKSGHAMPAVGLGTWRAGSDTAHSVRTAITEAGYRHVDTAAEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GV++ VG+GLKAA+ AG++RK LFVTSK+WCT+L+P+RVRPAL NTL++LQLDY+DL+ I
Sbjct  61    GVEKEVGKGLKAAMEAGIDRKDLFVTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA  PP+AGEV  FDMEGVW+EME LV D LV+DIGVCN+TV KLN+LLR A
Sbjct  121   HWPFRLKDGAHMPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLRSA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKS  2204
             KI P+VCQMEMHPGW+NDK+ +ACK + IH+TAYSPLGS E++L H+P+VEKVANKLNK+
Sbjct  181   KIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGSSEKNLAHDPVVEKVANKLNKT  240

Query  2203  PGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDM  2024
             PGQVL+KWA+QRGTS IPKS+   RIKENI VF WEIP++DF+ L SI D++RVL GE++
Sbjct  241   PGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIKDEKRVLTGEEL  300

Query  2023  FVNKTDGPFKNVADLWDHED  1964
             FVNKT GP+++  D+WDHE+
Sbjct  301   FVNKTHGPYRSARDVWDHEN  320



>ref|NP_001055826.1| Os05g0474600 [Oryza sativa Japonica Group]
 gb|AAU44244.1| putative aldose reductase [Oryza sativa Japonica Group]
 dbj|BAF17740.1| Os05g0474600 [Oryza sativa Japonica Group]
 dbj|BAG90104.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95754.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79394.1| hypothetical protein OsI_20318 [Oryza sativa Indica Group]
 gb|EEE64072.1| hypothetical protein OsJ_18902 [Oryza sativa Japonica Group]
Length=318

 Score =   453 bits (1166),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 208/320 (65%), Positives = 262/320 (82%), Gaps = 3/320 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA     A++E    F L SGH IPA+GLGTW+       +V  AI E GYRHVDTAAQY
Sbjct  1     MASAKAMAQDEH--HFVLKSGHAIPAVGLGTWRAGSDTAHSVQTAITEAGYRHVDTAAQY  58

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G++Q VG+GLKAA+ AG+ RK LFVTSK+WCT+L+P+RVRPAL NTL++LQLDY+DL+LI
Sbjct  59    GIEQEVGKGLKAAMEAGINRKDLFVTSKIWCTNLAPERVRPALKNTLKDLQLDYIDLYLI  118

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA +PP+AGEV  FDME VWREME+LV D LV+DIGVCNF+V KLN+LL+ A
Sbjct  119   HWPFRLKDGAHQPPEAGEVLEFDMEAVWREMERLVTDGLVKDIGVCNFSVTKLNRLLQSA  178

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKS  2204
              I P+VCQMEMHPGW+N+K+ +ACK + IHVTAYSPLGS E++L H+P+VEK+ANKLNK+
Sbjct  179   NIPPAVCQMEMHPGWKNNKIFEACKKHGIHVTAYSPLGSSEKNLAHDPVVEKIANKLNKT  238

Query  2203  PGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDM  2024
             PGQVL+KWA+QRGTS IPKS    RIKEN+ VF WEIP++DF+ L  I D++RVL GE++
Sbjct  239   PGQVLIKWALQRGTSVIPKSTKDERIKENMQVFGWEIPEEDFQVLCGIKDEKRVLTGEEL  298

Query  2023  FVNKTDGPFKNVADLWDHED  1964
             FVNKT GP+K+ +++WD+ED
Sbjct  299   FVNKTHGPYKSASEVWDNED  318



>ref|XP_003568253.1| PREDICTED: aldose reductase [Brachypodium distachyon]
Length=319

 Score =   452 bits (1164),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 259/320 (81%), Gaps = 2/320 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA     A+ EK   F L SGH IPA+GLGTW+       +V  AI E GYRHVDTAA+Y
Sbjct  1     MASAKAMAQ-EKQDHFVLKSGHTIPAVGLGTWRAGSDTAHSVQTAITEAGYRHVDTAAEY  59

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G+++ VG+GLKAA+  G+ RK LFVTSK+WCT+L P RVRPAL NTL++LQLDY+DL+LI
Sbjct  60    GIEKEVGKGLKAAMETGISRKDLFVTSKIWCTNLVPDRVRPALENTLKDLQLDYIDLYLI  119

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA +PP+AGEV  FDME VW+EME LV D LV+DIGVCN+TV KLN+LLR A
Sbjct  120   HWPFRLKDGAHKPPEAGEVLEFDMESVWKEMENLVKDGLVKDIGVCNYTVAKLNRLLRSA  179

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKS  2204
              + P+VCQMEMHPGW+NDK+ +ACK N IHVTAYSPLGS E++L H+P+V+KVA KLNK+
Sbjct  180   NVTPAVCQMEMHPGWKNDKIFEACKKNGIHVTAYSPLGSSEKNLAHDPVVDKVAKKLNKT  239

Query  2203  PGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDM  2024
             PGQVL+KWA+QRGTS IPKS+   RIKENI VF WEIP++DF+ L SI D++RVL GE++
Sbjct  240   PGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFQVLCSIKDEKRVLTGEEL  299

Query  2023  FVNKTDGPFKNVADLWDHED  1964
             FVNKT GP+K+ +D+WDHE+
Sbjct  300   FVNKTHGPYKSASDIWDHEN  319



>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley
 pdb|2BGS|A Chain A, Holo Aldose Reductase From Barley
 pdb|2VDG|A Chain A, Barley Aldose Reductase 1 Complex With Butanol
Length=344

 Score =   451 bits (1161),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 206/305 (68%), Positives = 257/305 (84%), Gaps = 1/305 (0%)
 Frame = -2

Query  2875  FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQYGVQQGVGEGLKAAIH  2699
             F L SGH +PA+GLGTW+       +V  AI E GYRHVDTAA+YGV++ VG+GLKAA+ 
Sbjct  40    FVLKSGHAMPAVGLGTWRAGSDTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLKAAME  99

Query  2698  AGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPPK  2519
             AG++RK LFVTSK+WCT+L+P+RVRPAL NTL++LQLDY+DL+ IHWPF LK+GA  PP+
Sbjct  100   AGIDRKDLFVTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWPFRLKDGAHMPPE  159

Query  2518  AGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQMEMHPGW  2339
             AGEV  FDMEGVW+EME LV D LV+DIGVCN+TV KLN+LLR AKI P+VCQMEMHPGW
Sbjct  160   AGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLRSAKIPPAVCQMEMHPGW  219

Query  2338  RNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKSPGQVLVKWAIQRGTS  2159
             +NDK+ +ACK + IH+TAYSPLGS E++L H+P+VEKVANKLNK+PGQVL+KWA+QRGTS
Sbjct  220   KNDKIFEACKKHGIHITAYSPLGSSEKNLAHDPVVEKVANKLNKTPGQVLIKWALQRGTS  279

Query  2158  TIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNVADL  1979
              IPKS+   RIKENI VF WEIP++DF+ L SI D++RVL GE++FVNKT GP+++  D+
Sbjct  280   VIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIKDEKRVLTGEELFVNKTHGPYRSARDV  339

Query  1978  WDHED  1964
             WDHE+
Sbjct  340   WDHEN  344



>gb|EMT03679.1| Aldose reductase [Aegilops tauschii]
Length=313

 Score =   449 bits (1156),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 206/311 (66%), Positives = 259/311 (83%), Gaps = 1/311 (0%)
 Frame = -2

Query  2893  NEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQYGVQQGVGEG  2717
              EK   F L SGH +PA+GLGTW+       +V  AI E GYRHVDTAA+YGV++ VG+G
Sbjct  3     QEKQDHFVLKSGHAMPAVGLGTWRAGSDTAHSVQTAITEAGYRHVDTAAEYGVEKEVGKG  62

Query  2716  LKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEG  2537
             LKAA+ A ++RK LFVTSKLWCT+L P+RVRPAL NTL++LQLDY+DL+ IHWPF LK+G
Sbjct  63    LKAAMEARIDRKDLFVTSKLWCTNLVPERVRPALENTLKDLQLDYIDLYHIHWPFRLKDG  122

Query  2536  ASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQM  2357
             A +PP+AGEV  FDMEGVW+EME LV D LV+DIG+CN+TV KL++LLR AKI P+VCQM
Sbjct  123   AHKPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGICNYTVTKLDRLLRSAKITPAVCQM  182

Query  2356  EMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKSPGQVLVKWA  2177
             EMHPGW+NDK+ +ACK + IHVTAYSPLGS E++L H+P+VEKVANKLNK+PGQVL++WA
Sbjct  183   EMHPGWKNDKIFEACKKHGIHVTAYSPLGSSEKNLAHDPVVEKVANKLNKTPGQVLIRWA  242

Query  2176  IQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPF  1997
             +QRGTS IPKS+   RIKENI VF WEIP++DF+ L SI D++RVL GE++FVNKT GP+
Sbjct  243   LQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIKDEKRVLTGEELFVNKTHGPY  302

Query  1996  KNVADLWDHED  1964
             K+ +++WDHE+
Sbjct  303   KSASEVWDHEN  313



>ref|XP_007140187.1| hypothetical protein PHAVU_008G091300g [Phaseolus vulgaris]
 gb|ESW12181.1| hypothetical protein PHAVU_008G091300g [Phaseolus vulgaris]
Length=320

 Score =   449 bits (1156),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 224/321 (70%), Positives = 269/321 (84%), Gaps = 3/321 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ+ V     K  +F L SGH IPA+GLGTWK   H  ++V+ AIV  GYRH+DTA+QY
Sbjct  1     MAQV-VRPHEAKTQAFTLSSGHTIPAVGLGTWKSGSHAVNSVFTAIVNAGYRHIDTASQY  59

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GV++ VG+ L+ AI AGVERK LFVTSKLWCTDL+P+RVRPAL +TLQ+LQLDYLDL+LI
Sbjct  60    GVEEEVGQALQTAIKAGVERKDLFVTSKLWCTDLTPERVRPALNSTLQKLQLDYLDLYLI  119

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GASRPP AG+V  FDMEGVWREMEKLV +KLVRDIG+CNFT+ KL KLL IA
Sbjct  120   HWPFRLKDGASRPPGAGDVLEFDMEGVWREMEKLVEEKLVRDIGICNFTLAKLEKLLSIA  179

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLG-SDERDLVHNPMVEKVANKLNK  2207
             +I+PSVCQMEMHPGW+N+KML ACK N IHVTAYSPLG SD R+L+ +  V+++ANK NK
Sbjct  180   EIRPSVCQMEMHPGWKNEKMLAACKKNGIHVTAYSPLGSSDGRNLIKDQTVDRIANKSNK  239

Query  2206  SPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGED  2027
             +PGQVLVKWAIQRGTS IPKS    RI EN+SVF+WE+P+QDF+ALS + DQ R+LDGE+
Sbjct  240   NPGQVLVKWAIQRGTSVIPKSIKPDRIMENVSVFNWELPQQDFKALSKMQDQGRILDGEE  299

Query  2026  MFVNKTDGPFKNVADLWDHED  1964
             +FVNK+DGPF++ ADLWDHED
Sbjct  300   LFVNKSDGPFRSAADLWDHED  320



>gb|AAC49138.1| aldose reductase-related protein [Avena fatua]
 prf||2207360A aldose reductase
Length=319

 Score =   447 bits (1150),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 209/320 (65%), Positives = 260/320 (81%), Gaps = 2/320 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA      + E+   F L SGH IPA+GLGTW+       +V  AI E GYRHVDTAAQY
Sbjct  1     MASAKAMGQGEQ-DRFVLKSGHAIPAVGLGTWRAGSDTAHSVQTAITEAGYRHVDTAAQY  59

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             G+++ V +GLKAA+ AG++RK LFVTSK+W T+L+P+R RPAL NTL++LQLDY+DL+LI
Sbjct  60    GIEKEVDKGLKAAMEAGIDRKDLFVTSKIWRTNLAPERARPALENTLKDLQLDYIDLYLI  119

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA +PP+AGEV  FDMEGVW+EMEKLV D LV+DI VCNFTV KLN+LLR A
Sbjct  120   HWPFRLKDGAHQPPEAGEVLEFDMEGVWKEMEKLVKDGLVKDIDVCNFTVTKLNRLLRSA  179

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKS  2204
              I P+VCQMEMHPGW+NDK+ +ACK + IHVTAYSPLGS E++LVH+P+VEKVANKLNK+
Sbjct  180   NIPPAVCQMEMHPGWKNDKIFEACKKHGIHVTAYSPLGSSEKNLVHDPVVEKVANKLNKT  239

Query  2203  PGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDM  2024
             PGQVL+KWA+QRGTS IPKS+   RIKENI  F WEIP+ DF+ L SI D++RVL GE++
Sbjct  240   PGQVLIKWALQRGTSVIPKSSKDERIKENIQAFGWEIPEDDFQVLCSIKDEKRVLTGEEL  299

Query  2023  FVNKTDGPFKNVADLWDHED  1964
             FVNKT GP+K+ +++WDHE+
Sbjct  300   FVNKTHGPYKSASEVWDHEN  319



>ref|XP_008799819.1| PREDICTED: aldose reductase-like isoform X2 [Phoenix dactylifera]
Length=324

 Score =   443 bits (1139),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 266/329 (81%), Gaps = 8/329 (2%)
 Frame = -2

Query  2941  IKEAELKMAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRH  2765
             + +A+L  AQ     R      F L+SGH IP++GLGTW+      D V+ AI E GYRH
Sbjct  1     MAQAQLIPAQGQADPR-----CFHLISGHTIPSVGLGTWRSGSKASDAVFTAITEAGYRH  55

Query  2764  VDTAAQYGVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLD  2585
             VDTAA+YGVQ+ VG GL AA+ AG++RK LF+TSK+WC+DLSP RVR AL  TLQ+LQLD
Sbjct  56    VDTAAEYGVQEEVGHGLAAAMQAGIDRKDLFITSKIWCSDLSPDRVRTALKTTLQDLQLD  115

Query  2584  YLDLFLIHWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKL  2405
             YLDL+LIHWP HLK GA +PP+A EV  FDMEGVWREME+LV D LVRDIGVCNFT+ KL
Sbjct  116   YLDLYLIHWPIHLKGGAHKPPEAEEVQDFDMEGVWREMEQLVKDGLVRDIGVCNFTLKKL  175

Query  2404  NKLLRIAKIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGS--DERDLVHNPMVE  2231
             +KLLRIA+  PSVCQMEMHPGWRNDKML+ACK N IHVTAYSPLGS  D RDL+H+P V 
Sbjct  176   DKLLRIAQTMPSVCQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSQDDGRDLIHDPTVT  235

Query  2230  KVANKLNKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQ  2051
             +VANKLNK+PGQVLV+WA+QRGTS IPKS +A RIKENI VF WEIP+++F ALSSI DQ
Sbjct  236   EVANKLNKTPGQVLVRWALQRGTSVIPKSTNAERIKENIQVFGWEIPEEEFRALSSIRDQ  295

Query  2050  RRVLDGEDMFVNKTDGPFKNVADLWDHED  1964
             RRVLDGED+FVNKT GP++  ADLWD+ED
Sbjct  296   RRVLDGEDIFVNKTHGPYRCAADLWDNED  324



>ref|XP_002264660.1| PREDICTED: aldose reductase [Vitis vinifera]
 emb|CBI18096.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   443 bits (1139),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 221/321 (69%), Positives = 261/321 (81%), Gaps = 3/321 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKVQHPRDN-VYAAIVEGGYRHVDTAAQY  2744
             MA  T     E+V S +L+SGH IPA+GLGTW+      N V+ AIVE GYRH+DTA +Y
Sbjct  1     MAHATFAQTGEQVQSCKLISGHSIPAVGLGTWRAGSQASNAVFTAIVEAGYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ  VG+ LKAA+HAG+ER+ LFVTSKLWCT+L P RVR AL  TLQELQLDYLDL+LI
Sbjct  61    GVQAEVGQALKAAMHAGMERRDLFVTSKLWCTELEPGRVRSALSKTLQELQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+G SRPPKA ++  FDMEGVWREMEKLV + LVRDIGVCNFT+ KLNKLL  A
Sbjct  121   HWPFRLKDGPSRPPKATDILEFDMEGVWREMEKLVKEGLVRDIGVCNFTLKKLNKLLGFA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             +  PSVCQMEMHPGW+NDKML+ACK N IHVTAYSPLGS E  RDL+H+P+V  +A KLN
Sbjct  181   QTMPSVCQMEMHPGWKNDKMLEACKKNGIHVTAYSPLGSSEGGRDLIHDPVVGSIARKLN  240

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             KSPGQVLVKWA++RGTS IPKS++  RIKENI VF W++P +DF AL SIPDQ RVLDGE
Sbjct  241   KSPGQVLVKWALKRGTSVIPKSSNPERIKENIQVFGWDMPDEDFHALCSIPDQGRVLDGE  300

Query  2029  DMFVNKTDGPFKNVADLWDHE  1967
             ++FVNK +GPF++V +LWD+E
Sbjct  301   ELFVNKEEGPFRSVTELWDNE  321



>ref|XP_009420397.1| PREDICTED: aldose reductase [Musa acuminata subsp. malaccensis]
Length=365

 Score =   444 bits (1142),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 207/307 (67%), Positives = 249/307 (81%), Gaps = 4/307 (1%)
 Frame = -2

Query  2875  FRLLSGHIIPAIGLGTWKV--QHPRDNVYAAIVEGGYRHVDTAAQYGVQQGVGEGLKAAI  2702
              +L+SGH IP++GLGTWK        +VY AI E GYRHVDTA  Y +Q+ VG GL+AA+
Sbjct  58    IKLVSGHSIPSVGLGTWKSASSEASHSVYTAITEAGYRHVDTAPLYAIQEEVGRGLQAAL  117

Query  2701  HAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPP  2522
              AG+ R  LF+TSKLWCTDLSP RVR AL  TL+ELQL+YLDL+LIHWPFHLKEGA+RPP
Sbjct  118   QAGIPRNDLFITSKLWCTDLSPDRVRNALKQTLKELQLEYLDLYLIHWPFHLKEGATRPP  177

Query  2521  KAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQMEMHPG  2342
             +A ++  FDMEGVWREMEKLV D LVRDIGV NFT  KLNKLL+ A+I PSVCQMEMHPG
Sbjct  178   RASDILDFDMEGVWREMEKLVKDGLVRDIGVSNFTSKKLNKLLQCAQIMPSVCQMEMHPG  237

Query  2341  WRNDKMLDACKDNNIHVTAYSPLGS--DERDLVHNPMVEKVANKLNKSPGQVLVKWAIQR  2168
             WRNDK+L+ACK+N IHVTAYSPLGS   +RDL+H+P V  V+ KLNK+PGQVL+KW +QR
Sbjct  238   WRNDKILEACKNNGIHVTAYSPLGSSRSDRDLIHDPTVVTVSKKLNKTPGQVLLKWGLQR  297

Query  2167  GTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNV  1988
             GTS IPKS +A RIK NI +F W IP++D EAL+SI DQRR + GE+ FVNK++GP+K+V
Sbjct  298   GTSVIPKSTNADRIKGNIQLFGWAIPQEDLEALNSIRDQRRTVSGEETFVNKSEGPYKSV  357

Query  1987  ADLWDHE  1967
             A+LWD E
Sbjct  358   AELWDDE  364



>ref|XP_006828161.1| hypothetical protein AMTR_s00023p00097750 [Amborella trichopoda]
 gb|ERM95577.1| hypothetical protein AMTR_s00023p00097750 [Amborella trichopoda]
Length=319

 Score =   442 bits (1137),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 218/305 (71%), Positives = 255/305 (84%), Gaps = 1/305 (0%)
 Frame = -2

Query  2875  FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQYGVQQGVGEGLKAAIH  2699
             FRL+SGH IPA+GLGTWK       +V+ +IV+ GYRHVDTAA+YGVQ+ VG GLKAAIH
Sbjct  15    FRLVSGHTIPAVGLGTWKSGSDATQSVFTSIVQCGYRHVDTAAEYGVQEEVGHGLKAAIH  74

Query  2698  AGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPPK  2519
             AGVER+ LF+TSK+WCTDLSP RVR AL  TL+ELQLDYLDL+LIHWPFHL++GA+RP K
Sbjct  75    AGVERRDLFITSKIWCTDLSPDRVRKALNKTLEELQLDYLDLYLIHWPFHLRDGATRPSK  134

Query  2518  AGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQMEMHPGW  2339
               ++  FDMEGVW EME LV DKLVRDIGVCN+TV KL+KLLR AKI PSVCQMEMHPGW
Sbjct  135   PSDILEFDMEGVWGEMELLVRDKLVRDIGVCNYTVRKLDKLLRFAKIMPSVCQMEMHPGW  194

Query  2338  RNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKSPGQVLVKWAIQRGTS  2159
             RNDKML+ACK N IH+TAY+PLGS + DL+H+P V+KVANKLNK+ GQVLV+WAIQR TS
Sbjct  195   RNDKMLNACKKNKIHITAYAPLGSGDWDLIHHPTVQKVANKLNKTSGQVLVRWAIQRRTS  254

Query  2158  TIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNVADL  1979
              IPKS H  RIKENI  F WEIP +DFE L SI DQRRV+ GE++FVNK +GPFK+V +L
Sbjct  255   VIPKSTHTERIKENIQAFGWEIPDRDFEELCSILDQRRVITGEELFVNKEEGPFKSVEEL  314

Query  1978  WDHED  1964
             W+ ED
Sbjct  315   WEFED  319



>ref|XP_010922651.1| PREDICTED: aldose reductase-like isoform X1 [Elaeis guineensis]
Length=324

 Score =   440 bits (1131),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/307 (72%), Positives = 260/307 (85%), Gaps = 3/307 (1%)
 Frame = -2

Query  2875  FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQYGVQQGVGEGLKAAIH  2699
             F+LLSGH IPA+GLGTWK      + V  AI+E GYRHVDTA+QYG+++ VG+GL+AA+ 
Sbjct  18    FKLLSGHTIPAVGLGTWKSGSKASEAVSTAIIEAGYRHVDTASQYGIEKEVGQGLRAAMQ  77

Query  2698  AGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPPK  2519
             AG+ERK LF+TSKLWCTDLSP RVR AL NTLQ+LQLDYLDL+LIHWPF LKEGA RPP+
Sbjct  78    AGIERKDLFITSKLWCTDLSPDRVRVALKNTLQDLQLDYLDLYLIHWPFRLKEGAHRPPE  137

Query  2518  AGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQMEMHPGW  2339
             AGEV  FDMEGVWREME+LV D LVRDIGVCNFT+ KL+KLL+IA+ KPSVCQMEMHPGW
Sbjct  138   AGEVLDFDMEGVWREMEQLVKDGLVRDIGVCNFTLKKLDKLLQIAQTKPSVCQMEMHPGW  197

Query  2338  RNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLNKSPGQVLVKWAIQRG  2165
             RNDKML+ACK N I +TAYSPLGS +  RDL+H+P V KVANKLNK+ GQ+LVKWA+QRG
Sbjct  198   RNDKMLEACKKNGILITAYSPLGSQDHGRDLIHDPTVTKVANKLNKTQGQILVKWALQRG  257

Query  2164  TSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNVA  1985
             T  IPKS +A RI+ NI VF  EIP+ DF ALSSI DQRRVLDGED+FVNK+ GP+++ A
Sbjct  258   TIVIPKSTNAERIRGNIQVFGCEIPEVDFRALSSIRDQRRVLDGEDLFVNKSHGPYRSAA  317

Query  1984  DLWDHED  1964
             DLWD+ED
Sbjct  318   DLWDNED  324



>ref|XP_010922658.1| PREDICTED: aldose reductase-like [Elaeis guineensis]
Length=324

 Score =   438 bits (1126),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 217/307 (71%), Positives = 258/307 (84%), Gaps = 3/307 (1%)
 Frame = -2

Query  2875  FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQYGVQQGVGEGLKAAIH  2699
             FRL+SGH IP++GLGTW+      D V+ AI E GYRHVDTAA+YGVQ+ VG GL AA+ 
Sbjct  18    FRLISGHTIPSVGLGTWRSGPKASDAVFIAITEAGYRHVDTAAEYGVQEEVGHGLSAAMQ  77

Query  2698  AGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPPK  2519
             AG++R+ LF+ SK+WC+DL+P RVR AL  TLQ+LQLDYLDL+LIHWPF LKEGA +PP+
Sbjct  78    AGIDRQDLFIASKIWCSDLAPDRVRTALKTTLQDLQLDYLDLYLIHWPFRLKEGAHKPPE  137

Query  2518  AGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQMEMHPGW  2339
             AGE+  FDME VWREME+LV D LVRDIGVCNFT+ KL+KLLRIA+  PSVCQMEMHPGW
Sbjct  138   AGEILDFDMEAVWREMEQLVKDGLVRDIGVCNFTLKKLDKLLRIAQTMPSVCQMEMHPGW  197

Query  2338  RNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLNKSPGQVLVKWAIQRG  2165
             RNDKML+ACK N IHVTAYSPLGS +  RDL+H+P V +VANKLNK+PGQVLV+WA+QRG
Sbjct  198   RNDKMLEACKKNGIHVTAYSPLGSQDGGRDLIHDPTVTEVANKLNKTPGQVLVRWALQRG  257

Query  2164  TSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNVA  1985
             TS IPKS ++ RIKENI VF WEIP++DF AL+SI DQRRVLDGED+FVNK  GP++  A
Sbjct  258   TSVIPKSTNSERIKENIQVFGWEIPEEDFRALNSIRDQRRVLDGEDIFVNKIHGPYRCAA  317

Query  1984  DLWDHED  1964
             DLWD+ED
Sbjct  318   DLWDNED  324



>ref|XP_004961766.1| PREDICTED: aldose reductase-like [Setaria italica]
Length=319

 Score =   433 bits (1113),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/305 (70%), Positives = 254/305 (83%), Gaps = 1/305 (0%)
 Frame = -2

Query  2875  FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQYGVQQGVGEGLKAAIH  2699
             F L SGH IPA+GLGTW+       +V  AI E GYRHVDTAAQYGV++ VG+GLKAA+ 
Sbjct  15    FVLKSGHTIPAVGLGTWRAGSDSAHSVKTAITEAGYRHVDTAAQYGVEKEVGKGLKAAME  74

Query  2698  AGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPPK  2519
             AG+ RK LFVTSKLWCTDL+P +VRPAL NTL++LQLDYLDL+LIHWPF LK+GA  PP+
Sbjct  75    AGINRKDLFVTSKLWCTDLAPNKVRPALQNTLKDLQLDYLDLYLIHWPFRLKDGAHMPPE  134

Query  2518  AGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQMEMHPGW  2339
             AGEV  FD+EGVWREME LV D LV+DIGVCN+TV KLN+L+R A I P+VCQMEMHPGW
Sbjct  135   AGEVLEFDLEGVWREMESLVKDGLVKDIGVCNYTVTKLNRLMRSATIPPAVCQMEMHPGW  194

Query  2338  RNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKSPGQVLVKWAIQRGTS  2159
             +NDK+ +ACK + IHVTAYSPLGS E++L H+P VEKVANKLNK+PGQVL+KWA+QRGTS
Sbjct  195   KNDKIFEACKKHGIHVTAYSPLGSSEKNLAHDPAVEKVANKLNKTPGQVLIKWALQRGTS  254

Query  2158  TIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNVADL  1979
              IPKS    RIKENI VF WEIP++DF+ L SI D++RVL GE++FVNKT GP+K+ ++L
Sbjct  255   VIPKSTKDERIKENIQVFGWEIPEEDFKVLCSIKDEKRVLTGEELFVNKTHGPYKSASEL  314

Query  1978  WDHED  1964
             WDHED
Sbjct  315   WDHED  319



>ref|XP_008799821.1| PREDICTED: aldose reductase [Phoenix dactylifera]
Length=324

 Score =   432 bits (1112),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 258/307 (84%), Gaps = 3/307 (1%)
 Frame = -2

Query  2875  FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQYGVQQGVGEGLKAAIH  2699
             F+LLSG  IP +GLGTWK      D V  AI+E GYRHVDTA+QYG+++ VG+GL+AA+ 
Sbjct  18    FKLLSGRTIPRVGLGTWKSGSKASDAVSTAIIEAGYRHVDTASQYGIEKEVGQGLRAAMK  77

Query  2698  AGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPPK  2519
             AG+ERK LF+TSKLWCTDLS  RVR AL NTLQ+LQLDYLDL+LIHWPF LK GA +PP+
Sbjct  78    AGIERKDLFITSKLWCTDLSADRVRVALKNTLQDLQLDYLDLYLIHWPFRLKGGAHKPPE  137

Query  2518  AGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQMEMHPGW  2339
             AGEV  FDMEGVWREME+LV D LVRDIGVCNFT+ KL+KLL+IA+ KPSVCQMEMHPGW
Sbjct  138   AGEVLDFDMEGVWREMEQLVKDGLVRDIGVCNFTLKKLDKLLQIAQTKPSVCQMEMHPGW  197

Query  2338  RNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLNKSPGQVLVKWAIQRG  2165
             RNDKML+ACK N I VTAYSPLGS +  RDL+H+  V KVANKLNK+ GQ+LVKWA+QRG
Sbjct  198   RNDKMLEACKKNGIQVTAYSPLGSQDHGRDLIHDLTVTKVANKLNKTQGQILVKWALQRG  257

Query  2164  TSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNVA  1985
             TS IPKS +A RI EN+ VF +EIP++DF ALSSI DQRRV+DGED+FVNK+ GP+++ A
Sbjct  258   TSVIPKSTNAERIGENMQVFGFEIPEEDFRALSSIRDQRRVVDGEDLFVNKSHGPYRSTA  317

Query  1984  DLWDHED  1964
             DLWD+ED
Sbjct  318   DLWDNED  324



>gb|AAD22264.1|AF133841_1 aldose reductase ALDRXV4 [Xerophyta viscosa]
Length=319

 Score =   431 bits (1107),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 214/310 (69%), Positives = 250/310 (81%), Gaps = 1/310 (0%)
 Frame = -2

Query  2893  NEKVGSFRLLSGHIIPAIGLGTWKVQHPRDN-VYAAIVEGGYRHVDTAAQYGVQQGVGEG  2717
             + K  SF+LLSGH IPA+GLGTWK      N VY AI EGGYRH+DTAAQYGV + VG  
Sbjct  9     DAKTQSFKLLSGHSIPAVGLGTWKSGDKAGNAVYTAITEGGYRHIDTAAQYGVHEEVGNA  68

Query  2716  LKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEG  2537
             L++A+ AG+ RK LFVTSK+WC DLSP+RVRPAL NTL+ELQLDYLDL+LIHWP HLK+G
Sbjct  69    LQSALKAGINRKALFVTSKVWCEDLSPERVRPALKNTLEELQLDYLDLYLIHWPIHLKKG  128

Query  2536  ASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQM  2357
             A  PP+AGEV  FD+ GVWREMEKLV   LVRDIG+ NFTV KL KLL  A+IKPSVCQM
Sbjct  129   AHMPPEAGEVLEFDIGGVWREMEKLVKVGLVRDIGISNFTVKKLEKLLNFAEIKPSVCQM  188

Query  2356  EMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKSPGQVLVKWA  2177
             EMHPGWR  KM + C+   IH TAYSPLGS ERDL+ +P V K+ANKLNKSPGQ+LV+WA
Sbjct  189   EMHPGWRKHKMFEICRKYGIHTTAYSPLGSSERDLLSDPTVLKIANKLNKSPGQLLVRWA  248

Query  2176  IQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPF  1997
             +QRGTS IPKS +  RIKENI VF WEIP +DF+ LSS+ +Q+RVLDGED+FVNKT GPF
Sbjct  249   VQRGTSVIPKSTNPERIKENIQVFGWEIPAEDFQILSSLSEQKRVLDGEDLFVNKTHGPF  308

Query  1996  KNVADLWDHE  1967
             ++ A+LWD E
Sbjct  309   RSAAELWDGE  318



>ref|XP_002526696.1| protein phosphatase-2c, putative [Ricinus communis]
 gb|EEF35718.1| protein phosphatase-2c, putative [Ricinus communis]
Length=463

 Score =   431 bits (1109),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 216/405 (53%), Positives = 273/405 (67%), Gaps = 42/405 (10%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MGACC+  +       RV     ++      E D  V  GD+GAR+RLHG+S+++SMYSQ
Sbjct  1     MGACCS--KEPSFAEGRVVEDVVEDREYEGNEDDDHVAIGDYGARMRLHGASKYISMYSQ  58

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA------  793
             QGKKGVNQDAMTVWE F G K  FFCGVFDGHGP GH+VA+ +RD LPS+LS A      
Sbjct  59    QGKKGVNQDAMTVWEEFIGNKDMFFCGVFDGHGPYGHKVARHVRDTLPSRLSAAIKLSQA  118

Query  794   -----------------------SKDNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALE  904
                                    SKD       +     L S W+++F + FKD+D  L 
Sbjct  119   NSIKYGDTDTADGEDSDDSKSEGSKDGENSNSTNNKGTLLLSSWEASFFKCFKDMDEELS  178

Query  905   GEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPV  1084
              +  IDSF SGTTAVT++KQG HLII NLGDSRA++CTR + +QLVP QLTVDLKPN+  
Sbjct  179   LDASIDSFCSGTTAVTVVKQGNHLIIANLGDSRAVLCTRSNKNQLVPVQLTVDLKPNIAS  238

Query  1085  ESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRK  1264
             E+ERIK+  GRV A AEEP V+R+WMP++DCPGLAMARAFGDFCLKDYG+IS PE+ YR+
Sbjct  239   EAERIKNRNGRVFAMAEEPEVYRIWMPDEDCPGLAMARAFGDFCLKDYGLISTPEVSYRR  298

Query  1265  ISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDD  1444
             ++ +DEFVVLA+DG+WDVLSNY+VI+ VA+A+KRSMAA+++++ AVR W+ KYP  + DD
Sbjct  299   LTNKDEFVVLATDGIWDVLSNYDVIRIVASARKRSMAAKMLIKYAVRAWRNKYPGCRVDD  358

Query  1445  CAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEENSAIIAET  1579
             CAV+CLF K       +T+     L  SF E  R   N   +AET
Sbjct  359   CAVICLFLKS------RTV-----LTRSFSEVSRVSANHTELAET  392



>ref|NP_001241850.1| aldose reductase [Zea mays]
 gb|ADU32868.1| aldose reductase [Zea mays]
 gb|AFW78354.1| putative oxidoreductase, aldo/keto reductase family protein [Zea 
mays]
Length=319

 Score =   426 bits (1094),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 210/320 (66%), Positives = 256/320 (80%), Gaps = 2/320 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA      + E+ G F L SGH IPA+GLGTW+       +V  AI E GYRHVDTAAQY
Sbjct  1     MASAQAVGQGER-GHFVLKSGHTIPAVGLGTWRAGSDTAHSVRTAIAEAGYRHVDTAAQY  59

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GV++ VG GLKAA+  G+ RK LFVTSKLWCT+L+P RVRPAL  TL++LQLDYLDL+LI
Sbjct  60    GVEKEVGRGLKAAMEGGINRKDLFVTSKLWCTELAPDRVRPALEKTLKDLQLDYLDLYLI  119

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA  PP+AGEV  FDMEGVWREME LV D LV+DIGVCN+TV KLN+L+R A
Sbjct  120   HWPFRLKDGAHMPPEAGEVLEFDMEGVWREMEGLVKDGLVKDIGVCNYTVAKLNRLMRSA  179

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKS  2204
              + P+VCQMEMHPGW+ND++ +ACK + IHVTAYSPLGS E++L H+P+VEKVANKL+K+
Sbjct  180   NVPPAVCQMEMHPGWKNDRIFEACKKHGIHVTAYSPLGSSEKNLAHDPLVEKVANKLDKT  239

Query  2203  PGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDM  2024
             PGQVL++WA+QRGTS IPKS    RIKENI VF WEIP++DF AL  I D++RVL GE++
Sbjct  240   PGQVLLRWALQRGTSVIPKSTRDERIKENIQVFGWEIPEEDFRALCGIKDEKRVLTGEEL  299

Query  2023  FVNKTDGPFKNVADLWDHED  1964
             FVNKT GP+K+  ++WDHED
Sbjct  300   FVNKTHGPYKSATEVWDHED  319



>gb|AAA21751.1| aldose reductase-related protein [Bromus inermis]
Length=320

 Score =   425 bits (1093),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/320 (66%), Positives = 259/320 (81%), Gaps = 1/320 (0%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA        E+   F L SGH IPA+GLGTW+       +V  AI E GYRHVDTAA+Y
Sbjct  1     MASAKAMMGQERQDHFVLKSGHAIPAVGLGTWRAGSDTAHSVQTAITEAGYRHVDTAAEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GV++ VG+GLKAA+ AG++RK LFVTSKLWCTDL P RVRPAL  TL++LQLDYLDL+LI
Sbjct  61    GVEKEVGKGLKAAMEAGIDRKDLFVTSKLWCTDLVPDRVRPALEKTLKDLQLDYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA +PP+AGEV  FDMEGVW+EME LV D LV+DIGVCN+TV KLN+LL+ A
Sbjct  121   HWPFRLKDGAHKPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLQSA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKS  2204
             KI P+VCQMEMHPGW+NDK+L+ACK + IH TAYSPL S E++L H+P+VEKVANKLNK+
Sbjct  181   KIAPAVCQMEMHPGWKNDKILEACKKHGIHATAYSPLCSSEKNLAHDPVVEKVANKLNKT  240

Query  2203  PGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDM  2024
             PGQVL+KWA+QRGT  IPKS+   RIKENI VF WEIP++DF+ L SI D++RVL GE++
Sbjct  241   PGQVLIKWALQRGTIVIPKSSKDERIKENIQVFGWEIPEEDFQVLCSIKDEKRVLTGEEL  300

Query  2023  FVNKTDGPFKNVADLWDHED  1964
             FVNKT GP+K+ +++WD+E+
Sbjct  301   FVNKTHGPYKSASEVWDNEN  320



>ref|XP_008799818.1| PREDICTED: aldose reductase-like isoform X1 [Phoenix dactylifera]
Length=359

 Score =   425 bits (1093),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 222/342 (65%), Positives = 258/342 (75%), Gaps = 38/342 (11%)
 Frame = -2

Query  2875  FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQYGVQQGVGEGLKAAIH  2699
             F L+SGH IP++GLGTW+      D V+ AI E GYRHVDTAA+YGVQ+ VG GL AA+ 
Sbjct  18    FHLISGHTIPSVGLGTWRSGSKASDAVFTAITEAGYRHVDTAAEYGVQEEVGHGLAAAMQ  77

Query  2698  AGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPPK  2519
             AG++RK LF+TSK+WC+DLSP RVR AL  TLQ+LQLDYLDL+LIHWP HLK GA +PP+
Sbjct  78    AGIDRKDLFITSKIWCSDLSPDRVRTALKTTLQDLQLDYLDLYLIHWPIHLKGGAHKPPE  137

Query  2518  AGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVC--------  2363
             A EV  FDMEGVWREME+LV D LVRDIGVCNFT+ KL+KLLRIA+  PSVC        
Sbjct  138   AEEVQDFDMEGVWREMEQLVKDGLVRDIGVCNFTLKKLDKLLRIAQTMPSVCQVCYLLFF  197

Query  2362  ---------------------------QMEMHPGWRNDKMLDACKDNNIHVTAYSPLGS-  2267
                                        QMEMHPGWRNDKML+ACK N IHVTAYSPLGS 
Sbjct  198   YVFFRALQVMKHLSYYWTNVMFPWAGAQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSQ  257

Query  2266  -DERDLVHNPMVEKVANKLNKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIP  2090
              D RDL+H+P V +VANKLNK+PGQVLV+WA+QRGTS IPKS +A RIKENI VF WEIP
Sbjct  258   DDGRDLIHDPTVTEVANKLNKTPGQVLVRWALQRGTSVIPKSTNAERIKENIQVFGWEIP  317

Query  2089  KQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNVADLWDHED  1964
             +++F ALSSI DQRRVLDGED+FVNKT GP++  ADLWD+ED
Sbjct  318   EEEFRALSSIRDQRRVLDGEDIFVNKTHGPYRCAADLWDNED  359



>gb|KDO63278.1| hypothetical protein CISIN_1g045692mg [Citrus sinensis]
Length=424

 Score =   424 bits (1090),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 204/361 (57%), Positives = 267/361 (74%), Gaps = 9/361 (2%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadee--HDGIVGRGDFGARVRLHGSSRFVSMY  625
             MG CC+ + VK   VY  +  E K+     +    D  V  GD GA VRL GSS+ +SM+
Sbjct  1     MGGCCSIE-VKYGSVYEEEEMERKDNYNNKKIGGEDDFVRVGDNGASVRLQGSSKNISMF  59

Query  626   SQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK--  799
             +QQG+KG+NQDAMTVWE+F G+K   FCGVFDGHGP+GH++A+ +RD LPSKLS A K  
Sbjct  60    TQQGRKGINQDAMTVWENFTGDKDTVFCGVFDGHGPAGHKIARHVRDNLPSKLSTAIKLL  119

Query  800   -DNSQDFEK--DIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGE  970
               N +D+        +P F   +++  ++++++D+ L     +DS+SSG TAV +IK+GE
Sbjct  120   KRNHEDYSNGSKSSQNPFFRALEASLVKAYEELDDELGLASAVDSYSSGATAVNIIKKGE  179

Query  971   HLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVF  1150
             HLII NLGDSRA++CTRDD +QLVP QLT DLKP +  E+ERI++CKGRV A  EEP+V+
Sbjct  180   HLIIANLGDSRAVLCTRDDRNQLVPVQLTTDLKPEIASEAERIRNCKGRVFAMDEEPDVY  239

Query  1151  RVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNY  1330
             RVWMP++DCPGLAMARAFGDFCLKDYG+IS+PEI YRK++  D+FVVLA+DGVWDVL+N 
Sbjct  240   RVWMPDEDCPGLAMARAFGDFCLKDYGLISIPEISYRKLTREDQFVVLATDGVWDVLTNS  299

Query  1331  EVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQA  1510
             EVI+TVA A K+ MAA+++V RAVR W+ KYP SK DDCA +CLF    KP+L K+ S  
Sbjct  300   EVIRTVACASKKEMAAKMLVSRAVRAWRTKYPGSKIDDCAAICLFLGH-KPLLTKSKSDT  358

Query  1511  A  1513
             +
Sbjct  359   S  359



>gb|KDP22816.1| hypothetical protein JCGZ_00403 [Jatropha curcas]
Length=416

 Score =   421 bits (1082),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/346 (58%), Positives = 258/346 (75%), Gaps = 14/346 (4%)
 Frame = +2

Query  551   DGIVGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHG  730
             D  V   D+GAR+RL G+S+F+SMYSQQGKKGVNQDAMTVWE F G K  FFCGVFDGHG
Sbjct  32    DDHVTIADYGARMRLQGASKFISMYSQQGKKGVNQDAMTVWEEFLGNKDMFFCGVFDGHG  91

Query  731   PSGHRVAQFIRDRLPSKLSVASK------------DNSQDFEKDIHHHP-LFSKWKSTFP  871
             P GH+V++ +RD LPS+LS A K             N  +  KD      L S  +++F 
Sbjct  92    PYGHKVSRHVRDTLPSRLSAAIKLSQANNFRYGTDGNDGNGSKDGDQGSRLLSSLEASFI  151

Query  872   QSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQ  1051
             + FK++D  L  +  IDSF SG+TAVT++KQG HLI+ NLGDSRA++CTR + +QLVP Q
Sbjct  152   KCFKEMDEELSLDASIDSFCSGSTAVTVVKQGNHLIVSNLGDSRAVLCTRSNGNQLVPVQ  211

Query  1052  LTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYG  1231
             LTVDLKPN+  E+ERIK+ KGR+ A  EEP VFR+WMP++DCPGLAMARAFGDFCLKDYG
Sbjct  212   LTVDLKPNIASEAERIKNSKGRIFAMKEEPEVFRIWMPDEDCPGLAMARAFGDFCLKDYG  271

Query  1232  VISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTW  1411
             +IS+PE+ YR+++  DEFVVLA+DG+WDVLSNY+VI  VA+A+KRSMAA+++V+ AVR W
Sbjct  272   LISIPEVSYRRLTNNDEFVVLATDGIWDVLSNYDVIHIVASARKRSMAAKILVKYAVRAW  331

Query  1412  KQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRN  1549
             K KYP  + DDCAVVCLF K  + +L ++ S+ + ++ +  E   N
Sbjct  332   KNKYPGCRVDDCAVVCLFLK-SRTVLSRSFSEVSRVSANHTELAEN  376



>ref|XP_003623413.1| Aldose reductase-like protein [Medicago truncatula]
 gb|AES79631.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=300

 Score =   416 bits (1069),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 209/293 (71%), Positives = 244/293 (83%), Gaps = 4/293 (1%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MAQ TV     K  SF LLSGH IPAIGLGTWK      ++V+ AI E GYRH+DTAAQY
Sbjct  1     MAQ-TVKPHEPKTKSFDLLSGHSIPAIGLGTWKSGSQAINSVFTAITEAGYRHIDTAAQY  59

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ+ VG  L++A+ AGVERK LF+TSK+WCTDL+P+RVRPAL NTLQELQLDYLDL+L+
Sbjct  60    GVQEEVGHALQSAMQAGVERKDLFITSKIWCTDLTPERVRPALNNTLQELQLDYLDLYLV  119

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GASRPPKAGEVS FDMEGVWREMEKLV + LVRDIG+CNFT+ KL+KL+ IA
Sbjct  120   HWPFLLKDGASRPPKAGEVSEFDMEGVWREMEKLVKENLVRDIGICNFTLTKLDKLVNIA  179

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
             ++ PSVCQMEMHPGWRNDKML+ACK N IHVTAYSPLGS +  RDL+H+  V+++A KLN
Sbjct  180   QVMPSVCQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSQDGGRDLIHDQTVDRIAKKLN  239

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQ  2051
             KSPGQVLVKWA+QRGTS IPKS + +RIKEN+ VF+WE+P  DF  LS IPDQ
Sbjct  240   KSPGQVLVKWAMQRGTSVIPKSTNPNRIKENVVVFNWELPDNDFNKLSKIPDQ  292



>ref|XP_002264900.2| PREDICTED: probable protein phosphatase 2C 65 [Vitis vinifera]
Length=441

 Score =   421 bits (1082),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 250/332 (75%), Gaps = 21/332 (6%)
 Frame = +2

Query  572   DFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVA  751
             D G+RVRL G+S + SM++Q G+KG+NQDAMTVWE F GEKG FFC V DGHGPSGH VA
Sbjct  32    DGGSRVRLGGNSMYTSMFTQGGRKGINQDAMTVWEDFSGEKGMFFCAVLDGHGPSGHHVA  91

Query  752   QFIRDRLPSKLSVASK---------------DNSQDFEKDIHH-----HPLFSKWKSTFP  871
               +RD LPS+LS A K                N +D  KD H      +PLF  WK++  
Sbjct  92    GLVRDILPSRLSSAFKLSLPNSSKCDSDIVHGNHKDDSKDSHENKNFEYPLFPLWKASLI  151

Query  872   QSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQ  1051
             +SF+++D  L      DSF SGTTAVT+IKQ +HLII NLGDSRA++CTR + +QLVP Q
Sbjct  152   KSFEEMDEELGSNSTFDSFCSGTTAVTVIKQEDHLIIANLGDSRAVLCTRGNRNQLVPVQ  211

Query  1052  LTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYG  1231
             LTVDLKPNLP E+ERIK+CKGRV A  +E  V+R+WMP+Q+ PGLAM RAFGDFCLKDYG
Sbjct  212   LTVDLKPNLPSEAERIKNCKGRVFALPDESGVYRLWMPDQNSPGLAMTRAFGDFCLKDYG  271

Query  1232  VISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTW  1411
             +IS+P++ YRK++++DEFVVLASDGVWDVLSN EV + VA+AKKRSMAA+L+V+RAVR W
Sbjct  272   LISIPDVSYRKLTDKDEFVVLASDGVWDVLSNSEVTRIVASAKKRSMAAQLLVDRAVREW  331

Query  1412  KQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQ  1507
             K KYP  KTDDCAV+CLF K P P+  K+ S+
Sbjct  332   KIKYPGCKTDDCAVICLFLKTP-PLSTKSTSK  362



>gb|EPS62214.1| hypothetical protein M569_12579, partial [Genlisea aurea]
Length=360

 Score =   416 bits (1070),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 195/365 (53%), Positives = 270/365 (74%), Gaps = 20/365 (5%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MG CC+C  V +R    V    +  E       + +V RG  GAR+RL GSS+++SM++Q
Sbjct  1     MGGCCSCH-VGRRMSDGVDGGGSDVE------EEDVVMRGPSGARIRLQGSSKYISMFTQ  53

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSV------A  793
             QGKKG+NQDAMTVWE+F G++  FFCGVFDGHGPSGH+VA+FIRD LP+K+S        
Sbjct  54    QGKKGINQDAMTVWENFSGDRDMFFCGVFDGHGPSGHKVAKFIRDSLPAKISAKYLESPP  113

