BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c89758_g1_i1 len=617 path=[645:0-616]

Length=617
                                                                      Score     E

dbj|BAD06583.1|  protein phosphatase 2C                                 174   2e-51   Nicotiana tabacum [American tobacco]
ref|XP_004239911.1|  PREDICTED: protein phosphatase 2C 37               181   3e-51   
ref|XP_006355694.1|  PREDICTED: protein phosphatase 2C 37-like          181   4e-51   
ref|XP_009604512.1|  PREDICTED: protein phosphatase 2C 37-like          177   1e-49   
gb|EPS71711.1|  hypothetical protein M569_03048                         176   2e-49   
dbj|BAF43700.1|  protein phosphatase 2C                                 176   6e-49   Nicotiana tabacum [American tobacco]
ref|XP_009802038.1|  PREDICTED: protein phosphatase 2C 37-like          176   6e-49   
emb|CAB90633.1|  protein phpsphatase 2C (PP2C)                          171   2e-47   Fagus sylvatica
gb|EYU19939.1|  hypothetical protein MIMGU_mgv1a007028mg                168   3e-46   
ref|XP_011091509.1|  PREDICTED: protein phosphatase 2C 37-like          167   7e-46   
ref|XP_011076792.1|  PREDICTED: protein phosphatase 2C 37-like          166   2e-45   
gb|EYU35238.1|  hypothetical protein MIMGU_mgv1a006976mg                166   3e-45   
ref|XP_002524215.1|  protein phosphatase 2c, putative                   166   4e-45   Ricinus communis
emb|CDP00134.1|  unnamed protein product                                162   6e-44   
ref|XP_009772290.1|  PREDICTED: protein phosphatase 2C 37-like          159   9e-43   
gb|KDP44892.1|  hypothetical protein JCGZ_01392                         157   4e-42   
gb|KHF99990.1|  Protein phosphatase 2C 37 -like protein                 156   1e-41   
gb|KDO66647.1|  hypothetical protein CISIN_1g0368521mg                  150   2e-41   
ref|XP_004503174.1|  PREDICTED: protein phosphatase 2C 37-like          155   2e-41   
ref|XP_011002618.1|  PREDICTED: protein phosphatase 2C 37               153   1e-40   
ref|XP_002282703.1|  PREDICTED: protein phosphatase 2C 37-like          152   2e-40   Vitis vinifera
ref|XP_003552788.1|  PREDICTED: protein phosphatase 2C 37               152   2e-40   
emb|CDQ51997.1|  protein phosphatase 2C                                 152   3e-40   
ref|XP_010262609.1|  PREDICTED: protein phosphatase 2C 37-like          152   3e-40   
ref|XP_002311183.2|  Protein phosphatase 2C family protein              152   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_011033764.1|  PREDICTED: protein phosphatase 2C 37-like          152   3e-40   
ref|XP_006488392.1|  PREDICTED: probable protein phosphatase 2C 7...    152   6e-40   
ref|XP_004307470.1|  PREDICTED: protein phosphatase 2C 37-like          151   7e-40   
ref|XP_007009278.1|  Phosphatase PP2C isoform 1                         151   1e-39   
gb|KHG07039.1|  Protein phosphatase 2C 37 -like protein                 150   1e-39   
ref|XP_006424911.1|  hypothetical protein CICLE_v10028495mg             150   2e-39   
ref|XP_010691227.1|  PREDICTED: protein phosphatase 2C 37               149   2e-39   
ref|XP_008233481.1|  PREDICTED: protein phosphatase 2C 37-like          150   3e-39   
ref|XP_003538425.1|  PREDICTED: protein phosphatase 2C 37               149   3e-39   
gb|AAQ03211.1|AF411074_1  protein phosphatase 2C                        149   5e-39   Prunus avium [gean]
ref|XP_007163459.1|  hypothetical protein PHAVU_001G236000g             149   5e-39   
ref|XP_010096621.1|  Protein phosphatase 2C 37                          149   6e-39   