Query  794   SKDNSQDFEKDIH---HHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQ  964
               D+  + EK+      +P F  WK+   + + DID  LEGE  I+S+ SGTT+V ++K+
Sbjct  114   PPDDGDEKEKETESQGENPSFDTWKARLIECYNDIDEKLEGESSIESYCSGTTSVCVLKK  173

Query  965   GEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPN  1144
             G HL+I NLGDSRA++  +DD DQL+PEQLTVDLKPNLP E+ RI++ +GRV+A  EEP+
Sbjct  174   GHHLVIANLGDSRAVVAKKDDQDQLIPEQLTVDLKPNLPEEANRIRNSQGRVLAMDEEPH  233

Query  1145  VFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLS  1324
             +FR+WMP +DCPGLAMARAFGDFCLKD+G+IS P++ YR++++RDEF+VLA+DG+WD LS
Sbjct  234   IFRIWMPHEDCPGLAMARAFGDFCLKDFGLISTPQVTYRRLNDRDEFLVLATDGIWDALS  293

Query  1325  NYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFF----KRPKPMLL  1492
             N EV++ V +A+KRS AA+ +VERA+++W+ K+P ++ DDCA V LFF    ++ +P L 
Sbjct  294   NEEVVRIVGSARKRSSAAKSLVERAIQSWRYKFPRARIDDCAAVILFFTAEKRQQQPALT  353

Query  1493  KTMSQ  1507
             K+ S+
Sbjct  354   KSASE  358



>dbj|BAJ89849.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   414 bits (1065),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 236/291 (81%), Gaps = 1/291 (0%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQY  2744
             MA    T    +   F L SGH +PA+GLGTW+       +V  AI E GYRHVDTAA+Y
Sbjct  1     MASAKATMGQGEQDHFVLKSGHAMPAVGLGTWRAGSDTAHSVRTAITEAGYRHVDTAAEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GV++ VG+GLKAA+ AG++RK LFVTSK+WCT+L+P+RVRPAL NTL++LQLDY+DL+ I
Sbjct  61    GVEKEVGKGLKAAMEAGIDRKDLFVTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             HWPF LK+GA  PP+AGEV  FDMEGVW+EME LV D LV+DIGVCN+TV KLN+LLR A
Sbjct  121   HWPFRLKDGAHMPPEAGEVLEFDMEGVWKEMENLVKDGLVKDIGVCNYTVTKLNRLLRSA  180

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKS  2204
             KI P+VCQMEMHPGW+NDK+ +ACK + IHVTAYSPLGS E++L H+P+VEKVANKLNK+
Sbjct  181   KIPPAVCQMEMHPGWKNDKIFEACKKHGIHVTAYSPLGSSEKNLAHDPVVEKVANKLNKT  240

Query  2203  PGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQ  2051
             PGQVL+KWA+QRGTS IPKS+   RIKENI VF WEIP++DF+ L SI D+
Sbjct  241   PGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIKDE  291



>ref|XP_008442353.1| PREDICTED: aldose reductase isoform X1 [Cucumis melo]
Length=352

 Score =   416 bits (1069),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 234/295 (79%), Gaps = 4/295 (1%)
 Frame = -2

Query  2923  KMAQMTVTARNEKVGS-FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAA  2750
             KMAQ  +T + +     F L+SGH IPA+GLGTW+      D+V+ AIVE GYRH+DTAA
Sbjct  23    KMAQAVMTPQVQDAERYFTLVSGHRIPAVGLGTWRSGSRADDSVFNAIVEAGYRHIDTAA  82

Query  2749  QYGVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLF  2570
             +YGV + VG GL+AAI AG+ R+ +FVT+KLWC+DLSP RVR  L N LQELQ+DYLDL 
Sbjct  83    EYGVHEEVGFGLQAAIKAGIRREDIFVTTKLWCSDLSPNRVRIGLNNALQELQVDYLDLL  142

Query  2569  LIHWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLR  2390
             LIHWPFHLKEGASRPPK GEV   DMEGVWREMEKLV + LVRDIG+ NFT+ KL+ LL 
Sbjct  143   LIHWPFHLKEGASRPPKEGEVLDLDMEGVWREMEKLVKENLVRDIGISNFTLKKLDNLLS  202

Query  2389  IAKIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANK  2216
              A+  PSVCQMEMHPGWRNDKML+ACK N IHVTAYSPLGS +  RDL+H+  VE++A K
Sbjct  203   FAQTMPSVCQMEMHPGWRNDKMLEACKKNGIHVTAYSPLGSSDGGRDLIHDEAVERIAKK  262

Query  2215  LNKSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQ  2051
             LN++PGQ+LVKWA+QRGTS IPKS H  RIKENI+VF WEIP +DFEAL  IP Q
Sbjct  263   LNRTPGQILVKWALQRGTSAIPKSTHLERIKENIAVFGWEIPVEDFEALCRIPTQ  317



>emb|CAN65584.1| hypothetical protein VITISV_019794 [Vitis vinifera]
Length=441

 Score =   418 bits (1075),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 249/332 (75%), Gaps = 21/332 (6%)
 Frame = +2

Query  572   DFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVA  751
             D G+RVRL G+S + SM++Q G+KG+NQDAMTVWE F GEKG FFC V DGHGPSGH VA
Sbjct  32    DGGSRVRLGGNSMYTSMFTQGGRKGINQDAMTVWEDFSGEKGMFFCAVLDGHGPSGHHVA  91

Query  752   QFIRDRLPSKLSVASK---------------DNSQDFEKDIHH-----HPLFSKWKSTFP  871
               +RD LPS+LS A K                N +D  KD H      +P F  WK++  
Sbjct  92    GLVRDILPSRLSSAFKLSLPNSSKCDSDIVHGNHKDDSKDSHENKNFEYPXFPLWKASLI  151

Query  872   QSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQ  1051
             +SF+++D  L      DSF SGTTAVT+IKQ +HLII NLGDSRA++CTR + +QLVP Q
Sbjct  152   KSFEEMDEELGSNSTFDSFCSGTTAVTVIKQEDHLIIANLGDSRAVLCTRGNRNQLVPVQ  211

Query  1052  LTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYG  1231
             LTVDLKPNLP E+ERIK+CKGRV A  +E  V+R+WMP+Q+ PGLAM RAFGDFCLKDYG
Sbjct  212   LTVDLKPNLPSEAERIKNCKGRVFALPDESGVYRLWMPDQNSPGLAMTRAFGDFCLKDYG  271

Query  1232  VISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTW  1411
             +IS+P++ YRK++++DEFVVLASDGVWDVLSN EV + VA+AKKRSMAA+L+V+RAVR W
Sbjct  272   LISIPDVSYRKLTDKDEFVVLASDGVWDVLSNSEVTRIVASAKKRSMAAQLLVDRAVREW  331

Query  1412  KQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQ  1507
             K KYP  KTDDCAV+CLF K P P+  K+ S+
Sbjct  332   KIKYPGCKTDDCAVICLFLKTP-PLSTKSTSK  362



>gb|KHN40686.1| Hypothetical protein glysoja_001184 [Glycine soja]
Length=424

 Score =   417 bits (1071),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 203/362 (56%), Positives = 258/362 (71%), Gaps = 23/362 (6%)
 Frame = +2

Query  548   HDGIVGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGH  727
             H+  V     GA VRL GSSRFVSMY+QQG+KGVNQDAMTVWE + GEK   FCGVFDGH
Sbjct  28    HENDVSFEQGGALVRLRGSSRFVSMYAQQGQKGVNQDAMTVWEDYTGEKDVIFCGVFDGH  87

Query  728   GPSGHRVAQFIRDRLPSKLSVASKDNSQ-----------------DFEKDIHHHPLFSKW  856
             GP GH+V+QFIRD LPSKLS A + + Q                 D   D +H+   + W
Sbjct  88    GPLGHKVSQFIRDNLPSKLSAAIEISQQKTIKYYDANDAETGCFDDAYDDNNHNMSLASW  147

Query  857   KSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQ  1036
             +    +SF ++D  L  E   DS+ SG TAVTLIKQG  LI+GNLGDSRA++CTRD  DQ
Sbjct  148   EGCLLKSFDEMDEYLAQEINTDSYCSGCTAVTLIKQGGQLIVGNLGDSRAVLCTRD-RDQ  206

Query  1037  LVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFC  1216
             L+P QLTVDLKP++P E+ RI +C+GRV A  EEP+V+R+WMP+ DCPGLAM+RAFGDFC
Sbjct  207   LIPVQLTVDLKPDIPSETSRIVNCEGRVFAAEEEPDVYRIWMPDDDCPGLAMSRAFGDFC  266

Query  1217  LKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVER  1396
             LKDYG+ISVP++FYRKI+ +DEFVVLA+DGVWDVL+N EVI  VA+A +RS+AA+L+V+R
Sbjct  267   LKDYGLISVPDVFYRKITPQDEFVVLATDGVWDVLTNSEVINIVASAPRRSIAAKLLVKR  326

Query  1397  AVRTWKQKYPCSKTDDCAVVCLFFKRPKPML-----LKTMSQAAGLNMSFPETGRNEENS  1561
             AVR W+ KYP SK DDCA +CLF      +L     +   S+    +++  ++ RNE+N 
Sbjct  327   AVRAWRYKYPGSKVDDCAAICLFLGEQSVLLNSQSYMSRKSRQRSKHLNRTKSTRNEDNE  386

Query  1562  AI  1567
              +
Sbjct  387   TV  388



>ref|XP_003533680.1| PREDICTED: probable protein phosphatase 2C 73-like [Glycine max]
Length=434

 Score =   417 bits (1071),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 205/363 (56%), Positives = 259/363 (71%), Gaps = 27/363 (7%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA VRL GSSRF SMYSQQG+KGVNQDAMTVWE + GEK   FCGVFDGHGP GH+V+QF
Sbjct  38    GALVRLRGSSRFASMYSQQGQKGVNQDAMTVWEDYTGEKDVIFCGVFDGHGPLGHKVSQF  97

Query  758   IRDRLPSKLSVASKDNSQ-----------------DFEKDIHHHPLFSKWKSTFPQSFKD  886
             IRD LPSKLS A + + Q                 D   D +H+   + W+    +SF +
Sbjct  98    IRDNLPSKLSAAIEISQQKTIKYYDANDAETGSFDDAYDDNNHNMSLASWEGCLLKSFDE  157

Query  887   IDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDL  1066
             +D  L  E   DS+ SG TAVTLIKQG+ LI+GNLGDSRA++CTRD  DQL+P QLTVDL
Sbjct  158   MDEYLAQEINTDSYCSGCTAVTLIKQGDQLIVGNLGDSRAVLCTRD-RDQLIPVQLTVDL  216

Query  1067  KPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVP  1246
             KP++P E+ RI +C+GRV A  EEP+V+R+WMP+ DCPGLAM+RAFGDFCLKDYG+ISVP
Sbjct  217   KPDIPSETSRIVNCEGRVFAAEEEPDVYRIWMPDDDCPGLAMSRAFGDFCLKDYGLISVP  276

Query  1247  EIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYP  1426
             ++FYRKI+ +DEFVVLA+DGVWDVL+N EVI  VA+A +RS+AA+L+V+RAVR W+ KYP
Sbjct  277   DVFYRKITPQDEFVVLATDGVWDVLTNSEVINIVASAPRRSIAAKLLVKRAVRAWRYKYP  336

Query  1427  CSKTDDCAVVCLFFKRPKPML-------LKTMSQAAGLNMSFPETGRNEENSAIIAETDD  1585
              SK DDCAV+CLF      +         K+  ++  LN +  ++ RNE+N  +  +   
Sbjct  337   GSKVDDCAVICLFLDAQSALSHSQSYSNRKSRQRSKHLNRT--KSTRNEDNETVYGKVGV  394

Query  1586  GLD  1594
              LD
Sbjct  395   ELD  397



>gb|KHN29557.1| Hypothetical protein glysoja_005281 [Glycine soja]
Length=439

 Score =   416 bits (1068),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 205/363 (56%), Positives = 259/363 (71%), Gaps = 27/363 (7%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA VRL GSSRF SMYSQQG+KGVNQDAMTVWE + GEK   FCGVFDGHGP GH+V+QF
Sbjct  38    GALVRLRGSSRFASMYSQQGQKGVNQDAMTVWEDYTGEKDVIFCGVFDGHGPLGHKVSQF  97

Query  758   IRDRLPSKLSVASKDNSQ-----------------DFEKDIHHHPLFSKWKSTFPQSFKD  886
             IRD LPSKLS A + + Q                 D   D +H+   + W+    +SF +
Sbjct  98    IRDNLPSKLSAAIEISQQKTIKYYDANDAETGSFDDAYDDNNHNMSLASWEGCLLKSFDE  157

Query  887   IDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDL  1066
             +D  L  E   DS+ SG TAVTLIKQG+ LI+GNLGDSRA++CTRD  DQL+P QLTVDL
Sbjct  158   MDEYLAQEINTDSYCSGCTAVTLIKQGDQLIVGNLGDSRAVLCTRD-RDQLIPVQLTVDL  216

Query  1067  KPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVP  1246
             KP++P E+ RI +C+GRV A  EEP+V+R+WMP+ DCPGLAM+RAFGDFCLKDYG+ISVP
Sbjct  217   KPDIPSETSRIVNCEGRVFAAEEEPDVYRIWMPDDDCPGLAMSRAFGDFCLKDYGLISVP  276

Query  1247  EIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYP  1426
             ++FYRKI+ +DEFVVLA+DGVWDVL+N EVI  VA+A +RS+AA+L+V+RAVR W+ KYP
Sbjct  277   DVFYRKITPQDEFVVLATDGVWDVLTNSEVINIVASAPRRSIAAKLLVKRAVRAWRYKYP  336

Query  1427  CSKTDDCAVVCLFFKRPKPML-------LKTMSQAAGLNMSFPETGRNEENSAIIAETDD  1585
              SK DDCAV+CLF      +         K+  ++  LN +  ++ RNE+N  +  +   
Sbjct  337   GSKVDDCAVICLFLDAQSALSHSQSYSNRKSRQRSKHLNRT--KSTRNEDNETVYGKVGV  394

Query  1586  GLD  1594
              LD
Sbjct  395   ELD  397



>ref|XP_004305101.1| PREDICTED: probable protein phosphatase 2C 73-like [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   416 bits (1069),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 197/339 (58%), Positives = 255/339 (75%), Gaps = 23/339 (7%)
 Frame = +2

Query  560   VGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSG  739
             V  G+ GAR+R+ GSSR++SMY+QQGKKG+NQDAMTVWE F  EK  ++CGVFDGHGP G
Sbjct  37    VKYGEDGARIRMQGSSRYISMYTQQGKKGINQDAMTVWEDFA-EKDMYYCGVFDGHGPDG  95

Query  740   HRVAQFIRDRLPSKLSVASK---------DN----SQDFEKDIHHHPL--------FSKW  856
             H++A+++RD LPSKLS   K         DN    S  F ++ +  P+         S W
Sbjct  96    HKIARYVRDNLPSKLSQVVKIYQLNTGIFDNASLPSSFFNQESNTTPISKGSQDISLSSW  155

Query  857   KSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQ  1036
             +++F +SFKD+D  L  +  IDSF SG+TAV ++KQG+HL+I NLGDSRA++ TR + +Q
Sbjct  156   EASFVKSFKDMDEELSLDSTIDSFCSGSTAVNVVKQGDHLVIANLGDSRAVLGTRGENNQ  215

Query  1037  LVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFC  1216
             +VP QLTVDLKP+ P E+ERIK C GR+ A  EEP V+R+WMP++DCPGLAMARAFGDFC
Sbjct  216   IVPVQLTVDLKPDTPSEAERIKKCNGRIFAVDEEPEVYRIWMPDEDCPGLAMARAFGDFC  275

Query  1217  LKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVER  1396
             LKDYG+IS+PE+ Y+ I+  DEFVVLA+DGVWD LSN  V+K VA+AKKRS AA+L+V+R
Sbjct  276   LKDYGLISIPEVCYKTITSDDEFVVLATDGVWDALSNANVVKIVASAKKRSNAAKLLVKR  335

Query  1397  AVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAA  1513
             AVR WK+KYP SK DDCAV+CLF K  +P L ++MS  +
Sbjct  336   AVRAWKRKYPESKIDDCAVICLFLK-DQPSLSRSMSHGS  373



>ref|XP_002309165.2| hypothetical protein POPTR_0006s10580g [Populus trichocarpa]
 gb|EEE92688.2| hypothetical protein POPTR_0006s10580g [Populus trichocarpa]
Length=477

 Score =   416 bits (1069),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 216/392 (55%), Positives = 279/392 (71%), Gaps = 39/392 (10%)
 Frame = +2

Query  452   MGACCTCQRVKKREVY----RVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVS  619
             MGACC+      RE Y     V++A    E+E  EE D I+G  D+GARVRL+G+S++ S
Sbjct  1     MGACCS------REPYGNGVDVEDAVADREQEDGEEGDAIIG--DYGARVRLYGASKYTS  52

Query  620   MYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK  799
             MY+QQG+K  NQDAMTVWE F G+K   FCGVFDGHGP GH+VA+ +RD LPS+LS A K
Sbjct  53    MYTQQGRKVTNQDAMTVWEEFTGDKDMLFCGVFDGHGPYGHKVARHVRDTLPSRLSSAIK  112

Query  800   ----------------DNSQDFEKD----------IHHHPLFSKWKSTFPQSFKDIDNAL  901
                             DNS +  K+               L S W+++F +SFK++D  L
Sbjct  113   ASQNNSFKRRDNEGKGDNSDEVSKNQGDEDSGDYDDSSSLLLSSWETSFIKSFKEMDEEL  172

Query  902   EGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLP  1081
               +  IDSF SGTTAV++IK+G +LII NLGDSRAI+C+R   +QLVP QLTVDLKPN+ 
Sbjct  173   SLDASIDSFCSGTTAVSVIKEGNNLIIANLGDSRAILCSRGPKNQLVPVQLTVDLKPNIS  232

Query  1082  VESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYR  1261
              E+ERIK+  GRV+A  +EP VFRVWMP++DCPGLAMARAFGDFCLKDYG+IS PE+ YR
Sbjct  233   SEAERIKNSNGRVLALDQEPEVFRVWMPDEDCPGLAMARAFGDFCLKDYGLISTPEVSYR  292

Query  1262  KISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTD  1441
             +++++DEFVVLA+DGVWDVL+NYEV+K VA A+KRSMAA+LVV+ AVR WK KYP  K D
Sbjct  293   RLTDKDEFVVLATDGVWDVLTNYEVVKIVAYARKRSMAAKLVVKYAVRAWKIKYPGCKVD  352

Query  1442  DCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPE  1537
             DCAV+CLF K  + +L ++ S+   ++++  E
Sbjct  353   DCAVICLFLKN-RTLLARSFSELTQVSVNHSE  383



>ref|XP_011019056.1| PREDICTED: probable protein phosphatase 2C 65 [Populus euphratica]
Length=477

 Score =   414 bits (1064),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 277/390 (71%), Gaps = 35/390 (9%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYR--VknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMY  625
             MGACC+      RE Y   V   +   +RE +++ +G    GD+GARVRL+G+S++ SMY
Sbjct  1     MGACCS------REPYGNGVDVEDAVADREQEDDEEGDATIGDYGARVRLYGASKYPSMY  54

Query  626   SQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK--  799
             +QQG+K  NQDAMTVWE F G+K   FCGVFDGHGP GH+VA+ +RD LPS+LS A K  
Sbjct  55    TQQGRKVTNQDAMTVWEEFTGDKDMLFCGVFDGHGPYGHKVARHVRDTLPSRLSSAIKAS  114

Query  800   --------------DNSQDFEKD----------IHHHPLFSKWKSTFPQSFKDIDNALEG  907
                           +NS +  K+               L S W+++F +SFK++D  L  
Sbjct  115   QNNSFKRRDNKGKGENSNEVNKNQSDEDSGDYDDSSSLLLSSWETSFMKSFKEMDEELSL  174

Query  908   EEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVE  1087
             +  IDSF SGTTAV++IK+G +LII NLGDSRAI+C+R   +QLVP QLTVDLKPN+  E
Sbjct  175   DASIDSFCSGTTAVSVIKEGNNLIIANLGDSRAILCSRGPKNQLVPVQLTVDLKPNITSE  234

Query  1088  SERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKI  1267
             +ERIK+  GRV+A  +EP VFRVWMP++DCPGLAMARAFGDFCLKDYG+IS PE+ YR++
Sbjct  235   AERIKNSNGRVLALDQEPEVFRVWMPDEDCPGLAMARAFGDFCLKDYGLISTPEVSYRRL  294

Query  1268  SERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDC  1447
             +++DEFVVLA+DGVWDVL+NYEV+K VA A+KRSMAA+LVV+ AVR WK KYP  K DDC
Sbjct  295   TDKDEFVVLATDGVWDVLTNYEVVKIVAYARKRSMAAKLVVKYAVRAWKIKYPGCKVDDC  354

Query  1448  AVVCLFFKRPKPMLLKTMSQAAGLNMSFPE  1537
             AV+CLF K  + +L ++ S+   ++++  E
Sbjct  355   AVICLFLKN-RTLLTRSFSELTQVSVNHSE  383



>ref|XP_002323635.2| hypothetical protein POPTR_0016s13560g [Populus trichocarpa]
 gb|EEF05396.2| hypothetical protein POPTR_0016s13560g [Populus trichocarpa]
Length=459

 Score =   412 bits (1058),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 210/391 (54%), Positives = 281/391 (72%), Gaps = 38/391 (10%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYR---VknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSM  622
             MGACC+      +E Y    V++A  ++E E +EE D IVG  D+GAR+RL+G+S++ SM
Sbjct  1     MGACCS------KEPYSDGVVEDAIEEKELEDEEEGDVIVG--DYGARMRLYGASKYTSM  52

Query  623   YSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK-  799
             Y+QQG+KG+NQDAMTVWE   G+K   FCGVFDGHGP GH+VA+ IRD LPS+LS   K 
Sbjct  53    YTQQGRKGINQDAMTVWEELTGDKDMLFCGVFDGHGPYGHKVARHIRDTLPSRLSREIKT  112

Query  800   ---------------DNSQDFEKD----------IHHHPLFSKWKSTFPQSFKDIDNALE  904
                            DNS +  K+               L S W++TF +SFK++D  L 
Sbjct  113   SQNNSFKSRDADGKGDNSDEVNKNKGGKDSVDDDDSSSLLLSSWEATFTKSFKEMDEELS  172

Query  905   GEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPV  1084
              +  IDSF SGTTAVT++K+G +LII NLGDSRA++C++   +QL+P QLTVDLKPN+  
Sbjct  173   LDASIDSFCSGTTAVTIVKEGNNLIIANLGDSRAVLCSKGPKNQLIPIQLTVDLKPNIAS  232

Query  1085  ESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRK  1264
             E+ERIK+  GRV A  +EP +FR+WMP++DCPGLAMARAFGDFCLKDYG+IS PE+ YR+
Sbjct  233   EAERIKNSNGRVFALEKEPELFRIWMPDEDCPGLAMARAFGDFCLKDYGLISTPEVSYRR  292

Query  1265  ISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDD  1444
             ++++DEFVVLA+DGVWDVL+NYEVIK VA+A+KRSMAA+LVV+ A R+W+ K+P SK DD
Sbjct  293   VTDKDEFVVLATDGVWDVLTNYEVIKIVASARKRSMAAKLVVKHAARSWRSKFPGSKVDD  352

Query  1445  CAVVCLFFKRPKPMLLKTMSQAAGLNMSFPE  1537
              AV+CLF K  + +L ++ S+   L+++  E
Sbjct  353   SAVICLFLKN-RTLLTRSFSEVTQLSVNHSE  382



>ref|XP_011032596.1| PREDICTED: probable protein phosphatase 2C 65 [Populus euphratica]
Length=478

 Score =   410 bits (1055),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 208/391 (53%), Positives = 280/391 (72%), Gaps = 38/391 (10%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYR---VknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSM  622
             MGACC+      +E Y    V++A  ++E E +EE D IVG  D+GAR+RL+G+S++ SM
Sbjct  1     MGACCS------KEPYSDGVVEDAIEEKELEDEEEGDVIVG--DYGARMRLYGASKYTSM  52

Query  623   YSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSV----  790
             Y+QQG+KG+NQDAMTVWE F G+K   FCGVFDGHGP GH+VA+ IRD LPS+LS     
Sbjct  53    YTQQGRKGINQDAMTVWEEFTGDKDMLFCGVFDGHGPYGHKVARHIRDTLPSRLSREIKT  112

Query  791   ------------ASKDNSQDFEKD----------IHHHPLFSKWKSTFPQSFKDIDNALE  904
                           +DNS +  K+               L S W++TF +SFK++D  L 
Sbjct  113   SQNNSFKSRDADGKRDNSDEVNKNKGGKDSLDDDDSSSLLLSSWEATFTKSFKEMDEELS  172

Query  905   GEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPV  1084
              +  IDSF SGTTAVT++K+G +LII NLGDSRA++C++   +QL+P QLTVDLKPN+  
Sbjct  173   LDASIDSFCSGTTAVTIVKEGNNLIIANLGDSRAVLCSKGPKNQLIPIQLTVDLKPNIAS  232

Query  1085  ESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRK  1264
             E+ERIK+  GRV A  +EP +FR+WMP++DCPGLAMARAFGDFCLKDYG+IS PE+ YR+
Sbjct  233   EAERIKNSNGRVFALEKEPELFRIWMPDEDCPGLAMARAFGDFCLKDYGLISTPEVSYRR  292

Query  1265  ISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDD  1444
             ++++DEFVVLA+DGVWDVL+N+EVIK VA+A+KRSMAA+LVV+ A R W+ K+P SK DD
Sbjct  293   VTDKDEFVVLATDGVWDVLTNFEVIKIVASARKRSMAAKLVVKHAARAWRSKFPGSKVDD  352

Query  1445  CAVVCLFFKRPKPMLLKTMSQAAGLNMSFPE  1537
              AV+C F K  + +L ++ S+   L+++  E
Sbjct  353   SAVICFFLKN-RTLLTRSFSEVTQLSVNHSE  382



>ref|XP_007140186.1| hypothetical protein PHAVU_008G091200g [Phaseolus vulgaris]
 gb|ESW12180.1| hypothetical protein PHAVU_008G091200g [Phaseolus vulgaris]
Length=433

 Score =   408 bits (1048),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/343 (57%), Positives = 250/343 (73%), Gaps = 18/343 (5%)
 Frame = +2

Query  548   HDGIVGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGH  727
             H+  V     GA VRL GSS+FVSMY+QQG+KGVNQDAM VWE + GEK   FCGVFDGH
Sbjct  28    HENDVSFNHGGALVRLRGSSKFVSMYTQQGQKGVNQDAMAVWEDYAGEKDVIFCGVFDGH  87

Query  728   GPSGHRVAQFIRDRLPSKLSVASKDNSQ----------------DFEKDIHHHPLFSKWK  859
             GP GH+V+QFIRD LPSKLS A + + Q                D   D  +    + W+
Sbjct  88    GPLGHKVSQFIRDNLPSKLSAAIEISQQKAIKFYDANDADTSSFDDGYDNSNQMSLASWE  147

Query  860   STFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQL  1039
               F +SF ++D  L  E   DS+ SG TAVTLIKQG+ LI+GNLGDSRA++CT+D  DQL
Sbjct  148   GCFLKSFSEMDEYLAREINTDSYCSGCTAVTLIKQGDQLIVGNLGDSRAVLCTKD-KDQL  206

Query  1040  VPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCL  1219
             +  QLTVDLKP +P E+ RI +C+GRV A  EEP+V+R+WMP+ DCPGLAM+RAFGDFCL
Sbjct  207   IAVQLTVDLKPEIPSETSRIVNCEGRVFAAEEEPDVYRIWMPDDDCPGLAMSRAFGDFCL  266

Query  1220  KDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERA  1399
             KDYG+ISVP++FYRKI+ +D+FVVLA+DG+WDVL+N+EVI  VA+A +RS+AA+L+V+RA
Sbjct  267   KDYGLISVPDVFYRKITPQDQFVVLATDGIWDVLTNHEVISIVASAPRRSVAAKLLVKRA  326

Query  1400  VRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMS  1528
             VR W+ KYP SK DDCA +C FF   +P+L  + S  +G N S
Sbjct  327   VRAWRYKYPGSKVDDCAAIC-FFLDEQPVLSHSQSHMSGKNRS  368



>ref|XP_010922653.1| PREDICTED: aldose reductase-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   403 bits (1035),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 243/305 (80%), Gaps = 21/305 (7%)
 Frame = -2

Query  2875  FRLLSGHIIPAIGLGTWKV-QHPRDNVYAAIVEGGYRHVDTAAQYGVQQGVGEGLKAAIH  2699
             F+LLSGH IPA+GLGTWK      + V  AI+E GYRHVDTA+QYG+++ VG+GL+AA+ 
Sbjct  18    FKLLSGHTIPAVGLGTWKSGSKASEAVSTAIIEAGYRHVDTASQYGIEKEVGQGLRAAMQ  77

Query  2698  AGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLIHWPFHLKEGASRPPK  2519
             AG+ERK LF+TSKLWCTDLSP RVR AL NTLQ+LQLDYLDL+LIHWPF LKEGA RPP+
Sbjct  78    AGIERKDLFITSKLWCTDLSPDRVRVALKNTLQDLQLDYLDLYLIHWPFRLKEGAHRPPE  137

Query  2518  AGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIAKIKPSVCQMEMHPGW  2339
             AGEV  FDMEGVWREME+LV D LVRDIGVCNFT+ KL+KLL+IA+ KPSVCQMEMHPGW
Sbjct  138   AGEVLDFDMEGVWREMEQLVKDGLVRDIGVCNFTLKKLDKLLQIAQTKPSVCQMEMHPGW  197

Query  2338  RNDKMLDACKDNNIHVTAYSPLGSDERDLVHNPMVEKVANKLNKSPGQVLVKWAIQRGTS  2159
             RNDKML+ACK N I +T                    VANKLNK+ GQ+LVKWA+QRGT 
Sbjct  198   RNDKMLEACKKNGILIT--------------------VANKLNKTQGQILVKWALQRGTI  237

Query  2158  TIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGEDMFVNKTDGPFKNVADL  1979
              IPKS +A RI+ NI VF  EIP+ DF ALSSI DQRRVLDGED+FVNK+ GP+++ ADL
Sbjct  238   VIPKSTNAERIRGNIQVFGCEIPEVDFRALSSIRDQRRVLDGEDLFVNKSHGPYRSAADL  297

Query  1978  WDHED  1964
             WD+ED
Sbjct  298   WDNED  302



>ref|XP_006828159.1| hypothetical protein AMTR_s00023p00095420 [Amborella trichopoda]
 gb|ERM95575.1| hypothetical protein AMTR_s00023p00095420 [Amborella trichopoda]
Length=397

 Score =   404 bits (1037),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 192/330 (58%), Positives = 240/330 (73%), Gaps = 14/330 (4%)
 Frame = +2

Query  593   LHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRL  772
             ++ S    SM++QQG+KG+NQDAM + E F  + G  FCGVFDGHGP GH+VA+ +RD L
Sbjct  17    INSSGAIASMFTQQGQKGINQDAMILCEDFAWKTGTIFCGVFDGHGPYGHKVARHVRDNL  76

Query  773   PSKLSV--------------ASKDNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGE  910
             PSKL                 S+ NS++ E+   + P FS WK++F Q+F+DID  L   
Sbjct  77    PSKLKSECEACELDSDETEDCSERNSENGERKTEYPPEFSSWKASFLQAFRDIDRELRVH  136

Query  911   EKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVES  1090
              +ID F SGTTAV L+KQGEHL+I NLGDSRAI+CTRDD +++VP QLTVDLKPNLP E+
Sbjct  137   PEIDCFCSGTTAVALVKQGEHLVIANLGDSRAILCTRDDNNKMVPLQLTVDLKPNLPSEA  196

Query  1091  ERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKIS  1270
             ERIK CKGRV A  EEP+V R+W+P +DCPGLAMARAFGDFCLKDYG+ISVP + YRK++
Sbjct  197   ERIKQCKGRVFAMEEEPDVARMWLPNEDCPGLAMARAFGDFCLKDYGLISVPHLSYRKLT  256

Query  1271  ERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCA  1450
              +DEFVVLA+DGVWDVL+N EVI  VA++K RS AAR +V RAVR WK KYP SK DDCA
Sbjct  257   PKDEFVVLATDGVWDVLTNKEVINIVASSKDRSSAARTLVTRAVRAWKYKYPTSKIDDCA  316

Query  1451  VVCLFFKRPKPMLLKTMSQAAGLNMSFPET  1540
             V+CL+ +    +  K  S+A     S PE+
Sbjct  317   VICLYLRTEPTVASKASSEALESVHSCPES  346



>ref|XP_007026551.1| Phosphatase 2C family protein, putative [Theobroma cacao]
 gb|EOY07053.1| Phosphatase 2C family protein, putative [Theobroma cacao]
Length=515

 Score =   407 bits (1047),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 262/378 (69%), Gaps = 30/378 (8%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MGACC+ Q   K    R    + +E  +     DG       GA VR  GSS + SMY++
Sbjct  1     MGACCSTQ--IKYNGCRPHEHDLEEIEDRVAHEDGDTTIRRDGAIVRFQGSSSYTSMYTR  58

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA------  793
             QGKKGVNQDAMTVWE+F GEK  FFCGVFDGHG SGHR+A++I D LP KLS        
Sbjct  59    QGKKGVNQDAMTVWENFMGEKNVFFCGVFDGHGASGHRIARYICDTLPPKLSSVIRASQP  118

Query  794   ----------------SKDNSQDFEKDI-----HHHPLFSKWKSTFPQSFKDIDNALEGE  910
                              KD+S    KD      +H+ + S W+++  Q+F ++D  L  E
Sbjct  119   DACQENVDAVAVGQNHGKDDSTGVNKDSDKEDSNHNEILSSWEASLIQAFGEVDEDLMLE  178

Query  911   EKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVES  1090
             E +DS+ SGTTAV ++KQ EHLI+ NLGDSRA++CTRDDT+QLVP QLTVDLKP++P E+
Sbjct  179   ESLDSYCSGTTAVIIVKQAEHLIVSNLGDSRAVLCTRDDTNQLVPVQLTVDLKPSIPSEA  238

Query  1091  ERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKIS  1270
             ERI+   GRV A  EEPNV RVWMP QD PGLAMARAFGDFCLKD+G+ S+P++ YR+++
Sbjct  239   ERIQRYGGRVFAMDEEPNVQRVWMPNQDYPGLAMARAFGDFCLKDHGLSSIPQVSYRRLT  298

Query  1271  ERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCA  1450
              +DEFVVLA+DGVWDVL+N EVI+ VA+ KKRS+AA+L+V  AV+TW+ KYP SK DDCA
Sbjct  299   SKDEFVVLATDGVWDVLTNNEVIRIVASVKKRSIAAKLLVYYAVQTWRTKYPGSKVDDCA  358

Query  1451  VVCLFFKRPKPMLLKTMS  1504
             VVCLF K+ +P + ++ S
Sbjct  359   VVCLFLKK-RPFVSRSFS  375



>ref|XP_008464241.1| PREDICTED: probable protein phosphatase 2C 65 isoform X2 [Cucumis 
melo]
Length=451

 Score =   404 bits (1038),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 199/377 (53%), Positives = 269/377 (71%), Gaps = 21/377 (6%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MGACCT     K  +Y      +K++R+++ +    V RG+ GA VRL GSS F SM++Q
Sbjct  1     MGACCT-----KDNLYGGYTTYDKDDRDSNGDDGEEVRRGEDGATVRLRGSSAFTSMFTQ  55

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASKDNSQ  811
             +G+KG+NQDAMTVWE F GEK   FCGVFDGHGPSGHRVA+  RD LP+KLS A K    
Sbjct  56    RGRKGINQDAMTVWEDFSGEKDLMFCGVFDGHGPSGHRVARHARDILPTKLSTAIKKQLY  115

Query  812   DFEKDI--------------HHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAV  949
             + E  +                + L SKW++   +SFK++D  L  +  ID F SGTTAV
Sbjct  116   EPENGVVSEACVEPDNNGGKQRNRLVSKWEAALEESFKEVDQELSLDSSIDCFCSGTTAV  175

Query  950   TLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMAT  1129
             T+IKQGEHL++ ++GDSRA++CTR D  QL+P QLTVD KPN+P E+ERIK+ +GR++A 
Sbjct  176   TIIKQGEHLVVASVGDSRAVLCTRGDKHQLIPIQLTVDQKPNIPCEAERIKNRQGRIIAE  235

Query  1130  AEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGV  1309
              EEP+++RVW+P+ + PGLAM+R+ GDFCLKDYG+IS P++ YRK++ +DEF+VLA+DG+
Sbjct  236   KEEPDIYRVWVPDGNYPGLAMSRSLGDFCLKDYGLISTPQVSYRKLTRKDEFIVLATDGI  295

Query  1310  WDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPML  1489
             WDVL+N +VI  VA+ + RSMAA+LVV+ AV  WK+++P S  DDCA +CLFFK P P+L
Sbjct  296   WDVLTNNQVINIVASVRNRSMAAKLVVKLAVSEWKRRFPGSLIDDCAAICLFFKNP-PLL  354

Query  1490  LKTMSQAAGLNM-SFPE  1537
              K+M+     N+ S PE
Sbjct  355   TKSMTSVGRRNVRSHPE  371



>ref|XP_008370206.1| PREDICTED: probable protein phosphatase 2C 65 [Malus domestica]
Length=471

 Score =   404 bits (1039),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 203/387 (52%), Positives = 267/387 (69%), Gaps = 45/387 (12%)
 Frame = +2

Query  569   GDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRV  748
             GD GAR+RL G SR +SMY+QQG+KG+NQDAMTVWE F  EKG +FCGVFDGHGP GH+V
Sbjct  41    GDDGARIRLQGCSRNISMYTQQGRKGINQDAMTVWEDFT-EKGMYFCGVFDGHGPEGHKV  99

Query  749   AQFIRDRLPSKLSVASK---------------------DNSQDFEKDIHHHPLFSKWKST  865
             A+ +RD LPSKLS   K                     +N  + ++          W+++
Sbjct  100   ARCVRDNLPSKLSEVIKIYQLNTGIFSDIDVAGSEINANNGNNHDRKRSRDISLPSWEAS  159

Query  866   FPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD-DTDQLV  1042
             F +SFK++D  L  +  IDSF SG+TAVT++KQG++L+I NLGDSRA++ TR  + +Q+V
Sbjct  160   FVKSFKEMDEELSVDNTIDSFCSGSTAVTVVKQGDNLVIANLGDSRAVLGTRSGEKNQIV  219

Query  1043  PEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLK  1222
             P QLTVDLKP+ P E+ERI  CKGR+++  EEP V+R+WMP++DCPGLAMARAFGDFC+K
Sbjct  220   PVQLTVDLKPDTPSEAERIMKCKGRILSVDEEPQVYRLWMPDEDCPGLAMARAFGDFCVK  279

Query  1223  DYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAV  1402
             DYG+IS+PE+FYRKIS  DEFVVLA+DGVWD L+N +V+K VA+A+KRSMAA L+V RAV
Sbjct  280   DYGLISIPEVFYRKISSDDEFVVLATDGVWDALTNTDVVKIVASARKRSMAAELLVRRAV  339

Query  1403  RTWKQKYPCSKTDDCAVVCLFFK-RPKPMLLKTMSQA--------AGLNMSFPETGRN--  1549
             R WK+K+P SK DDCA +CL+ K +P   L  + S          + L++S+  T  N  
Sbjct  340   RAWKRKFPASKIDDCAAICLYLKDKPASSLTHSTSXVSRLGKVNDSELSLSYYSTRSNIV  399

Query  1550  --------EENSAIIAETDDGLDTLLN  1606
                     E NS +   T+D  DT+LN
Sbjct  400   SDQGGTASEINSKM---TEDWKDTVLN  423



>ref|XP_010093563.1| putative protein phosphatase 2C 65 [Morus notabilis]
 gb|EXB54270.1| putative protein phosphatase 2C 65 [Morus notabilis]
Length=469

 Score =   403 bits (1036),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 252/348 (72%), Gaps = 36/348 (10%)
 Frame = +2

Query  569   GDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRV  748
             G+ GAR+RL GSS + SMY+QQG+KG+NQDAMTVWE+F GEK   FCGVFDGHGP GH+V
Sbjct  39    GESGARIRLKGSSGYTSMYTQQGRKGINQDAMTVWENFTGEKDMLFCGVFDGHGPYGHKV  98

Query  749   AQFIRDRLPSKLSVA---SKDNSQDF-EKDIHHHPLFSKW--------------------  856
             A+ +RD LP+KL  A   SK NS  + +    H  L +K+                    
Sbjct  99    ARHVRDNLPTKLCKAIQLSKLNSCKYGDVGDDHKDLTNKYGENSSTKSDIDDDKDGQNDD  158

Query  857   ------------KSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDS  1000
                         ++ F +SFK++D  L  +  IDSF SG+TAVT++KQG++LII NLGDS
Sbjct  159   NGSFCLLSLSSSEACFIKSFKEMDQELSLDSTIDSFCSGSTAVTVVKQGDNLIIANLGDS  218

Query  1001  RAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCP  1180
             RAI+CTR D +Q VP QLTVDLKP++P E+ERIK+CKGRV +  EEP+V+R+WMP+ DCP
Sbjct  219   RAILCTRGDKNQFVPIQLTVDLKPDIPSEAERIKNCKGRVFSADEEPDVYRIWMPDCDCP  278

Query  1181  GLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAK  1360
             GLAMARAFGDFCLKDYG+IS+P++ YR++++ DEF+VLA+DGVWD L+N EV+K VA+AK
Sbjct  279   GLAMARAFGDFCLKDYGLISIPDVSYRRLTKNDEFLVLATDGVWDALTNAEVVKIVASAK  338

Query  1361  KRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMS  1504
              RSMAA+L+V RAV  WK KYP  K DDCAVVCLFFK    +L+K+ S
Sbjct  339   NRSMAAKLLVNRAVHAWKDKYPGCKVDDCAVVCLFFKDDPTLLVKSSS  386



>ref|XP_007206493.1| hypothetical protein PRUPE_ppa019111mg [Prunus persica]
 gb|EMJ07692.1| hypothetical protein PRUPE_ppa019111mg [Prunus persica]
Length=459

 Score =   402 bits (1033),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 195/338 (58%), Positives = 254/338 (75%), Gaps = 25/338 (7%)
 Frame = +2

Query  560   VGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSG  739
             V  GD GAR+RL G SRF SMY+QQG+KG+NQDAMT+WE F  EKG +FCGVFDGHGP G
Sbjct  38    VRHGDDGARIRLQGCSRFTSMYTQQGRKGINQDAMTIWEDFT-EKGMYFCGVFDGHGPEG  96

Query  740   HRVAQFIRDRLPSKLSVASKD-------------NSQDFEKDIHHH--------PLFSKW  856
             H+VA+ +RD LPSKLS   K               S+ +E   H H        PL S W
Sbjct  97    HKVARCVRDNLPSKLSQVIKIYRLNTGIFSDIDVGSELYENVGHRHKKKASLDMPL-SSW  155

Query  857   KSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD-DTD  1033
             ++++ +SFK++D  L  +  IDSF SG+TAVT++KQG+HL+I NLGDSRA++ TR  + +
Sbjct  156   EASYVKSFKEMDEELSLDNTIDSFCSGSTAVTVVKQGDHLVIANLGDSRAVLGTRSGEKN  215

Query  1034  QLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDF  1213
             Q+   QLTVDLKP+ P E+ERIK+CKGR+++  EEP V+R+WMP++DCPGLAM+RAFGDF
Sbjct  216   QICSVQLTVDLKPDTPGEAERIKNCKGRILSVDEEPEVYRLWMPDEDCPGLAMSRAFGDF  275

Query  1214  CLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVE  1393
             C+KD G+IS+PE+FYR+IS  DEFVVLA+DGVWD L+N +V+K VA+AK+RS+AA LVV+
Sbjct  276   CVKDCGLISIPEVFYRRISSSDEFVVLATDGVWDALTNTDVVKIVASAKRRSIAAELVVK  335

Query  1394  RAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQ  1507
             RAVR WK+K+P SK DDCAV+CL+ K  +P L +T S 
Sbjct  336   RAVRAWKRKFPESKIDDCAVICLYLK-DQPSLTQTASN  372



>ref|XP_009373099.1| PREDICTED: probable protein phosphatase 2C 65 [Pyrus x bretschneideri]
Length=471

 Score =   402 bits (1032),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 201/387 (52%), Positives = 266/387 (69%), Gaps = 45/387 (12%)
 Frame = +2

Query  569   GDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRV  748
             GD GAR+RL G SR +SMY+QQG+KG+NQDAMTVWE F  E G +FCGVFDGHGP GH+V
Sbjct  41    GDDGARIRLQGCSRNISMYTQQGRKGINQDAMTVWEDFT-ENGMYFCGVFDGHGPEGHKV  99

Query  749   AQFIRDRLPSKLSVASK---------------------DNSQDFEKDIHHHPLFSKWKST  865
             A+ +RD LPSKLS   K                     +N  + ++    +     W+++
Sbjct  100   ARCVRDNLPSKLSEIIKIYQLNTGIFSDIDVAGSEINANNGNNHDRKPSRNISLPSWEAS  159

Query  866   FPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD-DTDQLV  1042
             F +SF+++D  L  +  IDSF SG+TAVT++KQG +L+I NLGDSRA++ TR  + +Q+V
Sbjct  160   FVKSFEEMDEELSVDNTIDSFCSGSTAVTVVKQGNNLVIANLGDSRAVLGTRSGEKNQIV  219

Query  1043  PEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLK  1222
             P QLTVDLKP+ P E+ERI  CKGR+++  EEP V+R+WMP++DCPGLAMARAFGDFC+K
Sbjct  220   PVQLTVDLKPDTPSEAERIMKCKGRILSVDEEPQVYRLWMPDEDCPGLAMARAFGDFCVK  279

Query  1223  DYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAV  1402
             DYG+IS+PE+FYRKIS  DEFVVLA+DGVWD L+N +V+K VA+A+KRSMAA L+V RAV
Sbjct  280   DYGLISIPEVFYRKISSDDEFVVLATDGVWDALTNTDVVKIVASARKRSMAAELLVRRAV  339

Query  1403  RTWKQKYPCSKTDDCAVVCLFFK-RPKPMLLKTMSQA--------AGLNMSFPETGRN--  1549
             R WK+K+P SK DDCA +CL+ K +P   L  + S          + L++S+  T  N  
Sbjct  340   RAWKRKFPASKIDDCAAICLYLKDKPASSLTHSTSHVSRLGKANDSQLSLSYYSTRSNIV  399

Query  1550  --------EENSAIIAETDDGLDTLLN  1606
                     E NS +   T+D  DT+LN
Sbjct  400   SDQGGTASEINSKM---TEDWKDTVLN  423



>ref|XP_006429502.1| hypothetical protein CICLE_v10013751mg [Citrus clementina]
 gb|ESR42742.1| hypothetical protein CICLE_v10013751mg [Citrus clementina]
Length=517

 Score =   402 bits (1034),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 181/303 (60%), Positives = 237/303 (78%), Gaps = 6/303 (2%)
 Frame = +2

Query  620   MYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK  799
             M++QQG+KG+NQDAMTVWE+F G+K   FCGVFDGHGP+GH++A+ +RD LPSKLS A K
Sbjct  1     MFTQQGRKGINQDAMTVWENFTGDKDTVFCGVFDGHGPAGHKIARHVRDNLPSKLSTAIK  60

Query  800   ---DNSQDFEK--DIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQ  964
                 N +D+        +P F   +++  ++++++D+ L     +DS+SSG TAV +IK+
Sbjct  61    LLKRNHEDYSNGSKSSQNPFFRALEASLVKAYEELDDELGLASAVDSYSSGATAVNIIKK  120

Query  965   GEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPN  1144
             GEHLII NLGDSRA++CTRDD +QLVP QLT DLKP +  E+ERI++CKGRV A  EEP+
Sbjct  121   GEHLIIANLGDSRAVLCTRDDRNQLVPVQLTTDLKPEIASEAERIRNCKGRVFAMDEEPD  180

Query  1145  VFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLS  1324
             V+RVWMP++DCPGLAMARAFGDFCLKDYG+IS+PEI YRK++  D+FVVLA+DGVWDVL+
Sbjct  181   VYRVWMPDEDCPGLAMARAFGDFCLKDYGLISIPEISYRKLTREDQFVVLATDGVWDVLT  240

Query  1325  NYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMS  1504
             N EVI+TVA A K+ MAA+++V RAVR W+ KYP SK DDCA +CLF    KP+L K+ S
Sbjct  241   NSEVIRTVACASKKEMAAKMLVSRAVRAWRTKYPGSKIDDCAAICLFLGH-KPLLTKSKS  299

Query  1505  QAA  1513
               +
Sbjct  300   DTS  302



>ref|XP_004492511.1| PREDICTED: probable protein phosphatase 2C 65-like [Cicer arietinum]
Length=437

 Score =   399 bits (1026),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 244/323 (76%), Gaps = 22/323 (7%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA VRL GSS++VSMY+QQG+KG+NQD+MTVWE + G+     CGVFDGHGP GH+V+QF
Sbjct  40    GAMVRLRGSSKYVSMYTQQGRKGINQDSMTVWEDYTGQHDMILCGVFDGHGPLGHKVSQF  99

Query  758   IRDRLPSKLSVASK-----------DNSQDFE--------KDIHHHPLFSKWKSTFPQSF  880
             IRD LP KLS A K            N+ D E         ++ +  L S W+  F +SF
Sbjct  100   IRDNLPLKLSAAIKMAQQKANRYYEANNADLETFDGVRNDNNLRNISLAS-WEGCFLKSF  158

Query  881   KDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTV  1060
              ++D  L  E   DS+ SG TAVTLIKQG+ LI+GNLGDSRAI+CTRD  DQL+P QLTV
Sbjct  159   DEMDEYLAQEINTDSYCSGCTAVTLIKQGDQLIVGNLGDSRAILCTRD-RDQLIPVQLTV  217

Query  1061  DLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVIS  1240
             DLKP++P E+ RI +C+GRV A  EEP+V+R+WMP+ DCPGLAM+RAFGDFCLKDYG+I+
Sbjct  218   DLKPDIPSEASRIFNCEGRVFAAEEEPDVYRIWMPDDDCPGLAMSRAFGDFCLKDYGLIA  277

Query  1241  VPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQK  1420
              P++FYRK++++DEFVVLASDG+WDVL+N EVI  VA+A ++S+AA+L+V+RAVR WK K
Sbjct  278   APDVFYRKVTKQDEFVVLASDGIWDVLTNNEVINIVASAPRKSIAAKLLVKRAVRAWKYK  337

Query  1421  YPCSKTDDCAVVCLFFKRPKPML  1489
             YP SK DDCAV+CLF    +P+L
Sbjct  338   YPGSKVDDCAVICLFLD-DQPVL  359



>ref|XP_006481121.1| PREDICTED: probable protein phosphatase 2C 65-like [Citrus sinensis]
Length=377

 Score =   396 bits (1017),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 236/303 (78%), Gaps = 6/303 (2%)
 Frame = +2

Query  620   MYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK  799
             M++QQG+KG+NQDAMTVWE+F G+K   FCGVFDGHGP+GH++A+ +RD LPSKLS A K
Sbjct  1     MFTQQGRKGINQDAMTVWENFTGDKDTVFCGVFDGHGPAGHKIARHVRDNLPSKLSTAIK  60

Query  800   ---DNSQDFEK--DIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQ  964
                 N +D+        +P F   +++  ++++++D+ L     +DS+SSG TAV +IK+
Sbjct  61    LLKRNHEDYSNGSKSSQNPFFRALEASLVKAYEELDDELGLASAVDSYSSGATAVNIIKK  120

Query  965   GEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPN  1144
             GEHLII NLGDSRA++CTRDD +QLVP QLT DLKP +  E+ERI++CKGRV A  EEP+
Sbjct  121   GEHLIIANLGDSRAVLCTRDDRNQLVPVQLTTDLKPEIAGEAERIRNCKGRVFAMDEEPD  180

Query  1145  VFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLS  1324
             V+RVWMP++DCPGLAMARAFGDFCLK YG+IS+PEI YRK++  D+FVVLA+DGVWDVL+
Sbjct  181   VYRVWMPDEDCPGLAMARAFGDFCLKGYGLISIPEISYRKLTREDQFVVLATDGVWDVLT  240

Query  1325  NYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMS  1504
             N EVI+TVA A K+ MAA+++V RAVR W+ KYP SK DDCA +CLF    KP+L K+ S
Sbjct  241   NSEVIRTVACASKKEMAAKMLVSRAVRAWRTKYPGSKIDDCAAICLFLGH-KPLLTKSKS  299

Query  1505  QAA  1513
               +
Sbjct  300   DTS  302



>ref|XP_010683599.1| PREDICTED: probable protein phosphatase 2C 73 [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   399 bits (1024),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 206/416 (50%), Positives = 273/416 (66%), Gaps = 47/416 (11%)
 Frame = +2

Query  452   MGACCTCQ-RVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYS  628
             MGACC+ +     R++            E + E +  V +GD GA +RL GSS F+SM +
Sbjct  1     MGACCSKEGNYGDRQI---------TVYEHECEQEDYVYKGDNGASIRLQGSSAFISMAT  51

Query  629   QQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK---  799
             QQG+KG+NQDAMTVWE F G K AFFCGVFDGHGP GH+VA+  RD LP KLS A K   
Sbjct  52    QQGRKGINQDAMTVWEDFTGYKDAFFCGVFDGHGPCGHKVARNARDELPIKLSAAHKLLQ  111

Query  800   ---------------------------DNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNA  898
                                        DN  D  K      +   WK+ F  SF+++D  
Sbjct  112   TKSRSTSDVDALYADDDDAHSINGETNDNLHD-GKGSDAELVLHLWKAAFLTSFREVDKE  170

Query  899   LEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNL  1078
             L  +  I+S+ SGTTAVT +KQG+HLIIGNLGDSRA+MCTR +  Q++P QLTVDLKP+L
Sbjct  171   LSQDSSIESYCSGTTAVTAVKQGDHLIIGNLGDSRAVMCTRGEKGQIIPVQLTVDLKPSL  230

Query  1079  PVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFY  1258
             P E+ER++ C GRV +  EE +V R+W+P++D PGLAM RAFGDFCLKDYG+IS P++FY
Sbjct  231   PREAERVRRCNGRVFSLEEESHVLRLWLPDEDSPGLAMTRAFGDFCLKDYGLISTPQVFY  290

Query  1259  RKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKT  1438
             RK++E+DEFVVLA+DGVWDVL+N+EV+K V+ A+KRS AA+ +   AVR WK ++P S+T
Sbjct  291   RKLTEQDEFVVLATDGVWDVLTNFEVVKIVSAARKRSHAAKFLATHAVRAWKSRFPSSRT  350

Query  1439  DDCAVVCLFFKRPKPMLLKTMSQAAGL---NMSFPETGRNEEN-SAIIAETDDGLD  1594
             DD AVVCLFFK P P   K+MS  + +   ++S   +  ++    +I ++ D+G D
Sbjct  351   DDIAVVCLFFKPPPPG--KSMSDISHITPDSLSHLNSSVSQHTYRSISSDADEGFD  404



>ref|XP_004148601.1| PREDICTED: probable protein phosphatase 2C 65-like [Cucumis sativus]
 gb|KGN54420.1| hypothetical protein Csa_4G314470 [Cucumis sativus]
Length=446

 Score =   398 bits (1023),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 202/377 (54%), Positives = 269/377 (71%), Gaps = 21/377 (6%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MGACCT     K  +Y      +K++R+++ +    V RGD GA VRL GSS F SM++Q
Sbjct  1     MGACCT-----KDYMYGGYTTYDKDDRDSNGDDGEEVRRGDDGATVRLRGSSTFTSMFTQ  55

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASKDNSQ  811
             +G+KG+NQDAMTVWE F GEK   FCGVFDGHGPSGHRVA+  RD LP+KLS + K    
Sbjct  56    RGRKGINQDAMTVWEDFSGEKDLIFCGVFDGHGPSGHRVARHARDVLPTKLSKSIKKKLC  115

Query  812   DFEKDI--------------HHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAV  949
               E  +                + L SKW++   +SFK++D  L  +  ID F SGTTAV
Sbjct  116   QPENGVVSEACVEPDNNGGKQRNRLVSKWEAALEESFKEVDQELSLDSSIDCFCSGTTAV  175

Query  950   TLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMAT  1129
             T+IKQGEHL++ N+GDSRA++CTR D  Q +P QLTVD KPN+P E+ERIK+ +GR++A 
Sbjct  176   TIIKQGEHLVVANVGDSRAVLCTRGDKHQHIPIQLTVDHKPNIPCEAERIKNLQGRIIAE  235

Query  1130  AEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGV  1309
              E+P++FRVW+P+ D PGLAM+R+ GDFCLKDYG+IS P++ YRK++ +DEF+VLA+DG+
Sbjct  236   KEDPDIFRVWVPDGDYPGLAMSRSVGDFCLKDYGLISTPQVSYRKLTRKDEFIVLATDGI  295

Query  1310  WDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPML  1489
             WDVL+N +VI  VA+ + RSMAA+LVV+ AVR WK+++P S  DDCAV+CLFFK P P+L
Sbjct  296   WDVLTNNQVINIVASVRNRSMAAKLVVKLAVREWKRRFPGSMIDDCAVICLFFKNP-PLL  354

Query  1490  LKTMSQAAGLNM-SFPE  1537
              K+M+     N+ S PE
Sbjct  355   TKSMTSVGRRNVRSHPE  371



>ref|XP_010264518.1| PREDICTED: probable protein phosphatase 2C 65 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010264519.1| PREDICTED: probable protein phosphatase 2C 65 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010264520.1| PREDICTED: probable protein phosphatase 2C 65 isoform X3 [Nelumbo 
nucifera]
Length=440

 Score =   396 bits (1018),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 188/322 (58%), Positives = 240/322 (75%), Gaps = 21/322 (7%)
 Frame = +2

Query  569   GDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRV  748
             GDFG  VRL G S + SM++Q+GKKG+NQD+MT+WE F GEK   FCGVFDGHGP GH+V
Sbjct  28    GDFGELVRLKGFSEYTSMFTQKGKKGINQDSMTIWEDFSGEKDEIFCGVFDGHGPLGHKV  87

Query  749   AQFIRDRLPSKLSVASKD--------NSQDFEKDIHH-------------HPLFSKWKST  865
             +  +RD LPSKLS   K+        +S D ++D  H                FS WK  
Sbjct  88    SCHVRDALPSKLSYLLKEPEMVDYYSSSSDEDEDADHVDSSHNEANTQNSFSSFSLWKKC  147

Query  866   FPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVP  1045
             F ++FK++D  L  +  +DSF SG+TAVT++K+GEHLII NLGDSRA++CTR+  +QLVP
Sbjct  148   FVKAFKEMDRELYLDSTVDSFCSGSTAVTVLKKGEHLIIANLGDSRAVLCTRNQKNQLVP  207

Query  1046  EQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKD  1225
              QLTVDLKPNLP E+ERI+S  GRV A  EEP+V+R+WM ++DCPGLAM+RAFGDFCLK+
Sbjct  208   VQLTVDLKPNLPGEAERIRSYNGRVFAREEEPDVYRLWMADEDCPGLAMSRAFGDFCLKN  267

Query  1226  YGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVR  1405
             +G+ S P++ YR+++E DEFVVLA+DGVWDVLSN EVIK VA+A KRSMAA+L+V RA R
Sbjct  268   FGLSSTPKVSYRELAEEDEFVVLATDGVWDVLSNKEVIKIVASAGKRSMAAKLLVRRASR  327

Query  1406  TWKQKYPCSKTDDCAVVCLFFK  1471
              WK ++P +K DDCA +CLFFK
Sbjct  328   AWKFQHPTAKADDCAAICLFFK  349



>ref|XP_010264516.1| PREDICTED: probable protein phosphatase 2C 65 isoform X1 [Nelumbo 
nucifera]
Length=448

 Score =   396 bits (1017),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/322 (58%), Positives = 240/322 (75%), Gaps = 21/322 (7%)
 Frame = +2

Query  569   GDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRV  748
             GDFG  VRL G S + SM++Q+GKKG+NQD+MT+WE F GEK   FCGVFDGHGP GH+V
Sbjct  36    GDFGELVRLKGFSEYTSMFTQKGKKGINQDSMTIWEDFSGEKDEIFCGVFDGHGPLGHKV  95

Query  749   AQFIRDRLPSKLSVASKD--------NSQDFEKDIHH-------------HPLFSKWKST  865
             +  +RD LPSKLS   K+        +S D ++D  H                FS WK  
Sbjct  96    SCHVRDALPSKLSYLLKEPEMVDYYSSSSDEDEDADHVDSSHNEANTQNSFSSFSLWKKC  155

Query  866   FPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVP  1045
             F ++FK++D  L  +  +DSF SG+TAVT++K+GEHLII NLGDSRA++CTR+  +QLVP
Sbjct  156   FVKAFKEMDRELYLDSTVDSFCSGSTAVTVLKKGEHLIIANLGDSRAVLCTRNQKNQLVP  215

Query  1046  EQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKD  1225
              QLTVDLKPNLP E+ERI+S  GRV A  EEP+V+R+WM ++DCPGLAM+RAFGDFCLK+
Sbjct  216   VQLTVDLKPNLPGEAERIRSYNGRVFAREEEPDVYRLWMADEDCPGLAMSRAFGDFCLKN  275

Query  1226  YGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVR  1405
             +G+ S P++ YR+++E DEFVVLA+DGVWDVLSN EVIK VA+A KRSMAA+L+V RA R
Sbjct  276   FGLSSTPKVSYRELAEEDEFVVLATDGVWDVLSNKEVIKIVASAGKRSMAAKLLVRRASR  335

Query  1406  TWKQKYPCSKTDDCAVVCLFFK  1471
              WK ++P +K DDCA +CLFFK
Sbjct  336   AWKFQHPTAKADDCAAICLFFK  357



>ref|XP_008244796.1| PREDICTED: probable protein phosphatase 2C 65 [Prunus mume]
Length=470

 Score =   397 bits (1019),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 193/340 (57%), Positives = 254/340 (75%), Gaps = 25/340 (7%)
 Frame = +2

Query  560   VGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSG  739
             V  GD GAR+RL G SRF SMY+QQG+KG+NQDAMT+WE F  EKG +FCGVFDGHGP G
Sbjct  49    VRHGDDGARIRLQGCSRFTSMYTQQGRKGINQDAMTIWEDFT-EKGMYFCGVFDGHGPEG  107

Query  740   HRVAQFIRDRLPSKLSVASKD-------------NSQDFEKDIHHH--------PLFSKW  856
             H+VA+ +RD LPSKLS   K               S+ +E   H H        PL S W
Sbjct  108   HKVARCVRDNLPSKLSQVIKIYQLNTGIFSDIDVGSELYENVGHRHNKKASQDMPL-SSW  166

Query  857   KSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD-DTD  1033
             ++++ +SFK++D  L  +  IDSF SG+TAV ++KQG+HL+I NLGDSRA++ TR  + +
Sbjct  167   EASYVKSFKEMDEELSLDNTIDSFCSGSTAVAVVKQGDHLVIANLGDSRAVLGTRSGEKN  226

Query  1034  QLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDF  1213
             Q+   QLTVDLKP+ P E+ERIK+CKGR+++  EEP+V+R+WMP++DCPGLAM+RAFGDF
Sbjct  227   QICSVQLTVDLKPDTPGEAERIKNCKGRILSVDEEPDVYRLWMPDEDCPGLAMSRAFGDF  286

Query  1214  CLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVE  1393
             C+KD G+IS+PE+ YR+IS  DEFVVLA+DGVWD L+N +V+K VA+AK+RS+AA LVV+
Sbjct  287   CVKDCGLISIPEVSYRRISSSDEFVVLATDGVWDALTNTDVVKIVASAKRRSIAAELVVK  346

Query  1394  RAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAA  1513
             RAVR WK+K+P SK DDCAV+CL+ K  +P L +T S  +
Sbjct  347   RAVRAWKRKFPESKIDDCAVICLYVK-DQPSLTQTASNLS  385



>ref|XP_003623414.1| hypothetical protein MTR_7g070510 [Medicago truncatula]
 gb|AES79632.1| protein phosphatase 2C-like protein [Medicago truncatula]
Length=447

 Score =   392 bits (1007),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 196/372 (53%), Positives = 255/372 (69%), Gaps = 27/372 (7%)
 Frame = +2

Query  551   DGIVGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHG  730
             D +  + D G  VRL G S+FVSMY+QQG KGVNQD+MTVWE + GE+G  FCGVFDGHG
Sbjct  42    DAVTYQND-GTMVRLKGFSKFVSMYTQQGMKGVNQDSMTVWEDYCGEEGMVFCGVFDGHG  100

Query  731   PSGHRVAQFIRDRLPSKLSVASKDNSQDFEKDIHHHPL-------------------FSK  853
             P GH+V+QFIRD LPS LS A K   Q   K    + +                    + 
Sbjct  101   PLGHKVSQFIRDNLPSTLSAAIKMAQQKTNKYYDANDVDTDNFDDVHHNNNRINNISLAS  160

Query  854   WKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTD  1033
             W+  F +SF ++D+ L  E   DS+ SG TAV LIKQG+ LI+GNLGDSRA++CTRD  D
Sbjct  161   WEGCFLKSFDEMDDHLAREVNTDSYCSGCTAVALIKQGDQLIVGNLGDSRAVLCTRD-RD  219

Query  1034  QLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDF  1213
             QL+  QLTVDLKP++P E+ RI SC+GRV A  EEP+V+R+WMP+ DCPGLAM+RAFGDF
Sbjct  220   QLIAVQLTVDLKPDIPSEASRICSCEGRVFAAEEEPDVYRIWMPDDDCPGLAMSRAFGDF  279

Query  1214  CLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVE  1393
             CLKDYG+I+ P++FYRKI+++DEFVVLASDG+WDVL+N EVI  VA+A ++S AA+++V+
Sbjct  280   CLKDYGLIATPDVFYRKITKQDEFVVLASDGIWDVLTNNEVINIVASAPRKSTAAKMLVK  339

Query  1394  RAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTM-----SQAAGLNMSFPETGRNEEN  1558
             RAV+ W  KYP SK DDCA VCLF    +P+L  +      S++        ++ RNE+N
Sbjct  340   RAVKAWMYKYPGSKIDDCAAVCLFLD-DQPILSHSQSSFKHSKSRHRRSKHSKSHRNEDN  398

Query  1559  SAIIAETDDGLD  1594
               +  +    LD
Sbjct  399   ETVAGKVGMELD  410



>ref|XP_008799822.1| PREDICTED: probable protein phosphatase 2C 73 [Phoenix dactylifera]
Length=432

 Score =   389 bits (1000),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 204/370 (55%), Positives = 251/370 (68%), Gaps = 34/370 (9%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             G RVRL GS  F SMY+QQG KGVNQDAMT+WE F GEK   FCGVFDGHGP GH+VA  
Sbjct  17    GTRVRLKGSCTFASMYTQQGWKGVNQDAMTMWEDFVGEKDTIFCGVFDGHGPFGHKVAGR  76

Query  758   IRDRLPSKLSVASKDNSQDFEKDI--------------------------HHHPLFSKWK  859
             +RD LPSKLS   K +SQ FE+D                                FS WK
Sbjct  77    VRDALPSKLSSELK-SSQSFEQDNNERNLNQNNVNGDDSDDSDHFHDASDDSQQCFSSWK  135

Query  860   STFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQL  1039
             + F ++F  +D  L  +  ID F SGTTAV+++KQ EHL+I NLGDSRA++CTRDD +Q 
Sbjct  136   AIFVKAFDKMDKELSQQAGIDCFCSGTTAVSIVKQREHLMIANLGDSRAVLCTRDDKNQP  195

Query  1040  VPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCL  1219
             VP QL+VDLKPN+P E+ERIKSCKGRV A  EEP+V R+W+P +D PGLAMARAFGDFCL
Sbjct  196   VPVQLSVDLKPNVPSEAERIKSCKGRVFALKEEPDVHRLWLPNEDSPGLAMARAFGDFCL  255

Query  1220  KDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERA  1399
             KD+G+IS P + YRK+SE+DEFVVLASDGVWDVLSN EV+K V++  +RS AA+++V+RA
Sbjct  256   KDFGLISTPLVSYRKLSEKDEFVVLASDGVWDVLSNKEVVKIVSSVSQRSDAAKILVDRA  315

Query  1400  VRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTM----SQAAGLNMSFPE---TGRNEEN  1558
             +R W+ K+P SK DDCAV+CLF        + TM    S    L +SF E   T R+ E 
Sbjct  316   IRAWRSKHPTSKVDDCAVICLFLNLLPTSTMATMEVHRSSGKSLGLSFSESFKTARSGEV  375

Query  1559  SAIIAETDDG  1588
             S +  E+  G
Sbjct  376   SDLDDESTAG  385



>ref|XP_009410548.1| PREDICTED: probable protein phosphatase 2C 73 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score =   389 bits (999),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 228/306 (75%), Gaps = 1/306 (0%)
 Frame = +2

Query  569   GDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRV  748
             GD G RVRL GS    SM++QQG KGVNQDAMT+WE F G++G  FCGVFDGHGP GHRV
Sbjct  36    GDGGGRVRLKGSCMVASMFTQQGWKGVNQDAMTLWEGFAGDQGTIFCGVFDGHGPYGHRV  95

Query  749   AQFIRDRLPSKLSVASKD-NSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDS  925
             A  +RD LPS+L    K       +        F+ W +T   +F+++D  L     ID 
Sbjct  96    ACHVRDALPSRLQSGMKAFEGGAGDTGGDGDGWFASWNATIVSAFEELDKELSNHPWIDC  155

Query  926   FSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKS  1105
               SG TAVT++K+ +HLII NLGDSRA++CTRDD DQLVP QLTVD KPNLP E+ERI+S
Sbjct  156   ICSGATAVTILKERDHLIIANLGDSRAVLCTRDDDDQLVPVQLTVDQKPNLPSEAERIRS  215

Query  1106  CKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEF  1285
             C+GRV +  EEP+V R+W+P++D PGLAMARAFGD CLKD+G+I+ P+I +RK+S++DEF
Sbjct  216   CRGRVFSLEEEPDVHRLWLPDEDSPGLAMARAFGDLCLKDFGLIATPQISHRKLSDKDEF  275

Query  1286  VVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLF  1465
             VVLA+DGVWDVLSN EVIK V++A KRS AA+ VV+RAVR W+ K+P SK DDC VVC F
Sbjct  276   VVLATDGVWDVLSNEEVIKIVSSANKRSAAAKQVVDRAVRAWRTKHPTSKVDDCTVVCFF  335

Query  1466  FKRPKP  1483
              ++P P
Sbjct  336   LQQPLP  341



>ref|XP_010264517.1| PREDICTED: probable protein phosphatase 2C 65 isoform X2 [Nelumbo 
nucifera]
Length=447

 Score =   389 bits (1000),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 239/322 (74%), Gaps = 22/322 (7%)
 Frame = +2

Query  569   GDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRV  748
             GDFG  VRL G S + SM++Q+GKKG+NQD+MT+WE   GEK   FCGVFDGHGP GH+V
Sbjct  36    GDFGELVRLKGFSEYTSMFTQKGKKGINQDSMTIWE-VSGEKDEIFCGVFDGHGPLGHKV  94

Query  749   AQFIRDRLPSKLSVASKD--------NSQDFEKDIHH-------------HPLFSKWKST  865
             +  +RD LPSKLS   K+        +S D ++D  H                FS WK  
Sbjct  95    SCHVRDALPSKLSYLLKEPEMVDYYSSSSDEDEDADHVDSSHNEANTQNSFSSFSLWKKC  154

Query  866   FPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVP  1045
             F ++FK++D  L  +  +DSF SG+TAVT++K+GEHLII NLGDSRA++CTR+  +QLVP
Sbjct  155   FVKAFKEMDRELYLDSTVDSFCSGSTAVTVLKKGEHLIIANLGDSRAVLCTRNQKNQLVP  214

Query  1046  EQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKD  1225
              QLTVDLKPNLP E+ERI+S  GRV A  EEP+V+R+WM ++DCPGLAM+RAFGDFCLK+
Sbjct  215   VQLTVDLKPNLPGEAERIRSYNGRVFAREEEPDVYRLWMADEDCPGLAMSRAFGDFCLKN  274

Query  1226  YGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVR  1405
             +G+ S P++ YR+++E DEFVVLA+DGVWDVLSN EVIK VA+A KRSMAA+L+V RA R
Sbjct  275   FGLSSTPKVSYRELAEEDEFVVLATDGVWDVLSNKEVIKIVASAGKRSMAAKLLVRRASR  334

Query  1406  TWKQKYPCSKTDDCAVVCLFFK  1471
              WK ++P +K DDCA +CLFFK
Sbjct  335   AWKFQHPTAKADDCAAICLFFK  356



>ref|XP_008464240.1| PREDICTED: probable protein phosphatase 2C 65 isoform X1 [Cucumis 
melo]
Length=475

 Score =   390 bits (1002),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 199/401 (50%), Positives = 269/401 (67%), Gaps = 45/401 (11%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MGACCT     K  +Y      +K++R+++ +    V RG+ GA VRL GSS F SM++Q
Sbjct  1     MGACCT-----KDNLYGGYTTYDKDDRDSNGDDGEEVRRGEDGATVRLRGSSAFTSMFTQ  55

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASKDNSQ  811
             +G+KG+NQDAMTVWE F GEK   FCGVFDGHGPSGHRVA+  RD LP+KLS A K    
Sbjct  56    RGRKGINQDAMTVWEDFSGEKDLMFCGVFDGHGPSGHRVARHARDILPTKLSTAIKKQLY  115

Query  812   DFEKDI--------------HHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAV  949
             + E  +                + L SKW++   +SFK++D  L  +  ID F SGTTAV
Sbjct  116   EPENGVVSEACVEPDNNGGKQRNRLVSKWEAALEESFKEVDQELSLDSSIDCFCSGTTAV  175

Query  950   TLIKQ------------------------GEHLIIGNLGDSRAIMCTRDDTDQLVPEQLT  1057
             T+IKQ                        GEHL++ ++GDSRA++CTR D  QL+P QLT
Sbjct  176   TIIKQVNFLENNILYFPIFIQSLDHFDHQGEHLVVASVGDSRAVLCTRGDKHQLIPIQLT  235

Query  1058  VDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVI  1237
             VD KPN+P E+ERIK+ +GR++A  EEP+++RVW+P+ + PGLAM+R+ GDFCLKDYG+I
Sbjct  236   VDQKPNIPCEAERIKNRQGRIIAEKEEPDIYRVWVPDGNYPGLAMSRSLGDFCLKDYGLI  295

Query  1238  SVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQ  1417
             S P++ YRK++ +DEF+VLA+DG+WDVL+N +VI  VA+ + RSMAA+LVV+ AV  WK+
Sbjct  296   STPQVSYRKLTRKDEFIVLATDGIWDVLTNNQVINIVASVRNRSMAAKLVVKLAVSEWKR  355

Query  1418  KYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNM-SFPE  1537
             ++P S  DDCA +CLFFK P P+L K+M+     N+ S PE
Sbjct  356   RFPGSLIDDCAAICLFFKNP-PLLTKSMTSVGRRNVRSHPE  395



>ref|XP_010038346.1| PREDICTED: probable protein phosphatase 2C 65 [Eucalyptus grandis]
Length=429

 Score =   388 bits (996),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 189/356 (53%), Positives = 237/356 (67%), Gaps = 55/356 (15%)
 Frame = +2

Query  620   MYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSK------  781
             M+ ++G+KG+NQD +TVWE F GEKGAFFCGVFDGHGP+GHRVAQ +RD+LPSK      
Sbjct  1     MFCKRGRKGINQDTLTVWEDFNGEKGAFFCGVFDGHGPAGHRVAQHVRDQLPSKLSSVIQ  60

Query  782   -----------------------------------LSVASKDNS--------------QD  814
                                                L +  KD+S                
Sbjct  61    SLQNRGSRRDLDLVDKDDDGQENGEKERRGSNPGDLDLVDKDDSGQENGEKERSDDVRDS  120

Query  815   FEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLG  994
             +E+D  H  L S W+++F +SFK+ID  L  +  IDSF SG+TAVT+IKQG+HL+I NLG
Sbjct  121   WEEDFGHDMLLSSWEASFVKSFKEIDEELSLDSSIDSFCSGSTAVTMIKQGDHLVIANLG  180

Query  995   DSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQD  1174
             DSRA++CTR   +Q VP QLTVDLKPN+  E++RIK CKGRV A  EEP VFRVW+P+++
Sbjct  181   DSRAVLCTRGQKNQPVPIQLTVDLKPNIKSEADRIKKCKGRVFAMDEEPEVFRVWLPDEN  240

Query  1175  CPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVAT  1354
             CPGLAMARAFGDFCLKDYG+IS PE+ YRK++  DEFVVLA+DGVWD LSN EV++ VA+
Sbjct  241   CPGLAMARAFGDFCLKDYGLISTPEVSYRKLTPDDEFVVLATDGVWDALSNAEVVRIVAS  300

Query  1355  AKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLN  1522
              +KRSMAA+L+V  AV  WK KYP  K DDCAVVCLF K  +P     ++  +G N
Sbjct  301   TRKRSMAAKLLVAHAVLAWKTKYPGCKIDDCAVVCLFLKNGRPRSQSVVNNTSGGN  356



>ref|XP_010257126.1| PREDICTED: probable protein phosphatase 2C 73 [Nelumbo nucifera]
Length=499

 Score =   386 bits (992),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 191/355 (54%), Positives = 250/355 (70%), Gaps = 35/355 (10%)
 Frame = +2

Query  569   GDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRV  748
             GDFG+RV L GS  F SM++Q+G+KG+NQDAMT+WE F GEK   FC VFDGHGP GH+V
Sbjct  94    GDFGSRVMLRGSCEFASMFTQKGRKGINQDAMTIWEDFAGEKDLIFCAVFDGHGPYGHKV  153

Query  749   AQFIRDRLPSKLSV------------------ASKD----------NSQDFEK-DIHHHP  841
             A  +RD LPSKLS                   AS D          NSQD +  +  H+ 
Sbjct  154   AGCVRDALPSKLSSRLKSWKLGEYDHKEDGNDASSDDVGHYSNDEANSQDKDGGESDHNR  213

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
                  K+ F ++F+D+D  L  +  I+S+ SGTTAVT++K+GEHLII NLGDSRA++CT 
Sbjct  214   SLCSLKTCFVKAFEDMDEELRQDSTIESYCSGTTAVTVLKKGEHLIIANLGDSRAVLCTI  273

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             D+ +QLVP QLTVDLKPN+P E+ERI+ C GRV A  +E +V+RVW+P++D PGLAMARA
Sbjct  274   DNKNQLVPIQLTVDLKPNIPSEAERIRRCGGRVFAMEDERDVYRVWVPDEDYPGLAMARA  333

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             F DFCLKD+G+IS P++ YRKI+++DEFVV+A+DGVWDVLSN EV++ VA+A+KR MAA+
Sbjct  334   FADFCLKDFGLISTPQVSYRKITDKDEFVVMATDGVWDVLSNEEVVEIVASAQKRCMAAK  393

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLF------FKRPKPMLLKTMSQAAGLNMS  1528
             L+V  A + W+ KYP SK DDCAVVCLF      F +  P+L+   S+   L++S
Sbjct  394   LLVNHACQAWENKYPNSKVDDCAVVCLFLKQQSSFTKTTPVLMNNESRNRRLDIS  448



>gb|KHG17181.1| hypothetical protein F383_23069 [Gossypium arboreum]
Length=418

 Score =   382 bits (982),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 193/368 (52%), Positives = 260/368 (71%), Gaps = 23/368 (6%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGR-GDFGARVRLHGSSRFVSMYS  628
             MGACCT   +K +  +R  +   ++E +    H  ++   G  GA VRL GSS F+SMY+
Sbjct  1     MGACCTTH-IKYQGRHRADDDLAEKEGKG---HQQVLPTPGHNGAIVRLQGSSSFISMYT  56

Query  629   QQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSV------  790
             ++GKKG+NQDAMTVWE+F GEK +FFCGVFDGHGP GH+V++ +RD LP KLS       
Sbjct  57    RKGKKGINQDAMTVWENFMGEKKSFFCGVFDGHGPFGHKVSRHVRDTLPFKLSSIIKTSQ  116

Query  791   --------ASKDNSQDFEKDIHH---HPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSG  937
                     A+    Q + K+  +      FS W+++  ++FK+ D  L      +S++SG
Sbjct  117   PNGCTENDAAASAGQSYGKNDSNGVNEDRFSSWEASLIRAFKESDEELNSGLSFNSYNSG  176

Query  938   TTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGR  1117
             +TAVT++KQ EHLII NLGDSRAI+CTR + ++L+P QLTVDLKP LP E+ERI+ C GR
Sbjct  177   STAVTIVKQDEHLIISNLGDSRAILCTRGNKNRLIPIQLTVDLKPRLPDEAERIEKCGGR  236

Query  1118  VMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLA  1297
             V A  EEP+V RVW P+QD PGLAM RAFGDFCLKDYG+ S+PE+ YR+++  DEFVVLA
Sbjct  237   VFAMDEEPHVLRVWAPDQDSPGLAMTRAFGDFCLKDYGLSSIPEVSYRRLTNNDEFVVLA  296

Query  1298  SDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRP  1477
             +DGVWDVL+N EVI  VA+ KK+S AA+++V  AV+ WK +YP S+ DDCAV+CLF K  
Sbjct  297   TDGVWDVLTNKEVITIVASVKKQSTAAKVLVYYAVQAWKSRYPGSQVDDCAVICLFLKE-  355

Query  1478  KPMLLKTM  1501
             +P++ K++
Sbjct  356   QPLVSKSV  363



>ref|XP_010931503.1| PREDICTED: probable protein phosphatase 2C 73 [Elaeis guineensis]
Length=446

 Score =   382 bits (981),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 250/375 (67%), Gaps = 34/375 (9%)
 Frame = +2

Query  563   GRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGH  742
             G+ + G  VRL G   F SMY+QQG KGVNQDAMT+WE F GEK   FCGVFDGHGP GH
Sbjct  26    GKEEDGGCVRLKGWCTFASMYTQQGWKGVNQDAMTIWEDFAGEKDTIFCGVFDGHGPFGH  85

Query  743   RVAQFIRDRLPSKLS---------------------VASKDNSQDFEKDIHH-----HPL  844
             ++A  +RD LP+KLS                         D+S D ++  H+        
Sbjct  86    KIAGCVRDALPTKLSSDFMSSQFFDHGNNDGNLNKNNVHGDDSDDSDR-FHNVSDDSQQC  144

Query  845   FSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD  1024
              S WK+ F ++F+++D  L  +  ID   SGTTAV+++KQ EHLII NLGDSRA++CTRD
Sbjct  145   LSSWKTIFVKAFEEMDRELSQQASIDCICSGTTAVSIVKQREHLIIANLGDSRAVLCTRD  204

Query  1025  DTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAF  1204
             D ++ V  QLTVDLKPN+P E+ERIK+CKGRV A  EEP+V R+W+P +D PGLAMARAF
Sbjct  205   DGNRPVAVQLTVDLKPNVPSEAERIKNCKGRVFALEEEPDVHRLWLPNEDTPGLAMARAF  264

Query  1205  GDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARL  1384
             GDFCLKDYG+IS P++ YRK+SE+DEFVVLA+DGVWDVLSN EV+K V++A KR  AA+ 
Sbjct  265   GDFCLKDYGLISTPQVSYRKLSEKDEFVVLATDGVWDVLSNEEVVKIVSSASKRHAAAKQ  324

Query  1385  VVERAVRTWKQKYPCSKTDDCAVVCLFFK----RPKPMLLKTMSQAAGLNMSFPE---TG  1543
             +V+RAVR W++K+P SK DDCAV+CLF         P +    S      +SF E   T 
Sbjct  325   LVDRAVRAWRRKHPTSKVDDCAVICLFLNLLPTSTMPTIDAHRSSRKSRELSFSESFKTA  384

Query  1544  RNEENSAIIAETDDG  1588
             R+ E S +  E+  G
Sbjct  385   RSGEVSGLDDESTAG  399



>ref|XP_010558395.1| PREDICTED: probable protein phosphatase 2C 65 isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010558396.1| PREDICTED: probable protein phosphatase 2C 65 isoform X3 [Tarenaya 
hassleriana]
Length=361

 Score =   378 bits (971),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 231/308 (75%), Gaps = 2/308 (1%)
 Frame = +2

Query  560   VGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSG  739
             V + D GA +R  GSS  +SM  QQGKKG+NQDAMTVWE+F G +   FCGVFDGHGP G
Sbjct  11    VRKTDDGAVIRSRGSSEHISMAIQQGKKGINQDAMTVWENFAGLEDMIFCGVFDGHGPMG  70

Query  740   HRVAQFIRDRLPSKLSVASKDNSQDFEKDIHHHP-LFSKWKSTFPQSFKDIDNALEGEEK  916
             H++A+ +R+ LPS L  A + +    +    +H  LF ++K+   +SFK +D+ +  +  
Sbjct  71    HKIARHVRENLPSMLHSAIRSSRSIIDISFQNHEELFHEFKAVLTKSFKYVDDEIGVQSP  130

Query  917   IDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESER  1096
              +SF SGTTAVT+IK+G+ L+I NLGDSRAI+CTR    QL   QLTVDLKP +P E+ER
Sbjct  131   YESFCSGTTAVTIIKRGDSLVIANLGDSRAILCTRGGKSQLQAVQLTVDLKPRVPGEAER  190

Query  1097  IKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISER  1276
             IK+CKGRV A  EEP V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++S+P++F+R+++  
Sbjct  191   IKACKGRVFAMEEEPEVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLLSIPDVFFRRVTSD  250

Query  1277  DEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVV  1456
             DEFVVLA+DG+WDVL+N EV+KTVA+ K+R+ AA  VVERA R W+ KYP S+ DDCAVV
Sbjct  251   DEFVVLATDGIWDVLTNEEVVKTVASTKERAKAAERVVERATRAWRIKYPISRADDCAVV  310

Query  1457  CLFFK-RP  1477
              LF   RP
Sbjct  311   VLFLNHRP  318



>ref|XP_010558393.1| PREDICTED: probable protein phosphatase 2C 65 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010558394.1| PREDICTED: probable protein phosphatase 2C 65 isoform X2 [Tarenaya 
hassleriana]
Length=370

 Score =   378 bits (971),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 231/308 (75%), Gaps = 2/308 (1%)
 Frame = +2

Query  560   VGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSG  739
             V + D GA +R  GSS  +SM  QQGKKG+NQDAMTVWE+F G +   FCGVFDGHGP G
Sbjct  20    VRKTDDGAVIRSRGSSEHISMAIQQGKKGINQDAMTVWENFAGLEDMIFCGVFDGHGPMG  79

Query  740   HRVAQFIRDRLPSKLSVASKDNSQDFEKDIHHHP-LFSKWKSTFPQSFKDIDNALEGEEK  916
             H++A+ +R+ LPS L  A + +    +    +H  LF ++K+   +SFK +D+ +  +  
Sbjct  80    HKIARHVRENLPSMLHSAIRSSRSIIDISFQNHEELFHEFKAVLTKSFKYVDDEIGVQSP  139

Query  917   IDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESER  1096
              +SF SGTTAVT+IK+G+ L+I NLGDSRAI+CTR    QL   QLTVDLKP +P E+ER
Sbjct  140   YESFCSGTTAVTIIKRGDSLVIANLGDSRAILCTRGGKSQLQAVQLTVDLKPRVPGEAER  199

Query  1097  IKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISER  1276
             IK+CKGRV A  EEP V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++S+P++F+R+++  
Sbjct  200   IKACKGRVFAMEEEPEVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLLSIPDVFFRRVTSD  259

Query  1277  DEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVV  1456
             DEFVVLA+DG+WDVL+N EV+KTVA+ K+R+ AA  VVERA R W+ KYP S+ DDCAVV
Sbjct  260   DEFVVLATDGIWDVLTNEEVVKTVASTKERAKAAERVVERATRAWRIKYPISRADDCAVV  319

Query  1457  CLFFK-RP  1477
              LF   RP
Sbjct  320   VLFLNHRP  327



>ref|XP_010922660.1| PREDICTED: probable protein phosphatase 2C 73 isoform X1 [Elaeis 
guineensis]
Length=451

 Score =   381 bits (978),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 248/370 (67%), Gaps = 34/370 (9%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             G R RL GS  F SMY+Q+G KGVNQDAMT+WE F GEK   FCGVFDGHGP GH+VA  
Sbjct  36    GTRARLKGSCTFASMYTQRGWKGVNQDAMTMWEDFAGEKDTIFCGVFDGHGPLGHKVAGC  95

Query  758   IRDRLPSKLSVASKDNSQDFEKDI--------------------------HHHPLFSKWK  859
             +RD LPSKLS   K +SQ F+ D                                FS WK
Sbjct  96    VRDALPSKLSSELK-SSQFFDPDNNDRNLNQNNVNGNDSDDSDHFHDVSDDSQLCFSSWK  154

Query  860   STFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQL  1039
             + F ++F+ +D  L  +  ID F SG+TAV+++KQ EHL+I NLGDSRA++CTRDD +Q 
Sbjct  155   AIFVEAFEKMDKELSQQASIDCFCSGSTAVSIVKQREHLMIANLGDSRAVLCTRDDKNQP  214

Query  1040  VPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCL  1219
             VP QLTVDLKPN+P E+ERIKSCKGRV A  EEP+V R+W+P  D PGLAMARAFGDFCL
Sbjct  215   VPVQLTVDLKPNVPSEAERIKSCKGRVFALKEEPDVHRLWLPNDDSPGLAMARAFGDFCL  274

Query  1220  KDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERA  1399
             KD+G+IS P++ YRK+SE+DEFVVLA+DGVWDVLSN EV+K V++   RS AA+++V+RA
Sbjct  275   KDFGLISTPQVSYRKLSEKDEFVVLATDGVWDVLSNKEVVKIVSSVSHRSDAAKILVDRA  334

Query  1400  VRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTM----SQAAGLNMSFPE---TGRNEEN  1558
             VR W+ K+P SK DDCAV+CLF        + TM    S    L +S  E   T R+ E 
Sbjct  335   VRAWRYKHPTSKVDDCAVICLFLNLLPTSTMPTMEAHRSSGKSLELSLSESFKTARSGEV  394

Query  1559  SAIIAETDDG  1588
             S +  E+  G
Sbjct  395   SDLDDESTAG  404



>ref|XP_010558391.1| PREDICTED: probable protein phosphatase 2C 65 isoform X1 [Tarenaya 
hassleriana]
Length=401

 Score =   379 bits (972),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 231/308 (75%), Gaps = 2/308 (1%)
 Frame = +2

Query  560   VGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSG  739
             V + D GA +R  GSS  +SM  QQGKKG+NQDAMTVWE+F G +   FCGVFDGHGP G
Sbjct  51    VRKTDDGAVIRSRGSSEHISMAIQQGKKGINQDAMTVWENFAGLEDMIFCGVFDGHGPMG  110

Query  740   HRVAQFIRDRLPSKLSVASKDNSQDFEKDIHHHP-LFSKWKSTFPQSFKDIDNALEGEEK  916
             H++A+ +R+ LPS L  A + +    +    +H  LF ++K+   +SFK +D+ +  +  
Sbjct  111   HKIARHVRENLPSMLHSAIRSSRSIIDISFQNHEELFHEFKAVLTKSFKYVDDEIGVQSP  170

Query  917   IDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESER  1096
              +SF SGTTAVT+IK+G+ L+I NLGDSRAI+CTR    QL   QLTVDLKP +P E+ER
Sbjct  171   YESFCSGTTAVTIIKRGDSLVIANLGDSRAILCTRGGKSQLQAVQLTVDLKPRVPGEAER  230

Query  1097  IKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISER  1276
             IK+CKGRV A  EEP V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++S+P++F+R+++  
Sbjct  231   IKACKGRVFAMEEEPEVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLLSIPDVFFRRVTSD  290

Query  1277  DEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVV  1456
             DEFVVLA+DG+WDVL+N EV+KTVA+ K+R+ AA  VVERA R W+ KYP S+ DDCAVV
Sbjct  291   DEFVVLATDGIWDVLTNEEVVKTVASTKERAKAAERVVERATRAWRIKYPISRADDCAVV  350

Query  1457  CLFFK-RP  1477
              LF   RP
Sbjct  351   VLFLNHRP  358



>gb|KHN44853.1| Hypothetical protein glysoja_024424 [Glycine soja]
Length=349

 Score =   368 bits (944),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 188/358 (53%), Positives = 243/358 (68%), Gaps = 28/358 (8%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MG CC+C      +V+ V+   N          DG    G  GARV L GSS FVSMYSQ
Sbjct  1     MGGCCSCHVSFVGKVHDVECECNHNND------DGACEHG--GARVMLKGSSTFVSMYSQ  52

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK----  799
             +G KGVNQDA+TVW+ F G+K   FCGVFDGHGP GH+++Q IRD LP+KLS + K    
Sbjct  53    KGSKGVNQDALTVWQDFTGKKDMIFCGVFDGHGPLGHKLSQCIRDNLPAKLSASIKQSQE  112

Query  800   --------------DNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSG  937
                            +S D+ +D + +  F  W+ TF + F +ID         D F  G
Sbjct  113   KAMKHYDANATNGGSHSDDYVED-NQNMSFPSWEGTFMRCFSEIDEKFAKNIDTDGFRGG  171

Query  938   TTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGR  1117
             +TAVT+IKQG+ LIIGN+GDSRA++C R   ++L+P QLTVDL P++P E+ RI +C GR
Sbjct  172   STAVTVIKQGDQLIIGNVGDSRAVLCRRAPDNRLIPVQLTVDLTPDIPREALRIINCGGR  231

Query  1118  VMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLA  1297
             + AT E+P+V RVWMP+ DCPGLAMARAFG+FCLKDYGV S+P++ YRK++++DEFVVLA
Sbjct  232   IFATEEDPSVNRVWMPKGDCPGLAMARAFGNFCLKDYGVTSIPDVSYRKLTKQDEFVVLA  291

Query  1298  SDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             SDG+WD+LSN EVI  VA+A KRSMAA+L+V  AVR W+ K+   K DDC+ +CLF K
Sbjct  292   SDGIWDMLSNSEVINIVASAPKRSMAAKLLVNHAVRAWRYKHG-FKVDDCSAICLFLK  348



>emb|CBI18095.3| unnamed protein product [Vitis vinifera]
Length=692

 Score =   379 bits (972),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 221/296 (75%), Gaps = 27/296 (9%)
 Frame = +2

Query  620   MYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK  799
             M++Q G+KG+NQDAMTVWE F GEKG FFC V DGHGPSGH VA                
Sbjct  1     MFTQGGRKGINQDAMTVWEDFSGEKGMFFCAVLDGHGPSGHHVAGL--------------  46

Query  800   DNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLI  979
                         +PLF  WK++  +SF+++D  L      DSF SGTTAVT+IKQ +HLI
Sbjct  47    ------------YPLFPLWKASLIKSFEEMDEELGSNSTFDSFCSGTTAVTVIKQEDHLI  94

Query  980   IGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVW  1159
             I NLGDSRA++CTR + +QLVP QLTVDLKPNLP E+ERIK+CKGRV A  +E  V+R+W
Sbjct  95    IANLGDSRAVLCTRGNRNQLVPVQLTVDLKPNLPSEAERIKNCKGRVFALPDESGVYRLW  154

Query  1160  MPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVI  1339
             MP+Q+ PGLAM RAFGDFCLKDYG+IS+P++ YRK++++DEFVVLASDGVWDVLSN EV 
Sbjct  155   MPDQNSPGLAMTRAFGDFCLKDYGLISIPDVSYRKLTDKDEFVVLASDGVWDVLSNSEVT  214

Query  1340  KTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQ  1507
             + VA+AKKRSMAA+L+V+RAVR WK KYP  KTDDCAV+CLF K P P+  K+ S+
Sbjct  215   RIVASAKKRSMAAQLLVDRAVREWKIKYPGCKTDDCAVICLFLKTP-PLSTKSTSK  269



>ref|XP_002325473.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ABK95223.1| unknown [Populus trichocarpa]
 gb|EEE99854.1| phosphatase 2C family protein [Populus trichocarpa]
Length=493

 Score =   369 bits (947),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 183/330 (55%), Positives = 228/330 (69%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG  + A FCGVFDGHGP GH VA+ +
Sbjct  54    GRLFLNGSSDIASLFTQQGKKGTNQDAMIVWENFGSRRDAVFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKLS------VASKD-------------NSQDFE--------------KDIHHHP  841
             RD LP KL+      VAS+D             NS+D                +D   HP
Sbjct  114   RDSLPLKLTAHWEVNVASEDVLREISLNTTGSMNSEDTSFISADDESRASVDLEDAEKHP  173

Query  842   -LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L     ID F SGTTAVTL+KQG++L++GN+GDSRA++ T
Sbjct  174   EIFQTLKESFLKAFKIMDRELRVHTNIDCFCSGTTAVTLVKQGQYLVLGNVGDSRAVLGT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D LV  QLTVDLKPNLPVE+ERI+ C+GRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDDSLVAVQLTVDLKPNLPVEAERIRKCRGRVFALQDEPEVSRVWLPNNDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP+I YR ++E+DEF+VLA+DG+WDVLSN EV+  V +   RS AA
Sbjct  294   AFGDFCLKDFGLISVPDISYRCLTEKDEFIVLATDGIWDVLSNKEVVDIVGSVPSRSSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             + +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  354   KTLVELAVRAWRYKYPTSKIDDCAVVCLFL  383



>ref|XP_002514837.1| protein phosphatase-2c, putative [Ricinus communis]
 gb|EEF47391.1| protein phosphatase-2c, putative [Ricinus communis]
Length=499