ref|XP_007163460.1|  hypothetical protein PHAVU_001G236000g             149   6e-39   
ref|XP_002316268.2|  Protein phosphatase 2C family protein              148   8e-39   Populus trichocarpa [western balsam poplar]
ref|XP_009589075.1|  PREDICTED: protein phosphatase 2C 37-like          149   9e-39   
gb|KHG19331.1|  Protein phosphatase 2C 3 -like protein                  148   1e-38   
ref|XP_008344852.1|  PREDICTED: probable protein phosphatase 2C 24      143   1e-38   
ref|XP_010256813.1|  PREDICTED: protein phosphatase 2C 37-like          148   1e-38   
gb|KEH34758.1|  protein phosphatase 2C-like protein                     147   2e-38   
gb|KCW65565.1|  hypothetical protein EUGRSUZ_G02960                     146   2e-38   
ref|XP_008356724.1|  PREDICTED: probable protein phosphatase 2C 24      147   3e-38   
ref|XP_007225540.1|  hypothetical protein PRUPE_ppa026727mg             140   3e-38   
ref|XP_007218057.1|  hypothetical protein PRUPE_ppa006174mg             147   4e-38   
ref|XP_002314150.1|  phosphatase 2C family protein                      145   6e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011080695.1|  PREDICTED: probable protein phosphatase 2C 24      146   6e-38   
gb|KDO69165.1|  hypothetical protein CISIN_1g015135mg                   145   9e-38   
ref|XP_006435621.1|  hypothetical protein CICLE_v10031682mg             145   9e-38   
ref|XP_006486407.1|  PREDICTED: protein phosphatase 2C 37-like          145   1e-37   
ref|XP_010067439.1|  PREDICTED: protein phosphatase 2C 37-like          145   1e-37   
ref|XP_007205293.1|  hypothetical protein PRUPE_ppa006696mg             145   1e-37   
ref|XP_010685683.1|  PREDICTED: probable protein phosphatase 2C 24      145   1e-37   
ref|XP_006344582.1|  PREDICTED: protein phosphatase 2C 37-like          145   2e-37   
ref|XP_008372056.1|  PREDICTED: protein phosphatase 2C 37               145   2e-37   
ref|XP_009351424.1|  PREDICTED: protein phosphatase 2C 37-like          145   2e-37   
emb|CBI31627.3|  unnamed protein product                                141   2e-37   
ref|XP_011032242.1|  PREDICTED: probable protein phosphatase 2C 24      145   2e-37   
ref|XP_004241211.1|  PREDICTED: probable protein phosphatase 2C 24      144   2e-37   
ref|XP_010106553.1|  putative protein phosphatase 2C 24                 144   3e-37   
ref|XP_007141853.1|  hypothetical protein PHAVU_008G231200g             144   4e-37   
ref|XP_007016311.1|  Highly ABA-induced PP2C gene 2 isoform 1           144   5e-37   
ref|XP_002282608.1|  PREDICTED: probable protein phosphatase 2C 24      143   7e-37   Vitis vinifera
emb|CDP09108.1|  unnamed protein product                                143   7e-37   
emb|CBI16058.3|  unnamed protein product                                142   9e-37   
ref|XP_008457441.1|  PREDICTED: probable protein phosphatase 2C 24      143   1e-36   
gb|AIA58904.1|  protein phosphatase                                     143   1e-36   
ref|XP_004490902.1|  PREDICTED: protein phosphatase 2C 37-like          143   1e-36   
ref|XP_007203519.1|  hypothetical protein PRUPE_ppa024950mg             137   1e-36   
gb|ABC16634.1|  protein phosphatase PP2C                                142   1e-36   Gossypium hirsutum [American cotton]
ref|XP_009343867.1|  PREDICTED: protein phosphatase 2C 37-like          142   2e-36   
gb|ABD65465.1|  protein phosphatase 2C                                  142   2e-36   Gossypium hirsutum [American cotton]
gb|KDP42204.1|  hypothetical protein JCGZ_02934                         142   2e-36   