 Score =   368 bits (945),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/372 (50%), Positives = 242/372 (65%), Gaps = 36/372 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQG+KG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  54    GRLFLNGSSDIASLFTQQGRKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKLS------VASKD-------------NSQ---------------DFEKDIHHH  838
             RD LP KLS      + S+D             NS+               D +  + H 
Sbjct  114   RDHLPLKLSAHWEVNITSEDVLKEISLNTAGSMNSEDTTFVSADEESRASVDLDDTVKHP  173

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L     ID F SGTTAVTLIKQG +L++GN+GDSRA++ T
Sbjct  174   EIFQTLKESFLKAFKVMDRELRIHANIDCFCSGTTAVTLIKQGRNLVVGNVGDSRAVLGT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D LV  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDDSLVAVQLTVDLKPNLPAEAERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP++ +R++SE+DEF+VLA+DG+WDVLSN EV+  VA+   R  AA
Sbjct  294   AFGDFCLKDFGLISVPDVSFRRLSEKDEFIVLATDGIWDVLSNKEVVDIVASVPTRPSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEEN  1558
             R +VE AVR W+ KYP SK DDCAVVCLF          T++  A  N++  E   +E+ 
Sbjct  354   RALVESAVRAWRYKYPTSKVDDCAVVCLFLDSNNVSTASTVN--ANSNINTKEQPTSEDQ  411

Query  1559  SAIIAETDDGLD  1594
             + + ++ +D L+
Sbjct  412   ADVDSQKEDDLN  423



>ref|XP_006847475.1| hypothetical protein AMTR_s00163p00051750 [Amborella trichopoda]
 gb|ERN09056.1| hypothetical protein AMTR_s00163p00051750 [Amborella trichopoda]
Length=480

 Score =   367 bits (943),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 226/332 (68%), Gaps = 33/332 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS+  S+++QQG+KG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  49    GRMFLNGSSKVASLFTQQGRKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  108

Query  761   RDRLPSKL----------------------SVASKD-----------NSQDFEKDIHHHP  841
             RD LP KL                      S+ S+D           +S D E+      
Sbjct  109   RDSLPLKLSAHWEVNIGSEEGLRENSSISGSMNSEDSAFMCLDEESRDSMDLEEKEKLAE  168

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   K +F ++FK +D  L     ID F SGTTAVTL+KQG+ L+IGN+GDSRAI+ TR
Sbjct  169   IFMSLKDSFLKAFKVMDKELRLHPAIDCFCSGTTAVTLVKQGQDLVIGNIGDSRAILGTR  228

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             D+ D L+  QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMARA
Sbjct  229   DEDDSLIAVQLTVDLKPNLPREAERIRQCRGRVFALQDEPEVARVWLPNNDSPGLAMARA  288

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKDYG+ISVP++ YR+++ERDEF+VLA+DGVWDVLSN EV+  VA+A  R+ AAR
Sbjct  289   FGDFCLKDYGLISVPDVSYRRLTERDEFIVLATDGVWDVLSNKEVVDIVASAMTRTTAAR  348

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFFKRP  1477
              +VE AVR W+ KYP SK DDCAVVCLF   P
Sbjct  349   SLVESAVRAWRYKYPTSKVDDCAVVCLFLDHP  380



>ref|XP_004514257.1| PREDICTED: probable protein phosphatase 2C 74-like [Cicer arietinum]
Length=364

 Score =   363 bits (931),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 225/318 (71%), Gaps = 21/318 (7%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGV-NQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQ  754
             G ++ L GSS FVSMY Q+G KG+ NQDAMTVW+ F G+K   FCGVFDGHGP GH+ + 
Sbjct  36    GDQIMLRGSSNFVSMYCQKGTKGLHNQDAMTVWKDFAGDKDTIFCGVFDGHGPLGHKFSY  95

Query  755   FIRDRLPSKLSVASKDNSQDFEK--------------------DIHHHPLFSKWKSTFPQ  874
              IRD+LPSKLS   K + Q   K                    +I+     + W+ +F +
Sbjct  96    SIRDKLPSKLSTIIKLSQQKLSKQNGPNAKEKSSYGDLYSNDDEINQQLSIASWEGSFLR  155

Query  875   SFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQL  1054
             SF ++D  L      D F  G+ AVTLIK+G+ LIIGNLGDSRA++CT+ D + L+P QL
Sbjct  156   SFNEMDKYLAKNVDTDGFCGGSVAVTLIKKGDQLIIGNLGDSRAVLCTKADDNHLIPIQL  215

Query  1055  TVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGV  1234
             +VDL P++P E++R+  C GRV AT ++P V R+WMPE DCPGLAM RAFGDFCLKDYG+
Sbjct  216   SVDLIPDVPSEAKRVIKCGGRVFATKQDPTVNRIWMPEGDCPGLAMTRAFGDFCLKDYGL  275

Query  1235  ISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWK  1414
              S+P++ YRK++++DEFVVLA+DG+W+VL+N EVI  VA+A KRS+AA+L+V+RAV+ WK
Sbjct  276   SSIPDVSYRKLTKQDEFVVLATDGIWNVLTNMEVITIVASAPKRSLAAKLLVKRAVQVWK  335

Query  1415  QKYPCSKTDDCAVVCLFF  1468
             QKYP    DDCA +CLFF
Sbjct  336   QKYPRHHIDDCAAICLFF  353



>gb|KEH28819.1| phosphatase 2C family protein [Medicago truncatula]
Length=357

 Score =   363 bits (931),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 183/360 (51%), Positives = 244/360 (68%), Gaps = 21/360 (6%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MG  C+CQ     +V+ V+  E  ++       +G       G++V   GSS+ +SMY +
Sbjct  1     MGNFCSCQVSIIGKVHDVEYDECDQKDIDFTSENG-------GSQVMFKGSSKSISMYCK  53

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSV-------  790
             +G KG+NQDA+TVWE FGGEK   FCGVFDGHGP GH+ AQ IRD LPSKLS        
Sbjct  54    KGTKGINQDAITVWEDFGGEKDTIFCGVFDGHGPLGHKFAQCIRDNLPSKLSTTIKMSQQ  113

Query  791   ----ASKDNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGE-EKIDSFSSGTTAVTL  955
                 A+  N   +++D  H    S W+     SF ++D  L     K D F  G+ AVTL
Sbjct  114   NVDGANATNKNTYDEDKQHLSCTS-WEKHLFSSFNEMDEDLAKNIAKTDGFCGGSVAVTL  172

Query  956   IKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAE  1135
             IKQG+ LIIGNLGDSRA++CT+ D + L+P QL+ DL P++P E++R+ +C GRV A  E
Sbjct  173   IKQGDQLIIGNLGDSRAVLCTKADDNHLIPIQLSTDLVPDVPNEAKRVINCGGRVFAAKE  232

Query  1136  EPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWD  1315
             +P+V R+WM E DCPGLAM+RAFGDFCLK+YG+ SVP++ +RKI+++DEFVVLASDGVW+
Sbjct  233   DPDVKRIWMAEGDCPGLAMSRAFGDFCLKEYGLSSVPDVSHRKITKQDEFVVLASDGVWN  292

Query  1316  VLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLK  1495
              LSN EVI  VA+A KRS+AA+L+V+RAV+ WKQK PC   DDC+ +CLF    +P+ L+
Sbjct  293   ALSNIEVITIVASAPKRSLAAKLLVKRAVQAWKQKNPCYHVDDCSAICLFL-NDQPVNLR  351



>gb|EYU39712.1| hypothetical protein MIMGU_mgv1a008325mg [Erythranthe guttata]
Length=377

 Score =   362 bits (928),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/328 (54%), Positives = 218/328 (66%), Gaps = 36/328 (11%)
 Frame = +2

Query  593   LHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRL  772
             L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +RD L
Sbjct  3     LNGSSDVASLFTQQGKKGTNQDAMVVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDSL  62

Query  773   PSKL------------------------SVASKDNSQ------------DFEKDIHHHPL  844
             P  L                        S+++++ S             D E+ +    +
Sbjct  63    PLMLIANWEVNNIKSGEILREVSLNTTESLSTEEASSCLSANEEVMSSIDSEEALKQQGV  122

Query  845   FSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD  1024
             F   K +F  +FK +D  L     ID F SGTTAVT +KQG+HL+IGN+GDSRA++ TRD
Sbjct  123   FQALKKSFLNAFKVMDRELRMYTNIDCFYSGTTAVTFVKQGQHLVIGNVGDSRAVLATRD  182

Query  1025  DTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAF  1204
             + ++L   QLTVDLKPNLP E ERI+ CKGRV A  +EP V RVW+P  + PGLAMARAF
Sbjct  183   ENNKLTAVQLTVDLKPNLPAEEERIRKCKGRVFALQDEPEVARVWLPNNNSPGLAMARAF  242

Query  1205  GDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARL  1384
             GDFCLKD+G+ISVPEI YR I+ +DEFVVLA+DG+WDVLSN EV+K V++   RS AAR 
Sbjct  243   GDFCLKDFGLISVPEISYRHITNKDEFVVLATDGIWDVLSNKEVVKIVSSCPSRSQAARA  302

Query  1385  VVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             VVE AVR W+ KYP SK DDCAVVCLF 
Sbjct  303   VVETAVRAWRSKYPTSKVDDCAVVCLFL  330



>ref|XP_008777864.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Phoenix 
dactylifera]
Length=498

 Score =   365 bits (938),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 225/335 (67%), Gaps = 34/335 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G+S   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  53    GRMFLNGASSVASLFTQQGKKGTNQDAMIVWENFGSRADTVFCGVFDGHGPYGHMVARKV  112

Query  761   RDRLPSKLS------VASKD-------------NSQ---------------DFEKDIHHH  838
             RD LP KLS      V S D             NS+               D E+   H 
Sbjct  113   RDSLPLKLSTHLEVNVGSDDCREGSIISHSGSMNSEETSSICLDEGSGVSTDIEEKDKHP  172

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L+    I+ F SGTTAVT++KQGE L+IGN+GDSRA++ T
Sbjct  173   EIFMTLKESFVKAFKVMDKELKLHPNINCFCSGTTAVTMVKQGEDLVIGNVGDSRAVLGT  232

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D L+  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  + PGLAMAR
Sbjct  233   RDKNDCLIAVQLTVDLKPNLPREAERIRKCKGRVFALQDEPGVARVWLPNSNSPGLAMAR  292

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVPE+ YR+++ERDEF+VLA+DGVWDVLSN EV+  VA+   RS AA
Sbjct  293   AFGDFCLKDFGLISVPEVSYRRVTERDEFIVLATDGVWDVLSNKEVVDIVASTPARSSAA  352

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKP  1483
             R +VE AVR W+ KYP SK DDCAVVCLF     P
Sbjct  353   RSLVESAVRAWRLKYPTSKIDDCAVVCLFLNADAP  387



>ref|XP_010907919.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
Length=486

 Score =   364 bits (934),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 192/369 (52%), Positives = 239/369 (65%), Gaps = 41/369 (11%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G+S   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  53    GRLFLNGASSVASLFTQQGKKGTNQDAMIVWENFGSRADTVFCGVFDGHGPYGHMVARSV  112

Query  761   RDRLPSKLS------VASKD-------------NSQDF----------------EKDIHH  835
             RD LP KLS      V S D             NS++                 EKD  H
Sbjct  113   RDSLPLKLSSHLEVNVGSDDHRECSIISHSGSMNSEETSSICLDKEPRVFTDIGEKD-KH  171

Query  836   HPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMC  1015
               +F   K +F ++FK +D  L+   KID F SGTTAVT++KQGE L+IGN+GDSRA++ 
Sbjct  172   PDIFMTLKESFLKAFKVMDKELKLHPKIDCFCSGTTAVTVVKQGEDLVIGNVGDSRAVLG  231

Query  1016  TRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMA  1195
             TRD  D L+  QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  + PGLAMA
Sbjct  232   TRDKNDCLIAVQLTVDLKPNLPREAERIRKCRGRVFALQDEPEVARVWLPNSNSPGLAMA  291

Query  1196  RAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMA  1375
             RAFGDFCLKD+G+ISVPE+ Y +I+ERDEF+VLA+DGVWDVLSN EV+  VA A  RS A
Sbjct  292   RAFGDFCLKDFGLISVPEVSYWRITERDEFIVLATDGVWDVLSNKEVVDIVACAPARSSA  351

Query  1376  ARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEE  1555
             AR +VE AV+ W+ KYP SK DDCAVVCLF K   P     +  A      +  TGR ++
Sbjct  352   ARFLVESAVQAWRLKYPTSKIDDCAVVCLFLKTDAPNNSSNLKTA-----DYMGTGRGKQ  406

Query  1556  NSAIIAETD  1582
               +  + TD
Sbjct  407   EPSTPSSTD  415



>ref|XP_011013066.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 33 [Populus euphratica]
Length=493

 Score =   364 bits (935),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 180/330 (55%), Positives = 226/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG  + A FCGVFDGHGP GH VA+ +
Sbjct  54    GRLFLNGSSDIASLFTQQGKKGTNQDAMIVWENFGSRRDAVFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKLS------VASKD-------------NSQDFE--------------KDIHHHP  841
             RD LP KL+      + S+D             NS+D                +D   HP
Sbjct  114   RDSLPLKLTTHWEVNITSEDVLREISLNTTGSMNSEDTSFISADDESRASVDLEDAEKHP  173

Query  842   -LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L     ID F SGTTAVTL+KQG++L++GN+GDSRA++ T
Sbjct  174   EIFQTLKESFLKAFKVMDRELRVHTNIDCFCSGTTAVTLVKQGQYLVLGNVGDSRAVLGT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D LV  QLTVDLKPNLPVE+ERI+ C+GRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDDSLVAVQLTVDLKPNLPVEAERIRKCRGRVFALQDEPEVARVWLPNNDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AF DFCLKD+G+ISVP+I YR ++E+DEF+VLA+DG+WDVLSN EV+  V +   RS AA
Sbjct  294   AFXDFCLKDFGLISVPDISYRCLTEKDEFIVLATDGIWDVLSNKEVVDIVGSVPSRSSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             + +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  354   KTLVELAVRAWRYKYPTSKIDDCAVVCLFL  383



>ref|XP_008792186.1| PREDICTED: probable protein phosphatase 2C 73 [Phoenix dactylifera]
Length=407

 Score =   360 bits (925),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 222/310 (72%), Gaps = 29/310 (9%)
 Frame = +2

Query  620   MYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASK  799
             MY+QQG KGVNQDAMT+WE F GEK   FCGVFDGHGP GH+VA  +RD LP +LS +  
Sbjct  1     MYTQQGWKGVNQDAMTMWEDFAGEKDTIFCGVFDGHGPFGHKVAGHVRDTLPMRLS-SEF  59

Query  800   DNSQDFEK---------------------------DIHHHPLFSKWKSTFPQSFKDIDNA  898
              +SQ F+                            D   H  FS WK+   ++F+++D  
Sbjct  60    MSSQFFDHGNNDSNLNKNNVNGDDSDDSDHFHDVGDDSQH-CFSAWKAIIVKAFEEMDKE  118

Query  899   LEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNL  1078
             L  +  ID   SGTTAV+++KQ EHLII NLGDSRA++CTRD+ +Q V  QLTVDLKPN+
Sbjct  119   LSQQASIDCICSGTTAVSIVKQMEHLIIANLGDSRAVLCTRDNENQPVAVQLTVDLKPNV  178

Query  1079  PVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFY  1258
             P E+ERIKSCKGRV A  EEP+V R+W+P++D PGLAMARAFGDFCLKD+G+IS P++ Y
Sbjct  179   PSEAERIKSCKGRVFALEEEPDVHRLWLPDEDSPGLAMARAFGDFCLKDFGLISTPQVSY  238

Query  1259  RKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKT  1438
             RK+SE+DEFVVLA+DGVWDVLSN EV+K V++  KR  AA+ +V+RAVR W+ K+P SK 
Sbjct  239   RKLSEKDEFVVLATDGVWDVLSNEEVVKIVSSVSKRYDAAKQLVDRAVRAWRFKHPTSKV  298

Query  1439  DDCAVVCLFF  1468
             DDCAV+CLF 
Sbjct  299   DDCAVICLFL  308



>ref|XP_007139720.1| hypothetical protein PHAVU_008G053700g [Phaseolus vulgaris]
 gb|ESW11714.1| hypothetical protein PHAVU_008G053700g [Phaseolus vulgaris]
Length=490

 Score =   363 bits (932),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/329 (54%), Positives = 223/329 (68%), Gaps = 34/329 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ ++GS++  S+++QQGKKG NQDAM VWE+F   +   FCGVFDGHGP GH VA+ +R
Sbjct  53    RIFINGSTQVASLFTQQGKKGTNQDAMVVWENFCSRQDTIFCGVFDGHGPFGHMVAKRVR  112

Query  764   DRLPSKLSV------------------------------ASKDN----SQDFEKDIHHHP  841
             D LP  L+                               AS D     S D E+   H  
Sbjct  113   DVLPLNLNTHWELNVSGEEILKEIGINPAGSMNIEEAASASADEDSRVSVDAEETEKHPK  172

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   K +F ++FK +D  L+  + ID F SGTTAVTLIKQG  LI+GN+GDSRA++ TR
Sbjct  173   IFQTLKESFLKAFKVMDRELKTHQSIDCFCSGTTAVTLIKQGHDLIVGNVGDSRAVLGTR  232

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             +  D LV  QLTVDLKPNLP E ERI+SCKGRV A  +EP V RVW+P  D PGLAMARA
Sbjct  233   EKDDSLVAVQLTVDLKPNLPAEEERIRSCKGRVFALHDEPEVARVWLPNNDSPGLAMARA  292

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVPE+ YR+++E+DEF+VLA+DG+WDVLSN EV+  VA   +RS+AAR
Sbjct  293   FGDFCLKDFGLISVPEVSYRRLTEKDEFIVLATDGIWDVLSNKEVVDIVAATSRRSLAAR  352

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  353   ALVESAVRAWRYKYPTSKVDDCAVVCLFL  381



>ref|XP_006398591.1| hypothetical protein EUTSA_v10013781mg [Eutrema salsugineum]
 gb|ESQ40044.1| hypothetical protein EUTSA_v10013781mg [Eutrema salsugineum]
Length=387

 Score =   359 bits (922),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 222/308 (72%), Gaps = 8/308 (3%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA +R  GSS+ VSM  +QGKKG+NQDAMTVWE+FGGE+   FCGVFDGHGP GH++++ 
Sbjct  36    GAVIRSRGSSKHVSMAIKQGKKGINQDAMTVWENFGGEEDMVFCGVFDGHGPMGHKISRH  95

Query  758   IRDRLPS----KLSVASKDNSQDFEKDIHHHP---LFSKWKSTFPQSFKDIDNALEGEEK  916
             + D LPS    K+  +    +++ E D +      LF K +      FK ID+ L  +  
Sbjct  96    VCDNLPSRVHSKIRSSKSGGNENIENDNNSQSEEVLFRKSEEVLVTFFKQIDSELGLDSP  155

Query  917   IDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESER  1096
              DSF SGTTAVT++KQG+ L+I NLGDSRA++ TR   + L   QLTVDLKP +  E+ER
Sbjct  156   YDSFCSGTTAVTVLKQGDCLVIANLGDSRAVLGTRGSKNNLKAVQLTVDLKPCVQREAER  215

Query  1097  IKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISER  1276
             I SCKGRV A  EEP+V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++ +PEIF RK+S  
Sbjct  216   IMSCKGRVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLLCIPEIFCRKVSRE  275

Query  1277  DEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVV  1456
             DEFV+LA+DG+WDVLSN EV+K V   K RSMAA  +V+RA RTW+ K+P SK DDCAVV
Sbjct  276   DEFVILATDGIWDVLSNEEVVKIVGACKDRSMAADTLVQRAARTWRTKFPASKADDCAVV  335

Query  1457  CLFFK-RP  1477
              L+   RP
Sbjct  336   VLYLNHRP  343



>ref|NP_001065952.2| Os12g0108600 [Oryza sativa Japonica Group]
 gb|EEE52621.1| hypothetical protein OsJ_34958 [Oryza sativa Japonica Group]
 dbj|BAF28971.2| Os12g0108600 [Oryza sativa Japonica Group]
Length=476

 Score =   362 bits (928),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 223/308 (72%), Gaps = 19/308 (6%)
 Frame = +2

Query  614   VSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA  793
             VSM+++QG KG NQDAMT  + F G KG  FCGVFDGHGP G  VA+ +RD LP KLS +
Sbjct  89    VSMHTKQGWKGANQDAMTTCQDFAGHKGQIFCGVFDGHGPLGREVARHVRDVLPMKLSSS  148

Query  794   -----SKDNSQDFEKDI-------------HHHPLFSKWKSTFPQSFKDIDNALEGEEKI  919
                   +D S + +K+              +   L S WK+ F ++F+D+D+ L     I
Sbjct  149   LALKTEQDPSSNTDKEALEKSDCTSLSDTSNEKQLLSTWKNIFVKTFEDVDDDLRQNSGI  208

Query  920   DSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERI  1099
             D   SGTTAVT+++QG+HLII NLGDSRA++CTRD  D+ +P QLT DLKPNLP E+ERI
Sbjct  209   DCICSGTTAVTVVRQGDHLIIANLGDSRAVLCTRDSKDRPIPVQLTTDLKPNLPSEAERI  268

Query  1100  KSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERD  1279
              +CKGRV A  +EP+V R+W+P+QD PGLAMARAFGDFCLK +G+I  PE++YRK+SE+D
Sbjct  269   LNCKGRVFAMDDEPDVSRMWLPDQDAPGLAMARAFGDFCLKSHGLICTPEVYYRKLSEKD  328

Query  1280  EFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVC  1459
             EF+VLA+DG+WDVLSN EVIK V++A   S AA+ +VERAVR W++K+P S  DDCAVVC
Sbjct  329   EFLVLATDGIWDVLSNKEVIKIVSSATDHSKAAKQLVERAVRAWRRKFPTSMVDDCAVVC  388

Query  1460  LFFKRPKP  1483
             LF K P P
Sbjct  389   LFLK-PSP  395



>ref|XP_010247822.1| PREDICTED: probable protein phosphatase 2C 33 [Nelumbo nucifera]
Length=476

 Score =   362 bits (928),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 233/359 (65%), Gaps = 33/359 (9%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ + G+S   S+++QQGKKGVNQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  108   GRMFISGASDVASLFTQQGKKGVNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVARRV  167

Query  761   RDRLPSKLS------VASKDNSQDFE---------------------------KDIHHHP  841
             RD LP KLS      + S+D S++                             ++  H  
Sbjct  168   RDSLPLKLSAHWEVNIRSEDGSREISSSVMGSMSSEETSYMYTEEKSRISVDLEEKKHPE  227

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   K +F ++FK +D  L     ID F SGTTAVTL+KQG+ L+IGN+GDSRA++ TR
Sbjct  228   IFLTLKESFLKAFKVMDKELRLHPNIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTR  287

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             D  + L+  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMARA
Sbjct  288   DQDNSLIAIQLTVDLKPNLPREAERIQQCKGRVFALQDEPEVVRVWLPNNDSPGLAMARA  347

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+IS+PEI YR+++E+DEF+VLA+DGVWDVLSN EV+  VA+A  RS AAR
Sbjct  348   FGDFCLKDFGLISLPEISYRRLTEKDEFIVLATDGVWDVLSNKEVVDIVASAPVRSSAAR  407

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEEN  1558
              +VE AVRTW+ KYP SK DDCAVVCLF          + S+  G   S   +    EN
Sbjct  408   ALVESAVRTWRFKYPNSKIDDCAVVCLFLNNDSSSSCISNSKPKGQPTSLDRSDNRSEN  466



>ref|XP_010673906.1| PREDICTED: probable protein phosphatase 2C 33 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010673907.1| PREDICTED: probable protein phosphatase 2C 33 [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   360 bits (925),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 218/328 (66%), Gaps = 33/328 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             RV  +G++   S+Y+QQG+KG NQDAM VWE+F       FCGVFDGHGP GH VA+ +R
Sbjct  54    RVFFNGATEVASLYTQQGRKGTNQDAMVVWENFCSRNDTIFCGVFDGHGPYGHLVAKRVR  113

Query  764   DRLPSKLSVASKDNSQ---------------------------------DFEKDIHHHPL  844
             D LP KL+   + N++                                 D E+      +
Sbjct  114   DSLPQKLNAQWEVNTKSEEVLREISLNCSSVNSEEASFISADEESRVSVDLEETDKEPEI  173

Query  845   FSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD  1024
             F   K +F ++F+ +D  L     +D F SGTTAVTLIKQG+ L+IGN+GDSRA++ TRD
Sbjct  174   FEILKESFLKAFRIMDRELRVHAGVDCFCSGTTAVTLIKQGQDLVIGNVGDSRAVLGTRD  233

Query  1025  DTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAF  1204
               + LV  QLTVDLKPNLP E+ERIK C+GRV A  +EP+V RVW+P  D PGLAMARAF
Sbjct  234   TDNTLVAVQLTVDLKPNLPAEAERIKKCRGRVFALQDEPDVARVWLPNNDSPGLAMARAF  293

Query  1205  GDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARL  1384
             GDFCLKDYG+I+VP+I YR+++E DEF+VLA+DG+WDVLSN +V+  VA A  RS AAR 
Sbjct  294   GDFCLKDYGLIAVPDISYRRLTEMDEFIVLATDGIWDVLSNKDVVNIVAAAPTRSTAARA  353

Query  1385  VVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             VVE AVR WK KYP SK DDCAVVCLF 
Sbjct  354   VVETAVRAWKMKYPTSKIDDCAVVCLFL  381



>gb|KDP26876.1| hypothetical protein JCGZ_18034 [Jatropha curcas]
Length=495

 Score =   361 bits (927),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 181/330 (55%), Positives = 222/330 (67%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  54    GRLFLNGSSNIASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKLS------VASKD-------------NSQD---------------FEKDIHHH  838
             RD LP KLS      + S+D             NS+D                ++     
Sbjct  114   RDHLPLKLSAHWEVNITSEDVLKEISVNTTASMNSEDQSFISADEESRASLDLDEPEKQP  173

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L     ID + SGTTAVTLIKQG +L++GN+GDSRA++ T
Sbjct  174   EIFQTLKESFLKAFKVMDRELRVHANIDCYCSGTTAVTLIKQGHYLVVGNVGDSRAVLGT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D LV  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDDSLVAIQLTVDLKPNLPAEAERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP+I  R+++E DEF+VLA+DGVWDVLSN EV+  VA+A  RS AA
Sbjct  294   AFGDFCLKDFGLISVPDISCRRLTENDEFIVLATDGVWDVLSNKEVVDIVASAPTRSSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  354   RALVESAVRAWRYKYPTSKVDDCAVVCLFL  383



>ref|XP_009406352.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   357 bits (917),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 175/325 (54%), Positives = 223/325 (69%), Gaps = 33/325 (10%)
 Frame = +2

Query  593   LHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRL  772
             L+G++   S+++Q+G+KG+NQDAM VWE+FG      FCGVFDGHGP+GH+VA+ +RD L
Sbjct  7     LNGATSAASLFTQRGRKGINQDAMLVWENFGDRSDTVFCGVFDGHGPNGHKVARKVRDIL  66

Query  773   PSKL----------------------SVASKDNSQ-----------DFEKDIHHHPLFSK  853
             P KL                      S+ S++ S             FE+ + H    + 
Sbjct  67    PLKLRASWEVYIGNDECRENNISSTRSMNSEETSSMNLNEESKASVGFEERVKHSETLTI  126

Query  854   WKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTD  1033
              K +F ++F+ +D  L     ID F SGTTAVTL+KQG+ L+IGN+GDSRA++ TRD  +
Sbjct  127   LKDSFLKAFRIVDKELRLHPDIDCFYSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDQHN  186

Query  1034  QLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDF  1213
              LV  QLTVDLKPNLP E+ERI+ C+GRV A   EP V RVW+P  D PGLAMARA GDF
Sbjct  187   TLVAVQLTVDLKPNLPREAERIRRCRGRVFALRGEPEVARVWLPNIDSPGLAMARALGDF  246

Query  1214  CLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVE  1393
             CLK++G+ISVPEI YR+I+E+DEF+VLA+DGVWDVLSN EV+K V+T   RS AAR++VE
Sbjct  247   CLKNFGLISVPEISYRRITEKDEFIVLATDGVWDVLSNREVVKIVSTVSARSSAARILVE  306

Query  1394  RAVRTWKQKYPCSKTDDCAVVCLFF  1468
              AVR WK KYP SK DDCAVVCLF 
Sbjct  307   SAVRAWKLKYPTSKIDDCAVVCLFL  331



>ref|XP_007026553.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY07055.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=297

 Score =   352 bits (904),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 179/322 (56%), Positives = 226/322 (70%), Gaps = 28/322 (9%)
 Frame = -2

Query  2920  MAQMTVTARNEKVGSFRLLSGHIIPAIGLGTWKVQHPRDN-VYAAIVEGGYRHVDTAAQY  2744
             M+Q T T   +K  SF LL GH IPA+GLGT +     +N V+ AIVE  YRH+DTA +Y
Sbjct  1     MSQATFTQEGQKTQSFGLLYGHTIPAVGLGTRRSGSQAENSVFTAIVEAVYRHIDTAWEY  60

Query  2743  GVQQGVGEGLKAAIHAGVERKTLFVTSKLWCTDLSPQRVRPALMNTLQELQLDYLDLFLI  2564
             GVQ+ VG   KAAIHAG+ER+ LF+ SKLWCTDL P+RV+PAL NTLQELQL+YLDL+LI
Sbjct  61    GVQEDVGRATKAAIHAGLERRNLFIASKLWCTDLCPERVQPALKNTLQELQLEYLDLYLI  120

Query  2563  HWPFHLKEGASRPPKAGEVSGFDMEGVWREMEKLVADKLVRDIGVCNFTVNKLNKLLRIA  2384
             H PF L++         E +G    G++R             I    +   K   L R  
Sbjct  121   HCPFRLRD---------EPAGLPRLGIYR-------------ISAWKWFGEKWKSLSRKT  158

Query  2383  KIKPSVCQMEMHPGWRNDKMLDACKDNNIHVTAYSPLGSDE--RDLVHNPMVEKVANKLN  2210
              ++     MEMHPGWRNDKML+AC+ N IHVTAYSPLGS    RDL+H+  VE++ANKL 
Sbjct  159   LLE---TLMEMHPGWRNDKMLEACRKNGIHVTAYSPLGSSAGGRDLIHDQTVERIANKLT  215

Query  2209  KSPGQVLVKWAIQRGTSTIPKSNHAHRIKENISVFDWEIPKQDFEALSSIPDQRRVLDGE  2030
             K+ GQVLVKWA+QRGTS IPKS++  RIKENI VF W++P++DF+AL +IPD+RRVL+G 
Sbjct  216   KTTGQVLVKWALQRGTSVIPKSSNPDRIKENIKVFGWQLPEEDFQALCNIPDERRVLNGA  275

Query  2029  DMFVNKTDGPFKNVADLWDHED  1964
             ++FVNK  GPF++VADLWD+ED
Sbjct  276   ELFVNKDVGPFRSVADLWDYED  297



>gb|ABA96190.1| protein phosphatase 2c, putative, expressed [Oryza sativa Japonica 
Group]
Length=543

 Score =   362 bits (928),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 223/308 (72%), Gaps = 19/308 (6%)
 Frame = +2

Query  614   VSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA  793
             VSM+++QG KG NQDAMT  + F G KG  FCGVFDGHGP G  VA+ +RD LP KLS +
Sbjct  89    VSMHTKQGWKGANQDAMTTCQDFAGHKGQIFCGVFDGHGPLGREVARHVRDVLPMKLSSS  148

Query  794   -----SKDNSQDFEKDI-------------HHHPLFSKWKSTFPQSFKDIDNALEGEEKI  919
                   +D S + +K+              +   L S WK+ F ++F+D+D+ L     I
Sbjct  149   LALKTEQDPSSNTDKEALEKSDCTSLSDTSNEKQLLSTWKNIFVKTFEDVDDDLRQNSGI  208

Query  920   DSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERI  1099
             D   SGTTAVT+++QG+HLII NLGDSRA++CTRD  D+ +P QLT DLKPNLP E+ERI
Sbjct  209   DCICSGTTAVTVVRQGDHLIIANLGDSRAVLCTRDSKDRPIPVQLTTDLKPNLPSEAERI  268

Query  1100  KSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERD  1279
              +CKGRV A  +EP+V R+W+P+QD PGLAMARAFGDFCLK +G+I  PE++YRK+SE+D
Sbjct  269   LNCKGRVFAMDDEPDVSRMWLPDQDAPGLAMARAFGDFCLKSHGLICTPEVYYRKLSEKD  328

Query  1280  EFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVC  1459
             EF+VLA+DG+WDVLSN EVIK V++A   S AA+ +VERAVR W++K+P S  DDCAVVC
Sbjct  329   EFLVLATDGIWDVLSNKEVIKIVSSATDHSKAAKQLVERAVRAWRRKFPTSMVDDCAVVC  388

Query  1460  LFFKRPKP  1483
             LF K P P
Sbjct  389   LFLK-PSP  395



>ref|XP_011077163.1| PREDICTED: probable protein phosphatase 2C 33 [Sesamum indicum]
 ref|XP_011077165.1| PREDICTED: probable protein phosphatase 2C 33 [Sesamum indicum]
Length=494

 Score =   358 bits (918),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 220/330 (67%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G S   S+Y+QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  50    GRMFLNGCSEIASLYTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHLVAKRV  109

Query  761   RDRLPSKLS-----------------------VASKDNSQ-----------DFEKDIHHH  838
             RD LP KLS                       + S+D S            D E+     
Sbjct  110   RDSLPLKLSAHWEVNIKSDEVLREVSLNTTGGLYSEDTSLLSADDEARASVDAEETGKQP  169

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L     ID F SGTTAVTL+KQG+ L+IGN+GDSRA++ T
Sbjct  170   DVFQTLKESFLKAFKAMDRELRMYANIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLAT  229

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD+ + L   QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  230   RDENNLLTAVQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVARVWLPNNDSPGLAMAR  289

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLK++G+ISVPEI YR I+++DEF+VLA+DG+WDVLSN EV++ V + + RS AA
Sbjct  290   AFGDFCLKEFGLISVPEISYRCITDKDEFIVLATDGIWDVLSNKEVVEVVGSCRARSNAA  349

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR WK KYP SK DDCAVVCLF 
Sbjct  350   RTLVESAVRAWKTKYPTSKVDDCAVVCLFL  379



>ref|XP_008441722.1| PREDICTED: probable protein phosphatase 2C 33 [Cucumis melo]
 ref|XP_008441723.1| PREDICTED: probable protein phosphatase 2C 33 [Cucumis melo]
Length=485

 Score =   357 bits (917),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 175/331 (53%), Positives = 224/331 (68%), Gaps = 35/331 (11%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+  +G +   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  51    GRLFTNGFTDMASLFTQQGKKGTNQDAMIVWENFGSRTDTIFCGVFDGHGPYGHMVAKKV  110

Query  761   RDRLPSKLSVASKDN--SQDFEKDI--------------------------------HHH  838
             RD LP +LS   + N  + D  ++I                                   
Sbjct  111   RDSLPLRLSAHWEVNLTTDDVHREISLNNTGSMNSDEATSFVSADEEFRASIDVDGTEKQ  170

Query  839   P-LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMC  1015
             P +F   K +F ++F+ +D  L   + IDSF SGTTAVT++KQG+ L+IGN+GDSRA++ 
Sbjct  171   PEIFHTLKESFLKAFRVMDWELRMHQTIDSFCSGTTAVTIVKQGQDLVIGNVGDSRAVLG  230

Query  1016  TRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMA  1195
              RD  D LVP QLTVDLKPNLP E+ERI+ C+GRV A  +EP+V RVW+P  + PGLAMA
Sbjct  231   MRDKGDSLVPIQLTVDLKPNLPAEAERIRKCRGRVFALQDEPDVARVWLPNSNSPGLAMA  290

Query  1196  RAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMA  1375
             RAFGDFCLKD+G+ISVPEI YR+++E+DEF+VLA+DG+WDVLSN EV+  VA+A KR+ A
Sbjct  291   RAFGDFCLKDFGLISVPEISYRRLTEKDEFIVLATDGIWDVLSNKEVVDIVASAPKRTTA  350

Query  1376  ARLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             AR +VE AV+ WK KYP SK DDCAVVCLF 
Sbjct  351   ARTLVETAVKAWKHKYPTSKIDDCAVVCLFL  381



>ref|XP_008218455.1| PREDICTED: probable protein phosphatase 2C 33 [Prunus mume]
Length=506

 Score =   358 bits (918),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 184/330 (56%), Positives = 225/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  54    GRMFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPFGHMVAKRV  113

Query  761   RDRLPSKLSV--------------ASKDNS--------------QDFEKDI------HHH  838
             RD LP KLS                S +NS              +DF   I       H 
Sbjct  114   RDSLPLKLSANWEVTITSEEVLKEISLNNSGSLNSDGTPFVYVDEDFRASIDIEETDKHP  173

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L  +  ID F SGTTAVTL+KQG  LIIGN+GDSRA++CT
Sbjct  174   EIFQTLKESFLKAFKIMDRELRTQPSIDCFCSGTTAVTLVKQGRDLIIGNVGDSRAVLCT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D L+  QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDDTLIAIQLTVDLKPNLPAEAERIRKCRGRVFALQDEPEVSRVWLPNNDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP+I +R+++E+DEF+VLA+DG+WDVLSN EV+  VA+A  RS AA
Sbjct  294   AFGDFCLKDFGLISVPDISFRRLTEKDEFIVLATDGIWDVLSNKEVVDIVASAPARSSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR W+QKYP SK DDCAVVCLF 
Sbjct  354   RALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>emb|CDY40298.1| BnaA10g27700D [Brassica napus]
Length=361

 Score =   353 bits (905),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/303 (57%), Positives = 218/303 (72%), Gaps = 2/303 (1%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA +R  GSS+ VSM  +QGKKG+NQDAMTVWE+FG E+   FCGVFDGHGP GH++++ 
Sbjct  36    GAIIRSRGSSKHVSMAIKQGKKGINQDAMTVWENFGEEEDMIFCGVFDGHGPMGHKISRH  95

Query  758   IRDRLPSKLSVASKDNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSG  937
             + D LPS++    K +S    +      LF + +      FK ID+ L  +   DSF SG
Sbjct  96    VCDSLPSRVHSRIK-SSNISSQSRQEEGLFRELEEVLVTFFKRIDSELGLDSPYDSFCSG  154

Query  938   TTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGR  1117
             TTAVT++KQG+ L+I NLGDSRA++ TR     L   QLTVDLKP +  E+ERI SCKGR
Sbjct  155   TTAVTVLKQGDCLVIANLGDSRAVLGTRGGKSSLKAVQLTVDLKPCVQREAERIVSCKGR  214

Query  1118  VMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLA  1297
             V A  EEP+V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++ +PE+F RK+S  DEFVVLA
Sbjct  215   VFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLLCIPEVFCRKVSRDDEFVVLA  274

Query  1298  SDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFK-R  1474
             +DG+WDVLSN EV+K V   K RS+AA  +V+RA R+W+ K+P SK DDCAVV LF   R
Sbjct  275   TDGIWDVLSNEEVVKIVGACKDRSIAAETLVQRAARSWRTKFPASKADDCAVVVLFLNHR  334

Query  1475  PKP  1483
             P P
Sbjct  335   PYP  337



>ref|XP_009125400.1| PREDICTED: probable protein phosphatase 2C 65 isoform X1 [Brassica 
rapa]
Length=358

 Score =   352 bits (904),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 218/302 (72%), Gaps = 1/302 (0%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA +R  GSS+ VSM  +QGKKG+NQDAMTVWE+FGGE+   FCGVFDGHGP GH++++ 
Sbjct  36    GAIIRSSGSSKHVSMAIKQGKKGINQDAMTVWENFGGEEDMIFCGVFDGHGPMGHKISRH  95

Query  758   IRDRLPSKL-SVASKDNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSS  934
             I D LPS++ S      + + E D +        +      FK ID+ L  +   DSF S
Sbjct  96    ICDSLPSRVHSRIRCGGNVNIENDNNSKSQEGFLEKVLVTLFKRIDSELGLDSPYDSFCS  155

Query  935   GTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKG  1114
             GTTAVT++KQG+ L+I NLGDSRA++ TR   + L   QLTVDLKP +  E+ERI +CKG
Sbjct  156   GTTAVTVLKQGDCLVIANLGDSRAVLGTRGSKNNLKAVQLTVDLKPCVQREAERIVACKG  215

Query  1115  RVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVL  1294
             RV A  EEP+V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++ VPE+F+RK+   DEFVVL
Sbjct  216   RVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLLCVPEVFFRKVGREDEFVVL  275

Query  1295  ASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKR  1474
             A+DG+WDVLSN EV+K V + K RS+AA  +V+RA R W+ K+P SK DDCAVV L+   
Sbjct  276   ATDGIWDVLSNEEVVKIVGSCKDRSVAADTLVQRAARAWRTKFPTSKADDCAVVVLYLNH  335

Query  1475  PK  1480
             P+
Sbjct  336   PR  337



>gb|KHG03244.1| putative phosphatase 2C 33 -like protein [Gossypium arboreum]
Length=483

 Score =   356 bits (913),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 243/379 (64%), Gaps = 39/379 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R  L+GS+   S+++QQGKKG NQDAM VWE+FG      FCG+FDGHGP GH VA+ +
Sbjct  54    GRFFLNGSTDVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGIFDGHGPYGHLVAKRV  113

Query  761   RDRLPSKLS------VASKD-------------------------NSQDFEKDIHHHPLF  847
             RD LP KLS      V+S+D                          S DF +   H  +F
Sbjct  114   RDHLPVKLSAHWEANVSSEDVFRDFGLGSMTSEDMSLLSVDKESRPSIDFLESEKHPDIF  173

Query  848   SKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDD  1027
                K +F ++FK +D  L     IDSF SGTTAVTL+KQG +L+IGN+GDSRA++ TRD 
Sbjct  174   ETLKESFLKAFKAMDRELRVHPSIDSFCSGTTAVTLVKQGPYLVIGNVGDSRAVLGTRDK  233

Query  1028  TDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFG  1207
              + L   QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMARAFG
Sbjct  234   NNMLTAVQLTVDLKPNLPAEAERIRRCKGRVFALHDEPEVTRVWLPNNDSPGLAMARAFG  293

Query  1208  DFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLV  1387
             DFCLKD+G+ISVPEI YR ++E DEFVVLA+DG+WDVLSN E ++ +A+A  RS AAR +
Sbjct  294   DFCLKDFGLISVPEITYRHLTENDEFVVLATDGIWDVLSNEEAVEIIASAPARSSAARAL  353

Query  1388  VERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEENSAI  1567
             VE A+R W+ KYP SK DDCAVVCLF           +S A+  N     T ++E ++ I
Sbjct  354   VEVAIRAWRYKYPTSKVDDCAVVCLFLDSNS----NHLSTASNGNTEVQPTSKDELDNDI  409

Query  1568  IAETDDGLDTL--LNFKGT  1618
               E ++ LD L  LN  GT
Sbjct  410   --EENNNLDVLTPLNQSGT  426



>ref|XP_009122857.1| PREDICTED: probable protein phosphatase 2C 65 isoform X1 [Brassica 
rapa]
Length=361

 Score =   351 bits (901),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 221/306 (72%), Gaps = 8/306 (3%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA +R  GSS+ VSM  +QGKKG+NQDAMTVWE+FG E+   FCGVFDGHGP GH++++ 
Sbjct  36    GAIIRSRGSSKHVSMAIKQGKKGINQDAMTVWENFGEEEDMIFCGVFDGHGPMGHKISRH  95

Query  758   IRDRLPSKLSV---ASKDNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSF  928
             + D LPS++     AS  +SQ  +++     LF + +      FK ID+ L  +   DSF
Sbjct  96    VCDSLPSRVHSRIKASNISSQSRQEE----GLFRELEEVLVTFFKRIDSELGLDSPYDSF  151

Query  929   SSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSC  1108
              SGTTAVT++KQG+ L+I NLGDSRA++ TR     L   QLTVDLKP +  E+ERI SC
Sbjct  152   CSGTTAVTVLKQGDCLVIANLGDSRAVLGTRGGKSSLKAVQLTVDLKPCVQREAERIVSC  211

Query  1109  KGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFV  1288
             KGRV A  EEP+V RVWMP+ DCPGLAM+RAFGDFCLKDYG++ +PE+F RK+S  DEFV
Sbjct  212   KGRVFAMEEEPDVHRVWMPDDDCPGLAMSRAFGDFCLKDYGLLCIPEVFCRKVSRDDEFV  271

Query  1289  VLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             VLA+DG+WDVLSN EV+K V   K RS+AA  +V+RA R+W+ K+P SK DDCAVV LF 
Sbjct  272   VLATDGIWDVLSNEEVVKIVGACKDRSIAAETLVQRAARSWRTKFPASKADDCAVVVLFL  331

Query  1469  K-RPKP  1483
               RP P
Sbjct  332   NHRPYP  337



>ref|XP_010463699.1| PREDICTED: probable protein phosphatase 2C 33 [Camelina sativa]
Length=491

 Score =   356 bits (913),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 185/377 (49%), Positives = 239/377 (63%), Gaps = 47/377 (12%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS    +++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +R
Sbjct  55    RMFLNGSSEAACIFTQQGKKGPNQDAMVVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVR  114

Query  764   DRLPSKLS---------------------------VASKDNSQDF--------------E  820
             D LP KLS                             S+D +                 E
Sbjct  115   DNLPLKLSSYWEAKVPVEGVLKAITTDNVNNATNINNSEDTAASVSAEEEPRTCAKMEEE  174

Query  821   KDIHHHP-LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGD  997
             +++  HP LF   K +F ++FK +D  L+    +D F SGTTAVTLIKQG++L++GN+GD
Sbjct  175   ENMESHPELFQTLKESFLKAFKVMDRELKFHGSVDCFCSGTTAVTLIKQGQYLVVGNIGD  234

Query  998   SRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDC  1177
             SRA+M TRD  + LV  QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D 
Sbjct  235   SRAVMGTRDSNNALVSVQLTVDLKPNLPAEAERIRKCRGRVFALRDEPEVCRVWLPNCDS  294

Query  1178  PGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATA  1357
             PGLAMARAFGDFCLKD+G+ISVP++ +R+++E+DEF+VLA+DG+WDVLSN +V+  VA+A
Sbjct  295   PGLAMARAFGDFCLKDFGLISVPDVSFRRLTEKDEFIVLATDGIWDVLSNDDVMGIVASA  354

Query  1358  KKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPE  1537
               RS AAR +VE AVR W+ KYP SK DDCA VCL+       ++ T S  + L+    E
Sbjct  355   PSRSTAARAIVESAVRAWRYKYPTSKVDDCAAVCLYLDANNSNVISTSSSISKLD---DE  411

Query  1538  TGRNEENSAIIAETDDG  1588
              G  E  +A   E DD 
Sbjct  412   EGDEELKAA--TENDDA  426



>ref|XP_007134631.1| hypothetical protein PHAVU_010G063200g [Phaseolus vulgaris]
 gb|ESW06625.1| hypothetical protein PHAVU_010G063200g [Phaseolus vulgaris]
Length=354

 Score =   350 bits (899),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 233/355 (66%), Gaps = 24/355 (7%)
 Frame = +2

Query  452   MGACCTCQRVKKREVYRVknaenkeereadeeHDGIVGRGDFGARVRLHGSSRFVSMYSQ  631
             MG CC+C      +VY ++ +          +H G        A V L GSS FVSM+SQ
Sbjct  1     MGGCCSCSGSFVDKVYDLECSCKHYIDYGACKHGG--------AGVMLRGSSEFVSMFSQ  52

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASKDNSQ  811
             +G K VNQDA+TVW+ F G+K   FCGVFDGHGP GH+ A+ +R++LPSKLS + K + Q
Sbjct  53    KGSKEVNQDALTVWKDFTGKKDTIFCGVFDGHGPLGHKFARSLREKLPSKLSASIKQSQQ  112

Query  812   DFEKDIH---------------HHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTA  946
                K  +                +  FS W+ +F + F ++D  L        F  G+TA
Sbjct  113   KVVKHTNDTDGSSHSNVYVEDDQNMSFSSWEGSFTRCFNEMDEELIKNIDSKGFGGGSTA  172

Query  947   VTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMA  1126
             VT+IKQG+ LIIGNLGDSRA++C R   + LVP QLTVDL PN+P E+ RI +C G + +
Sbjct  173   VTVIKQGDQLIIGNLGDSRAVLCRRAHDNHLVPVQLTVDLTPNIPSEALRIINCGGSIFS  232

Query  1127  TAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDG  1306
               E+P+V R+W P+   PGLAMARAFG+FCLKDYG+I+VP++ YRK++E+DEFVVLASDG
Sbjct  233   LKEQPSVKRIWRPQGARPGLAMARAFGNFCLKDYGLIAVPDVSYRKLTEQDEFVVLASDG  292

Query  1307  VWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             VWDVL+N EVI  VA+A KRSMAA L+V  A++ W++KY  SK DDC  +CLF K
Sbjct  293   VWDVLTNSEVINIVASAPKRSMAANLLVNHAIKAWRRKYG-SKVDDCTAICLFLK  346



>gb|KDO54036.1| hypothetical protein CISIN_1g011218mg [Citrus sinensis]
Length=456

 Score =   354 bits (909),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/329 (55%), Positives = 223/329 (68%), Gaps = 34/329 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS   S+++QQGKKG NQDAM VWE+F       FCGVFDGHGP GH VA+ +R
Sbjct  55    RLFLNGSSEIASLFTQQGKKGTNQDAMIVWENFASRADTIFCGVFDGHGPYGHMVAKRVR  114

Query  764   DRLPSKL-----------------------SVASKDN-----------SQDFEKDIHHHP  841
             D LP KL                       S+ S+D            S D E+      
Sbjct  115   DSLPLKLSSHWEVNITSEEVLREISINTAGSINSEDTSFVSADEEPRASADLEETEKFPE  174

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
              F   K +F ++FK +D  L     ID F SGTTAVTLIKQG+HL+IGN+GDSRA++ TR
Sbjct  175   FFQTLKESFLKAFKVMDRELRMHATIDCFCSGTTAVTLIKQGQHLVIGNVGDSRAVLGTR  234

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             D  D LV  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMARA
Sbjct  235   DKDDSLVAMQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVARVWLPNYDSPGLAMARA  294

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVP+I YR+++++DEF+VLA+DG+WDVLSN EV++ VA+A  RS AAR
Sbjct  295   FGDFCLKDFGLISVPDISYRRLTDKDEFIVLATDGIWDVLSNEEVVEIVASAPARSSAAR  354

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AVR W++KYP SK DDCAVVCLF 
Sbjct  355   SLVESAVRAWRRKYPTSKVDDCAVVCLFL  383



>ref|XP_008388813.1| PREDICTED: probable protein phosphatase 2C 33 [Malus domestica]
Length=500

 Score =   355 bits (912),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/366 (50%), Positives = 234/366 (64%), Gaps = 36/366 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS   S+++QQGKKG NQDAM VWE+F       FCGVFDGHGP GH VA+ +R
Sbjct  55    RMFLNGSSEAASLFTQQGKKGTNQDAMIVWENFCSRTDTVFCGVFDGHGPFGHMVAKRVR  114

Query  764   DRLPSKLS-------------------VASKDNSQD-----FEKDIH----------HHP  841
             D LP KLS                    A   NS D      ++D+           +  
Sbjct  115   DSLPLKLSANWEVKITNDEVLKGISLNTAGSLNSDDTAFVSVDEDLRPSVDVDETEKNPE  174

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +    + +F ++FK +D  L     ID F SGTTAVTLIKQG  L IGN+GDSRA++CTR
Sbjct  175   ILQALRESFLKAFKVMDRELRTTPSIDCFCSGTTAVTLIKQGRDLFIGNVGDSRAVLCTR  234

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             D  D L   QLTVDLKP+LP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMARA
Sbjct  235   DRDDTLSAIQLTVDLKPSLPAEAERIRKCRGRVFALQDEPEVARVWLPNNDSPGLAMARA  294

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVP++ YR+++E+DEF+VLA+DG+WDVLSN EV+  +ATA  R  AA+
Sbjct  295   FGDFCLKDFGLISVPDVSYRRLTEKDEFIVLATDGIWDVLSNKEVVDVIATAPARPSAAQ  354

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEENS  1561
              +VE AVR W+QKYP SK DDCAVVCLF      ++  + +   G N     T  +E N+
Sbjct  355   ALVETAVRAWRQKYPTSKVDDCAVVCLFLDLDSNIV--STAANNGSNEKEQPTTADEVNA  412

Query  1562  AIIAET  1579
               ++ET
Sbjct  413   EDLSET  418



>gb|EAY82001.1| hypothetical protein OsI_37184 [Oryza sativa Indica Group]
Length=760

 Score =   363 bits (933),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 223/308 (72%), Gaps = 19/308 (6%)
 Frame = +2

Query  614   VSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA  793
             VSM+++QG KG NQDAMT  + F G KG  FCGVFDGHGP G  VA+ +RD LP KLS +
Sbjct  34    VSMHTKQGWKGANQDAMTTCQDFAGHKGQIFCGVFDGHGPLGREVARHVRDVLPMKLSSS  93

Query  794   -----SKDNSQDFEKDI-------------HHHPLFSKWKSTFPQSFKDIDNALEGEEKI  919
                   +D S + +K+              +   L S WK+ F ++F+D+D+ L     I
Sbjct  94    LALKTEQDPSSNTDKEALEKSDCTSLSDTSNEKQLLSTWKNIFVKTFEDVDDDLRQNSGI  153

Query  920   DSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERI  1099
             D   SGTTAVT+++QG+HLII NLGDSRA++CTRD  D+ +P QLT DLKPNLP E+ERI
Sbjct  154   DCICSGTTAVTVVRQGDHLIIANLGDSRAVLCTRDSKDRPIPVQLTTDLKPNLPSEAERI  213

Query  1100  KSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERD  1279
              +CKGRV A  +EP+V R+W+P+QD PGLAMARAFGDFCLK +G+I  PE++YRK+SE+D
Sbjct  214   LNCKGRVFAMDDEPDVSRMWLPDQDAPGLAMARAFGDFCLKSHGLICTPEVYYRKLSEKD  273

Query  1280  EFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVC  1459
             EF+VLA+DG+WDVLSN EVIK V++A   S AA+ +VERAVR W++K+P S  DDCAVVC
Sbjct  274   EFLVLATDGIWDVLSNKEVIKIVSSATDHSKAAKQLVERAVRAWRRKFPTSMVDDCAVVC  333

Query  1460  LFFKRPKP  1483
             LF K P P
Sbjct  334   LFLK-PSP  340



>ref|XP_010485598.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Camelina 
sativa]
 ref|XP_010485599.1| PREDICTED: probable protein phosphatase 2C 33 isoform X2 [Camelina 
sativa]
 ref|XP_010485600.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Camelina 
sativa]
 ref|XP_010485601.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Camelina 
sativa]
 ref|XP_010485602.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Camelina 
sativa]
 ref|XP_010485603.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Camelina 
sativa]
Length=494

 Score =   355 bits (911),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 177/356 (50%), Positives = 231/356 (65%), Gaps = 45/356 (13%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS    +++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  54    GRMFLNGSSDAACIFTQQGKKGPNQDAMVVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKLSV-----------------------ASKDNSQDF------------------  817
             RD LP KLS                         + +NS+D                   
Sbjct  114   RDNLPLKLSTYWEAKVPVEGVLKAITTDTVNNATNINNSEDNTAAAASVSAEEEPRTSAK  173

Query  818   ---EKDIHHHP-LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIG  985
                E+++  HP LF   K +F ++FK +D  L+    +D F SGTTAVTLIKQG++L++G
Sbjct  174   MEEEENMESHPELFQTLKESFLKAFKVMDRELKFHGSVDCFCSGTTAVTLIKQGQYLVVG  233

Query  986   NLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMP  1165
             N+GDSRA+M TRD  + LV  QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P
Sbjct  234   NIGDSRAVMGTRDSNNALVSVQLTVDLKPNLPAEAERIRKCRGRVFALRDEPEVCRVWLP  293

Query  1166  EQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKT  1345
               D PGLAMARAFGDFCLKD+G+ISVP++ +R+++++DEF+VLA+DG+WDVLSN +V+  
Sbjct  294   NCDSPGLAMARAFGDFCLKDFGLISVPDVSFRRLTKKDEFIVLATDGIWDVLSNDDVVGI  353

Query  1346  VATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAA  1513
             VA+A  RS AAR +VE AVR W+ KYP SK DDCA VCL+       ++ T S  +
Sbjct  354   VASAPSRSTAARAIVESAVRAWRYKYPTSKVDDCAAVCLYLDANNSNVISTSSSVS  409



>ref|XP_006286518.1| hypothetical protein CARUB_v10001181mg [Capsella rubella]
 gb|EOA19416.1| hypothetical protein CARUB_v10001181mg [Capsella rubella]
Length=379

 Score =   351 bits (900),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 222/309 (72%), Gaps = 8/309 (3%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA +R  GSS+ VSM  +QGKKG+NQDAMTVWE+FGGE+   FCGVFDGHGP GH++++ 
Sbjct  36    GAVIRSRGSSKHVSMAIKQGKKGINQDAMTVWENFGGEEDMIFCGVFDGHGPMGHKISRH  95

Query  758   IRDRLPSKLSVASKDNSQDFEKDIHHHP------LFSKWKSTFPQSFKDIDNALEGEEKI  919
             + + LPS++    + +     + I ++       LF ++       FK ID+ L  +   
Sbjct  96    VCENLPSRIHSKIRSSKFGGSESIENNSSQSQEELFREFGDILVTFFKQIDSELGLDFPY  155

Query  920   DSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERI  1099
             DSF SGTTAVT+ KQG+ L+I NLGDSRAI+ TR   +     Q+TVDLKP +  E+ERI
Sbjct  156   DSFCSGTTAVTVFKQGDCLVIANLGDSRAILGTRS-KNSFKAVQITVDLKPCVQREAERI  214

Query  1100  KSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERD  1279
             +SCKGRV A  EEP+V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++S+PE+F RK+   D
Sbjct  215   RSCKGRVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVSIPEVFCRKVGRED  274

Query  1280  EFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVC  1459
             EFVVLA+DG+WDVLSN EV+K V + K RSMAA  +V+RA RTW+ K+P SK DDCAVV 
Sbjct  275   EFVVLATDGIWDVLSNEEVVKIVGSCKDRSMAAETLVQRAARTWRTKFPASKADDCAVVV  334

Query  1460  LFFK-RPKP  1483
             L+   RP P
Sbjct  335   LYLNHRPYP  343



>ref|XP_006665077.1| PREDICTED: probable protein phosphatase 2C 73-like, partial [Oryza 
brachyantha]
Length=381

 Score =   351 bits (900),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/298 (55%), Positives = 210/298 (70%), Gaps = 18/298 (6%)
 Frame = +2

Query  632   QGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA------  793
             QG KG NQDAMT+ + F G KG  FCGVFDGHGP G  VA+ +RD LP KLS +      
Sbjct  1     QGWKGANQDAMTICQDFAGRKGQIFCGVFDGHGPLGREVARHVRDTLPMKLSSSLALKTE  60

Query  794   ------------SKDNSQDFEKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSG  937
                          K N   F        L   WK+ F ++F+D+D  L    +ID   SG
Sbjct  61    QDPSSNIDKDSLDKSNCTSFSDTSDEKQLLHTWKNIFVKTFEDVDEDLRQHSRIDCICSG  120

Query  938   TTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGR  1117
             TTAVT+++QG+HL+I NLGDSRA++CTRD  D+ +P QLT DLKP+LP E+ERI +CKGR
Sbjct  121   TTAVTVVRQGDHLMIANLGDSRAVLCTRDSKDRPIPVQLTTDLKPDLPSEAERILNCKGR  180

Query  1118  VMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLA  1297
             V A  +EP+V R+W+P+QD PGLAMARAFGDFCLK +G+I  PE++YRK+S++DEF+VLA
Sbjct  181   VFAMDDEPDVPRLWLPDQDAPGLAMARAFGDFCLKSHGLICTPEVYYRKLSDKDEFLVLA  240

Query  1298  SDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             +DG+WDVLSN EVIK V++A   S AA+ +VERAVR W++K+P S  DDCAVVCLF K
Sbjct  241   TDGIWDVLSNKEVIKIVSSATDHSKAAKQLVERAVRAWRRKFPTSMVDDCAVVCLFLK  298



>ref|XP_009340340.1| PREDICTED: probable protein phosphatase 2C 33 [Pyrus x bretschneideri]
Length=497

 Score =   355 bits (911),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 183/329 (56%), Positives = 221/329 (67%), Gaps = 34/329 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +R
Sbjct  55    RMFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPFGHMVAKRVR  114

Query  764   DRLPSKLSVASKDN----------------------------SQDFEKDI-----HHHP-  841
             D LP KLSV  + N                             +DF   +       +P 
Sbjct  115   DSLPLKLSVNWEVNIVNEEVLKEISPNTAGSLNSDDTAFVSVDEDFRSSVDVDETEKNPE  174

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
              F   + +F ++FK +D  L     ID F SGTTAVTLIKQG  LIIGN+GDSRA++CTR
Sbjct  175   FFQTLRESFLKAFKVMDRELRTTPSIDCFCSGTTAVTLIKQGRDLIIGNVGDSRAVLCTR  234

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
                D L   QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMARA
Sbjct  235   RIDDTLSAIQLTVDLKPNLPAEAERIRKCRGRVFALQDEPEVARVWLPNTDSPGLAMARA  294

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVP++ YR+++ERDEF+VLA+DG+WDVLSN EV+  VATA  RS AAR
Sbjct  295   FGDFCLKDFGLISVPDVSYRRLTERDEFIVLATDGIWDVLSNKEVVDIVATAPARSSAAR  354

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AVR W+QKYP SK DDCAVVCLF 
Sbjct  355   ALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>ref|XP_009340399.1| PREDICTED: probable protein phosphatase 2C 33 [Pyrus x bretschneideri]
Length=497

 Score =   355 bits (911),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 183/329 (56%), Positives = 221/329 (67%), Gaps = 34/329 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +R
Sbjct  55    RMFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPFGHMVAKRVR  114

Query  764   DRLPSKLSVASKDN----------------------------SQDFEKDI-----HHHP-  841
             D LP KLSV  + N                             +DF   +       +P 
Sbjct  115   DSLPLKLSVNWEVNIVNDEVLKEISPNTAGSLNSDDTAFVSVDEDFRSSVDVDETEKNPE  174

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
              F   + +F ++FK +D  L     ID F SGTTAVTLIKQG  LIIGN+GDSRA++CTR
Sbjct  175   FFQTLRESFLKAFKVMDRELRTTPSIDCFCSGTTAVTLIKQGRDLIIGNVGDSRAVLCTR  234

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
                D L   QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMARA
Sbjct  235   RIDDTLSAVQLTVDLKPNLPAEAERIRKCRGRVFALQDEPEVARVWLPNTDSPGLAMARA  294

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVP++ YR+++ERDEF+VLA+DG+WDVLSN EV+  VATA  RS AAR
Sbjct  295   FGDFCLKDFGLISVPDVSYRRLTERDEFIVLATDGIWDVLSNKEVVDIVATAPARSSAAR  354

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AVR W+QKYP SK DDCAVVCLF 
Sbjct  355   ALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>ref|XP_010272535.1| PREDICTED: probable protein phosphatase 2C 66 [Nelumbo nucifera]
Length=507

 Score =   355 bits (911),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 219/325 (67%), Gaps = 29/325 (9%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS    +Y+QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  58    GRMFLNGSSDIACLYTQQGKKGTNQDAMLVWENFGSRDDTIFCGVFDGHGPYGHMVAKKV  117

Query  761   RDRLPSKLSVASKDNSQDFEK----------------------------DIHHHP-LFSK  853
             RD LP KL      NS D +                             D    P L+  
Sbjct  118   RDSLPLKLCTQWNANSSDCQNGIAPESINSDETGSISMDDEWCCSLDIDDTEKLPDLYQP  177

Query  854   WKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTD  1033
              K +  ++F+ +D  L+    ID F SGTTAVTL+KQG++L+IGN+GDSRA+M T+D  +
Sbjct  178   LKQSILKTFRLMDKELKMHPTIDCFCSGTTAVTLVKQGQNLVIGNVGDSRAVMGTKDKEN  237

Query  1034  QLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDF  1213
              LV  QLTVDLKPNLP E+ RI+ CKGRV A  +EP V RVW+P  D PGLAMARAFGDF
Sbjct  238   SLVAVQLTVDLKPNLPREAARIQQCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDF  297

Query  1214  CLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVE  1393
             CLKD+G+ISVP++ YR+++ERD+F++LA+DGVWDVLSN EV+  VA+A  R+ AAR VV+
Sbjct  298   CLKDFGLISVPDVSYRRLTERDQFIILATDGVWDVLSNKEVVDIVASAPSRTTAARAVVD  357

Query  1394  RAVRTWKQKYPCSKTDDCAVVCLFF  1468
              AVR W+ K+P SK+DDCAVVCLF 
Sbjct  358   CAVRAWRLKFPTSKSDDCAVVCLFL  382



>gb|KHG26837.1| putative phosphatase 2C 33 -like protein [Gossypium arboreum]
Length=487

 Score =   354 bits (909),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 217/325 (67%), Gaps = 33/325 (10%)
 Frame = +2

Query  593   LHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRL  772
             L+GS+   S+++QQGKKG NQDAM +WE+FG      FCGVFDGHGP GH VA+ +RD L
Sbjct  57    LNGSNDVASLFTQQGKKGTNQDAMIIWENFGSRTDTVFCGVFDGHGPYGHMVAKRVRDHL  116

Query  773   PSKLS-------------------VASKDNSQ--------------DFEKDIHHHPLFSK  853
             P KL+                    A   NS+              D E+      +F  
Sbjct  117   PLKLNAHWEVSKSGEDALREINLNTAGSMNSETSFLTADEESRASVDLEETEKFPEIFQT  176

Query  854   WKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTD  1033
              K +F ++FK +D  L     ID F SGTTAVTL+KQG H++IGN+GDSRA++ TRD  +
Sbjct  177   LKESFLKAFKVMDRDLRTHASIDCFCSGTTAVTLVKQGPHIVIGNVGDSRAVLGTRDKDN  236

Query  1034  QLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDF  1213
              L+  QLTVDLKPNLP E+ERI+  KGRV A  +EP V RVW+P  + PGLAMARAFGDF
Sbjct  237   SLIAVQLTVDLKPNLPAEAERIRKYKGRVFALKDEPEVARVWLPNSNAPGLAMARAFGDF  296

Query  1214  CLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVE  1393
             CLKD+G+ISVPEI Y  +SE+DEF+VLA+DG+WDVLSN EV+  VA+ + R+ AAR +VE
Sbjct  297   CLKDFGLISVPEISYWHVSEKDEFIVLATDGIWDVLSNKEVVDIVASCRARTSAARALVE  356

Query  1394  RAVRTWKQKYPCSKTDDCAVVCLFF  1468
              AVR W+ KYP SK DDCAVVCLFF
Sbjct  357   TAVRAWRYKYPTSKVDDCAVVCLFF  381



>ref|XP_004302165.1| PREDICTED: probable protein phosphatase 2C 33-like [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   355 bits (910),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 240/368 (65%), Gaps = 38/368 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              RV L+GS++  S+++QQGKKG NQDAM VWE+F       FCGVFDGHGP GH VA+ +
Sbjct  58    GRVFLNGSTQAASLFTQQGKKGTNQDAMIVWENFCSRTDTIFCGVFDGHGPYGHMVAKRV  117

Query  761   RDRLPSKLS-------------------VASKDNS---------QDFEKDI-----HHHP  841
             RD LP KLS                    A   NS         +DF   I       HP
Sbjct  118   RDSLPLKLSSNWEVNINSEEVLKEISPNTAGSLNSDDAAIVPVDEDFRASIDSEESEKHP  177

Query  842   -LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++F+ +D  L  +  ID F SGTTAVTL+KQG  +I+GN+GDSRA++CT
Sbjct  178   EIFHTLKESFLKAFRVMDRELRIQPSIDCFCSGTTAVTLVKQGRDIIVGNVGDSRAVLCT  237

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D L+  QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMAR
Sbjct  238   RDKDDTLLAVQLTVDLKPNLPAEAERIRKCRGRVFALHDEPEVCRVWLPNNDSPGLAMAR  297

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP++ YR+++E+DEF+VLA+DG+WDVLSN EV+  +A+A  RS AA
Sbjct  298   AFGDFCLKDFGLISVPDVSYRRLTEKDEFIVLATDGIWDVLSNKEVVDIIASAPARSSAA  357

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEEN  1558
             R +VE AVR W+QKYP SK DDCAVVCL+           +S AA  N+S   TG ++ N
Sbjct  358   RALVESAVRAWRQKYPTSKVDDCAVVCLYLDSDG----NNLSTAANNNLSEQHTGVDDLN  413

Query  1559  SAIIAETD  1582
             +    E D
Sbjct  414   AGSENEED  421



>ref|XP_010451945.1| PREDICTED: probable protein phosphatase 2C 65 [Camelina sativa]
 ref|XP_010451946.1| PREDICTED: probable protein phosphatase 2C 65 [Camelina sativa]
Length=381

 Score =   350 bits (899),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 221/308 (72%), Gaps = 7/308 (2%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA +R  GSS+ VSM  +QGKKG+NQDAMTVWE FGGE+   FCGVFDGHGP GH++++ 
Sbjct  36    GAIIRSRGSSKHVSMAIKQGKKGINQDAMTVWEKFGGEEDMIFCGVFDGHGPMGHKISRQ  95

Query  758   IRDRLPSKLSV---ASKDNSQDFEKDIHH--HPLFSKWKSTFPQSFKDIDNALEGEEKID  922
             + + LPS++     +SK   ++ E +       LF +++      FK +D+ L  +   D
Sbjct  96    VCENLPSRVHSKIRSSKSGGENIENNSSQSQEELFREFEEILVTFFKQVDSELGLDSPYD  155

Query  923   SFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIK  1102
             SF SGTTAVT+ KQG+ L+I NLGDSRA++ TR   +     QLTVDLKP +  E+ERI 
Sbjct  156   SFCSGTTAVTVFKQGDCLMIANLGDSRAVLGTRS-KNSFKAVQLTVDLKPCVQREAERIV  214

Query  1103  SCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDE  1282
             SCKGRV A  EEP+V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++ +PE+F RK+   DE
Sbjct  215   SCKGRVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVCIPEVFCRKVGREDE  274

Query  1283  FVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCL  1462
             FVVLA+DG+WDVLSN EV+K V + K RS AA  +V+RA RTW+ K+P SK DDCAVV L
Sbjct  275   FVVLATDGIWDVLSNEEVVKIVGSCKDRSTAAETLVQRAARTWRTKFPASKADDCAVVVL  334

Query  1463  FFK-RPKP  1483
             + K RP P
Sbjct  335   YLKHRPYP  342



>dbj|BAJ88930.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   352 bits (903),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 229/347 (66%), Gaps = 29/347 (8%)
 Frame = +2

Query  614   VSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA  793
             VSM+++QG KGVNQDAM   + F G KG  FCGVFDGHGP G  VA+ +RD LP KLS +
Sbjct  39    VSMHTKQGWKGVNQDAMAACQDFAGHKGQIFCGVFDGHGPLGRDVARHVRDSLPKKLSAS  98

Query  794   ----SKDNSQDFEKDIH---------------HHPLFSKWKSTFPQSFKDIDNALEGEEK  916
                 ++D++     D+                 H L S WKS   ++F+D+D  L     
Sbjct  99    MAPRAEDDAPSSNADVDSFDKSDCTSSSDTSDEHQLLSSWKSLIVKAFEDVDEELRQHSG  158

Query  917   IDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESER  1096
             ID   SGTTAVT+++QG+HLII NLGDSRA++C RD  ++ V  Q+T DLKP+LP E+ER
Sbjct  159   IDCICSGTTAVTVVRQGDHLIIANLGDSRAVLCARDGKNRPVSVQITTDLKPDLPGEAER  218

Query  1097  IKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISER  1276
             I SCKGR+ A  +EP+V R+W+P+QD PGLAMARAFGDFCLK++G+I  PE++YRK+SER
Sbjct  219   ILSCKGRIFAMDDEPDVPRLWLPDQDAPGLAMARAFGDFCLKNHGLICTPEVYYRKLSER  278

Query  1277  DEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVV  1456
             D+F+VLA+DG+WDVLSN EV+K V++A  RS AA+ +V+RAVR W++K+P S  DDCA V
Sbjct  279   DDFLVLATDGIWDVLSNKEVVKIVSSASDRSKAAKQLVDRAVRAWRRKFPTSMVDDCAAV  338

Query  1457  CLFFK----------RPKPMLLKTMSQAAGLNMSFPETGRNEENSAI  1567
             CLF K            KP     +S       +    G  EE +A+
Sbjct  339   CLFLKPAAISCEEDSTTKPPQAPVLSFTGSFRKALSGGGEAEEGTAV  385



>ref|XP_007205041.1| hypothetical protein PRUPE_ppa004533mg [Prunus persica]
 gb|EMJ06240.1| hypothetical protein PRUPE_ppa004533mg [Prunus persica]
Length=504

 Score =   355 bits (910),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/330 (55%), Positives = 224/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  54    GRMFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPFGHMVAKRV  113

Query  761   RDRLPSKLSV--------------ASKDNS--------------QDFEKDI------HHH  838
             RD LP KLS                S +NS              +DF   I       H 
Sbjct  114   RDSLPLKLSANWEVTITSEEVLKEISLNNSGSLNSDGTPFVYVDEDFRASIDIEETDKHP  173

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L  +  ID F SGTTAVTL+KQG  LIIGN+GDSRA++CT
Sbjct  174   EIFQTLKESFLKAFKIMDRELRTQPSIDCFCSGTTAVTLVKQGRDLIIGNVGDSRAVLCT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D L+  QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDDTLIAIQLTVDLKPNLPAEAERIRKCRGRVFALQDEPEVSRVWLPNNDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP+I + +++E+DEF+VLA+DG+WDVLSN EV+  VA+A  RS AA
Sbjct  294   AFGDFCLKDFGLISVPDISFWRLTEKDEFIVLATDGIWDVLSNKEVVDIVASAPARSSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR W+QKYP SK DDCAVVCLF 
Sbjct  354   RALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>ref|XP_004296680.1| PREDICTED: probable protein phosphatase 2C 33-like [Fragaria 
vesca subsp. vesca]
Length=424

 Score =   352 bits (902),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/303 (57%), Positives = 219/303 (72%), Gaps = 8/303 (3%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G S   S++S+QGKKGVNQDAM  WE+FG ++   FCGVFDGHGPSGH VA+ +
Sbjct  91    GRLFLNGFSDVASLFSKQGKKGVNQDAMIAWENFGSKEDTIFCGVFDGHGPSGHMVAKKV  150

Query  761   RDRLPSKLSVASKDNSQDF-------EKDIHHHPLFSKWKSTFPQSFKDIDNALEGEEKI  919
             RD LP K+S     N+ D        E    H   F+  K +F ++FK +D  L+   +I
Sbjct  151   RDSLPLKVSSQWVLNTTDANRAGASEENKDSHGEFFATLKDSFLKAFKVMDKELKLHPRI  210

Query  920   DSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERI  1099
             D + SGTTAVT++KQG+ L+I N+GDSRA++ TRD+   LV  QLTVDLKPNLP E+ERI
Sbjct  211   DCYCSGTTAVTMVKQGQDLVIANIGDSRAVLGTRDEEGSLVAVQLTVDLKPNLPREAERI  270

Query  1100  KSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERD  1279
                KGRV A   EP+V RVW+P  + PGLAMARAFGDFCLKDYG+ISVP+I YR+++++D
Sbjct  271   TLRKGRVFALHNEPDVSRVWLPNSNSPGLAMARAFGDFCLKDYGLISVPDISYRRLTDKD  330

Query  1280  EFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVC  1459
             EFVVLA+DG+WDVLSN EV++ VA A  R  AAR +VE A R WK KYP +KTDDCAVVC
Sbjct  331   EFVVLATDGIWDVLSNKEVVEIVA-ASPRPSAARALVELANRAWKFKYPYAKTDDCAVVC  389

Query  1460  LFF  1468
             LF 
Sbjct  390   LFL  392



>gb|KDO54033.1| hypothetical protein CISIN_1g011218mg [Citrus sinensis]
 gb|KDO54034.1| hypothetical protein CISIN_1g011218mg [Citrus sinensis]
Length=491

 Score =   354 bits (908),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 182/330 (55%), Positives = 223/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+F       FCGVFDGHGP GH VA+ +
Sbjct  54    GRLFLNGSSEIASLFTQQGKKGTNQDAMIVWENFASRADTIFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKL-----------------------SVASKDN-----------SQDFEKDIHHH  838
             RD LP KL                       S+ S+D            S D E+     
Sbjct  114   RDSLPLKLSSHWEVNITSEEVLREISINTAGSINSEDTSFVSADEEPRASADLEETEKFP  173

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
               F   K +F ++FK +D  L     ID F SGTTAVTLIKQG+HL+IGN+GDSRA++ T
Sbjct  174   EFFQTLKESFLKAFKVMDRELRMHATIDCFCSGTTAVTLIKQGQHLVIGNVGDSRAVLGT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D LV  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDDSLVAMQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVARVWLPNYDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP+I YR+++++DEF+VLA+DG+WDVLSN EV++ VA+A  RS AA
Sbjct  294   AFGDFCLKDFGLISVPDISYRRLTDKDEFIVLATDGIWDVLSNEEVVEIVASAPARSSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR W++KYP SK DDCAVVCLF 
Sbjct  354   RSLVESAVRAWRRKYPTSKVDDCAVVCLFL  383



>ref|XP_009629131.1| PREDICTED: probable protein phosphatase 2C 33 [Nicotiana tomentosiformis]
Length=486

 Score =   353 bits (907),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 220/328 (67%), Gaps = 32/328 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S++SQQG KG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  51    GRMFLNGSSEVASLFSQQGNKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  110

Query  761   RDRLPSKLSVASKDN--------------------------------SQDFEKDIHHHPL  844
             RD LP KLS   + N                                S D E    H  +
Sbjct  111   RDALPLKLSTHWEVNIKSEDVLREISLNRGSSLYPEDASLISEESRVSIDVEDTEKHTEV  170

Query  845   FSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD  1024
             F   K +F +++K +D  L     ID   SGTTAVTL+KQG+ L+IGN+GDSRA++CTR 
Sbjct  171   FQTLKESFLKAYKVMDRELRSYTNIDCLCSGTTAVTLVKQGKDLVIGNIGDSRAVLCTRG  230

Query  1025  DTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAF  1204
             D D L   QLTVDLKPNLP E+ERI+ CKGRV +  +EP+V RVWMP  + PGLAMARAF
Sbjct  231   DDDSLTAVQLTVDLKPNLPAEAERIRKCKGRVFSLHDEPDVARVWMPNSNSPGLAMARAF  290

Query  1205  GDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARL  1384
             GDFCLKD+GVISVPEI YR++SE+DEF++LA+DG+WDVLSN EV+K VA+A  RS+AAR 
Sbjct  291   GDFCLKDFGVISVPEISYRRLSEKDEFIILATDGIWDVLSNDEVVKIVASASSRSLAARS  350

Query  1385  VVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             +VE AVR WK  YP SK DDCAVVCLF 
Sbjct  351   LVEVAVRAWKTTYPTSKVDDCAVVCLFL  378



>ref|XP_010500496.1| PREDICTED: probable protein phosphatase 2C 33 [Camelina sativa]
Length=495

 Score =   354 bits (908),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 178/359 (50%), Positives = 231/359 (64%), Gaps = 46/359 (13%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS    +++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  54    GRMFLNGSSEAACIFTQQGKKGPNQDAMVVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKLSV-----------------------ASKDNSQDF------------------  817
             RD LP KLS                         + +NS+D                   
Sbjct  114   RDNLPLKLSTYWEAKVPVEGVLKAITTDTVNNATNINNSEDTAAAAAASVSAEEEPRTSA  173

Query  818   ----EKDIHHHP-LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLII  982
                 E+++  HP LF   K +F ++FK +D  L+    +D F SGTTAVTLIKQG++L++
Sbjct  174   KMEEEENMESHPELFQTLKESFLKAFKVMDRELKFHGSVDCFCSGTTAVTLIKQGQYLVV  233

Query  983   GNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWM  1162
             GN+GDSRA+M TRD  + L   QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+
Sbjct  234   GNIGDSRAVMGTRDSDNALHSVQLTVDLKPNLPAEAERIRKCRGRVFALRDEPEVCRVWL  293

Query  1163  PEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIK  1342
             P  D PGLAMARAFGDFCLKD+G+ISVP++ +R+++E+DEF+VLA+DG+WDVLSN +V+ 
Sbjct  294   PNCDSPGLAMARAFGDFCLKDFGLISVPDVSFRRLTEKDEFIVLATDGIWDVLSNDDVVG  353

Query  1343  TVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGL  1519
              VA+A  RS AAR +VE AVR W+ KYP SK DDCA VCL+       ++ T S  + L
Sbjct  354   IVASAPSRSTAARAIVESAVRAWRYKYPTSKVDDCAAVCLYLDANNSNVISTSSSISRL  412



>emb|CDP04194.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   354 bits (908),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 227/331 (69%), Gaps = 36/331 (11%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +R
Sbjct  54    RLFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVR  113

Query  764   DRLPSKLS------VASKD-------------NSQDFE----------------KDIHHH  838
             D LP KLS      + + D             NS+D                  +D   H
Sbjct  114   DCLPLKLSAHWEVNIKNDDVLREISQNRTVSMNSEDTSYSSVSVDEEARVSIGVEDAEKH  173

Query  839   P-LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMC  1015
             P +F   K +F ++FK +D  L+    ID F SGTTAVTL+KQG+ L+IGN+GDSRAI+ 
Sbjct  174   PEVFQTLKESFMKAFKVMDRELKMHTNIDCFCSGTTAVTLVKQGDDLVIGNVGDSRAILA  233

Query  1016  TRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMA  1195
             +RD  D L+  QLTVDLKP+LP E+ERI+ CKGRV A  +EP+V RVW+P  D PGLAMA
Sbjct  234   SRDGNDSLIAVQLTVDLKPSLPAEAERIRKCKGRVFALQDEPDVARVWLPNNDSPGLAMA  293

Query  1196  RAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMA  1375
             RAFGDFCLKD+G+ISVPEI YR+++E+DEF+V+ASDG+WDVLSN EV+  VA++  RS A
Sbjct  294   RAFGDFCLKDFGLISVPEISYRRLTEKDEFIVVASDGIWDVLSNKEVVDIVASSPARSSA  353

Query  1376  ARLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             AR +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  354   ARRLVESAVRAWRSKYPTSKVDDCAVVCLFL  384



>ref|XP_009783863.1| PREDICTED: probable protein phosphatase 2C 33 [Nicotiana sylvestris]
Length=487

 Score =   353 bits (907),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 218/328 (66%), Gaps = 32/328 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S++SQQG KG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  51    GRMFLNGSSEVASLFSQQGNKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKLV  110

Query  761   RDRLPSKLSVASKDN--------------------------------SQDFEKDIHHHPL  844
             RD LP KLS   + N                                S D E    H  +
Sbjct  111   RDALPLKLSTHWEVNIKSEDVLREISLNRGSSLYPEDASLISEESRVSIDVEDTEKHTEV  170

Query  845   FSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD  1024
             F   K +F +++K +D  L     ID   SGTTAVTL+KQG+ L+IGN+GDSRA++C R 
Sbjct  171   FQTLKGSFLKAYKVVDRELRSYTNIDCLCSGTTAVTLVKQGKDLVIGNIGDSRAVLCMRG  230

Query  1025  DTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAF  1204
             D D L   QLTVDLKPNLP E+ERI+ CKGRV +  +EP+V RVWMP  D PGLAMARAF
Sbjct  231   DDDSLTAVQLTVDLKPNLPAEAERIRKCKGRVFSLHDEPDVARVWMPNSDSPGLAMARAF  290

Query  1205  GDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARL  1384
             GDFCLKD+GVISVPEI YR +SE+DEF+VLA+DG+WDVLSN EV++ VA+A  RS+AAR 
Sbjct  291   GDFCLKDFGVISVPEISYRCLSEKDEFIVLATDGIWDVLSNDEVVRIVASASSRSLAARS  350

Query  1385  VVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             +VE AVR WK  YP SK DDCAVVCLF 
Sbjct  351   LVEVAVRAWKTTYPTSKVDDCAVVCLFL  378



>ref|XP_006480437.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X1 
[Citrus sinensis]
 ref|XP_006480438.1| PREDICTED: probable protein phosphatase 2C 33-like isoform X2 
[Citrus sinensis]
Length=491

 Score =   353 bits (907),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 182/330 (55%), Positives = 223/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+F       FCGVFDGHGP GH VA+ +
Sbjct  54    GRLFLNGSSEIASLFTQQGKKGTNQDAMIVWENFASRADTIFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKL-----------------------SVASKDN-----------SQDFEKDIHHH  838
             RD LP KL                       S+ S+D            S D E+     
Sbjct  114   RDSLPLKLSSHWEVNITSEEVLREISINTAGSINSEDTSFVSADEEPRASADLEETEKFP  173

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
               F   K +F ++FK +D  L     ID F SGTTAVTLIKQG+HL+IGN+GDSRA++ T
Sbjct  174   EFFQTLKESFLKAFKVMDRELRMHATIDCFCSGTTAVTLIKQGQHLVIGNVGDSRAVLGT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D LV  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDDSLVAMQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVARVWLPNYDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP+I YR+++++DEF+VLA+DG+WDVLSN EV++ VA+A  RS AA
Sbjct  294   AFGDFCLKDFGLISVPDISYRRLTDKDEFIVLATDGIWDVLSNEEVVEIVASAPARSSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR W++KYP SK DDCAVVCLF 
Sbjct  354   RSLVESAVRAWRRKYPTSKVDDCAVVCLFL  383



>ref|XP_010549876.1| PREDICTED: probable protein phosphatase 2C 33 [Tarenaya hassleriana]
Length=565

 Score =   356 bits (914),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 174/323 (54%), Positives = 222/323 (69%), Gaps = 27/323 (8%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG+NQDAM VWE+FG      F GVFDGHGP GH VA+ +
Sbjct  144   GRMFLNGSSEIASLFTQQGKKGLNQDAMIVWENFGSRADTIFTGVFDGHGPYGHLVAKRV  203

Query  761   RDRLPSKLS----------------VASKDN-----------SQDFEKDIHHHPLFSKWK  859
             RD LP KLS                + SKD            S D +       +F   K
Sbjct  204   RDSLPLKLSAHWEAKAPVEDALKAGMNSKDAAFVSAEEESRPSVDLDDTEDCPEIFRTLK  263

Query  860   STFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQL  1039
              +F ++FK +D  L+    +D F SGTTAVTL+KQG +L++GN+GDSRA++ TR+D + L
Sbjct  264   ESFLKAFKVMDRELKFHANVDCFCSGTTAVTLVKQGRYLVVGNVGDSRAVLGTRNDENAL  323

Query  1040  VPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCL  1219
             V  QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMARAFGDFCL
Sbjct  324   VAVQLTVDLKPNLPAEAERIRKCRGRVFALQDEPEVSRVWLPNNDSPGLAMARAFGDFCL  383

Query  1220  KDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERA  1399
             KD+G+ISVP++ +R+++ERDEF+VLA+DG+WDVLSN EV++ VA+   R  AAR +VE A
Sbjct  384   KDFGLISVPDVSFRRLTERDEFIVLATDGIWDVLSNEEVVEIVASVPARGSAARALVETA  443

Query  1400  VRTWKQKYPCSKTDDCAVVCLFF  1468
             VR W+ KYP SK DDCAVVCLF 
Sbjct  444   VRAWRYKYPTSKVDDCAVVCLFL  466



>ref|XP_003552448.1| PREDICTED: probable protein phosphatase 2C 33-like [Glycine max]
Length=487

 Score =   353 bits (905),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 182/330 (55%), Positives = 226/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS+  S+++QQGKKG NQDAM VWE+F   +   FCGVFDGHGP GH VA+ +
Sbjct  53    GRIFLNGSSQVASLFTQQGKKGTNQDAMVVWENFCSRQDTIFCGVFDGHGPYGHMVAKRV  112

Query  761   RDRLPSKLSV------------------------------ASKDN----SQDFEKDIHHH  838
             RD LP KL+V                              AS D+    S D E+   H 
Sbjct  113   RDSLPLKLNVHWEQSASGEEVLKEISVNTAGSMNSEEAAFASADDESRVSVDAEETEKHP  172

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L+  + ID F SGTTAVTL+KQG  LIIGN+GDSRA++ T
Sbjct  173   EIFQTLKDSFLKAFKVMDRELKTHQSIDCFCSGTTAVTLVKQGHDLIIGNVGDSRAVLGT  232

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             R+  + LV  QLTVDLKPNLP E ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  233   REKDNSLVAIQLTVDLKPNLPAEEERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMAR  292

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVPE+ YR+++E+DEFVVLA+DG+WDVLSN EV+  VA A +R+ AA
Sbjct  293   AFGDFCLKDFGLISVPEVSYRRLTEKDEFVVLATDGIWDVLSNKEVVDIVAAAPRRASAA  352

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR+W+ KYP SK DDCAVVCLF 
Sbjct  353   RALVESAVRSWRYKYPTSKVDDCAVVCLFL  382



>ref|XP_009416608.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=431

 Score =   351 bits (900),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 174/329 (53%), Positives = 220/329 (67%), Gaps = 33/329 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G+S   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP+GH VA+ +
Sbjct  49    GRMFLNGASSAASLFTQQGKKGTNQDAMIVWENFGNRSDTVFCGVFDGHGPNGHMVARKV  108

Query  761   RDRLPSKL----------------------SVASKDNSQ-----------DFEKDIHHHP  841
             RD LP KL                      SV S++ S             FE+      
Sbjct  109   RDILPLKLCASWEANTGNDEVIENNIGNPGSVISEETSSVFLNEESRALTGFEETDKDSE  168

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
               +  + +F ++F+ +D  L     I+   SGTTAVTL+KQG+ L+IGN+GDSRA++ TR
Sbjct  169   TLTTLEDSFLKAFRVVDKELRLHPDIECIYSGTTAVTLVKQGQDLVIGNVGDSRAVLGTR  228

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             D  + L+P QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMARA
Sbjct  229   DHNNSLIPVQLTVDLKPNLPREAERIRRCRGRVFALRDEPEVARVWLPNIDSPGLAMARA  288

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
              GDFCLK +G+ISVPEI YR+++E+DEF+VLA+DGVWDVLSN EV++ V TA  RS AAR
Sbjct  289   LGDFCLKKFGLISVPEITYRRVTEKDEFIVLATDGVWDVLSNQEVVEIVDTAPTRSSAAR  348

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  349   YLVETAVRAWRIKYPTSKIDDCAVVCLFL  377



>ref|XP_010490517.1| PREDICTED: probable protein phosphatase 2C 65 [Camelina sativa]
Length=381

 Score =   349 bits (895),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 220/308 (71%), Gaps = 7/308 (2%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA +R  GSS+ VSM  +QGKKG+NQDAMTVWE FGGE+   FCGVFDGHGP GH++++ 
Sbjct  36    GAIIRSRGSSKHVSMAIKQGKKGINQDAMTVWEKFGGEEDMIFCGVFDGHGPMGHKISRQ  95

Query  758   IRDRLPSKLSV---ASKDNSQDFEKDIHH--HPLFSKWKSTFPQSFKDIDNALEGEEKID  922
             + + LPS++     +SK   ++ E +       LF +++      FK +D+ L      D
Sbjct  96    VCENLPSRVHSKIRSSKTGGENIENNSSQSQEELFREFEDILVTFFKQVDSELGLNSPYD  155

Query  923   SFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIK  1102
             SF SGTTAVT+ KQG+ L+I NLGDSRA++ TR   +     QLTVDLKP +  E+ERI 
Sbjct  156   SFCSGTTAVTVFKQGDCLMIANLGDSRAVLGTRS-KNSFKAVQLTVDLKPCVQREAERIV  214

Query  1103  SCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDE  1282
             SCKGRV A  EEP+V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++ +PE+F RK+   DE
Sbjct  215   SCKGRVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVCIPEVFCRKVGREDE  274

Query  1283  FVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCL  1462
             FVVLA+DG+WDVLSN EV+K V + K RS AA  +V+RA RTW+ K+P SK DDCAVV L
Sbjct  275   FVVLATDGIWDVLSNEEVVKIVGSCKDRSTAAETLVQRAARTWRTKFPASKADDCAVVVL  334

Query  1463  FFK-RPKP  1483
             + K RP P
Sbjct  335   YLKHRPYP  342



>ref|XP_009766317.1| PREDICTED: probable protein phosphatase 2C 52 [Nicotiana sylvestris]
Length=464

 Score =   352 bits (902),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 232/351 (66%), Gaps = 27/351 (8%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+  +G SR   +++QQG+KGVNQDAM VWE F  E    FCGVFDGHGP GH VA+ +R
Sbjct  57    RIFTNGKSRTSCIFTQQGRKGVNQDAMIVWEDFMSED-VTFCGVFDGHGPHGHLVARKVR  115

Query  764   DRLPSKLSVASKDNSQDFEKDIHHHP----------------LFSKWKSTFPQSFKDIDN  895
             D LP KL    K   Q FE +   +P                + ++WK  F QS+K +D 
Sbjct  116   DALPLKL----KSLLQSFESNRSENPQVETVDPDKDQVTSDKVVTQWKDAFLQSYKAMDK  171

Query  896   ALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPN  1075
              L  +  +D F SG+TAVTLIKQG +L +G +GDSRAI+ ++D+ D +V  QLTVDLKP+
Sbjct  172   ELRSQPNLDCFCSGSTAVTLIKQGSNLYMGYIGDSRAILASKDENDSMVAVQLTVDLKPD  231

Query  1076  LPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIF  1255
             LP E+ERIK CKGRV A  +EP V RVW+P  + PGLAMARAFGDFC+K+YGVIS+PE  
Sbjct  232   LPREAERIKQCKGRVFALQDEPEVHRVWLPYDNAPGLAMARAFGDFCVKEYGVISMPEFS  291

Query  1256  YRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSK  1435
             +R ++ERD+F+VLASDGVWDVLSN EV+  V++A  RS AAR++V+ A R WK KYP SK
Sbjct  292   HRVLTERDQFIVLASDGVWDVLSNEEVVDIVSSAPTRSSAARILVDSAAREWKTKYPTSK  351

Query  1436  TDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEENSAIIAETDDG  1588
              DDCAVVCLF      M      Q+     S     RN  ++A  AE+DDG
Sbjct  352   MDDCAVVCLFLDGHMDMESDNEEQS----FSSATLQRNHSDNA--AESDDG  396



>ref|NP_001031819.1| putative protein phosphatase 2C 65 [Arabidopsis thaliana]
 sp|Q6NKS1.1|P2C65_ARATH RecName: Full=Probable protein phosphatase 2C 65; Short=AtPP2C65 
[Arabidopsis thaliana]
 gb|AAS47624.1| At5g01700 [Arabidopsis thaliana]
 gb|AAT06441.1| At5g01700 [Arabidopsis thaliana]
 gb|AED90379.1| putative protein phosphatase 2C 65 [Arabidopsis thaliana]
Length=382

 Score =   348 bits (894),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 223/309 (72%), Gaps = 8/309 (3%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA VR  GSS+ VSM  +QGKKG+NQDAMTVWE+FGGE+   FCGVFDGHGP GH++++ 
Sbjct  36    GAVVRTRGSSKHVSMSIKQGKKGINQDAMTVWENFGGEEDTIFCGVFDGHGPMGHKISRH  95

Query  758   IRDRLPSKLSVASKDNSQDFEKDIHHHP------LFSKWKSTFPQSFKDIDNALEGEEKI  919
             + + LPS++    + +    +++I ++       LF +++      FK ID+ L  +   
Sbjct  96    VCENLPSRVHSKIRSSKSAGDENIENNSSQSQEELFREFEDILVTFFKQIDSELGLDSPY  155

Query  920   DSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERI  1099
             DSF SGTTAVT+ KQ + L+I NLG SRA++ TR   +     QLTVDLKP +  E+ERI
Sbjct  156   DSFCSGTTAVTVFKQADCLVIANLGHSRAVLGTRS-KNSFKAVQLTVDLKPCVQREAERI  214

Query  1100  KSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERD  1279
              SCKGRV A  EEP+V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++ +P++F RK+S  D
Sbjct  215   VSCKGRVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVCIPDVFCRKVSRED  274

Query  1280  EFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVC  1459
             EFVVLA+DG+WDVLSN EV+K V + K RS+AA ++V+RA RTW+ K+P SK DDCAVV 
Sbjct  275   EFVVLATDGIWDVLSNEEVVKVVGSCKDRSVAAEMLVQRAARTWRTKFPASKADDCAVVV  334

Query  1460  LFFK-RPKP  1483
             L+   RP P
Sbjct  335   LYLNHRPYP  343



>ref|XP_002870903.1| protein phosphatase type 2C [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47162.1| protein phosphatase type 2C [Arabidopsis lyrata subsp. lyrata]
Length=382

 Score =   348 bits (894),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 222/309 (72%), Gaps = 8/309 (3%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA VR  GSS+ VSM  +QGKKG+NQDAMTVWE+FGGE+   FCGVFDGHGP GH++++ 
Sbjct  36    GAVVRTRGSSKHVSMSIKQGKKGINQDAMTVWENFGGEEDMIFCGVFDGHGPMGHKISRH  95

Query  758   IRDRLPSKLSVASKDNSQDFEKDIHHHP------LFSKWKSTFPQSFKDIDNALEGEEKI  919
             + + LPS++    + +     +++ ++       LF +++      FK ID+ L  +   
Sbjct  96    VCENLPSRVHSKIRSSKSAGNENVENNSSQSQEELFREFEDILVTFFKQIDSELGLDSPY  155