ref|NP_001234692.1|  protein phosphatase 2C AHG3 homolog                142   2e-36   
ref|XP_004145326.1|  PREDICTED: protein phosphatase 2C 3-like           142   2e-36   
ref|XP_004291511.1|  PREDICTED: probable protein phosphatase 2C 2...    141   3e-36   
ref|XP_011035254.1|  PREDICTED: probable protein phosphatase 2C 24      142   3e-36   
ref|XP_008221946.1|  PREDICTED: probable protein phosphatase 2C 24      141   3e-36   
ref|XP_009364345.1|  PREDICTED: probable protein phosphatase 2C 24      141   3e-36   
gb|AFK46885.1|  unknown                                                 140   5e-36   
ref|XP_009599862.1|  PREDICTED: probable protein phosphatase 2C 24      141   5e-36   
ref|XP_003616468.1|  Protein phosphatase 2C                             140   5e-36   
ref|XP_006369545.1|  hypothetical protein POPTR_0001s25200g             141   5e-36   
gb|KHN17892.1|  Protein phosphatase 2C 37                               140   6e-36   
ref|XP_006350789.1|  PREDICTED: protein phosphatase 2C 37-like          140   8e-36   
emb|CAC10359.1|  protein phosphatase 2C                                 139   1e-35   Nicotiana tabacum [American tobacco]
ref|XP_009773018.1|  PREDICTED: probable protein phosphatase 2C 2...    138   2e-35   
ref|XP_002299846.2|  hypothetical protein POPTR_0001s25200g             139   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009773017.1|  PREDICTED: probable protein phosphatase 2C 2...    137   8e-35   
gb|AHA43410.1|  ABA-induced PP2C                                        137   1e-34   
ref|XP_003519357.1|  PREDICTED: protein phosphatase 2C 37-like          137   2e-34   
gb|KHN41115.1|  Protein phosphatase 2C 37                               137   2e-34   
ref|XP_010033093.1|  PREDICTED: probable protein phosphatase 2C 24      137   2e-34   
ref|XP_010541411.1|  PREDICTED: probable protein phosphatase 2C 78      136   3e-34   
ref|NP_001044788.1|  Os01g0846300                                       136   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006401003.1|  hypothetical protein EUTSA_v10013567mg             135   5e-34   
ref|XP_006401004.1|  hypothetical protein EUTSA_v10013567mg             136   5e-34   
gb|KHG14347.1|  Protein phosphatase 2C 3 -like protein                  135   6e-34   
ref|XP_010520253.1|  PREDICTED: probable protein phosphatase 2C 7...    135   1e-33   
ref|XP_009120420.1|  PREDICTED: probable protein phosphatase 2C 78      134   2e-33   
ref|XP_006645000.1|  PREDICTED: probable protein phosphatase 2C 9...    133   3e-33   
gb|AGG35960.1|  ABA hypersensitive PP2C protein AHG3/PP2CA              132   5e-33   
gb|KHN20909.1|  Protein phosphatase 2C 3                                130   6e-33   
ref|XP_008384916.1|  PREDICTED: probable protein phosphatase 2C 24      132   7e-33   
ref|XP_009146731.1|  PREDICTED: protein phosphatase 2C 37               132   1e-32   
emb|CDY08530.1|  BnaA05g27660D                                          131   2e-32   
ref|NP_172223.1|  protein phosphatase 2C 3                              130   4e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61361.1|  protein phosphatase 2C, putative                        130   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892398.1|  hypothetical protein ARALYDRAFT_470764             130   6e-32   
ref|XP_009384837.1|  PREDICTED: probable protein phosphatase 2C 68      129   7e-32   
ref|XP_010510497.1|  PREDICTED: probable protein phosphatase 2C 24      129   7e-32   
ref|XP_003544192.2|  PREDICTED: protein phosphatase 2C 37-like          130   9e-32   