Query  920   DSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERI  1099
             DSF SGTTAVT+ KQ + L+I NLGDSRA++ TR   +     QLTVDLKP +  E+ERI
Sbjct  156   DSFCSGTTAVTVFKQADCLVIANLGDSRAVLGTRS-KNSFKAVQLTVDLKPCVQREAERI  214

Query  1100  KSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERD  1279
              SCKGRV A  EEP+V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++ +P+IF RK+S  D
Sbjct  215   VSCKGRVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVCIPDIFCRKVSRED  274

Query  1280  EFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVC  1459
             EFVVLA+DG+WDVLSN EV+K V + K R++AA  +V+RA RTW+ K+P SK DDCAVV 
Sbjct  275   EFVVLATDGIWDVLSNEEVVKVVGSCKDRTIAAETLVQRAARTWRTKFPASKADDCAVVV  334

Query  1460  LFFK-RPKP  1483
             L+   RP P
Sbjct  335   LYLNHRPYP  343



>gb|EAZ17162.1| hypothetical protein OsJ_32667 [Oryza sativa Japonica Group]
Length=421

 Score =   350 bits (898),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/304 (56%), Positives = 218/304 (72%), Gaps = 18/304 (6%)
 Frame = +2

Query  614   VSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA  793
             VSM+++QG KG NQDAMT  + F G KG  FCGVFDGHGP G  VA+ +RD LP KLS +
Sbjct  34    VSMHTKQGWKGANQDAMTTCQDFAGHKGQIFCGVFDGHGPLGREVARHVRDVLPVKLSSS  93

Query  794   -----SKDNSQDFEKDI-------------HHHPLFSKWKSTFPQSFKDIDNALEGEEKI  919
                   +D S + +K+              +   L S WK+ F ++F+D+D  L     I
Sbjct  94    LALKTEQDPSSNTDKETLEKSDCTSLSDTSNEKQLLSTWKNIFVKTFEDVDEDLRQHSGI  153

Query  920   DSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERI  1099
             D   SGTTAVT+++QG+HLII NLGDSRA++CTRD  D+ +  QLT DLKPNLP E+ERI
Sbjct  154   DCICSGTTAVTVVRQGDHLIIANLGDSRAVLCTRDSKDRPISVQLTTDLKPNLPSEAERI  213

Query  1100  KSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERD  1279
              + KGRV A  +EP+V R+W+P+QD PGLAMARAFGDFCLK +G+I  PE++YRK+S +D
Sbjct  214   LNSKGRVFAMDDEPDVPRMWLPDQDAPGLAMARAFGDFCLKSHGLICTPEVYYRKLSAKD  273

Query  1280  EFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVC  1459
             +F+VLA+DG+WDVLSN EVIK V++A   S AA+ +VERAVRTW++K+P S  DDCAVVC
Sbjct  274   DFLVLATDGIWDVLSNKEVIKIVSSATDHSKAAKQLVERAVRTWRRKFPTSMVDDCAVVC  333

Query  1460  LFFK  1471
             LF K
Sbjct  334   LFLK  337



>ref|XP_009415101.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009415102.1| PREDICTED: probable protein phosphatase 2C 33 [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   350 bits (897),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 174/328 (53%), Positives = 221/328 (67%), Gaps = 31/328 (9%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G+S   S++S+QGKKG+NQDAM VWE+FG      FCGVFDGHGP+GH VA+ +
Sbjct  50    GRMFLNGASSAASLFSRQGKKGINQDAMIVWENFGCRSDTVFCGVFDGHGPNGHMVAKKV  109

Query  761   RDRLPSKL--------------------SVASKDNSQ-----------DFEKDIHHHPLF  847
             RD LP KL                    S+ S++ S             F+  I    + 
Sbjct  110   RDILPLKLRARWEVNIGDDECKENNLSKSMDSEETSSVCLNEEFRASIGFKDLIKRSEII  169

Query  848   SKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDD  1027
             +  +  F ++F+ +D  L     ID F SGTTAVTL+KQG+ L+IGN+GDSRA++ TRD 
Sbjct  170   ATLRDPFLKAFRKVDKELRLHPDIDCFYSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRDQ  229

Query  1028  TDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFG  1207
              + LV  QLTVDLKPNLP E+ERI+ C+GRV A  +EP V R+W+P  + PGLAMARAFG
Sbjct  230   NNTLVAVQLTVDLKPNLPREAERIRRCRGRVFALRDEPEVARLWLPNANSPGLAMARAFG  289

Query  1208  DFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLV  1387
             DFCLKD+G+ISVPEI YR+I+E+DEF+VLA+DGVWDVLSN EV+  VA A  RS AAR V
Sbjct  290   DFCLKDFGLISVPEISYRRITEKDEFIVLATDGVWDVLSNKEVVDIVAMASTRSSAARYV  349

Query  1388  VERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             VE A R W+ +YP S+ DDCAVVCLF  
Sbjct  350   VESAGRAWRLRYPTSRVDDCAVVCLFLN  377



>ref|XP_007029293.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007029294.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007029295.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY09795.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY09796.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY09797.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=493

 Score =   352 bits (904),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 183/330 (55%), Positives = 224/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  54    GRLFLNGSSDVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKL------SVASKD-------------NSQ---------------DFEKDIHHH  838
             RD LP KL      S++S+D             NS+               D E+   H 
Sbjct  114   RDHLPLKLCAHWEVSISSEDVLREISLNTAGSMNSEDTTFVSADEESRASVDLEETEKHP  173

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L     ID F SGTTAVTL+KQG +L+IGN+GDSRA++ T
Sbjct  174   EIFQALKESFLKAFKVMDRELRMHANIDCFCSGTTAVTLVKQGPYLVIGNVGDSRAVLGT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  + L   QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDNSLTAVQLTVDLKPNLPAEAERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVPEI Y ++SE+DEF+VLA+DG+WDVLSN EV+  VA+A  RS AA
Sbjct  294   AFGDFCLKDFGLISVPEISYWRLSEKDEFIVLATDGIWDVLSNKEVVDIVASAPARSSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  354   RALVESAVRAWRYKYPTSKVDDCAVVCLFL  383



>gb|ABR16400.1| unknown [Picea sitchensis]
Length=523

 Score =   353 bits (907),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 223/334 (67%), Gaps = 39/334 (12%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ ++GSS    M++QQG+KG NQDAM VWE FG  K   FCGVFDGHGP GH VA+ +R
Sbjct  56    RMCMNGSSDIACMFTQQGRKGTNQDAMVVWEEFGSNKDTVFCGVFDGHGPFGHLVAKRVR  115

Query  764   DRLPSKL---------------------SVASKDNS-----------------QDFEKDI  829
             D LPSKL                     S     NS                 +D E   
Sbjct  116   DSLPSKLCSHWEAITRGDEGNNNIREAVSAVGSLNSDETASITMDEEWKEAEGEDTEGLT  175

Query  830   HHHP-LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRA  1006
                P + + WK +F ++FK +D  L     ID F SGTTAVTL+KQGE L++GN+GDSRA
Sbjct  176   GKAPDMLTAWKESFLKAFKVMDKELRFHPTIDCFCSGTTAVTLLKQGEDLVMGNVGDSRA  235

Query  1007  IMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGL  1186
             I+ TRD+ + L+  QLTVDLKPNLP E+ERIK  KGRV A ++EP+V RVW+P  D PGL
Sbjct  236   ILGTRDNDNSLIAVQLTVDLKPNLPKEAERIKQFKGRVFALSDEPDVARVWLPHDDSPGL  295

Query  1187  AMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKR  1366
             AMARAFGDFCLKD+G+I+VP+I YR++++RDEF+VLA+DGVWDVLSN EV+  VA+A  +
Sbjct  296   AMARAFGDFCLKDFGLIAVPDISYRRLTQRDEFIVLATDGVWDVLSNKEVVDIVASAPTQ  355

Query  1367  SMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             + AAR +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  356   ATAARSLVEFAVRAWRLKYPTSKVDDCAVVCLFL  389



>ref|XP_006857543.1| hypothetical protein AMTR_s00061p00041440 [Amborella trichopoda]
 gb|ERN19010.1| hypothetical protein AMTR_s00061p00041440 [Amborella trichopoda]
Length=534

 Score =   353 bits (907),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 175/337 (52%), Positives = 224/337 (66%), Gaps = 39/337 (12%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ ++GS+ F  +++QQG+KG NQDAM +WE+FG      FCGVFDGHGP GH VA+ +
Sbjct  67    GRIFVNGSTDFACLHTQQGRKGTNQDAMLIWENFGSRNDTVFCGVFDGHGPYGHMVAKKV  126

Query  761   RDRLPSKLS------------------------------------VASKDNSQDFEKDIH  832
             RD LP KLS                                    +    ++ ++EK   
Sbjct  127   RDSLPLKLSKHWDANLGIQNGLHENGSLNGSMNSEETASIGMDEDLGDSIDADEYEKLPE  186

Query  833   HHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIM  1012
              H      + +F ++FK +D  L+    ID F SGTTAVTL+KQG+ L+IGN+GDSRAI+
Sbjct  187   IHMTL---RQSFLKAFKVMDKELKLHPTIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAIL  243

Query  1013  CTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAM  1192
              TRD  D L+  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAM
Sbjct  244   GTRDQDDSLIAVQLTVDLKPNLPREAERIQRCKGRVFALQDEPEVARVWLPNNDSPGLAM  303

Query  1193  ARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSM  1372
             ARAFGDFCLKD+G+ISVP+I Y +I+ERDEF+VLA+DGVWDVL+N EV+  V +A  R+ 
Sbjct  304   ARAFGDFCLKDFGLISVPDISYHRITERDEFIVLATDGVWDVLTNKEVVDIVWSAPSRTT  363

Query  1373  AARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKP  1483
             AAR +VE AVR W+ K+P SK+DDCAVVCLFF +P P
Sbjct  364   AARALVECAVRAWRLKFPTSKSDDCAVVCLFFNKPPP  400



>ref|NP_001065550.1| Os11g0109000 [Oryza sativa Japonica Group]
 sp|Q2RBJ6.1|P2C73_ORYSJ RecName: Full=Probable protein phosphatase 2C 73; Short=OsPP2C73 
[Oryza sativa Japonica Group]
 gb|ABA91135.1| protein phosphatase 2c, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27395.1| Os11g0109000 [Oryza sativa Japonica Group]
 dbj|BAG88619.1| unnamed protein product [Oryza sativa Japonica Group]
Length=420

 Score =   350 bits (897),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/304 (56%), Positives = 218/304 (72%), Gaps = 18/304 (6%)
 Frame = +2

Query  614   VSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA  793
             VSM+++QG KG NQDAMT  + F G KG  FCGVFDGHGP G  VA+ +RD LP KLS +
Sbjct  34    VSMHTKQGWKGANQDAMTTCQDFAGHKGQIFCGVFDGHGPLGREVARHVRDVLPVKLSSS  93

Query  794   -----SKDNSQDFEKDI-------------HHHPLFSKWKSTFPQSFKDIDNALEGEEKI  919
                   +D S + +K+              +   L S WK+ F ++F+D+D  L     I
Sbjct  94    LALKTEQDPSSNTDKETLEKSDCTSLSDTSNEKQLLSTWKNIFVKTFEDVDEDLRQHSGI  153

Query  920   DSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERI  1099
             D   SGTTAVT+++QG+HLII NLGDSRA++CTRD  D+ +  QLT DLKPNLP E+ERI
Sbjct  154   DCICSGTTAVTVVRQGDHLIIANLGDSRAVLCTRDSKDRPISVQLTTDLKPNLPSEAERI  213

Query  1100  KSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERD  1279
              + KGRV A  +EP+V R+W+P+QD PGLAMARAFGDFCLK +G+I  PE++YRK+S +D
Sbjct  214   LNSKGRVFAMDDEPDVPRMWLPDQDAPGLAMARAFGDFCLKSHGLICTPEVYYRKLSAKD  273

Query  1280  EFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVC  1459
             +F+VLA+DG+WDVLSN EVIK V++A   S AA+ +VERAVRTW++K+P S  DDCAVVC
Sbjct  274   DFLVLATDGIWDVLSNKEVIKIVSSATDHSKAAKQLVERAVRTWRRKFPTSMVDDCAVVC  333

Query  1460  LFFK  1471
             LF K
Sbjct  334   LFLK  337



>gb|ACN40371.1| unknown [Picea sitchensis]
Length=523

 Score =   353 bits (906),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 223/334 (67%), Gaps = 39/334 (12%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ ++GSS    M++QQG+KG NQDAM VWE FG  K   FCGVFDGHGP GH VA+ +R
Sbjct  56    RMCMNGSSDIACMFTQQGRKGTNQDAMVVWEEFGSNKDTVFCGVFDGHGPFGHLVAKRVR  115

Query  764   DRLPSKL---------------------SVASKDNS-----------------QDFEKDI  829
             D LPSKL                     S     NS                 +D E   
Sbjct  116   DSLPSKLCSHWEAITRGDEGNNNIREAVSAVGSLNSDETASITMDEEWKEAEGEDTEGLT  175

Query  830   HHHP-LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRA  1006
                P + + WK +F ++FK +D  L     ID F SGTTAVTL+KQGE L++GN+GDSRA
Sbjct  176   GKAPDMLTAWKESFLKAFKVMDKELRFHPTIDCFCSGTTAVTLLKQGEDLVMGNVGDSRA  235

Query  1007  IMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGL  1186
             I+ TRD+ + L+  QLTVDLKPNLP E+ERIK  KGRV A ++EP+V RVW+P  D PGL
Sbjct  236   ILGTRDNDNSLIAVQLTVDLKPNLPKEAERIKQFKGRVFALSDEPDVARVWLPHDDSPGL  295

Query  1187  AMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKR  1366
             AMARAFGDFCLKD+G+I+VP+I YR++++RDEF+VLA+DGVWDVLSN EV+  VA+A  +
Sbjct  296   AMARAFGDFCLKDFGLIAVPDISYRRLTQRDEFIVLATDGVWDVLSNKEVVDIVASAPTQ  355

Query  1367  SMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             + AAR +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  356   ATAARSLVEFAVRAWRLKYPTSKVDDCAVVCLFL  389



>ref|XP_004239696.1| PREDICTED: probable protein phosphatase 2C 33 [Solanum lycopersicum]
Length=470

 Score =   351 bits (901),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 180/329 (55%), Positives = 221/329 (67%), Gaps = 33/329 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S++SQQGKKG NQDAM VWE+FG  +   FCGVFDGHGP GH VA+ +
Sbjct  51    GRMFLNGSSEVASLFSQQGKKGTNQDAMIVWENFGSREDTVFCGVFDGHGPFGHMVAKRV  110

Query  761   RDRLPSKLSVASKDN---------------------------------SQDFEKDIHHHP  841
             RD LP KLS   + N                                 S D E+  +H  
Sbjct  111   RDALPLKLSTHWEVNIKSEDVLREISLNTGSSLYPEDAVLISAEESRLSIDVEETKNHLE  170

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   K +F +++K +D  L     ID F SGTTAVTL+KQGEHL+IGN+GDSRA++ TR
Sbjct  171   VFQTLKESFLKAYKVMDRELRSYTNIDCFCSGTTAVTLVKQGEHLVIGNVGDSRAVLGTR  230

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
              + D L   QLTVDLKP+LP E ERI+ CKGRV +  +EP+V RVWMP  + PGLAMARA
Sbjct  231   GEDDSLTAVQLTVDLKPDLPAEFERIRKCKGRVFSLQDEPDVARVWMPNSNSPGLAMARA  290

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+GVISVPEI YR++SE+DEF++LA+DG+WDVLSN EV+  V +A  RS AAR
Sbjct  291   FGDFCLKDFGVISVPEISYRRLSEKDEFIILATDGIWDVLSNDEVVNIVDSASSRSSAAR  350

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AV+ WK  YP SK DDCAVVCLF 
Sbjct  351   ALVEEAVQAWKITYPTSKVDDCAVVCLFL  379



>gb|ABR16508.1| unknown [Picea sitchensis]
Length=526

 Score =   353 bits (906),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 179/339 (53%), Positives = 221/339 (65%), Gaps = 33/339 (10%)
 Frame = +2

Query  596   HGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLP  775
             +G+S    M++QQG+KG NQDAM VWE FG  K   FCGVFDGHGP GH VA+ +RD LP
Sbjct  62    NGASNVACMFTQQGRKGTNQDAMLVWEDFGSRKDTVFCGVFDGHGPFGHLVAKKVRDSLP  121

Query  776   SKLS----VASKDN-----------------------------SQDFEKDIHHHPLFSKW  856
             SKLS       KD+                             S D E+      +F   
Sbjct  122   SKLSNQWEAEMKDDDSIKEANSTVGSMNSEESLSVTMDDEWRESADMEEREKCPEIFLTL  181

Query  857   KSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQ  1036
             K +F ++FK +D  L     ID F SGTTAVTL+KQG+ L+IGN+GDSRA++ TR   + 
Sbjct  182   KESFLKAFKVMDKELRLHPTIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTRVQDNS  241

Query  1037  LVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFC  1216
             L   QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMARAFGDFC
Sbjct  242   LSAVQLTVDLKPNLPREAERIRQCKGRVFALHDEPEVSRVWLPHNDSPGLAMARAFGDFC  301

Query  1217  LKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVER  1396
             LKD+G+I+VP++ YR+++ERDEF+VLASDGVWDVLSN EV+  VA+A  ++ AAR +VE 
Sbjct  302   LKDFGLIAVPDVSYRRLTERDEFIVLASDGVWDVLSNKEVVDIVASAPSQTTAARALVEY  361

Query  1397  AVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAA  1513
             AVR W+ KYP SK DDCAVVCLF     P   K+ +  A
Sbjct  362   AVRAWRLKYPTSKVDDCAVVCLFLNNSLPSEPKSKTALA  400



>ref|XP_008370833.1| PREDICTED: probable protein phosphatase 2C 33 [Malus domestica]
Length=494

 Score =   352 bits (903),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 180/329 (55%), Positives = 219/329 (67%), Gaps = 34/329 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+  +GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +R
Sbjct  55    RMFFNGSSEVASLFTQQGKKGTNQDAMIVWENFGXRTDTVFCGVFDGHGPFGHMVAKRVR  114

Query  764   DRLPSKLSVASKDN----------------------------------SQDFEKDIHHHP  841
             D LP KLS   + N                                  S D ++   +  
Sbjct  115   DSLPLKLSANWEVNIVNDEVLKEISLNAAGSLNSDDTAFVSVDEDFRPSVDVDETEKNPE  174

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   + +F ++FK +D  L     ID F SGTTAVTLIKQG  LIIGN+GDSRA++CTR
Sbjct  175   IFQTLRESFLKAFKVMDRELRTTPSIDCFCSGTTAVTLIKQGRDLIIGNVGDSRAVLCTR  234

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
                D L   QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMARA
Sbjct  235   RIDDTLSAIQLTVDLKPNLPAEAERIRKCRGRVFALQDEPEVARVWLPNTDSPGLAMARA  294

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVP++ YR+++ERDEF+VLA+DG+WDVLSN EV+  VATA  RS AAR
Sbjct  295   FGDFCLKDFGLISVPDVSYRRLTERDEFIVLATDGIWDVLSNKEVVDIVATAPARSSAAR  354

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AVR W+QKYP SK DDCAVVCLF 
Sbjct  355   ALVETAVRAWRQKYPTSKVDDCAVVCLFL  383



>ref|XP_011084661.1| PREDICTED: probable protein phosphatase 2C 33 [Sesamum indicum]
Length=485

 Score =   352 bits (902),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 223/345 (65%), Gaps = 34/345 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG  K   FCGVFDGHGP GH VA+ +
Sbjct  50    GRMFLNGSSEIASLFTQQGKKGTNQDAMIVWENFGSRKDTVFCGVFDGHGPYGHMVAKRV  109

Query  761   RDRLPSKLSVASKDNSQ----------------------------------DFEKDIHHH  838
             RD LP KL+   + N++                                  D  +     
Sbjct  110   RDSLPLKLNAHWEANNKSDEILREVSLNTTGSLCTEDTSFLSADEEARASIDVGETGKDT  169

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L     ID F SGTTAVT++KQ + L+IGN+GDSRA++ T
Sbjct  170   DVFQTLKESFLKAFKVMDRELRMYANIDCFCSGTTAVTMVKQDQDLVIGNVGDSRAVLGT  229

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD+ + L   QLTVDLKPNLP E ERI+ CKGRV A  +EP+V RVW+P  + PGLAMAR
Sbjct  230   RDENNSLTAVQLTVDLKPNLPAEEERIRKCKGRVFALQDEPDVARVWLPNSNAPGLAMAR  289

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLK++G+ISVPEI YR+I+++DEFVVLA+DG+WDVLSN EV+  V +   RS AA
Sbjct  290   AFGDFCLKEFGLISVPEISYRQITDKDEFVVLATDGIWDVLSNEEVVDIVGSCPSRSYAA  349

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAA  1513
             R +VE AV+ W+ KYP SK DDCAVVCLF    +       S+A+
Sbjct  350   RTLVESAVKAWRSKYPTSKIDDCAVVCLFLDSNESTAYTIKSRAS  394



>ref|XP_009390619.1| PREDICTED: probable protein phosphatase 2C 66 [Musa acuminata 
subsp. malaccensis]
Length=536

 Score =   353 bits (907),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 177/329 (54%), Positives = 220/329 (67%), Gaps = 33/329 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+G+S    +Y+QQG+KG NQDAM VWE+F   K   FCGVFDGHGP GH V++ +R
Sbjct  78    RMFLNGTSEAACLYTQQGRKGTNQDAMIVWENFSLTKDTIFCGVFDGHGPYGHMVSKKVR  137

Query  764   DRLPSKLS------------------VASKDNSQ---------------DFEKDIHHHPL  844
             D LP KLS                  ++   NS+               D +++     +
Sbjct  138   DSLPLKLSTQWRASLNSHESPDPNGSISGSMNSEETASMSIDDECGESLDVDENEKLPEM  197

Query  845   FSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD  1024
             +   K +F +SFK +D  L+    ID F SGTTAVT++KQG+ L+IGN+GDSRAIM TRD
Sbjct  198   YLPLKQSFLKSFKSMDKELKFHPTIDCFCSGTTAVTVVKQGQDLVIGNIGDSRAIMGTRD  257

Query  1025  DTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAF  1204
               + L   QLTVDLKPNLP E+ RI+ CKGRV A  +EP V RVW+P  D PGLAMARAF
Sbjct  258   KENNLTAVQLTVDLKPNLPREAARIQQCKGRVFALQDEPEVARVWLPNNDSPGLAMARAF  317

Query  1205  GDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARL  1384
             GDFCLKDYG+ISVPEI YR ++E+DEF+VLA+DGVWDVLSN EV+  V +A  RS AAR 
Sbjct  318   GDFCLKDYGLISVPEISYRHLTEKDEFIVLATDGVWDVLSNKEVVDVVGSAPTRSTAARA  377

Query  1385  VVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             VV+ AVR W+ K+P SK DDCAVVCLF K
Sbjct  378   VVDCAVRAWRLKFPTSKIDDCAVVCLFLK  406



>ref|XP_008244425.1| PREDICTED: probable protein phosphatase 2C 33 [Prunus mume]
Length=409

 Score =   348 bits (894),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 217/311 (70%), Gaps = 17/311 (5%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R  L+GSS F S++ +QGKKGVNQDAM  WE+FG      FCGVFDGHGP GH VA+ +
Sbjct  71    GRQFLNGSSDFASLFCKQGKKGVNQDAMIAWENFGSPD-TIFCGVFDGHGPFGHVVAKKV  129

Query  761   RDRLPSKLSV-------ASKDNSQDFE--------KDIHHHPLFSKWKSTFPQSFKDIDN  895
             RD LP KL+        A K  + D          KD  H  LF   K +F ++FK +D 
Sbjct  130   RDALPLKLTSQWVLTNNAKKGAADDTNETASYQDHKDNDHCELFMTLKDSFLKAFKVMDK  189

Query  896   ALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPN  1075
              L+   +ID + SGTTAVTL+KQG+ L+I N+GDSRA++ TRD+   LV  QLTVDLKPN
Sbjct  190   ELKLHPRIDCYCSGTTAVTLVKQGQDLVIANVGDSRALLGTRDEDGSLVAVQLTVDLKPN  249

Query  1076  LPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIF  1255
             LP E+ERI  CKGRV A   EP V RVW+P  + PGLAMARAFGDFCLKD+G+ISVP+I 
Sbjct  250   LPRETERIMRCKGRVFALQNEPEVARVWLPNSNSPGLAMARAFGDFCLKDFGLISVPDIS  309

Query  1256  YRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSK  1435
             YR+++E+DEFVVLA+DG+WDVLSN EV+K VA A  R+ AAR +VE A R W+ KYP  K
Sbjct  310   YRRLTEKDEFVVLATDGIWDVLSNEEVVKIVALA-PRASAARALVESATRAWRSKYPYVK  368

Query  1436  TDDCAVVCLFF  1468
              DDCAVVCLF 
Sbjct  369   VDDCAVVCLFL  379



>gb|EYU39458.1| hypothetical protein MIMGU_mgv1a005481mg [Erythranthe guttata]
Length=482

 Score =   351 bits (900),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 177/326 (54%), Positives = 222/326 (68%), Gaps = 30/326 (9%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQG+KG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  52    GRMFLNGSSDTASLFTQQGRKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  111

Query  761   RDRLPSKLS-------------------VASKDNSQD---FEKD-------IHHHP-LFS  850
             RD LP KLS                    +S   S+D   F  D       I   P +F 
Sbjct  112   RDCLPLKLSSHWEVNIKNDEILRDVSLNTSSSRCSEDASFFSADTEVARASIDEQPEVFH  171

Query  851   KWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDT  1030
               K +F +++K +D  L+    ID F SGTTAVT++KQG+ LIIGN+GDSRA++ TRD+ 
Sbjct  172   TLKESFLKAYKVMDRELKMYANIDCFCSGTTAVTMVKQGQDLIIGNVGDSRAVLATRDEN  231

Query  1031  DQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGD  1210
             + L   QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMARAFGD
Sbjct  232   NLLTAVQLTVDLKPNLPGEAERIRKCKGRVFALHDEPEVARVWLPNNDSPGLAMARAFGD  291

Query  1211  FCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVV  1390
             FCLKD+G+ISVPE+ YR+I+++DEF+VLA+DG+WDVLSN EV+  V +   RS AA+ +V
Sbjct  292   FCLKDFGLISVPEVSYRRITDKDEFIVLATDGIWDVLSNKEVVDIVESCSTRSSAAKSLV  351

Query  1391  ERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             E AVR W+ KYP SK DDCAVVCLF 
Sbjct  352   ECAVRGWRSKYPTSKVDDCAVVCLFL  377



>gb|EAY79673.1| hypothetical protein OsI_34819 [Oryza sativa Indica Group]
Length=420

 Score =   348 bits (894),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 217/304 (71%), Gaps = 18/304 (6%)
 Frame = +2

Query  614   VSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA  793
             VSM+++QG KG NQDAMT  + F G KG  FCGVFDGHGP G  VA+ +RD LP KLS +
Sbjct  34    VSMHTKQGWKGANQDAMTTCQDFAGHKGQIFCGVFDGHGPLGREVARHVRDVLPVKLSSS  93

Query  794   -----SKDNSQDFEKDI-------------HHHPLFSKWKSTFPQSFKDIDNALEGEEKI  919
                   +D S + +K+              +   L S WK+ F ++F+D+D  L     I
Sbjct  94    LALKTEQDPSSNTDKETLEKSDCTSLSDTSNEKQLLSTWKNIFVKTFEDVDEDLRQHSGI  153

Query  920   DSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERI  1099
             D   SGTTAVT+++QG+HLII NLGDSRA++CTRD  D+ +  QLT DLKPNLP E+ERI
Sbjct  154   DCICSGTTAVTVVRQGDHLIIANLGDSRAVLCTRDSKDRPISVQLTTDLKPNLPSEAERI  213

Query  1100  KSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERD  1279
              + KGRV A  +EP+V R+W+P+QD PGLAMARAFGDFCLK +G+I  PE++YRK+S +D
Sbjct  214   LNSKGRVFAMDDEPDVPRMWLPDQDAPGLAMARAFGDFCLKSHGLICTPEVYYRKLSAKD  273

Query  1280  EFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVC  1459
             +F+VLA+DG+WDVLSN EVIK V++A   S AA+ +VERA RTW++K+P S  DDCAVVC
Sbjct  274   DFLVLATDGIWDVLSNKEVIKIVSSATDHSKAAKQLVERAARTWRRKFPTSMVDDCAVVC  333

Query  1460  LFFK  1471
             LF K
Sbjct  334   LFLK  337



>ref|XP_002987553.1| hypothetical protein SELMODRAFT_183192 [Selaginella moellendorffii]
 gb|EFJ11389.1| hypothetical protein SELMODRAFT_183192 [Selaginella moellendorffii]
Length=464

 Score =   350 bits (898),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 235/353 (67%), Gaps = 29/353 (8%)
 Frame = +2

Query  599   GSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPS  778
              S+    +++QQG+KGVNQDAM VWE F   K   FCGVFDGHGP GH VA+ +RD LPS
Sbjct  50    ASNSAACLFTQQGRKGVNQDAMIVWESFCSRKDTTFCGVFDGHGPYGHLVARRVRDSLPS  109

Query  779   KL------SVASKDNS---------------QDFEKDIHHHPLFSKWKSTFPQSFKDIDN  895
             KL      +  SK+ S                D  ++     +F  WK T  +S+K +D 
Sbjct  110   KLLAYWQEATESKNLSDGGESEKAEEQVLPGSDSGEEAQEPEMFKVWKETHLKSYKVMDK  169

Query  896   ALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPN  1075
              L     ID F SGTTAVTLIKQG+ L++GN+GDSRA+M +R D + +   QLTVDLKPN
Sbjct  170   DLRVHPIIDCFCSGTTAVTLIKQGDELVLGNVGDSRAVMGSRADDNSIRAVQLTVDLKPN  229

Query  1076  LPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIF  1255
             LP E+ERI+ CKGRV A  +EP V RVW+P  + PGLAMARAFGDFCLKD+GVI+VPE+ 
Sbjct  230   LPEEAERIRQCKGRVFALHDEPEVARVWLPHDNSPGLAMARAFGDFCLKDFGVIAVPEVS  289

Query  1256  YRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSK  1435
             Y +I+ERD+FVVLA+DGVWDVLSN EV+K VATA  ++ +AR +VE AVR W+ KYP SK
Sbjct  290   YYRITERDQFVVLATDGVWDVLSNEEVVKIVATAPTKTTSARSLVESAVRAWRLKYPTSK  349

Query  1436  TDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEENSAIIAE-TDDGL  1591
              DDCAVVCL+  + K     T +Q A +      +G+ EE   ++AE T+D L
Sbjct  350   MDDCAVVCLYLNKGKDA---TATQEAVVKKKV--SGQEEE--IVVAEITEDDL  395



>ref|XP_010245945.1| PREDICTED: probable protein phosphatase 2C 33 [Nelumbo nucifera]
 ref|XP_010245946.1| PREDICTED: probable protein phosphatase 2C 33 [Nelumbo nucifera]
Length=477

 Score =   350 bits (899),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 186/352 (53%), Positives = 230/352 (65%), Gaps = 38/352 (11%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G S   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP+GH VA+ +
Sbjct  51    GRMFLNGGSEVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPNGHMVARRV  110

Query  761   RDRLPSKLSV------ASKDN----------------------------SQDFEKDIHHH  838
             RD LP KLS        S+D                             S D E+   H 
Sbjct  111   RDSLPLKLSAHWEVTRGSEDGYREISSSIMGSMSSEENAYMHTGGESRVSVDLEEKEKHP  170

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              ++   K +F ++FK +D  L     ID F SGTTAVTL+KQG+ L+IGN+GDSRA++ T
Sbjct  171   EIYHTLKESFLKAFKVMDKELRLHPNIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGT  230

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             R+  + L+  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  231   RNQENSLIAVQLTVDLKPNLPREAERIRKCKGRVFALRDEPEVARVWLPNYDSPGLAMAR  290

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVPEIFYR ++E+DEF+VLA+DGVWDVLSN EV++ VA+A  RS AA
Sbjct  291   AFGDFCLKDFGLISVPEIFYRHLTEKDEFIVLATDGVWDVLSNKEVVEIVASAPARSSAA  350

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKP----MLLKTMSQAAGLN  1522
             R +VE AVR W+ KYP SK DDCAVVCLF            LKT  Q + L+
Sbjct  351   RTLVESAVRAWRFKYPTSKIDDCAVVCLFLDNESSSSATAYLKTKEQPSSLD  402



>ref|XP_002319268.2| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE95191.2| phosphatase 2C family protein [Populus trichocarpa]
Length=482

 Score =   350 bits (898),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 222/331 (67%), Gaps = 34/331 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG    A FCGVFDGHGP GH VA+ +
Sbjct  54    GRLFLNGSSDIASLFTQQGKKGTNQDAMIVWENFGSRTDAVFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKL-----------------------SVASKDNS-----------QDFEKDIHHH  838
             RD LP KL                       S+ S+D S            D E    H 
Sbjct  114   RDSLPLKLTAYWEMNATSEAVLKEISLNTTGSMNSEDTSFISADEEPRASVDLEDAEKHP  173

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
               F   K +F ++FK +D  L     ID F SGTTAVTL+KQG++L++GN+GDSRA++ T
Sbjct  174   ENFQTLKESFLKAFKVMDRELRVHANIDCFCSGTTAVTLVKQGQYLVLGNVGDSRAVLGT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D LV  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDDSLVAVQLTVDLKPNLPAEAERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP+I YR ++E+DEF+VLA+DG+WDVLSN EV+  VA+   RS AA
Sbjct  294   AFGDFCLKDFGLISVPDISYRHLTEKDEFIVLATDGIWDVLSNKEVVDIVASVSSRSSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             R +VE AVR W+ KYP SK DDCAVVCLF +
Sbjct  354   RALVESAVRAWRYKYPTSKIDDCAVVCLFLE  384



>ref|XP_002992818.1| hypothetical protein SELMODRAFT_187001 [Selaginella moellendorffii]
 gb|EFJ06108.1| hypothetical protein SELMODRAFT_187001 [Selaginella moellendorffii]
Length=463

 Score =   350 bits (897),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 217/315 (69%), Gaps = 21/315 (7%)
 Frame = +2

Query  599   GSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPS  778
              S+    +++QQG+KGVNQDAM VWE F   K   FCGVFDGHGP GH VA+ +RD LPS
Sbjct  50    ASNSAACLFTQQGRKGVNQDAMIVWESFCSRKDTTFCGVFDGHGPYGHLVARRVRDSLPS  109

Query  779   KL------SVASKDNS---------------QDFEKDIHHHPLFSKWKSTFPQSFKDIDN  895
             KL      +  SK+ S                D  ++     +F  WK T  +S+K +D 
Sbjct  110   KLLAYWQEATESKNLSDGGESEKAEEQVLPGSDSGEEAQEPEMFKVWKETHLKSYKVMDK  169

Query  896   ALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPN  1075
              L     ID F SGTTAVTLIKQG+ L++GN+GDSRA+M +R D + +   QLTVDLKPN
Sbjct  170   DLRVHPIIDCFCSGTTAVTLIKQGDELVLGNVGDSRAVMGSRADDNSIRAVQLTVDLKPN  229

Query  1076  LPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIF  1255
             LP E+ERI+ CKGRV A  +EP V RVW+P  + PGLAMARAFGDFCLKD+GVI+VPE+ 
Sbjct  230   LPEEAERIRQCKGRVFALHDEPEVARVWLPHDNSPGLAMARAFGDFCLKDFGVIAVPEVS  289

Query  1256  YRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSK  1435
             Y +I+ERD+FVVLA+DGVWDVLSN EV+K VATA  ++ +AR +VE AVR W+ KYP SK
Sbjct  290   YYRITERDQFVVLATDGVWDVLSNEEVVKIVATAPTKTTSARSLVESAVRAWRLKYPTSK  349

Query  1436  TDDCAVVCLFFKRPK  1480
              DDCAVVCL+  + K
Sbjct  350   MDDCAVVCLYLNKGK  364



>ref|XP_010423984.1| PREDICTED: probable protein phosphatase 2C 65 [Camelina sativa]
 ref|XP_010423985.1| PREDICTED: probable protein phosphatase 2C 65 [Camelina sativa]
Length=381

 Score =   347 bits (889),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 171/308 (56%), Positives = 219/308 (71%), Gaps = 7/308 (2%)
 Frame = +2

Query  578   GARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQF  757
             GA +R  GSS+ VSM  +QGKKG+NQDAMTVWE FGGE+   FCGVFDGHGP GH++++ 
Sbjct  36    GAVIRSRGSSKHVSMAIKQGKKGINQDAMTVWEKFGGEEDMIFCGVFDGHGPMGHKISRQ  95

Query  758   IRDRLPSKLSV---ASKDNSQDFEKDIHH--HPLFSKWKSTFPQSFKDIDNALEGEEKID  922
             + + LPS++     + K   ++ E +       LF +++      FK +D+ L      D
Sbjct  96    VCENLPSRVHSKIRSFKTGGENIENNSSQSQEELFREFEDILVTFFKQVDSELGLNSPYD  155

Query  923   SFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIK  1102
             SF SGTTAVT+ KQG+ L+I NLGDSRA++ TR   +     QLTVDLKP +  E+ERI 
Sbjct  156   SFCSGTTAVTVFKQGDCLMIANLGDSRAVLGTRS-KNSFKAVQLTVDLKPCVQREAERIV  214

Query  1103  SCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDE  1282
             SCKGRV A  EEP+V+RVWMP+ DCPGLAM+RAFGDFCLKDYG++ +PE+F RK+   DE
Sbjct  215   SCKGRVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVCIPEVFCRKVGREDE  274

Query  1283  FVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCL  1462
             FVVLA+DG+WDVLSN EV+K V + K RS AA  +V+RA RTW+ K+P SK DDCAVV L
Sbjct  275   FVVLATDGIWDVLSNEEVVKIVGSCKDRSTAAETLVQRAARTWRTKFPASKADDCAVVVL  334

Query  1463  FFK-RPKP  1483
             + K RP P
Sbjct  335   YLKHRPYP  342



>ref|XP_006345821.1| PREDICTED: probable protein phosphatase 2C 33-like [Solanum tuberosum]
Length=470

 Score =   349 bits (896),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 180/329 (55%), Positives = 220/329 (67%), Gaps = 33/329 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S++SQQGKKG NQDAM VWE+FG  +   FCGVFDGHGP GH VA+ +
Sbjct  51    GRMFLNGSSEVASLFSQQGKKGTNQDAMIVWENFGSREDTVFCGVFDGHGPFGHMVAKRV  110

Query  761   RDRLPSKLSVASKDN---------------------------------SQDFEKDIHHHP  841
             RD LP KLS   + N                                 S D E+   H  
Sbjct  111   RDALPLKLSTHWEVNIKSEDVLREISLNTGSSLYPEDAVLISAEESRLSIDVEETEKHLE  170

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   K +F +++K +D  L     ID F SGTT+VTL+KQGE+L+IGN+GDSRA++ TR
Sbjct  171   VFQTLKESFLKAYKVMDRELRSYTNIDCFCSGTTSVTLVKQGENLVIGNVGDSRAVLGTR  230

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
              + D L   QLTVDLKP+LP E ERI+ CKGRV +  +EP+V RVWMP  + PGLAMARA
Sbjct  231   GEDDSLTAVQLTVDLKPDLPAEFERIRKCKGRVFSLQDEPDVARVWMPNSNSPGLAMARA  290

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+GVISVPEI YR++SE+DEF+VLA+DG+WDVLSN EV+  V +A  RS AAR
Sbjct  291   FGDFCLKDFGVISVPEISYRRLSEKDEFIVLATDGIWDVLSNDEVVNIVDSASSRSSAAR  350

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AVR WK  YP SK DDCAVVCLF 
Sbjct  351   SLVEEAVRAWKITYPTSKVDDCAVVCLFL  379



>ref|XP_004170792.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 33-like [Cucumis sativus]
Length=400

 Score =   346 bits (888),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/340 (51%), Positives = 230/340 (68%), Gaps = 26/340 (8%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G++   S++++QGKKG+NQDAM VWE+FG ++   FCGVFDGHGP GH VA+ +
Sbjct  60    GRMFLNGTTDHASLFTRQGKKGINQDAMIVWENFGSKEDTIFCGVFDGHGPFGHMVAKXV  119

Query  761   RDRLPSKLSV-----ASKDNSQD---------FEKDI---HHHP--------LFSKWKST  865
             RD LP KL+      A++   Q           +KD    H  P        ++   K +
Sbjct  120   RDSLPLKLNAQLELDATRKEGQARCQVSPPTLVQKDSGTSHCDPDHRGSYGNIYITLKES  179

Query  866   FPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVP  1045
             F ++FK +D  L+    ID ++SGTT+V L+KQG HLIIGN+GDSRA++ TRD ++ L  
Sbjct  180   FLKAFKVMDKELKLHPYIDCYTSGTTSVALVKQGRHLIIGNVGDSRAVLGTRDKSNSLAA  239

Query  1046  EQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKD  1225
              QLTVDLKPN P E+ERI+ CKGR+ A   EP +FRVW+P  D PGLAMARAFGDFCLKD
Sbjct  240   VQLTVDLKPNHPREAERIRLCKGRIFALQNEPEIFRVWLPNNDSPGLAMARAFGDFCLKD  299

Query  1226  YGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVR  1405
             +GVI+VP++ YR ++E+DEFVVLA+DGVWDVLSN EV+  VA++ K S AAR++V+ A R
Sbjct  300   FGVIAVPDVSYRHLTEKDEFVVLATDGVWDVLSNEEVVAIVASSPKSS-AARVLVDSATR  358

Query  1406  TWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNM  1525
              W+ KYP +K DDCAVVCL+    K   +    Q    +M
Sbjct  359   AWRLKYPTAKVDDCAVVCLYLDSNKSYAMTAKEQEFANDM  398



>ref|XP_009394985.1| PREDICTED: probable protein phosphatase 2C 66 [Musa acuminata 
subsp. malaccensis]
Length=540

 Score =   351 bits (900),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 219/327 (67%), Gaps = 31/327 (9%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+ +S    +Y+QQG+KG NQDAM VWE+F   KG  FCGVFDGHGP GH VA+ +
Sbjct  83    GRMFLNDASEVACLYTQQGRKGTNQDAMIVWENFSLTKGTIFCGVFDGHGPYGHMVAKKV  142

Query  761   RDRLPSKLSV------------------------------ASKDNSQDFEKDIHHHP-LF  847
             RD LP KLS                               +  DN  D+  +    P ++
Sbjct  143   RDSLPLKLSTQWRVRVNSHESPDLNGSISGSMDSEEMASFSKDDNWSDYMDENEKVPEMY  202

Query  848   SKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDD  1027
                K +F ++F+ +D  L+    ID F SGTTAVT++KQG+ L+IGN+GDSRAIM TRD+
Sbjct  203   LPLKQSFLKAFRLMDKELKFHPLIDCFCSGTTAVTIVKQGQDLVIGNIGDSRAIMGTRDE  262

Query  1028  TDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFG  1207
              + L+  QLTVDLKPNLP E+ RI+ CKGRV A  +EP V RVW+P  + PGLAMARAFG
Sbjct  263   DNNLIALQLTVDLKPNLPREAARIQQCKGRVFALQDEPEVARVWLPNNNSPGLAMARAFG  322

Query  1208  DFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLV  1387
             DFCLKDYG+ISVPEI YR ++E+DEF+VLA+DGVWDVLSN EV+  V +A  RS AAR V
Sbjct  323   DFCLKDYGLISVPEISYRHLTEKDEFIVLATDGVWDVLSNKEVVDIVVSAPTRSSAARAV  382

Query  1388  VERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             V+ AVR W+ K+P SK DDCAV+CLF 
Sbjct  383   VDCAVREWQLKFPTSKVDDCAVICLFL  409



>ref|XP_004140875.1| PREDICTED: probable protein phosphatase 2C 33-like [Cucumis sativus]
Length=400

 Score =   346 bits (887),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 172/340 (51%), Positives = 230/340 (68%), Gaps = 26/340 (8%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G++   S++++QGKKG+NQDAM VWE+FG ++   FCGVFDGHGP GH VA+ +
Sbjct  60    GRMFLNGTTDHASLFTRQGKKGINQDAMIVWENFGSKEDTIFCGVFDGHGPFGHMVAKKV  119

Query  761   RDRLPSKLSV-----ASKDNSQD---------FEKDI---HHHP--------LFSKWKST  865
             RD LP KL+      A++   Q           +KD    H  P        ++   K +
Sbjct  120   RDSLPLKLNAQLELDATRKEGQARCQVSPPTLVQKDSGTSHCDPDHRGSYGNIYITLKES  179

Query  866   FPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVP  1045
             F ++FK +D  L+    ID ++SGTT+V L+KQG HLIIGN+GDSRA++ TRD ++ L  
Sbjct  180   FLKAFKVMDKELKLHPYIDCYTSGTTSVALVKQGRHLIIGNVGDSRAVLGTRDKSNSLAA  239

Query  1046  EQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKD  1225
              QLTVDLKPN P E+ERI+ CKGR+ A   EP +FRVW+P  D PGLAMARAFGDFCLKD
Sbjct  240   VQLTVDLKPNHPREAERIRLCKGRIFALQNEPEIFRVWLPNNDSPGLAMARAFGDFCLKD  299

Query  1226  YGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVR  1405
             +GVI+VP++ YR ++E+DEFVVLA+DGVWDVLSN EV+  VA++ K S AAR++V+ A R
Sbjct  300   FGVIAVPDVSYRHLTEKDEFVVLATDGVWDVLSNEEVVAIVASSPKSS-AARVLVDSATR  358

Query  1406  TWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNM  1525
              W+ KYP +K DDCAVVCL+    K   +    Q    +M
Sbjct  359   AWRLKYPTAKVDDCAVVCLYLDSNKSYAMTAKEQEFANDM  398



>ref|XP_003534509.1| PREDICTED: probable protein phosphatase 2C 33-like [Glycine max]
Length=489

 Score =   349 bits (895),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 180/330 (55%), Positives = 226/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS+  S+++QQGKKG NQDAM VWE+F   +   FCGVFDGHGP GH VA+ +
Sbjct  53    GRIFLNGSSQVASLFTQQGKKGTNQDAMVVWENFCSREDTIFCGVFDGHGPYGHMVAKRV  112

Query  761   RDRLPSKLSV------------------------------ASKDN----SQDFEKDIHHH  838
             RD LP KL+                               AS D+    S D E+   H 
Sbjct  113   RDSLPLKLNAHWEQSASGEEVLKEISVNTAGSMNSEEAAFASADDESRVSVDAEETEKHP  172

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F ++FK +D  L+  + ID F SGTTAVTL+KQG  LIIGN+GDSRA++ T
Sbjct  173   EIFQTLKESFLKAFKVMDRELKMHQSIDCFCSGTTAVTLVKQGRDLIIGNVGDSRAVLGT  232

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             R+  + LV  QLTVDLKPNLP E ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  233   REKDNSLVAIQLTVDLKPNLPAEEERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMAR  292

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVPE+ YR+++E+DEFVV+A+DG+WDVLSN EV+  VA A +R++AA
Sbjct  293   AFGDFCLKDFGLISVPEVSYRRVTEKDEFVVMATDGIWDVLSNKEVVDIVAAAPRRALAA  352

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR+W+ KYP SK DDCAVVCLF 
Sbjct  353   RALVESAVRSWRYKYPTSKVDDCAVVCLFL  382



>ref|XP_004977606.1| PREDICTED: probable protein phosphatase 2C 73-like [Setaria italica]
Length=436

 Score =   347 bits (890),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 214/322 (66%), Gaps = 34/322 (11%)
 Frame = +2

Query  614   VSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA  793
              SM+++QG KG NQDAM V + F G KG  FCGVFDGHGP G  VA+ +RD LP KLS A
Sbjct  27    ASMHTKQGWKGANQDAMAVCQDFAGHKGHIFCGVFDGHGPLGREVARHVRDTLPMKLSSA  86

Query  794   SKDNSQDFEKD--------IHHHP--------------------------LFSKWKSTFP  871
              K  +++ E              P                          L S WKS F 
Sbjct  87    LKPKTEEQEDPSTDTLKLATEQDPSSNTDLDSSDKSDSTTSSDDTSDEKHLLSSWKSIFV  146

Query  872   QSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQ  1051
             ++F+ +D  L+    ID   SGTTAVT+++QG+HL I NLGDSRA++CTRD  D+L+P Q
Sbjct  147   KTFEQVDEELKQHSGIDCICSGTTAVTVVRQGDHLFIANLGDSRAVLCTRDSKDRLIPVQ  206

Query  1052  LTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYG  1231
             LT DLKP+LP E  RI +CKGRV A  +EP+V R+W+P+QD PGLAMARAFGDFCLK +G
Sbjct  207   LTTDLKPDLPSELARILNCKGRVFAMDDEPDVPRMWLPDQDAPGLAMARAFGDFCLKSHG  266