ref|XP_010414391.1|  PREDICTED: probable protein phosphatase 2C 24      128   1e-31   
ref|XP_007016312.1|  Highly ABA-induced PP2C gene 2 isoform 2           129   1e-31   
gb|ABW81144.1|  unknown                                                 128   1e-31   Capsella rubella
ref|XP_006295431.1|  hypothetical protein CARUB_v10024530mg             128   1e-31   
emb|CDY10275.1|  BnaC05g05180D                                          129   1e-31   
ref|XP_009375956.1|  PREDICTED: probable protein phosphatase 2C 24      128   2e-31   
emb|CDY40181.1|  BnaC04g14090D                                          127   3e-31   
gb|AHN16199.1|  HAI3.1                                                  127   3e-31   
gb|KFK22788.1|  hypothetical protein AALP_AAs59949U000200               126   3e-31   
ref|XP_009144382.1|  PREDICTED: probable protein phosphatase 2C 24      127   3e-31   
ref|XP_008803118.1|  PREDICTED: probable protein phosphatase 2C 24      127   3e-31   
ref|XP_002879213.1|  predicted protein                                  127   3e-31   
gb|ABW81041.1|  protein-phosphatase-2C                                  127   3e-31   Arabidopsis lyrata subsp. lyrata
emb|CDY45436.1|  BnaA05g12650D                                          127   3e-31   
ref|XP_010469960.1|  PREDICTED: probable protein phosphatase 2C 24      127   4e-31   
ref|XP_010937563.1|  PREDICTED: probable protein phosphatase 2C 24      127   6e-31   
gb|ABW74582.1|  putative protein phosphatase                            127   6e-31   Boechera divaricarpa
ref|XP_002465495.1|  hypothetical protein SORBIDRAFT_01g039890          127   7e-31   Sorghum bicolor [broomcorn]
ref|XP_006307527.1|  hypothetical protein CARUB_v10009150mg             126   1e-30   
ref|XP_008441392.1|  PREDICTED: probable protein phosphatase 2C 24      125   1e-30   
ref|XP_010457921.1|  PREDICTED: protein phosphatase 2C 3                126   2e-30   
ref|XP_009387749.1|  PREDICTED: probable protein phosphatase 2C 68      125   2e-30   
ref|XP_010487459.1|  PREDICTED: protein phosphatase 2C 3-like           126   2e-30   
ref|XP_006417805.1|  hypothetical protein EUTSA_v10007705mg             125   2e-30   
ref|XP_010558044.1|  PREDICTED: protein phosphatase 2C 37-like          125   2e-30   
ref|XP_010521895.1|  PREDICTED: protein phosphatase 2C 3-like           125   3e-30   
gb|ABW81089.1|  unknown                                                 125   3e-30   Tarenaya spinosa
gb|EYU45960.1|  hypothetical protein MIMGU_mgv1a008586mg                124   3e-30   
ref|XP_008777431.1|  PREDICTED: probable protein phosphatase 2C 24      125   3e-30   
gb|ABW81185.1|  protein-phosphatase1                                    124   4e-30   Arabidopsis cebennensis
ref|XP_009402271.1|  PREDICTED: probable protein phosphatase 2C 30      124   4e-30   
ref|XP_010920508.1|  PREDICTED: probable protein phosphatase 2C 68      124   4e-30   
gb|ACR36367.1|  unknown                                                 119   9e-30   Zea mays [maize]
gb|KHN07593.1|  Protein phosphatase 2C 37                               122   1e-29   
gb|AHN16197.1|  HAI2.1                                                  123   1e-29   
ref|XP_010931227.1|  PREDICTED: probable protein phosphatase 2C 24      123   1e-29   
ref|XP_009118961.1|  PREDICTED: protein phosphatase 2C 3                123   1e-29   
emb|CDY06259.1|  BnaA09g49440D                                          123   2e-29   
gb|AHN16198.1|  HAI2.2                                                  122   2e-29   