Query  1232  VISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTW  1411
             +I  PE++YRK+SE+DEF+VLA+DG+WDVLSN EV+K V++    S AAR +++RAVR W
Sbjct  267   LICTPEVYYRKLSEKDEFLVLATDGIWDVLSNKEVVKIVSSVTDPSKAARQLIDRAVRAW  326

Query  1412  KQKYPCSKTDDCAVVCLFFKRP  1477
             + KYP S  DDCAVVCLF  RP
Sbjct  327   RCKYPTSMVDDCAVVCLFLNRP  348



>emb|CBI17615.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   348 bits (892),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 184/329 (56%), Positives = 221/329 (67%), Gaps = 33/329 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G+S F S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  53    GRMFLNGASDFASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  112

Query  761   RDRLPSKLS----------------------VASKDN-----------SQDFEKDIHHHP  841
             RD LP KLS                      + S+D            S D E+      
Sbjct  113   RDSLPLKLSAHWEVNINEDVLKEISLNTTGSMNSEDTAFISADEESRPSIDLEETEKQPE  172

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   K +F ++FK +D  L     ID F SGTTAVTL+KQG+ L+IGN+GDSRA++ TR
Sbjct  173   IFQALKESFLKAFKVMDRELRMHTNIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTR  232

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             D    LV  QLTVDLKPNLP E+ERI+  KGRV A  +EP V RVW+P  D PGLAMARA
Sbjct  233   DKDGYLVAIQLTVDLKPNLPGEAERIRRFKGRVFALQDEPEVARVWLPNNDSPGLAMARA  292

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVPEI YR++SE+DEFVVLA+DGVWDVLSN EV+  VA+A  RS AAR
Sbjct  293   FGDFCLKDFGLISVPEISYRRLSEKDEFVVLATDGVWDVLSNKEVVDIVASASSRSTAAR  352

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  353   TLVETAVRAWRLKYPTSKVDDCAVVCLFL  381



>ref|XP_010069369.1| PREDICTED: probable protein phosphatase 2C 33 [Eucalyptus grandis]
 gb|KCW57692.1| hypothetical protein EUGRSUZ_H00454 [Eucalyptus grandis]
Length=406

 Score =   345 bits (886),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 221/328 (67%), Gaps = 34/328 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS   S++++QGKKG+NQDAM VWE+FG +     CGVFDGHGP GH VA+ +R
Sbjct  55    RIFLNGSSDAASLFTRQGKKGINQDAMIVWENFGSKTDTILCGVFDGHGPFGHMVAKKVR  114

Query  764   DRLPSKLS------VASKDNSQDFE--------------KDIHHHPLFSKW---------  856
             D LP KL+      V S D   DF               K I     F K          
Sbjct  115   DSLPLKLNALWELKVGSPDGHSDFSSSAMGSMNSEETSIKTIEDLKTFPKLEFGENHSDT  174

Query  857   ----KSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRD  1024
                 K +F ++FK +D  L+   +ID + SGTTAVTL+KQG  L+IGN+GDSRA++ TRD
Sbjct  175   ILTLKESFVKAFKVMDKELKLHPQIDCYCSGTTAVTLVKQGHDLLIGNVGDSRAVLGTRD  234

Query  1025  DTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAF  1204
               + L+  QLTVDLKP+LP E ERI+ C+GRV A   EP V RVW+P  D PGLAMARAF
Sbjct  235   KNNSLIAVQLTVDLKPDLPRELERIRLCRGRVFALKNEPEVARVWLPNCDSPGLAMARAF  294

Query  1205  GDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARL  1384
             GDFCLKD+G+IS+PEI YR++++RDEFVVLA+DG+WDVLSN EV+  VA+A  RS AAR 
Sbjct  295   GDFCLKDFGLISIPEISYRRLTDRDEFVVLATDGIWDVLSNNEVVDIVASA-PRSSAART  353

Query  1385  VVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             +VE A+R W+ KYP +K DDCAVVCLF 
Sbjct  354   LVESAIRAWRFKYPYAKVDDCAVVCLFL  381



>ref|XP_007222732.1| hypothetical protein PRUPE_ppa006494mg [Prunus persica]
 gb|EMJ23931.1| hypothetical protein PRUPE_ppa006494mg [Prunus persica]
Length=409

 Score =   345 bits (886),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 176/306 (58%), Positives = 214/306 (70%), Gaps = 17/306 (6%)
 Frame = +2

Query  596   HGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLP  775
             +GSS F S++ +QGKKGVNQDAM  WE+FG      FCGVFDGHGP GH VA+ +RD LP
Sbjct  76    NGSSDFASLFCKQGKKGVNQDAMIAWENFGSPD-TIFCGVFDGHGPFGHVVAKKVRDALP  134

Query  776   SKLSV-------ASKDNSQDFE--------KDIHHHPLFSKWKSTFPQSFKDIDNALEGE  910
              KL+        A K  + D          KD  H  LF   K +F ++FK +D  L+  
Sbjct  135   LKLTSQWVLTNNAKKGAADDTNEAASYQDHKDNEHCELFVTLKDSFLKAFKVMDKELKLH  194

Query  911   EKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVES  1090
              +ID + SGTTAVTL+KQG+ L+I N+GDSRA++ TRD+   LV  QLTVDLKPNLP E+
Sbjct  195   PRIDCYCSGTTAVTLVKQGQDLVIANVGDSRALLGTRDEDGSLVAVQLTVDLKPNLPREA  254

Query  1091  ERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKIS  1270
             ERI  CKGRV A   EP V RVW+P  + PGLAMARAFGDFCLKD+G+ISVP+I YR+++
Sbjct  255   ERIMRCKGRVFALQNEPEVARVWLPNSNSPGLAMARAFGDFCLKDFGLISVPDISYRRLT  314

Query  1271  ERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCA  1450
             E DEFVVLA+DG+WDVLSN EV+K VA A  R+ AAR +VE A R W+ KYP  K DDCA
Sbjct  315   ENDEFVVLATDGIWDVLSNEEVVKIVALA-PRASAARALVESATRAWRSKYPYVKVDDCA  373

Query  1451  VVCLFF  1468
             VVCLF 
Sbjct  374   VVCLFL  379



>ref|NP_001067763.2| Os11g0417400 [Oryza sativa Japonica Group]
 sp|Q2R637.1|P2C75_ORYSJ RecName: Full=Probable protein phosphatase 2C 75; Short=OsPP2C75 
[Oryza sativa Japonica Group]
 gb|ABA93159.2| protein phosphatase 2C, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG92015.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF28126.2| Os11g0417400 [Oryza sativa Japonica Group]
Length=432

 Score =   346 bits (888),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 178/369 (48%), Positives = 235/369 (64%), Gaps = 32/369 (9%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+  +G+     ++++QGKKG NQDAM  WE++ G     FCGVFDGHGP GH +A+ +
Sbjct  34    GRIAGNGAGNVACLFTRQGKKGTNQDAMVAWENYNGRSDTVFCGVFDGHGPHGHLIARKV  93

Query  761   RDRLPSKL----------SVASKDNSQDFEKDI-----------------HHHPLFSKWK  859
             RD LPS+L          S  S  +    E+++                  H   F+  K
Sbjct  94    RDILPSRLCDLIYEDCGDSPTSNSDVSTLEENLSPYADAECRSPTLAGQKEHQEFFNAMK  153

Query  860   STFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQL  1039
              +F ++FK++D  L+ +  IDS  SGTTAVTLIKQG  LI+GNLGDSRA++ TRD  D+L
Sbjct  154   ESFRKAFKNVDKELKLQRNIDSICSGTTAVTLIKQGHDLIVGNLGDSRAVLGTRDQNDKL  213

Query  1040  VPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCL  1219
             V  QLTVDLKP+ P E+ RI+ C GRV A  +EP+V R+W+P  + PGLAMARAFGDFCL
Sbjct  214   VAHQLTVDLKPDHPREARRIRRCNGRVFAHQDEPDVARLWLPNCNSPGLAMARAFGDFCL  273

Query  1220  KDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERA  1399
             KD+G+ISVP++ YR+I+E+DEF+VLA+DGVWDVLSN EV+  VA+   R  AAR VV+ A
Sbjct  274   KDFGLISVPDVTYRQITEKDEFIVLATDGVWDVLSNQEVVDVVASCSGRFAAARSVVDLA  333

Query  1400  VRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPE-TGRNEENSAIIA-  1573
               TW+ KYP SKTDDCAVVCLF    K  +   +S   G +   P  +G    NS  +  
Sbjct  334   NETWRFKYPTSKTDDCAVVCLFLN--KYEVTGGLSGQPGYSPRMPALSGITRPNSKRVTP  391

Query  1574  -ETDDGLDT  1597
              + DDG D+
Sbjct  392   DDVDDGSDS  400



>ref|XP_009118526.1| PREDICTED: probable protein phosphatase 2C 33 [Brassica rapa]
Length=467

 Score =   347 bits (891),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 181/341 (53%), Positives = 227/341 (67%), Gaps = 28/341 (8%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS    +++QQGKKG NQDAM VWE FG      FCGVFDGHGP GH VA+ +
Sbjct  56    GRMFLNGSSEVACIFTQQGKKGPNQDAMVVWESFGSRTDTVFCGVFDGHGPFGHMVAKRV  115

Query  761   RDRLPSKLSV-----------------ASKDNSQDFE-----------KDIHHHPLFSKW  856
             RD LP KLS                  ++ +NS+D             ++     LF   
Sbjct  116   RDNLPLKLSAYWEAKVPVEGSIKTVNNSANNNSEDAASFVSTEEEPRPEESTESELFQTL  175

Query  857   KSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQ  1036
             K  F ++FK +D  L+    +D F SGTTAVTLIKQGE+L++GN+GDSRA+M TRD  + 
Sbjct  176   KEAFLKAFKVMDRELKFHGSVDCFCSGTTAVTLIKQGEYLVVGNVGDSRAVMGTRDGKNG  235

Query  1037  LVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFC  1216
             LV  QLTVDLKPNLP E ERIK C+GRV A  +EP+V RVW+P  D PGLAMARAFGDFC
Sbjct  236   LVAVQLTVDLKPNLPAEEERIKKCRGRVFALRDEPDVCRVWLPNCDSPGLAMARAFGDFC  295

Query  1217  LKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVER  1396
             LKD+G+ISVPE+ +R+++E+DEF+VLA+DG+WDVLSN EV+K VA+A  RS AAR +VE 
Sbjct  296   LKDFGLISVPEVSFRRLTEKDEFIVLATDGIWDVLSNEEVVKIVASAPSRSSAARALVET  355

Query  1397  AVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGL  1519
             AVR W+ KYP SK DDCA VCL+        + T S  + L
Sbjct  356   AVRAWRHKYPTSKVDDCAAVCLYLNSNGSNAISTASSFSKL  396



>gb|EEE68422.1| hypothetical protein OsJ_26787 [Oryza sativa Japonica Group]
Length=425

 Score =   345 bits (886),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 178/369 (48%), Positives = 235/369 (64%), Gaps = 32/369 (9%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+  +G+     ++++QGKKG NQDAM  WE++ G     FCGVFDGHGP GH +A+ +
Sbjct  22    GRIAGNGAGNVACLFTRQGKKGTNQDAMVAWENYNGRSDTVFCGVFDGHGPHGHLIARKV  81

Query  761   RDRLPSKL----------SVASKDNSQDFEKDI-----------------HHHPLFSKWK  859
             RD LPS+L          S  S  +    E+++                  H   F+  K
Sbjct  82    RDILPSRLCDLIYEDCGDSPTSNSDVSTLEENLSPYADAECRSPTLAGQKEHQEFFNAMK  141

Query  860   STFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQL  1039
              +F ++FK++D  L+ +  IDS  SGTTAVTLIKQG  LI+GNLGDSRA++ TRD  D+L
Sbjct  142   ESFRKAFKNVDKELKLQRNIDSICSGTTAVTLIKQGHDLIVGNLGDSRAVLGTRDQNDKL  201

Query  1040  VPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCL  1219
             V  QLTVDLKP+ P E+ RI+ C GRV A  +EP+V R+W+P  + PGLAMARAFGDFCL
Sbjct  202   VAHQLTVDLKPDHPREARRIRRCNGRVFAHQDEPDVARLWLPNCNSPGLAMARAFGDFCL  261

Query  1220  KDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERA  1399
             KD+G+ISVP++ YR+I+E+DEF+VLA+DGVWDVLSN EV+  VA+   R  AAR VV+ A
Sbjct  262   KDFGLISVPDVTYRQITEKDEFIVLATDGVWDVLSNQEVVDVVASCSGRFAAARSVVDLA  321

Query  1400  VRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPE-TGRNEENSAIIA-  1573
               TW+ KYP SKTDDCAVVCLF    K  +   +S   G +   P  +G    NS  +  
Sbjct  322   NETWRFKYPTSKTDDCAVVCLFLN--KYEVTGGLSGQPGYSPRMPALSGITRPNSKRVTP  379

Query  1574  -ETDDGLDT  1597
              + DDG D+
Sbjct  380   DDVDDGSDS  388



>ref|XP_002277393.1| PREDICTED: probable protein phosphatase 2C 33 [Vitis vinifera]
Length=486

 Score =   348 bits (892),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 184/329 (56%), Positives = 221/329 (67%), Gaps = 33/329 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G+S F S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  53    GRMFLNGASDFASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  112

Query  761   RDRLPSKLS----------------------VASKDN-----------SQDFEKDIHHHP  841
             RD LP KLS                      + S+D            S D E+      
Sbjct  113   RDSLPLKLSAHWEVNINEDVLKEISLNTTGSMNSEDTAFISADEESRPSIDLEETEKQPE  172

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   K +F ++FK +D  L     ID F SGTTAVTL+KQG+ L+IGN+GDSRA++ TR
Sbjct  173   IFQALKESFLKAFKVMDRELRMHTNIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGTR  232

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             D    LV  QLTVDLKPNLP E+ERI+  KGRV A  +EP V RVW+P  D PGLAMARA
Sbjct  233   DKDGYLVAIQLTVDLKPNLPGEAERIRRFKGRVFALQDEPEVARVWLPNNDSPGLAMARA  292

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVPEI YR++SE+DEFVVLA+DGVWDVLSN EV+  VA+A  RS AAR
Sbjct  293   FGDFCLKDFGLISVPEISYRRLSEKDEFVVLATDGVWDVLSNKEVVDIVASASSRSTAAR  352

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  353   TLVETAVRAWRLKYPTSKVDDCAVVCLFL  381



>emb|CDY53743.1| BnaAnng12710D [Brassica napus]
Length=468

 Score =   347 bits (890),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 182/341 (53%), Positives = 227/341 (67%), Gaps = 28/341 (8%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS    +++QQGKKG NQDAM VWE FG      FCGVFDGHGP GH VA+ +
Sbjct  56    GRMFLNGSSDVACIFTQQGKKGPNQDAMVVWESFGSRTDTVFCGVFDGHGPFGHMVAKRV  115

Query  761   RDRLPSKLSV-----------------ASKDNSQDFE-----------KDIHHHPLFSKW  856
             RD LP KLS                  ++ +NS+D             ++     LF   
Sbjct  116   RDNLPLKLSAYWEAKVPVEGSIKTVNNSANNNSEDAASFVSTEEEPRPEESTESELFQTL  175

Query  857   KSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQ  1036
             K  F ++FK +D  L+    +D F SGTTAVTLIKQGE+L++GN+GDSRA+M TRD  + 
Sbjct  176   KEAFLKAFKVMDRELKFHGSVDCFCSGTTAVTLIKQGEYLVVGNVGDSRAVMGTRDGENG  235

Query  1037  LVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFC  1216
             LV  QLTVDLKPNLP E ERIK C+GRV A  +EP+V RVW+P  D PGLAMARAFGDFC
Sbjct  236   LVAVQLTVDLKPNLPAEEERIKKCRGRVFALRDEPDVCRVWLPNCDSPGLAMARAFGDFC  295

Query  1217  LKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVER  1396
             LKD+G+ISVPE+ +R+++E+DEF+VLA+DGVWDVLSN EV+K VA+A  RS AAR +VE 
Sbjct  296   LKDFGLISVPEVSFRRLTEQDEFIVLATDGVWDVLSNEEVVKIVASAPSRSSAARALVET  355

Query  1397  AVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGL  1519
             AVR W+ KYP SK DDCA VCL+        + T S  + L
Sbjct  356   AVRAWRHKYPTSKVDDCAAVCLYLNSNGSNAISTASSFSKL  396



>ref|XP_006366012.1| PREDICTED: probable protein phosphatase 2C 52-like [Solanum tuberosum]
Length=470

 Score =   347 bits (889),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 183/355 (52%), Positives = 236/355 (66%), Gaps = 26/355 (7%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+  +G SR   +Y+QQG+KG+NQDAM VWE F  E    FCGVFDGHGP GH VA+ +R
Sbjct  56    RIFTNGKSRTSCIYTQQGRKGINQDAMIVWEDFMAED-VTFCGVFDGHGPHGHLVARKVR  114

Query  764   DRLPSKL-----SVASKDNSQ--------------DFEKD-IHHHPLFSKWKSTFPQSFK  883
             D LP KL     SV SK N                D +KD ++   + ++ +  F QS+K
Sbjct  115   DALPLKLMSFLQSVESKGNGSAADCCNENPGSEVVDPDKDQVNTDKVDTQRREAFLQSYK  174

Query  884   DIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVD  1063
              +D  L  +  +D F SG+TA+TL+KQG +L +G +GDSRAI+ ++DD D +V  QLTVD
Sbjct  175   AMDKELRSQPNLDCFCSGSTAITLVKQGSNLYMGYIGDSRAILASKDDNDSMVAVQLTVD  234

Query  1064  LKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISV  1243
             LKP+LP E+ERIK CKGRV A  +EP V RVW+P  + PGLAMARAFGDFC+KDYGVISV
Sbjct  235   LKPDLPKEAERIKQCKGRVFALQDEPEVQRVWLPFDNAPGLAMARAFGDFCVKDYGVISV  294

Query  1244  PEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKY  1423
             PE  +R ++ERD+F+VLASDGVWDVLSN EV++ V++A  RS AAR++V+ A R WK KY
Sbjct  295   PEFSHRVLTERDKFIVLASDGVWDVLSNEEVVEIVSSAPTRSSAARILVDCAAREWKIKY  354

Query  1424  PCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEENSAIIAETDDG  1588
             P SK DDCAVVCLF      M L++ ++                +S I AE+DDG
Sbjct  355   PTSKMDDCAVVCLFLD--GKMDLESDNEE---EQCLSSAALQSNHSGIAAESDDG  404



>emb|CDX88554.1| BnaC06g39980D [Brassica napus]
Length=478

 Score =   347 bits (890),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 219/333 (66%), Gaps = 28/333 (8%)
 Frame = +2

Query  557   IVGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPS  736
             + G  +   R+  +GSS    +Y+QQGKKG NQDAM V+E+F       FCGVFDGHGP 
Sbjct  46    VEGVQEVSGRLISNGSSEIACLYTQQGKKGTNQDAMLVFENFCSRDDTVFCGVFDGHGPF  105

Query  737   GHRVAQFIRDRLPS------KLSVASKDNSQDFEKDIHHH--------------------  838
             GH VA+ +RD LPS      KL+  S+ NS   EK +                       
Sbjct  106   GHMVAKKVRDTLPSTLSTQLKLTSESEQNSLVNEKGVQIKCTEEEEAVTTTMDEQCDEQL  165

Query  839   --PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIM  1012
                ++   K    +S + ID  L+    ID F SGTT+VTLIKQGE L++GN+GDSRA++
Sbjct  166   LPEMYLPLKHALLKSCQQIDKDLKMHPTIDCFCSGTTSVTLIKQGEDLVVGNIGDSRAVL  225

Query  1013  CTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAM  1192
              TRD  + LV  QLTVDLKP+LP ES RI+ CKGRV A  +EP V RVW+P  D PGLAM
Sbjct  226   ATRDQDNALVAVQLTVDLKPDLPSESARIQKCKGRVFALQDEPEVARVWLPNSDSPGLAM  285

Query  1193  ARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSM  1372
             ARAFGDFCLKDYG+ISVP+I YR+++ERD+F+VLASDGVWDVLSN E +  +A+A  RS 
Sbjct  286   ARAFGDFCLKDYGLISVPDINYRRLTERDQFIVLASDGVWDVLSNKEAVDIIASAPSRST  345

Query  1373  AARLVVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             AAR +V+ AVR+W+ KYP SK DDC VVCLF +
Sbjct  346   AARALVDTAVRSWRIKYPTSKNDDCTVVCLFLQ  378



>ref|XP_010278294.1| PREDICTED: probable protein phosphatase 2C 52 [Nelumbo nucifera]
Length=474

 Score =   347 bits (889),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/316 (55%), Positives = 218/316 (69%), Gaps = 22/316 (7%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+  +G+SR   +++QQG+KG+NQDAM VWE F  E  A FCGVFDGHGP GH VA+ +R
Sbjct  58    RIFANGNSRTSCIFTQQGRKGINQDAMVVWEDFMSED-AIFCGVFDGHGPHGHLVARKVR  116

Query  764   DRLPSKL-------------------SVASKDNSQD--FEKDIHHHPLFSKWKSTFPQSF  880
             D LP KL                   S  +K +S D   EKD     L S W+  F +S+
Sbjct  117   DTLPLKLLSFLQSQESRQNGLGNNCFSRKAKPDSMDKESEKDDPTEDLGSLWREAFLKSY  176

Query  881   KDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTV  1060
             K +D  L     +D F SG+TAVT++KQG +L +G +GDSRAI+ +RD    +V  QLTV
Sbjct  177   KSMDKELRSHPTLDCFCSGSTAVTIVKQGLNLFMGYIGDSRAILGSRDSNGSMVAVQLTV  236

Query  1061  DLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVIS  1240
             DLKP+LP E+ERIK CKGRV A  +EP V RVW+P  D PGLAMARAFGDFCLKDYGVIS
Sbjct  237   DLKPDLPKEAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKDYGVIS  296

Query  1241  VPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQK  1420
             +PE  +R ++ERD+F+VLASDGVWDVLSN EV++ +++A  RS AAR++VE A R WK K
Sbjct  297   IPEFSHRILTERDQFIVLASDGVWDVLSNEEVVEIISSAPTRSSAARILVESAAREWKLK  356

Query  1421  YPCSKTDDCAVVCLFF  1468
             YP SK DDCAVVCLF 
Sbjct  357   YPTSKMDDCAVVCLFL  372



>ref|XP_008445704.1| PREDICTED: probable protein phosphatase 2C 33 [Cucumis melo]
Length=399

 Score =   344 bits (882),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/320 (52%), Positives = 221/320 (69%), Gaps = 25/320 (8%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G++   S++++QGKKG+NQDAM VWE+FG ++   FCGVFDGHGP GH VA+ +
Sbjct  60    GRMFLNGTTDHASLFTRQGKKGINQDAMIVWENFGTKEDTIFCGVFDGHGPFGHMVAKKV  119

Query  761   RDRLPSKLSV------ASKDNSQDFEKDI------------------HHHPLFSKWKSTF  868
             RD LP KL+         K+   D    +                  H   ++   K +F
Sbjct  120   RDSLPLKLNAQLELDATRKEGQNDARCQVSPPTLVNKGSGTSHCDPDHRGNIYVMLKESF  179

Query  869   PQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPE  1048
              ++FK +D  L+    ID ++SGTT+V L+KQG  LIIGN+GDSRA++ TRD ++ LV  
Sbjct  180   LKAFKVMDKELKLHPYIDCYTSGTTSVALVKQGRDLIIGNVGDSRAVLGTRDKSNSLVAV  239

Query  1049  QLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDY  1228
             QLTVDLKPN P E+ERI+ CKGR+ A   EP +FRVW+P  D PGLAMARAFGDFCLKD+
Sbjct  240   QLTVDLKPNHPREAERIRLCKGRIFALQNEPEIFRVWLPNNDSPGLAMARAFGDFCLKDF  299

Query  1229  GVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRT  1408
             GVI+VP++ YR ++E+DEFVVLA+DGVWDVLSN EV+  VA++  RS AAR++V+ A R 
Sbjct  300   GVIAVPDVSYRHLTEKDEFVVLATDGVWDVLSNEEVVAVVASS-PRSSAARVLVDSATRA  358

Query  1409  WKQKYPCSKTDDCAVVCLFF  1468
             W+ KYP +K DDCAVVCL+ 
Sbjct  359   WRLKYPTAKVDDCAVVCLYL  378



>ref|XP_006662878.1| PREDICTED: probable protein phosphatase 2C 75-like [Oryza brachyantha]
Length=432

 Score =   345 bits (885),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 234/369 (63%), Gaps = 32/369 (9%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+   G+     ++++QG+KG NQDAM  WE++ G     FCGVFDGHGP GH +A+ +
Sbjct  34    GRIAGSGAGNVACLFTRQGRKGTNQDAMVAWENYNGRSDTVFCGVFDGHGPHGHLIARKV  93

Query  761   RDRLPSKL----------SVASKDNSQDFEKDI-----------------HHHPLFSKWK  859
             RD LPS+L          S  S  +    E+++                  H   ++  K
Sbjct  94    RDILPSRLCDLIYEDYGDSPTSNSDVSTLEENLSPYADAECRSPTLAGHKEHQEFYNAMK  153

Query  860   STFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQL  1039
              +F ++FK++D  L+ +  ID   SGTTAVTLIKQG  LI+GNLGDSRA++ TRD  D+L
Sbjct  154   ESFRKAFKNVDKELKLQRNIDCICSGTTAVTLIKQGHDLIVGNLGDSRAVLGTRDQNDKL  213

Query  1040  VPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCL  1219
             +  QLTVDLKP+ P E+ RI+ C GRV A  +EP+V R+W+P  + PGLAMARAFGDFCL
Sbjct  214   IAHQLTVDLKPDHPREARRIRRCNGRVFAHQDEPDVARLWLPNCNSPGLAMARAFGDFCL  273

Query  1220  KDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERA  1399
             KD+G+ISVP++ YR+I+E+DEF+VLA+DGVWDVLSN EV+  VA+   R  AAR VV+ A
Sbjct  274   KDFGLISVPDVAYRRITEKDEFIVLATDGVWDVLSNQEVVDVVASCSGRFTAARSVVDLA  333

Query  1400  VRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPE-TGRNEENSAIIA-  1573
               TW+ KYP SKTDDCAVVCLF    K  +   +S   G N   P  +G  + NS  +  
Sbjct  334   NETWRFKYPTSKTDDCAVVCLFLN--KYDVASGLSGHPGYNPRIPALSGNTQPNSKRVTP  391

Query  1574  -ETDDGLDT  1597
              + DDG D+
Sbjct  392   VDADDGSDS  400



>ref|XP_010264521.1| PREDICTED: probable protein phosphatase 2C 73 isoform X4 [Nelumbo 
nucifera]
Length=381

 Score =   343 bits (880),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/285 (58%), Positives = 210/285 (74%), Gaps = 21/285 (7%)
 Frame = +2

Query  680   FGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVASKD--------NSQDFEKDIHH  835
             F GEK   FCGVFDGHGP GH+V+  +RD LPSKLS   K+        +S D ++D  H
Sbjct  6     FSGEKDEIFCGVFDGHGPLGHKVSCHVRDALPSKLSYLLKEPEMVDYYSSSSDEDEDADH  65

Query  836   -------------HPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHL  976
                             FS WK  F ++FK++D  L  +  +DSF SG+TAVT++K+GEHL
Sbjct  66    VDSSHNEANTQNSFSSFSLWKKCFVKAFKEMDRELYLDSTVDSFCSGSTAVTVLKKGEHL  125

Query  977   IIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRV  1156
             II NLGDSRA++CTR+  +QLVP QLTVDLKPNLP E+ERI+S  GRV A  EEP+V+R+
Sbjct  126   IIANLGDSRAVLCTRNQKNQLVPVQLTVDLKPNLPGEAERIRSYNGRVFAREEEPDVYRL  185

Query  1157  WMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEV  1336
             WM ++DCPGLAM+RAFGDFCLK++G+ S P++ YR+++E DEFVVLA+DGVWDVLSN EV
Sbjct  186   WMADEDCPGLAMSRAFGDFCLKNFGLSSTPKVSYRELAEEDEFVVLATDGVWDVLSNKEV  245

Query  1337  IKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             IK VA+A KRSMAA+L+V RA R WK ++P +K DDCA +CLFFK
Sbjct  246   IKIVASAGKRSMAAKLLVRRASRAWKFQHPTAKADDCAAICLFFK  290



>ref|XP_002986464.1| hypothetical protein SELMODRAFT_235030 [Selaginella moellendorffii]
 gb|EFJ12321.1| hypothetical protein SELMODRAFT_235030 [Selaginella moellendorffii]
Length=468

 Score =   346 bits (888),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 212/313 (68%), Gaps = 15/313 (5%)
 Frame = +2

Query  575   FGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQ  754
             F  R+  +GSS    ++SQQG+KGVNQDAM  WE F   +   FCGVFDGHGP GH VA+
Sbjct  46    FPGRLCTNGSSNSCCLFSQQGRKGVNQDAMIAWESFASREDTAFCGVFDGHGPYGHLVAR  105

Query  755   FIRDRLPSKL---------------SVASKDNSQDFEKDIHHHPLFSKWKSTFPQSFKDI  889
              +RD LP KL                + SK N ++ ++    + LF  WK    ++FK +
Sbjct  106   RVRDSLPLKLVLNWQESECAKNDEIKIPSKRNDEEGDEAAAEYDLFCTWKDLHLKAFKVM  165

Query  890   DNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLK  1069
             D  L+    ID F SGTTAVT++KQG+ L IGN+GDSRAI+ T  +        LTVDLK
Sbjct  166   DRELQVHPSIDCFCSGTTAVTVLKQGQDLFIGNVGDSRAILGTTAEDGSFSAVPLTVDLK  225

Query  1070  PNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPE  1249
             PNLP E+ERI+ CKGRV A  +EP V RVW+P ++ PGLAMARAFGDFCLKD+GVI+VPE
Sbjct  226   PNLPKEAERIRQCKGRVFALHDEPEVHRVWLPHENSPGLAMARAFGDFCLKDFGVIAVPE  285

Query  1250  IFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPC  1429
             ++YR++S+RD+FVVLA+DGVWDVLSN EV+  +++   RS AAR +VE AV  W  KYP 
Sbjct  286   VYYRRLSDRDKFVVLATDGVWDVLSNEEVVNIISSHPTRSTAARTLVEAAVHAWMLKYPT  345

Query  1430  SKTDDCAVVCLFF  1468
             SK DDCA VCLF 
Sbjct  346   SKIDDCAAVCLFL  358



>ref|XP_002978948.1| hypothetical protein SELMODRAFT_153020 [Selaginella moellendorffii]
 gb|EFJ19905.1| hypothetical protein SELMODRAFT_153020 [Selaginella moellendorffii]
Length=470

 Score =   346 bits (888),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 212/313 (68%), Gaps = 15/313 (5%)
 Frame = +2

Query  575   FGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQ  754
             F  R+  +GSS    ++SQQG+KGVNQDAM  WE F   +   FCGVFDGHGP GH VA+
Sbjct  46    FPGRLCTNGSSNSCCLFSQQGRKGVNQDAMIAWESFASREDTAFCGVFDGHGPYGHLVAR  105

Query  755   FIRDRLPSKL---------------SVASKDNSQDFEKDIHHHPLFSKWKSTFPQSFKDI  889
              +RD LP KL                + SK N ++ ++    + LF  WK    ++FK +
Sbjct  106   RVRDSLPLKLVLNWQESECAKNDEIKIPSKRNDEEGDEAAAEYDLFCTWKDLHLKAFKVM  165

Query  890   DNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLK  1069
             D  L+    ID F SGTTAVT++KQG+ L IGN+GDSRAI+ T  +        LTVDLK
Sbjct  166   DRELQVHPSIDCFCSGTTAVTVLKQGQDLFIGNVGDSRAILGTTAEDGSFSAVPLTVDLK  225

Query  1070  PNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPE  1249
             PNLP E+ERI+ CKGRV A  +EP V RVW+P ++ PGLAMARAFGDFCLKD+GVI+VPE
Sbjct  226   PNLPKEAERIRQCKGRVFALHDEPEVHRVWLPHENSPGLAMARAFGDFCLKDFGVIAVPE  285

Query  1250  IFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPC  1429
             ++YR++S+RD+FVVLA+DGVWDVLSN EV+  +++   RS AAR +VE AV  W  KYP 
Sbjct  286   VYYRRLSDRDKFVVLATDGVWDVLSNEEVVNIISSHPTRSTAARTLVEAAVHAWMLKYPT  345

Query  1430  SKTDDCAVVCLFF  1468
             SK DDCA VCLF 
Sbjct  346   SKIDDCAAVCLFL  358



>ref|XP_006350422.1| PREDICTED: probable protein phosphatase 2C 33-like [Solanum tuberosum]
Length=604

 Score =   350 bits (899),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 223/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  170   GRLFLNGSSEAASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPHGHMVAKRV  229

Query  761   RDRLPSKLS-------------------------------VASKDNSQ---DFEKDIHHH  838
             RD LPSKLS                               +++ D S+   D E+   H 
Sbjct  230   RDSLPSKLSAHWEVNLKSEDVLKEISLNAGASLYPEDASLISAADESRVSIDVEETGKHP  289

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F +++K +D  L+    ID F SGTTAVTLIKQG+ L+IGN+GDSRAI+ T
Sbjct  290   EIFQTLKESFLKAYKVMDRELKSYTNIDCFCSGTTAVTLIKQGQDLVIGNVGDSRAILGT  349

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD    L   QLTVDLKPNLP E+ERI+ C+GRV +  +EP V RVW+P  D PGLAMAR
Sbjct  350   RDKDGSLTAVQLTVDLKPNLPAEAERIRKCRGRVFSLRDEPEVARVWLPNSDSPGLAMAR  409

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVPEI YR+++ +DEF+VLA+DG+WDVL+N EV+K VA+A   S AA
Sbjct  410   AFGDFCLKDFGLISVPEISYRRLTGKDEFIVLATDGIWDVLTNDEVVKIVASASSHSSAA  469

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  470   RSLVESAVRAWRTKYPTSKVDDCAVVCLFL  499



>ref|XP_004237585.1| PREDICTED: probable protein phosphatase 2C 33 [Solanum lycopersicum]
Length=645

 Score =   352 bits (902),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 224/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+F       FCGVFDGHGP GH VA+ +
Sbjct  218   GRLFLNGSSEAASLFTQQGKKGTNQDAMVVWENFASRTDTVFCGVFDGHGPHGHMVAKRV  277

Query  761   RDRLPSKLS-------------------------------VASKDNSQ---DFEKDIHHH  838
             RD LPSKLS                               +++ D+S+   D E+   H 
Sbjct  278   RDSLPSKLSAHWEVSLKSEDVLKEISLNAGASLYPEDASLISAADDSRVSIDVEETGKHP  337

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F +++K +D  L+    ID F SGTTAVTLIKQG+ L+IGN+GDSRAI+ T
Sbjct  338   EIFQTLKESFLKAYKVMDRELKSYTNIDCFCSGTTAVTLIKQGQDLVIGNVGDSRAILGT  397

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD    L   QLTVDLKPNLP E+ERI+ C+GRV +  +EP V RVW+P  D PGLAMAR
Sbjct  398   RDKDGSLTAVQLTVDLKPNLPAEAERIRKCRGRVFSLHDEPEVARVWLPNSDSPGLAMAR  457

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVPEI YR+++ +DEF+VLA+DG+WDVL+N EV+K VA+A  RS AA
Sbjct  458   AFGDFCLKDFGLISVPEISYRRLTGKDEFIVLATDGIWDVLTNDEVVKIVASASSRSSAA  517

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  518   RSLVESAVRAWRTKYPTSKVDDCAVVCLFL  547



>gb|AAV73837.1| protein phosphatase 2c [Medicago sativa]
Length=502

 Score =   347 bits (890),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 239/368 (65%), Gaps = 46/368 (13%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS F S+++QQGKKG NQDAM VWE+F   +   FCGVFDGHGP GH VA+ +R
Sbjct  56    RIFLNGSSEFASLFTQQGKKGTNQDAMVVWENFCSREDTIFCGVFDGHGPYGHMVAKRVR  115

Query  764   DRLPSKLSV------------------------------ASKDN----SQDFEKDIHHHP  841
             D LP KL+                               AS D     S D E+      
Sbjct  116   DSLPLKLNTQWELNVSGDDVLKEISINAAGSMILEDATFASADEESRVSIDAEEMEKLPE  175

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   K +F ++FK +D  L+  + ID F SGTTAVTL+KQG  LIIGN+GDSRA++ TR
Sbjct  176   IFHTLKESFLKAFKVMDRELKMHQTIDCFCSGTTAVTLVKQGRDLIIGNVGDSRAVLGTR  235

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             +  D LV  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMARA
Sbjct  236   EKDDSLVAVQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVCRVWLPNSDSPGLAMARA  295

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVPE+ YR+++E+DEFVV+A+DG+WDVLSN EV+  +A A +R+ AAR
Sbjct  296   FGDFCLKDFGLISVPEVSYRRLTEKDEFVVMATDGIWDVLSNKEVVDIIAAAPRRATAAR  355

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQA---------AGLNMSFP  1534
              +VE AVR W+ KYP SK DDCAVVCLF  +     + T S A         +G+ +S+ 
Sbjct  356   SLVETAVRAWRYKYPTSKVDDCAVVCLFLDKGMQK-ISTASHANKSKEHRPSSGIQVSY-  413

Query  1535  ETGRNEEN  1558
               G NEE+
Sbjct  414   -NGDNEED  420



>emb|CDY33350.1| BnaC05g12330D [Brassica napus]
Length=480

 Score =   346 bits (888),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 233/355 (66%), Gaps = 27/355 (8%)
 Frame = +2

Query  596   HGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLP  775
             +GSS    +Y+QQG KG NQDAM VWE+F        CGVFDGHGP GH VA+ +RD LP
Sbjct  59    NGSSELACLYTQQGSKGTNQDAMLVWENFCSRSDTVLCGVFDGHGPFGHMVAKRVRDMLP  118

Query  776   SKLSVASK-----------------DNSQDFEKD--IHHHPLFSKWKSTFPQSFKDIDNA  898
               LS   K                 D  Q  EK+  +    ++   K    ++ + +D  
Sbjct  119   FTLSTQLKKTLGMDSTSVINSATCIDEEQWCEKEDKLPLPEMYLPLKRALLKTCQQMDKE  178

Query  899   LEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNL  1078
             L+    I+ F SGTT+VT+IKQG+HL++GN+GDSRA++ TRDD + L+  QLT+DLKP+L
Sbjct  179   LKMHPTINCFCSGTTSVTVIKQGKHLVVGNIGDSRAVLATRDDDNALIAVQLTIDLKPDL  238

Query  1079  PVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFY  1258
             P ES RI+ CKGRV A  +EP V RVW+P  D PGLAMARAFGDFCLKDYG+ISVP+I Y
Sbjct  239   PSESARIQKCKGRVFALQDEPEVARVWLPNSDSPGLAMARAFGDFCLKDYGLISVPDINY  298

Query  1259  RKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKT  1438
             R+++ERD+F++LA+DGVWDVLSN E +  VA+A  R+ AAR +V  AVR W+ KYP SK 
Sbjct  299   RRLTERDQFIILATDGVWDVLSNKEAVDIVASAPSRNTAARALVCTAVRAWRLKYPTSKN  358

Query  1439  DDCAVVCLFFKRPKPM-LLKTMSQA-----AGLNMSFPETGRNEENSAIIAETDD  1585
             DDCAVVCLF +    M +L+T+  +       +N++  + G  +E +  +AETD+
Sbjct  359   DDCAVVCLFLEDSASMEVLETVVHSRKESIESVNITSSKDGEKKEEA--LAETDE  411



>ref|XP_010928162.1| PREDICTED: probable protein phosphatase 2C 66 [Elaeis guineensis]
Length=558

 Score =   349 bits (895),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 177/335 (53%), Positives = 222/335 (66%), Gaps = 31/335 (9%)
 Frame = +2

Query  572   DFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVA  751
             D   R+ L+G+S    +Y+QQGKKG NQDAM VWE+F       FCGVFDGHGP GH VA
Sbjct  100   DVPGRMFLNGTSEMACLYTQQGKKGTNQDAMIVWENFTSRSDTIFCGVFDGHGPFGHMVA  159

Query  752   QFIRDRLPSKLSVASKDN---------------SQDFEK--------------DIHHHP-  841
             + +RD LP KL    + N               S + E+              D +  P 
Sbjct  160   KKVRDCLPLKLCTEWRANVNGHNSPQQNGNLSRSMNSEESTFSGIDDEWGESIDENEKPP  219

Query  842   -LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              ++   K +F ++FK +D  L+    ID F SGTTAVT++KQG+ LIIGN+GDSRAI+ T
Sbjct  220   EIYIPLKQSFLKAFKLMDKELKLHSTIDCFCSGTTAVTVVKQGQDLIIGNVGDSRAILGT  279

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD+ D LV  QLTVDLKPNLP E+ RI+ CKGRV A  +EP V R+W+P  D PGLAMAR
Sbjct  280   RDEDDNLVAVQLTVDLKPNLPREAARIQQCKGRVFALLDEPEVARIWLPNNDSPGLAMAR  339

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKDYG+ISVP+I YR ++ +DEF+VLA+DGVWDVLSN E +  VA+A  R+ AA
Sbjct  340   AFGDFCLKDYGLISVPDISYRHLTSKDEFIVLATDGVWDVLSNKEAVDIVASAPTRASAA  399

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKP  1483
             R +V+ AVR W+ K+P SK DDCAVVCLF + P P
Sbjct  400   RALVDCAVRAWRLKFPTSKIDDCAVVCLFLEPPSP  434



>ref|XP_003624186.1| Protein phosphatase 2c [Medicago truncatula]
 gb|ABR24134.1| protein phosphatase 2c [Medicago truncatula]
 gb|AES80404.1| catalytic/protein phosphatase type 2C [Medicago truncatula]
Length=502

 Score =   347 bits (890),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 236/349 (68%), Gaps = 38/349 (11%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS+F S+++QQGKKG NQDAM VWE+F   +   FCGVFDGHGP GH VA+ +R
Sbjct  56    RIFLNGSSQFASLFTQQGKKGTNQDAMLVWENFCSREDTIFCGVFDGHGPYGHMVAKRVR  115

Query  764   DRLPSKLSV-------------------ASKDNSQDFE--------------KDIHHHP-  841
             D LP KL+                    A+  NS+D                +++   P 
Sbjct  116   DSLPLKLNTQWELNVSGDDVLKEISVNAAASMNSEDATFASADEESRVSIDTEEMEKLPE  175

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   K +F ++FK +D  L+  + ID F SGTTAVTL+KQG  LIIGN+GDSRA++ TR
Sbjct  176   IFHTLKESFLKAFKVMDRELKMHQTIDCFCSGTTAVTLVKQGRDLIIGNIGDSRAVLGTR  235

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             +  + LV  QLTVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMARA
Sbjct  236   EKDNSLVAVQLTVDLKPNLPAEAERIRKCKGRVFALHDEPEVCRVWLPNSDSPGLAMARA  295

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVPE+ YR+++E+DEFVV+A+DG+WDVLSN EV+  +A A +R+ AAR
Sbjct  296   FGDFCLKDFGLISVPEVSYRRLTEKDEFVVMATDGIWDVLSNKEVVDIIAAAPRRATAAR  355

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMS  1528
              +VE AVR W+ KYP SK DDCAVVCLF  +     ++ +S A+  N S
Sbjct  356   SLVETAVRAWRYKYPTSKVDDCAVVCLFLDKG----MQKISTASHANKS  400



>ref|XP_004159488.1| PREDICTED: probable protein phosphatase 2C 6-like [Cucumis sativus]
Length=523

 Score =   347 bits (891),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 184/375 (49%), Positives = 240/375 (64%), Gaps = 32/375 (9%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+  +GSSR   +Y+QQGKKGVNQDAM V E+F  ++   FCGVFDGHGP GH VA+ +R
Sbjct  78    RICSNGSSRIACLYTQQGKKGVNQDAMIVQENFSSKRDTVFCGVFDGHGPFGHMVAKKVR  137

Query  764   DRLP---------------SKLSVASKDNSQDF---------------EKDIHHHPLFSK  853
             D LP               SK   +   NS+D                E++     +F  
Sbjct  138   DTLPLILCTQWTSKSNEDQSKTRHSRSSNSEDSVALEGDEDSYKSLEGEENEKFPKMFLP  197

Query  854   WKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTD  1033
              K +  +SFK +D  L+  +KID F SG+TAVTLIKQG++LI+GN+GDSRA++ T D+ +
Sbjct  198   LKVSLLKSFKLMDKELKLHQKIDCFCSGSTAVTLIKQGQNLILGNVGDSRAVLATIDEDN  257

Query  1034  QLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDF  1213
              L+P QLTVDLKP+LP E+ RI+ CKGRV A  +EP V RVW+P  D PGLAMARAFGDF
Sbjct  258   SLIPIQLTVDLKPDLPGEAARIQQCKGRVFALQDEPEVARVWLPNNDSPGLAMARAFGDF  317

Query  1214  CLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVE  1393
             CLKD+G+ISVP+++YR ++ RD+FV+LA+DGVWDVLSN E I+ VA+A  R  AAR +V+
Sbjct  318   CLKDFGLISVPDVYYRHLTPRDQFVILATDGVWDVLSNKEAIEIVASAPSRETAARALVD  377

Query  1394  RAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEENSAIIA  1573
              AVR W+ KYP SK DDCAVVCLF +  +P + +     A      P T  N+    I  
Sbjct  378   CAVRAWRLKYPTSKNDDCAVVCLFLEY-EPDVDENTETCAMPVEEVPATPSNDAKD-IEV  435

Query  1574  ETDDGLDTLLNFKGT  1618
             + DD   T+    GT
Sbjct  436   DLDDCRTTVFEQSGT  450



>ref|XP_010111089.1| putative protein phosphatase 2C 33 [Morus notabilis]
 gb|EXC29951.1| putative protein phosphatase 2C 33 [Morus notabilis]
Length=482

 Score =   346 bits (888),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 224/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  55    GRMFLNGSSEVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVAKRV  114

Query  761   RDRLPSKLS-------------------VASKDNSQDFE--------------KDIHHHP  841
             RD LP KLS                    A   NS+D                 ++   P
Sbjct  115   RDSLPLKLSAHWEVNINGSDVLKEISLNTAGSMNSEDSALAFADEELRASIDIGEVEKRP  174

Query  842   -LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   + +F ++FK +D  L  +  ID F SGTTAVTL+KQG  ++IGN+GDSRA++ T
Sbjct  175   EIFQTLRESFLKAFKVMDRELRMQGSIDCFCSGTTAVTLVKQGRDIVIGNVGDSRAVLGT  234

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  + L+P QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMAR
Sbjct  235   RDKDNSLIPIQLTVDLKPNLPEEAERIRKCRGRVFALQDEPEVARVWLPNNDSPGLAMAR  294

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP+I  R+ISE+DEF+VLA+DG+WDVLSN EV+  VA+A  RS AA
Sbjct  295   AFGDFCLKDFGLISVPDISNRRISEKDEFIVLATDGIWDVLSNKEVVDIVASAPARSSAA  354

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AV++W+QKYP SK DDCAVVCLF 
Sbjct  355   RALVETAVQSWRQKYPTSKVDDCAVVCLFL  384



>ref|XP_009413563.1| PREDICTED: probable protein phosphatase 2C 33 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=496

 Score =   347 bits (889),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 223/332 (67%), Gaps = 29/332 (9%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S++SQQG+KG NQDAM VWE+FG      FCGVFDGHGP GH +A+ +
Sbjct  54    GRMFLNGSSGVASLFSQQGRKGPNQDAMIVWENFGSRNDTVFCGVFDGHGPHGHMIAKRV  113

Query  761   RDRLPSKL------------------SVASKDNSQ-----------DFEKDIHHHPLFSK  853
             RD LP KL                  S+ S  +S            DFE++  H  +   
Sbjct  114   RDVLPLKLNSNWEGEDCRETTVNNSGSINSDTSSTVSLKEENHTSIDFEENDEHSHILRT  173

Query  854   WKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTD  1033
              K  F ++F+ +D  L     ID F SGTTAVTL+KQG+ L+IGN+GDSRA++ TRD+ +
Sbjct  174   LKDPFLKAFRIMDKELRQHSDIDCFYSGTTAVTLVKQGQELVIGNVGDSRAVLGTRDENN  233

Query  1034  QLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDF  1213
              L+  QLTVDLKPNLP E+ERI+ CKGRV A  +EP+V RVW+P  D PGLAMARA GDF
Sbjct  234   SLIAVQLTVDLKPNLPREAERIRQCKGRVFALRDEPDVARVWLPNSDTPGLAMARALGDF  293

Query  1214  CLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVE  1393
             CLKDYG+ISVPEI Y  I+ERDEF+++A+DGVWDVLSN EV+  VA+A  RS AA L+VE
Sbjct  294   CLKDYGLISVPEISYWHITERDEFIIMATDGVWDVLSNEEVVDIVASAPARSSAAHLLVE  353

Query  1394  RAVRTWKQKYPCSKTDDCAVVCLFFKRPKPML  1489
              AV+ W+ K+P S+ DDCAVVCLF     P +
Sbjct  354   SAVKAWRFKFPTSRVDDCAVVCLFLDLDAPNI  385



>ref|XP_010908969.1| PREDICTED: probable protein phosphatase 2C 33 [Elaeis guineensis]
Length=494

 Score =   346 bits (888),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 180/330 (55%), Positives = 225/330 (68%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+G+S   S+++Q+GKKG+NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  57    GRMFLNGASSVASLFTQKGKKGLNQDAMIVWENFGSRTDTVFCGVFDGHGPYGHMVARRV  116

Query  761   RDRLPSKLS------VASKD-------------NSQ---------------DFEKDIHHH  838
             RD LP KLS      V S D             NS+               D E+   H 
Sbjct  117   RDSLPLKLSALWEVNVGSDDCRESTIISHSASMNSEETSSICLDEEPGVSTDIEEKDKHP  176

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F+  K +F ++FK +D  L+    ID F SGTTAVTL+KQG+ L+IGN+GDSRA++ T
Sbjct  177   EIFTTLKESFLKAFKVMDKELKLHTNIDCFCSGTTAVTLVKQGQDLVIGNVGDSRAVLGT  236

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D L+  QLTVDLKPNLP E+ERI+ C+GRV A   EP V RVW+P  D PGLAMAR
Sbjct  237   RDQNDCLIAVQLTVDLKPNLPREAERIRKCRGRVFALQSEPEVARVWLPNNDSPGLAMAR  296

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVPEI Y +I+++DEF+VLA+DGVWDVLSN EV+  V++A  RS AA
Sbjct  297   AFGDFCLKDFGLISVPEISYLRITKKDEFIVLATDGVWDVLSNKEVVDIVSSAPARSSAA  356

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AV+ W+ KYP SK DDCAVVCLF 
Sbjct  357   RSLVESAVQAWRLKYPTSKIDDCAVVCLFL  386



>ref|XP_009371152.1| PREDICTED: probable protein phosphatase 2C 33 [Pyrus x bretschneideri]
 ref|XP_009371153.1| PREDICTED: probable protein phosphatase 2C 33 [Pyrus x bretschneideri]
Length=407

 Score =   343 bits (880),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 218/308 (71%), Gaps = 17/308 (6%)
 Frame = +2

Query  593   LHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRL  772
             L+GSS F S++S+QGKKGVNQDAM  WE+FG     F CGVFDGHGP GH VA+ +RD L
Sbjct  73    LNGSSDFTSLFSKQGKKGVNQDAMIAWENFGSADTTF-CGVFDGHGPFGHVVAKKVRDAL  131

Query  773   PSKLSV-------ASKDNSQDFEKDIHHHP--------LFSKWKSTFPQSFKDIDNALEG  907
             P +L+        AS   + D  + + +H         LF   K +F ++FK +D  L+ 
Sbjct  132   PLRLTSQWVLNGNASNGPADDSSEAVAYHEGKDEERCDLFMTLKDSFLKAFKVMDKELKL  191

Query  908   EEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVE  1087
               +ID + SGTTAVTL+KQG+ L+I N+GDSRA++ TRD    LV  QLTVDLKPNLP E
Sbjct  192   HPRIDCYCSGTTAVTLVKQGQDLVIANVGDSRAVLGTRDKDGSLVAVQLTVDLKPNLPRE  251

Query  1088  SERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKI  1267
             +ERI+ CKGRV A   EP + RVW+P  + PGLAMARAFGDFCLKD+G+ISVP++ YR++
Sbjct  252   AERIRLCKGRVFALQNEPEIARVWLPNCNSPGLAMARAFGDFCLKDFGLISVPDLSYRRL  311

Query  1268  SERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDC  1447
             +E+DEFVVLA+DG+WDVLSN EV+  VA A + S AAR +VE A R W+ KYP +K DDC
Sbjct  312   TEKDEFVVLATDGIWDVLSNEEVVDIVALAPRPS-AARALVESATRAWRIKYPYAKVDDC  370

Query  1448  AVVCLFFK  1471
             AVVCLF  
Sbjct  371   AVVCLFLN  378



>ref|XP_009147325.1| PREDICTED: probable protein phosphatase 2C 33 [Brassica rapa]
Length=458

 Score =   345 bits (884),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 176/336 (52%), Positives = 226/336 (67%), Gaps = 24/336 (7%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+G+S    +++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +R
Sbjct  55    RMYLNGASEAACIFTQQGKKGPNQDAMVVWENFGSRTDTVFCGVFDGHGPYGHMVAKRVR  114

Query  764   DRLPSKLSV------------------------ASKDNSQDFEKDIHHHPLFSKWKSTFP  871
             D LP KLS                         A ++ S +   +     LF   K  F 
Sbjct  115   DNLPLKLSAYWEAIVPINSASNINNSEDASFVSAEEEPSANNNSEESQSDLFQTLKDAFL  174

Query  872   QSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQ  1051
             ++FK +D  L+  + +D F SGTTAVTLIKQGE+L++GN+GDSRA+M TR+  + LV  Q
Sbjct  175   KAFKVMDRELKFHKSVDCFCSGTTAVTLIKQGEYLVVGNVGDSRAVMGTRNGENALVAVQ  234

Query  1052  LTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYG  1231
             LTVDLKPNLP E+ERIK C+GRV A  +EP V RVW+P  D PGLAMARAFGDFCLKD+G
Sbjct  235   LTVDLKPNLPAEAERIKKCRGRVFALRDEPEVCRVWLPNCDSPGLAMARAFGDFCLKDFG  294

Query  1232  VISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTW  1411
             +ISVP++ +R+++E+DEF+VLASDG+WDVLSN EV+  VA+A  RS AAR +VE AVR W
Sbjct  295   LISVPDVSFRRLTEQDEFIVLASDGIWDVLSNEEVVAIVASAPSRSSAARALVESAVRAW  354

Query  1412  KQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGL  1519
             + KYP SK DDCA VCL+       ++ + S  + L
Sbjct  355   RYKYPTSKVDDCAAVCLYLHSNDTNVISSASSISKL  390



>ref|XP_010529005.1| PREDICTED: probable protein phosphatase 2C 74 [Tarenaya hassleriana]
Length=583

 Score =   349 bits (895),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 182/373 (49%), Positives = 243/373 (65%), Gaps = 35/373 (9%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GS     ++SQQGKKG+NQDAM  WE+FG      FCGVFDGHGP GH VA+ +
Sbjct  183   GRMFLNGSMDAACLFSQQGKKGLNQDAMIFWENFGSIPDTVFCGVFDGHGPYGHIVAKRV  242

Query  761   RDRLPS-------------------KLSVASKDNSQDFE---------KDIHHHP-LFSK  853
             RD LP                     L+ A   NS+D           +D+   P +   
Sbjct  243   RDLLPLKLSSLLEAYVSLEDVLKEINLNTADSKNSEDLAGGGENRVSIQDLEKCPDMLQS  302

Query  854   WKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTD  1033
              K+T  ++FK +D  L+ +  +D F SGTTAVTL+KQG+HL++GN+GDSRA++  R+D +
Sbjct  303   LKATLLKAFKFMDRELKMQRDVDCFCSGTTAVTLVKQGQHLVVGNIGDSRAVLGMRNDDN  362

Query  1034  QLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDF  1213
              LV  QLTVDLKP++P E+ERI+ C+GRV A  +EP V R+W+P  + PGLAMARAFGDF
Sbjct  363   TLVAIQLTVDLKPDVPAEAERIRKCRGRVFAHEDEPGVARLWLPNHNSPGLAMARAFGDF  422

Query  1214  CLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVE  1393
             CLKD+G+ISVPE+ +R ++E+DEFVVLA+DG+WD LSN EV++ VA A  RS A R VVE
Sbjct  423   CLKDFGLISVPEVSHRHLTEKDEFVVLATDGIWDALSNEEVVEIVAAAPTRSSAGRAVVE  482

Query  1394  RAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAA---GLNMSFPETGRNEENSA  1564
              AVRTWK K+P SK DDCAVVCLF    +P  L T S ++    +N    E+G+N++   
Sbjct  483   AAVRTWKWKFPTSKVDDCAVVCLFLD-SEPNKLSTASSSSDDKDINKGGSESGKNDKEVV  541

Query  1565  IIAETDDGLDTLL  1603
                E++   +TLL
Sbjct  542   TSEESEQ--ETLL  552



>emb|CDY28706.1| BnaCnng05920D [Brassica napus]
Length=530

 Score =   347 bits (890),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 180/338 (53%), Positives = 228/338 (67%), Gaps = 26/338 (8%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+G+S    +++QQGKKG NQDAM VWE FG      FCGVFDGHGP GH VA+ +R
Sbjct  141   RMYLNGASEAACIFTQQGKKGPNQDAMVVWESFGSMTDTVFCGVFDGHGPYGHMVAKRVR  200

Query  764   DRLPSKLSV-----------ASKDNSQD---------------FEKDIHHHPLFSKWKST  865
             D LP KLS            ++ +NS+D                EK+     LF   K  
Sbjct  201   DNLPLKLSAYWEAKVPINSASTINNSEDASFVSAEEEPSPSVDIEKEESQSELFQTLKDA  260

Query  866   FPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVP  1045
             F ++FK +D  L+  + +D F SGTTAVTLIKQGE+L++GN+GDSRA+M TR+  + LV 
Sbjct  261   FLKAFKVMDRELKFHKSVDCFCSGTTAVTLIKQGEYLVVGNVGDSRAVMGTRNGENALVA  320

Query  1046  EQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKD  1225
              QLTVDLKPNLP E ERIK C+GRV A  +EP V RVW+P  D PGLAMARAFGDFCLKD
Sbjct  321   VQLTVDLKPNLPAEEERIKKCRGRVFALRDEPEVCRVWLPNCDSPGLAMARAFGDFCLKD  380

Query  1226  YGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVR  1405
             +G+ISVP++ +R+++E+DEF+VLASDG+WDVLSN EV+  VA+A  RS AAR +VE AVR
Sbjct  381   FGLISVPDVSFRRLTEQDEFIVLASDGIWDVLSNEEVVAIVASAPSRSSAARALVESAVR  440

Query  1406  TWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGL  1519
              W+ KYP SK DDCA VCL+       L+ + S  + L
Sbjct  441   AWRYKYPTSKVDDCAAVCLYLHSNDTNLISSASSISKL  478



>ref|XP_009379076.1| PREDICTED: probable protein phosphatase 2C 6 [Pyrus x bretschneideri]
Length=542

 Score =   347 bits (890),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 223/345 (65%), Gaps = 40/345 (12%)
 Frame = +2

Query  560   VGRGDFGARVRL------HGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFD  721
              G GD G ++ +      +G S+   +Y+QQGKKG NQDAM VWE+F       FCGVFD
Sbjct  50    AGCGDLGHQIGIPGRLIGNGGSKVACLYTQQGKKGTNQDAMLVWENFATRSDTTFCGVFD  109

Query  722   GHGPSGHRVAQFIRDRLP---------------SKLSVASKDNSQDFEKDIHHHPLFSKW  856
             GHGP GH VA+ +RD LP               S L+ A   N     ++     +  +W
Sbjct  110   GHGPFGHVVAKKVRDSLPLILCTQWKADSNSDLSNLNKAENANGSSNLEEPASPSIDDEW  169

Query  857   -------------------KSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLI  979
                                K +F ++FK +D  L+    ID F SGTTAVTLIKQG++L+
Sbjct  170   CESLEVRENEKLPDMYLPLKKSFLKAFKLMDKELKLHPTIDCFCSGTTAVTLIKQGQNLV  229

Query  980   IGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVW  1159
             IGN+GDSRA++ TRD  + L+  QLTVDLKP+LP ES RI+ CKGRV A  +EP V RVW
Sbjct  230   IGNVGDSRAVLATRDQDNSLIAVQLTVDLKPDLPAESARIQQCKGRVFALQDEPEVARVW  289

Query  1160  MPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVI  1339
             +P  D PGLAMARAFGDFCLKD+G+ISVP++FYR ++ERDEF++LA+DGVWDVLSN E +
Sbjct  290   LPNNDSPGLAMARAFGDFCLKDFGLISVPDVFYRHLTERDEFIILATDGVWDVLSNKEAV  349

Query  1340  KTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKR  1474
             + VA+A   + AAR +V+ AVR W+ KYP SK DDCAVVCLF ++
Sbjct  350   EIVASAPGHTTAARALVDCAVRAWRLKYPTSKNDDCAVVCLFLEK  394



>gb|EMS48353.1| putative protein phosphatase 2C 73 [Triticum urartu]
Length=477

 Score =   345 bits (884),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/307 (53%), Positives = 216/307 (70%), Gaps = 21/307 (7%)
 Frame = +2

Query  614   VSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIRDRLPSKLSVA  793
             VSM+++QG KGVNQDAM   + F G KG  FCGVFDGHGP G  VA+ +RD LP KLS +
Sbjct  39    VSMHTKQGWKGVNQDAMAACQDFAGHKGQIFCGVFDGHGPLGRDVARHVRDSLPKKLSAS  98

Query  794   SKDNSQD-------------FEKD--------IHHHPLFSKWKSTFPQSFKDIDNALEGE  910
                +++D             F+K            + L S WKS   ++F+D+D  L   
Sbjct  99    LAPSTEDDAPSSNSNADVDSFDKSDCTSSSDASDENQLLSSWKSLIVKAFEDVDEELRQH  158

Query  911   EKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVES  1090
               ID   SGTTAVT+++QG+HLII NLGDSRA++CTRD   + V  Q+T DLKP+LP E+
Sbjct  159   SGIDCLCSGTTAVTVVRQGDHLIIANLGDSRAVLCTRDSKGRPVSVQITTDLKPDLPGEA  218

Query  1091  ERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFYRKIS  1270
             ERI  CKGR+ A  +EP+V R+W+P+QD PGLAMARAFGDFCLK++G+I  PE++YRK+S
Sbjct  219   ERILICKGRIFAMDDEPDVPRLWLPDQDAPGLAMARAFGDFCLKNHGLICTPEVYYRKLS  278

Query  1271  ERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCA  1450
             E+D+F+VLA+DG+WDVLSN EV+K V++   RS AA+ +V+RAVR W++K+P S  DDCA
Sbjct  279   EKDDFLVLATDGIWDVLSNKEVVKIVSSVSDRSKAAKQLVDRAVRAWRRKFPTSMVDDCA  338

Query  1451  VVCLFFK  1471
              VCLF K
Sbjct  339   AVCLFLK  345



>ref|XP_008384641.1| PREDICTED: probable protein phosphatase 2C 6 [Malus domestica]
Length=545

 Score =   347 bits (890),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 219/333 (66%), Gaps = 34/333 (10%)
 Frame = +2

Query  572   DFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVA  751
             D   R+  +GSS+   +Y+QQGKKG NQDAM VWE+F       FCGVFDGHGP GH VA
Sbjct  61    DIPGRLIGNGSSKVACLYTQQGKKGTNQDAMLVWENFATRSDTTFCGVFDGHGPFGHMVA  120

Query  752   QFIRDRLPSKLSVASKDNSQ----------------DFE-----------------KDIH  832
             + +RD LP  L    K NS                 +FE                 K+  
Sbjct  121   KKVRDSLPLILCTQWKANSSGDLSNLNKAENANGRSNFEEPVSPSIDDEWCESLEVKESE  180

Query  833   HHP-LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAI  1009
               P ++   K +F ++FK +D  L+    ID F SGTTAVTL+KQG++L+IGN+GDSRA+
Sbjct  181   KLPEMYLPQKKSFLKAFKLMDKELKLHPTIDCFCSGTTAVTLVKQGQNLVIGNVGDSRAV  240

Query  1010  MCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLA  1189
             + TRDD + L+  QLTVDLKP+LP ES RI  CKGRV A  +EP V RVW+P  D PGLA
Sbjct  241   LATRDDDNSLIAVQLTVDLKPDLPAESARIHQCKGRVFALQDEPEVARVWLPNNDSPGLA  300

Query  1190  MARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRS  1369
             MARAFGDFCLKD+G+ISVP++ YR ++ERDEF++LA+DGVWDVLSN E ++ VA+A   +
Sbjct  301   MARAFGDFCLKDFGLISVPDVCYRHLTERDEFIILATDGVWDVLSNKEAVEIVASAPGXT  360

Query  1370  MAARLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              AAR +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  361   TAARALVECAVRAWRLKYPTSKNDDCAVVCLFL  393



>ref|XP_009609263.1| PREDICTED: probable protein phosphatase 2C 33, partial [Nicotiana 
tomentosiformis]
Length=529

 Score =   346 bits (888),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 236/370 (64%), Gaps = 40/370 (11%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  94    GRLFLNGSSDVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPHGHMVAKRV  153

Query  761   RDRLPSKLSVASKDN--SQDFEKDIHHHP-------------------------------  841
             RD LP KLS   + N  S+D  K+I  +                                
Sbjct  154   RDSLPLKLSAHWEVNLKSEDVLKEISLNAGASLNSEDASLISAAEESRVSIDVEEAEKQP  213

Query  842   -LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F +++K +D  L     ID F SGTTAVT +KQG+ L+IGN+GDSRA++ T
Sbjct  214   EVFQTLKESFLKAYKVMDRELRSYTNIDCFCSGTTAVTFVKQGQDLVIGNVGDSRAVLGT  273

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD +  L   QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMAR
Sbjct  274   RDKSGSLTAVQLTVDLKPNLPAEAERIRKCRGRVFALRDEPEVARVWLPNSDSPGLAMAR  333

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVPEI YR+++ +DEF+VLA+DG+WDVLSN EV+K +A+    S AA
Sbjct  334   AFGDFCLKDFGLISVPEISYRRLTGKDEFIVLATDGIWDVLSNDEVVKIIASTSSHSSAA  393

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEEN  1558
             R +VE AVR W+ KYP SK DDCAVVCLF           +S A+  N ++ +   + E 
Sbjct  394   RSLVEAAVRAWRTKYPTSKVDDCAVVCLFLDSNS----NNLSTAS--NTNYNDETVSMEA  447

Query  1559  SAIIAETDDG  1588
             + + A+TDD 
Sbjct  448   NEVGAKTDDA  457



>ref|XP_003539901.1| PREDICTED: probable protein phosphatase 2C 52-like isoform X1 
[Glycine max]
 ref|XP_006592417.1| PREDICTED: probable protein phosphatase 2C 52-like isoform X2 
[Glycine max]
Length=471

 Score =   344 bits (883),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 219/315 (70%), Gaps = 21/315 (7%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+  +G SR   +++QQG+KG+NQDAM VWE F  E    FCGVFDGHGP GH VA+ +R
Sbjct  57    RIFTNGKSRSSCIFTQQGRKGINQDAMIVWEDFMSED-TIFCGVFDGHGPHGHLVARKVR  115

Query  764   DRLPSKL-----SVASKDN--------------SQDFEKDIH-HHPLFSKWKSTFPQSFK  883
             D LP+KL     S  SK N              S D EKD      L S W+  F +++K
Sbjct  116   DALPTKLVSSLHSNESKRNGSGKTCFKGNVKPDSGDSEKDCSAEDKLNSTWREAFMKAYK  175

Query  884   DIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVD  1063
              +D  L     +D F SG+TAVT++KQG +L +G +GDSRAIM ++D  D +V  QLTVD
Sbjct  176   AMDKELRSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAIMGSKDSNDSIVAIQLTVD  235

Query  1064  LKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISV  1243
             LKP+LP E+ERIK CKGRV A  +EP V RVW+P  D PGLAMARAFGDFCLK+YGVIS+
Sbjct  236   LKPDLPREAERIKKCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISI  295

Query  1244  PEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKY  1423
             PE  +R++++RD+F++LASDGVWDVLSN EV++ V++A  RS AAR++V+ A R WK KY
Sbjct  296   PEFSHRQLTDRDQFIILASDGVWDVLSNEEVVEIVSSAPTRSSAARILVDSAAREWKLKY  355

Query  1424  PCSKTDDCAVVCLFF  1468
             P SK DDCAVVCLF 
Sbjct  356   PTSKMDDCAVVCLFL  370



>ref|XP_007023520.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007023521.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007023523.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY26142.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY26143.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY26145.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=516

 Score =   345 bits (886),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 215/333 (65%), Gaps = 34/333 (10%)
 Frame = +2

Query  575   FGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQ  754
                R+ L+G+S    +Y+QQGKKG NQDAM VWE+F       FCGVFDGHGP GH VA+
Sbjct  66    ISGRMFLNGASNVACLYTQQGKKGTNQDAMLVWENFCSRSDTMFCGVFDGHGPYGHMVAK  125

Query  755   FIRDRLPSKLSVASKDN----------------------------------SQDFEKDIH  832
               RD LP  L    KD+                                  S + E++  
Sbjct  126   KARDSLPIILCTQWKDSLAGDWSSLNKSENAPDNTIPEDTASLSMDDECCESLEIEENEQ  185

Query  833   HHPLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIM  1012
                ++   K +  ++FK +D  L+    ID F SGTTAVTL+KQG+HLIIGN+GDSRA++
Sbjct  186   LPEMYLPLKRSMLKAFKLMDKELKLHPTIDCFCSGTTAVTLVKQGQHLIIGNVGDSRAVL  245

Query  1013  CTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAM  1192
               RD  + L+  QLTVDLKP+LP E+ RI+ CKGRV A  +EP V RVW+P  D PGLAM
Sbjct  246   AARDKDNSLIAIQLTVDLKPDLPREAARIQQCKGRVFALQDEPEVARVWLPNNDSPGLAM  305

Query  1193  ARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSM  1372
             ARAFGDFCLKD+G+ISVP++FYR ++ERDEF++LA+DGVWDVLSN E +  VA+A  RS 
Sbjct  306   ARAFGDFCLKDFGLISVPDVFYRCLTERDEFIILATDGVWDVLSNKEAVDIVASAPSRST  365

Query  1373  AARLVVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             AAR +V+ A R W+ KYP SK DDCAVVCLF +
Sbjct  366   AARALVDCATRAWRLKYPTSKNDDCAVVCLFLE  398



>ref|XP_004492843.1| PREDICTED: probable protein phosphatase 2C 33-like [Cicer arietinum]
Length=506

 Score =   345 bits (885),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/329 (53%), Positives = 224/329 (68%), Gaps = 34/329 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS+F S+++QQGKKG NQDAM VWE+F   +   FCGVFDGHGP GH VA+ +R
Sbjct  61    RIFLNGSSQFASLFTQQGKKGTNQDAMVVWENFCSREDTIFCGVFDGHGPYGHMVAKKVR  120

Query  764   DRLPSKL-----------------------SVASKDN-----------SQDFEKDIHHHP  841
             D LP KL                       S+ S+D            S D E+      
Sbjct  121   DSLPLKLNAHWELNVSGEEVLKEISINTAGSMNSEDTAFISADEESRVSFDAEETEKLPE  180

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             +F   K +F ++FK +D  L+  + ID F SGTTAVTLIKQG  L+IGN+GDSRA++ TR
Sbjct  181   IFQTLKESFLKAFKVMDRDLKTHQTIDCFCSGTTAVTLIKQGRDLVIGNVGDSRAVLGTR  240

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             D  + LV  QLTVDLKPNLP E+ERI+ CKGRV +  +EP V RVW+P  D PGLAMARA
Sbjct  241   DKDNSLVAVQLTVDLKPNLPAEAERIRKCKGRVFSLQDEPEVARVWLPNNDSPGLAMARA  300

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVPE+ YR+++ +DEF+VLA+DG+WDVLSN EV+  ++ A +R+ AAR
Sbjct  301   FGDFCLKDFGLISVPEVSYRRLTGKDEFIVLATDGIWDVLSNKEVVDIISAAPRRATAAR  360

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
              +VE AVR W+ KYP SK DDCAV+CLF 
Sbjct  361   SLVESAVRAWRYKYPTSKVDDCAVICLFL  389



>ref|XP_008337529.1| PREDICTED: probable protein phosphatase 2C 33 [Malus domestica]
 ref|XP_008337531.1| PREDICTED: probable protein phosphatase 2C 33 [Malus domestica]
Length=407

 Score =   342 bits (876),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 226/338 (67%), Gaps = 22/338 (7%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+GSS F S++S+QGKKGVNQDAM  WE+FG     F CGVFDGHGP GH VA+ +R
Sbjct  70    RMFLNGSSDFTSLFSKQGKKGVNQDAMIAWENFGSADTTF-CGVFDGHGPFGHMVAKKVR  128

Query  764   DRLPSKLSV----------ASKDNSQDFE-----KDIHHHPLFSKWKSTFPQSFKDIDNA  898
             D LP +L+              D+S +       KD      F   K +F ++FK +D  
Sbjct  129   DALPLRLTSQWVLNGNATNGPADDSSEAAACHEGKDEERCDFFMTLKDSFLKAFKVMDKE  188

Query  899   LEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDLKPNL  1078
             L+   +ID + SGTTAVTL+KQG+ L+I N+GDSRA++ TRD    LV  QLTVDLKPNL
Sbjct  189   LKLHPRIDCYCSGTTAVTLVKQGQDLVIANVGDSRAVLGTRDKDGSLVAVQLTVDLKPNL  248

Query  1079  PVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVPEIFY  1258
             P E+ERI+ CKGRV A   EP + RVW+P  + PGLAMARAFGDFCLKD+G+ISVP+I Y
Sbjct  249   PREAERIRLCKGRVFALQNEPEIARVWLPNCNSPGLAMARAFGDFCLKDFGLISVPDISY  308

Query  1259  RKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYPCSKT  1438
             R+++E+DEFVVLA+DG+WDVL+N EV+  VA A + S AAR +VE A R W+ KYP +K 
Sbjct  309   RRLTEKDEFVVLATDGIWDVLTNEEVVDIVALAPRPS-AARTLVESATRAWRLKYPYAKV  367

Query  1439  DDCAVVCLFFKRPKPMLLKTMS-----QAAGLNMSFPE  1537
             DDCAVVCLF            S      ++G ++ +PE
Sbjct  368   DDCAVVCLFLNSSTSNTTSHFSPTGEEMSSGKSLQYPE  405



>ref|XP_007132652.1| hypothetical protein PHAVU_011G113300g [Phaseolus vulgaris]
 gb|ESW04646.1| hypothetical protein PHAVU_011G113300g [Phaseolus vulgaris]
Length=468

 Score =   343 bits (881),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 220/316 (70%), Gaps = 21/316 (7%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
             +R+  +G SR   +++QQG+KG+NQDAM VWE F  E    FCGVFDGHGP GH VA+ +
Sbjct  56    SRIFSNGKSRGSCIFTQQGRKGINQDAMIVWEDFMSED-MIFCGVFDGHGPHGHLVARKV  114

Query  761   RDRLPSKL-----SVASK--------------DNSQDFEKDIH-HHPLFSKWKSTFPQSF  880
             RD LP KL     S  SK               +S +FEKD      + S W+  F +S+
Sbjct  115   RDALPVKLLSFLHSSESKRSGSGKTCFKGNVKPDSVEFEKDCSTEDKMNSMWREAFMKSY  174

Query  881   KDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTV  1060
             K +D  L     +D F SG+TAVT++KQG +L +G +GDSRAIM ++D  D +V  QLTV
Sbjct  175   KAMDKELRSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAIQLTV  234

Query  1061  DLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVIS  1240
             DLKP+LP E+ERIK CKGRV A  +EP V RVW+P  D PGLAMARAFGDFCLKDYGVIS
Sbjct  235   DLKPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKDYGVIS  294

Query  1241  VPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQK  1420
             +PE  +R++++RD+F+VLASDGVWDVLSN EV++ V++A  RS AAR++V+ A R WK K
Sbjct  295   IPEFSHRQLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRSSAARILVDSAAREWKLK  354

Query  1421  YPCSKTDDCAVVCLFF  1468
             YP SK DDCAVVCLF 
Sbjct  355   YPTSKMDDCAVVCLFL  370



>ref|XP_010913240.1| PREDICTED: probable protein phosphatase 2C 66 [Elaeis guineensis]
Length=541

 Score =   346 bits (888),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/331 (53%), Positives = 222/331 (67%), Gaps = 31/331 (9%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+G+S    +++QQGKKG NQDAM VWE+F       FCGVFDGHGP GH VA+ +R
Sbjct  85    RMILNGASEVACLHTQQGKKGTNQDAMIVWENFTLRSDTIFCGVFDGHGPFGHMVARKVR  144

Query  764   DRLPSKL------------------SVASKDNSQD-------------FEKDIHHHPLFS  850
             D LP KL                  S++   NS++              ++D      + 
Sbjct  145   DSLPLKLCTEWRANVSGHDSPRQNGSLSGSMNSEETASISIDDDWGESIDEDEKIPENYI  204

Query  851   KWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDT  1030
               K +F ++FK +D  L+    ID F SGTTAVT++KQG+ LIIGN+GDSRAI+ TRD  
Sbjct  205   PLKQSFLKAFKLMDKELKLHPIIDCFCSGTTAVTVVKQGQDLIIGNVGDSRAILGTRDKD  264

Query  1031  DQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGD  1210
             + LV  QLTVDLKPNLP E+ RI+ C+GRV A  +EP V RVW+P  D PGLAMARAFGD
Sbjct  265   NNLVAVQLTVDLKPNLPREAARIQQCRGRVFALQDEPEVARVWLPNNDSPGLAMARAFGD  324

Query  1211  FCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVV  1390
             FCLKDYG+ISVP+I YR ++E+DEF+VLA+DGVWDVLSN EV+  VA+A   + AAR +V
Sbjct  325   FCLKDYGLISVPDISYRHLTEKDEFIVLATDGVWDVLSNKEVVDIVASAPTHATAARALV  384

Query  1391  ERAVRTWKQKYPCSKTDDCAVVCLFFKRPKP  1483
             + AVR W+ K+P SK DDCAVVCLFF+ P P
Sbjct  385   DCAVRAWRLKFPTSKIDDCAVVCLFFEAPSP  415



>ref|XP_009106686.1| PREDICTED: probable protein phosphatase 2C 18 [Brassica rapa]
Length=487

 Score =   344 bits (883),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 173/341 (51%), Positives = 220/341 (65%), Gaps = 36/341 (11%)
 Frame = +2

Query  557   IVGRGDFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPS  736
             + G  +   R+  +GSS    +Y+QQGKKG NQDAM V+E+F    G  FCGVFDGHGP 
Sbjct  44    VEGVQEVSGRLISNGSSEIACLYTQQGKKGTNQDAMLVFENFCSRDGTVFCGVFDGHGPF  103

Query  737   GHRVAQFIRDRLPSKLSVASKDNSQDFE--------------------------------  820
             GH VA+ +RD LPS LS   K  S+  +                                
Sbjct  104   GHMVAKKVRDTLPSTLSTQLKLTSESDQNGLVNEKGTEEDEEEAQRSECVTTMDEQWCEL  163

Query  821   ---KDIHHHP-LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGN  988
                ++I   P ++   K    +S + ID  L+    ID F SGTT+VTLIKQGE L++GN
Sbjct  164   NPNENIDALPEMYLPLKHALLKSCQQIDKDLKMHPTIDCFCSGTTSVTLIKQGEDLVVGN  223

Query  989   LGDSRAIMCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPE  1168
             +GDSRA++ TRD  + LV  QLT+DLKP+LP ES RI+ CKGRV A  +EP V RVW+P 
Sbjct  224   IGDSRAVLATRDLDNALVAVQLTIDLKPDLPSESARIQKCKGRVFALQDEPEVARVWLPN  283

Query  1169  QDCPGLAMARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTV  1348
              D PGLAMARAFGDFCLKDYG+ISVP+I YR+++ERD+F++LASDGVWDVLSN E +  +
Sbjct  284   SDSPGLAMARAFGDFCLKDYGLISVPDINYRRLTERDQFIILASDGVWDVLSNKEAVDII  343

Query  1349  ATAKKRSMAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             A+A  RS AAR +V+ AVR+W+ KYP SK DDC VVCLF +
Sbjct  344   ASAPSRSTAARALVDTAVRSWRIKYPTSKNDDCTVVCLFLQ  384



>ref|XP_011039750.1| PREDICTED: probable protein phosphatase 2C 52 [Populus euphratica]
Length=474

 Score =   343 bits (881),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 233/357 (65%), Gaps = 29/357 (8%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             RV  +G SR   +++QQG+KG+NQDAM VWE F  E  A FCGVFDGHGP GH VA+ +R
Sbjct  56    RVFTNGKSRTSCIFTQQGRKGINQDAMIVWEDFMSED-ATFCGVFDGHGPHGHLVARKVR  114

Query  764   DRLPSKL-----SVASKDNSQD---------------FEKDIH-HHPLFSKWKSTFPQSF  880
             D LP KL     S  S+ N  D                +KD      L S W+  F +S+
Sbjct  115   DALPVKLQSFLNSCQSRQNGSDQACFKGNLMKSDVGDLDKDGSVEDKLNSLWREAFLKSY  174

Query  881   KDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTV  1060
             K +D  L+    +D F SG+TA+T++KQG +L +G +GDSRAIM ++D  D +V  QLTV
Sbjct  175   KAMDKELKSHPNLDCFCSGSTAITIVKQGSNLFMGYIGDSRAIMGSKDSNDSMVAVQLTV  234

Query  1061  DLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVIS  1240
             DLKP+LP E+ERIK CKGRV A  +EP V RVW+P  D PGLAMARAFGDFCLK+YGVIS
Sbjct  235   DLKPDLPREAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVIS  294

Query  1241  VPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQK  1420
             +PE  +R ++ERD+F+VLASDGVWDVLSN EV++ V++A  R+ AAR++V+ A R WK K
Sbjct  295   IPEFSHRTLTERDQFIVLASDGVWDVLSNEEVVEIVSSAPTRASAARILVDSAAREWKLK  354

Query  1421  YPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEEN-SAIIAETDDG  1588
             YP SK DDCAVVCLF         K  S++      F     ++ N S   AE+DDG
Sbjct  355   YPTSKMDDCAVVCLFLDG------KMDSESDYDEQGFSSATLDQSNHSGNAAESDDG  405



>ref|XP_004147974.1| PREDICTED: probable protein phosphatase 2C 6-like [Cucumis sativus]
 gb|KGN55960.1| hypothetical protein Csa_3G039310 [Cucumis sativus]
Length=523

 Score =   345 bits (886),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/375 (49%), Positives = 239/375 (64%), Gaps = 32/375 (9%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+  +GSSR   +Y+QQGKKGVNQDAM V E+F  ++   FCGVFDGHGP GH VA+ +R
Sbjct  78    RICSNGSSRIACLYTQQGKKGVNQDAMIVQENFSSKRDTVFCGVFDGHGPFGHMVAKKVR  137

Query  764   DRLP---------------SKLSVASKDNSQDF---------------EKDIHHHPLFSK  853
             D LP               SK   +   NS+D                E++     +F  
Sbjct  138   DTLPLILCTQWTSKSNEDQSKTRHSRSSNSEDSVALEGDEDSYKSLEGEENEKFPKMFLP  197

Query  854   WKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTD  1033
              K +  +SFK +D  L+  +KID F SG+TAVTLIKQG++LI+GN+GDSRA++ T D+ +
Sbjct  198   LKVSLLKSFKLMDKELKLHQKIDCFCSGSTAVTLIKQGQNLILGNVGDSRAVLATIDEDN  257

Query  1034  QLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDF  1213
              L+P QLTVDLKP+LP E+ RI+ CKGRV A  +EP V R W+P  D PGLAMARAFGDF
Sbjct  258   SLIPIQLTVDLKPDLPGEAARIQQCKGRVFALQDEPEVARFWLPNNDSPGLAMARAFGDF  317

Query  1214  CLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVE  1393
             CLKD+G+ISVP+++YR ++ RD+FV+LA+DGVWDVLSN E I+ VA+A  R  AAR +V+
Sbjct  318   CLKDFGLISVPDVYYRHLTPRDQFVILATDGVWDVLSNKEAIEIVASAPSRETAARALVD  377

Query  1394  RAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLNMSFPETGRNEENSAIIA  1573
              AVR W+ KYP SK DDCAVVCLF +  +P + +     A      P T  N+    I  
Sbjct  378   CAVRAWRLKYPTSKNDDCAVVCLFLEY-EPDVDENTETCAMPVEEVPATPSNDAKD-IEV  435

Query  1574  ETDDGLDTLLNFKGT  1618
             + DD   T+    GT
Sbjct  436   DLDDCRTTVFEQSGT  450



>ref|XP_009374430.1| PREDICTED: probable protein phosphatase 2C 6 [Pyrus x bretschneideri]
Length=539

 Score =   346 bits (887),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/381 (48%), Positives = 235/381 (62%), Gaps = 41/381 (11%)
 Frame = +2

Query  572   DFGARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVA  751
             D   R+  +GSS+   +Y+QQGKKG NQDAM VWE+        FCGVFDGHGP GH VA
Sbjct  61    DIPGRLIGNGSSKVACLYTQQGKKGTNQDAMLVWENLATRSDTTFCGVFDGHGPFGHMVA  120

Query  752   QFIRDRLP---------------SKLSVASKDN-SQDFEKDIHHH---------------  838
             + +RD LP               S L+ A   N S +FE+ +                  
Sbjct  121   KKVRDSLPLILCTQWKANSSGDLSNLNEAENANGSSNFEEPVSPSIDDEWCESLEVKENE  180

Query  839   ---PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAI  1009
                 ++   K +F ++FK +D  L+    ID F SGTTAVTL+KQG++L+IGN+GDSRA+
Sbjct  181   KLPDMYLPLKQSFLKAFKLMDKELKLHPTIDCFCSGTTAVTLVKQGQNLVIGNVGDSRAV  240

Query  1010  MCTRDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLA  1189
             + TRDD + L+  QLTVDLKP+LP ES RI  CKGRV A  +EP V RVW+P  D PGLA
Sbjct  241   LATRDDDNSLIAVQLTVDLKPDLPAESARIHQCKGRVFALQDEPEVARVWLPNNDSPGLA  300

Query  1190  MARAFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRS  1369
             MARAFGDFCLKD+G+ISVP++ YR+++ERDEF++LA+DGVWDVLSN E ++ VA+A   +
Sbjct  301   MARAFGDFCLKDFGLISVPDVCYRRLTERDEFIILATDGVWDVLSNKEAVEIVASAPGHT  360

Query  1370  MAARLVVERAVRTWKQKYPCSKTDDCAVVCLFFKRPKPMLLKTMSQAAGLN--MSFPETG  1543
              AAR +V+ AVR W+ KYP SK DDCAVVCLF        L    +AA  N      E  
Sbjct  361   TAARALVDCAVRAWRLKYPTSKNDDCAVVCLFLDH-----LSAADEAATENDMTKINEET  415

Query  1544  RNEENSAIIAETDDGLDTLLN  1606
             +  E   I  ET    +T +N
Sbjct  416   KVNEELKINGETKSDRETKIN  436



>ref|XP_009766558.1| PREDICTED: probable protein phosphatase 2C 33 [Nicotiana sylvestris]
Length=532

 Score =   345 bits (886),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 222/330 (67%), Gaps = 34/330 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG      FCGVFDGHGP GH VA+ +
Sbjct  97    GRLFLNGSSDVASLFTQQGKKGTNQDAMIVWENFGSRTDTVFCGVFDGHGPHGHMVAKRV  156

Query  761   RDRLPSKLS------VASKD-------------NSQD---------------FEKDIHHH  838
             RD LP KLS      V S+D             NS+D                E+     
Sbjct  157   RDSLPLKLSAHWEVNVKSEDVLKEISLNAGASLNSEDASLISADEESRVSIDVEEAEKQP  216

Query  839   PLFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
              +F   K +F +++K +D  L     ID F SGTTAVT +KQG+ L+IGN+GDSRA++ T
Sbjct  217   EVFQTLKESFLKAYKVMDRELRSYTNIDCFCSGTTAVTFVKQGQDLVIGNVGDSRAVLGT  276

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD +  L   QLTVDLKPNLP E+ERI+ C+GRV A  +EP V RVW+P  D PGLAMAR
Sbjct  277   RDKSGSLTAVQLTVDLKPNLPAEAERIRKCRGRVFALRDEPEVSRVWLPHSDSPGLAMAR  336

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVPEI YR+++ +DEF+VLA+DG+WDVLSN EV+K +A+A  RS AA
Sbjct  337   AFGDFCLKDFGLISVPEISYRRLTGKDEFIVLATDGIWDVLSNDEVVKIIASASSRSSAA  396

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFF  1468
             R +VE AVR W+ KYP SK DDCAVVCLF 
Sbjct  397   RSLVEAAVRAWRTKYPTSKVDDCAVVCLFL  426



>ref|XP_011009964.1| PREDICTED: probable protein phosphatase 2C 33 [Populus euphratica]
Length=482

 Score =   344 bits (882),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 222/331 (67%), Gaps = 34/331 (10%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   S+++QQGKKG NQDAM VWE+FG    A FCGVFDGHGP GH VA+ +
Sbjct  54    GRLFLNGSSDIASLFTQQGKKGTNQDAMIVWENFGSRTDAVFCGVFDGHGPYGHMVAKRV  113

Query  761   RDRLPSKLS-------------------VASKDNSQDFE--------------KDIHHHP  841
             RD LP KL+                        NS+D                +D   HP
Sbjct  114   RDSLPLKLTAHWEMNATSEAVLKEISLNTTGSMNSEDASFVSADEEPRASVDPEDAEKHP  173

Query  842   L-FSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCT  1018
               F   K +F ++FK +D  L+     D F SGTTAVTL+KQG++L++GN+GDSRA++ T
Sbjct  174   ENFQILKESFLKAFKVMDGELKVHANFDCFCSGTTAVTLVKQGQYLVLGNVGDSRAVLGT  233

Query  1019  RDDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMAR  1198
             RD  D LV  Q+TVDLKPNLP E+ERI+ CKGRV A  +EP V RVW+P  D PGLAMAR
Sbjct  234   RDKDDSLVAVQMTVDLKPNLPAEAERIRKCKGRVFALQDEPEVARVWLPNNDSPGLAMAR  293

Query  1199  AFGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAA  1378
             AFGDFCLKD+G+ISVP+I YR ++E+DEF+VLA+DG+WDVLSN EV+  VA+   RS AA
Sbjct  294   AFGDFCLKDFGLISVPDISYRHLTEKDEFIVLATDGIWDVLSNKEVVDIVASVSSRSSAA  353

Query  1379  RLVVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
             R +V+ AVR W+ KYP SK DDCAVVCLF +
Sbjct  354   RALVKSAVRAWRYKYPTSKIDDCAVVCLFLE  384



>ref|XP_010268762.1| PREDICTED: probable protein phosphatase 2C 1 [Nelumbo nucifera]
Length=469

 Score =   343 bits (880),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 218/314 (69%), Gaps = 20/314 (6%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+  +G+SR   +++QQG+KG+NQDAM VWE F  E  A FCGVFDGHGP GH VA+ +R
Sbjct  56    RIFANGNSRTSCIFTQQGRKGINQDAMVVWEDFMSED-AIFCGVFDGHGPHGHLVARKVR  114

Query  764   DRLPSKL-----SVASKDN-------------SQDFEKD-IHHHPLFSKWKSTFPQSFKD  886
             D LP KL     S  S+ N               D EKD      L S W+  F +S+K 
Sbjct  115   DDLPLKLLSFLQSQESRQNGLNNNCFGRKTKLEGDSEKDGSTEDNLGSLWREAFLKSYKA  174

Query  887   IDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLVPEQLTVDL  1066
             +D  L     +D F SG+TAVT++KQG +L +G +GDSRAIM ++D +D +V  QLTVDL
Sbjct  175   MDKELRSHPTLDCFCSGSTAVTIVKQGLNLFMGYIGDSRAIMGSKDSSDSMVAVQLTVDL  234

Query  1067  KPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLKDYGVISVP  1246
             KP+LP E ERIK CKGRV A  +EP V RVW+P  D PGLAMARAFGDFCLKDYGVIS+P
Sbjct  235   KPDLPREEERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKDYGVISIP  294

Query  1247  EIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAVRTWKQKYP  1426
             E  +R ++ERD+F+VLASDGVWDVLSN EV++ V++A  RS AAR++V+ A R WK KYP
Sbjct  295   EFSHRILTERDQFIVLASDGVWDVLSNEEVVEIVSSAPTRSSAARILVDSASREWKLKYP  354

Query  1427  CSKTDDCAVVCLFF  1468
              SK DDCAVVCLF 
Sbjct  355   TSKMDDCAVVCLFL  368



>gb|KEH21866.1| phosphatase 2C family protein [Medicago truncatula]
Length=411

 Score =   341 bits (874),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 220/323 (68%), Gaps = 27/323 (8%)
 Frame = +2

Query  581   ARVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFI  760
              R+ L+GSS   SMY +QGKKG+NQDAM VWE+F  ++G  FCGVFDGHGP GHRVA+ +
Sbjct  47    GRMFLNGSSEIASMYCKQGKKGINQDAMLVWENFCSKEGTVFCGVFDGHGPYGHRVAKKV  106

Query  761   RDRLPSKLSV------------------ASKDNSQDFEKDIH---HHPL-----FSKWKS  862
             RD  P KLS                   A+  NS++  K I    +H L         + 
Sbjct  107   RDSFPLKLSAQWDLHRKNQDGFNDQNGAATSHNSEEQIKLIDENCNHELDGTDTILALRE  166

Query  863   TFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTRDDTDQLV  1042
             +F ++ K +D  L+    ID F SGTTAVTLIKQG  L++GN+GDSRA++ TRD  D L+
Sbjct  167   SFLKASKIMDKELKMHRDIDCFCSGTTAVTLIKQGLDLVVGNVGDSRAVLGTRDHEDSLI  226

Query  1043  PEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARAFGDFCLK  1222
               QLTVDLKPNLP E ERI+  KGRV +   EP+V RVW+P  D PGLAMARAFGDFCLK
Sbjct  227   AVQLTVDLKPNLPKEEERIRHRKGRVFSLKNEPDVARVWLPNSDFPGLAMARAFGDFCLK  286

Query  1223  DYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAARLVVERAV  1402
             D G+ISVP++ Y +++E+DEFVVLA+DG+WDVLSN EV++ VA+A  RS AARL+VE AV
Sbjct  287   DVGLISVPDVSYHRLTEKDEFVVLATDGIWDVLSNEEVVEIVASA-PRSTAARLLVESAV  345

Query  1403  RTWKQKYPCSKTDDCAVVCLFFK  1471
              +WK K+P  K DDCA VCLF  
Sbjct  346   LSWKAKFPFCKIDDCAAVCLFLN  368



>gb|KHG02830.1| hypothetical protein F383_26202 [Gossypium arboreum]
 gb|KHG23855.1| hypothetical protein F383_10165 [Gossypium arboreum]
Length=515

 Score =   344 bits (883),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/330 (52%), Positives = 217/330 (66%), Gaps = 34/330 (10%)
 Frame = +2

Query  584   RVRLHGSSRFVSMYSQQGKKGVNQDAMTVWEHFGGEKGAFFCGVFDGHGPSGHRVAQFIR  763
             R+ L+G+S    +Y+QQGKKG NQDAM VWE+F     A FCGVFDGHGP GH VA+ +R
Sbjct  66    RMFLNGASSVACLYTQQGKKGTNQDAMLVWENFSSRSDAIFCGVFDGHGPYGHMVAKKVR  125

Query  764   DRLPSKL-----------------------SVASKD-----------NSQDFEKDIHHHP  841
             D LP  L                       S  S+D            S + E++     
Sbjct  126   DSLPVILCTQWKASLTGEQSCLNKSENAPESTMSEDAASLSMDDECCESWEIEENEQLPE  185

Query  842   LFSKWKSTFPQSFKDIDNALEGEEKIDSFSSGTTAVTLIKQGEHLIIGNLGDSRAIMCTR  1021
             ++   K +  ++FK +D  L+    ID F SGTTAVTL+KQG  L+IGN+GDSRA++  R
Sbjct  186   MYLPLKQSMLKAFKLMDKELKLHPAIDCFCSGTTAVTLVKQGLDLVIGNIGDSRAVLAMR  245

Query  1022  DDTDQLVPEQLTVDLKPNLPVESERIKSCKGRVMATAEEPNVFRVWMPEQDCPGLAMARA  1201
             D  + L+  QLTVDLKP+LP E+ RI+ C+GRV A  +EP V RVW+P  D PGLAMARA
Sbjct  246   DKDNSLIAVQLTVDLKPDLPREAARIQQCRGRVFALQDEPEVARVWLPNNDSPGLAMARA  305

Query  1202  FGDFCLKDYGVISVPEIFYRKISERDEFVVLASDGVWDVLSNYEVIKTVATAKKRSMAAR  1381
             FGDFCLKD+G+ISVP++FYR+++ERDEFV+LA+DGVWDVLSN E I  VA+A  RS AAR
Sbjct  306   FGDFCLKDFGLISVPDVFYRRLTERDEFVILATDGVWDVLSNKEAIDIVASAPSRSTAAR  365

Query  1382  LVVERAVRTWKQKYPCSKTDDCAVVCLFFK  1471
              +V+ A R W+ KYP SK DDCAVVCLF +
Sbjct  366   ALVDCATRAWRLKYPTSKNDDCAVVCLFLE  395



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9648853286424