ref|XP_009118439.1|  PREDICTED: protein phosphatase 2C 3-like           122   2e-29   
ref|NP_180499.1|  highly ABA-induced PP2C protein 3                     122   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130968.1|  uncharacterized protein LOC100192073               119   6e-29   Zea mays [maize]
ref|XP_004984925.1|  PREDICTED: probable protein phosphatase 2C 3...    120   1e-28   
ref|XP_004172971.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...    120   2e-28   
ref|NP_001266874.1|  uncharacterized protein LOC101027236               120   2e-28   
gb|KGN45741.1|  hypothetical protein Csa_6G008720                       120   2e-28   
ref|XP_004138578.1|  PREDICTED: protein phosphatase 2C 3-like           120   2e-28   
emb|CDY06705.1|  BnaA10g04840D                                          119   2e-28   
ref|XP_008676186.1|  PREDICTED: uncharacterized protein LOC100192...    119   3e-28   
ref|XP_006827523.1|  hypothetical protein AMTR_s00009p00196700          117   1e-27   
ref|XP_006279627.1|  hypothetical protein CARUB_v10026477mg             117   2e-27   
gb|ACG39816.1|  protein phosphatase 2C                                  116   3e-27   Zea mays [maize]
ref|XP_006409984.1|  hypothetical protein EUTSA_v10017797mg             116   4e-27   
ref|XP_006407450.1|  hypothetical protein EUTSA_v10020827mg             115   6e-27   
gb|EPS58614.1|  hypothetical protein M569_16200                         115   7e-27   
emb|CDY67227.1|  BnaA01g37370D                                          115   8e-27   
emb|CDY33008.1|  BnaA10g12140D                                          115   1e-26   
ref|XP_010464843.1|  PREDICTED: protein phosphatase 2C 37               114   1e-26   
ref|XP_009121141.1|  PREDICTED: protein phosphatase 2C 37-like          114   2e-26   
emb|CDX80307.1|  BnaC09g34350D                                          114   2e-26   
ref|XP_010486793.1|  PREDICTED: protein phosphatase 2C 37-like          114   2e-26   
ref|XP_010495429.1|  PREDICTED: protein phosphatase 2C 37 isoform X1    114   2e-26   
tpg|DAA56862.1|  TPA: putative protein phosphatase 2C family protein    114   2e-26   
ref|NP_001149037.1|  protein phosphatase 2C                             114   3e-26   Zea mays [maize]
gb|KFK43050.1|  hypothetical protein AALP_AA1G071700                    114   3e-26   
gb|AIB05995.1|  orphans transcription factor                            114   3e-26   
pdb|4N0G|A  Chain A, Crystal Structure Of Pyl13-pp2ca Complex           113   3e-26   
ref|XP_002864609.1|  hypothetical protein ARALYDRAFT_496034             113   4e-26   
ref|NP_187748.1|  protein phosphatase 2CA                               113   4e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01017.1|  BnaC05g41830D                                          113   4e-26   
ref|XP_010483528.1|  PREDICTED: probable protein phosphatase 2C 78      113   5e-26   
gb|EMT28836.1|  Putative protein phosphatase 2C 8                       108   5e-26   
gb|KFK38501.1|  hypothetical protein AALP_AA3G121300                    112   6e-26   
ref|XP_010443659.1|  PREDICTED: probable protein phosphatase 2C 78      113   6e-26   
ref|XP_003564598.1|  PREDICTED: probable protein phosphatase 2C 9       113   6e-26   
ref|XP_010454666.1|  PREDICTED: probable protein phosphatase 2C 78      112   8e-26   
ref|XP_009404586.1|  PREDICTED: probable protein phosphatase 2C 49      112   9e-26   
ref|XP_002884844.1|  AHG3/ATPP2CA                                       112   1e-25   
ref|XP_006297848.1|  hypothetical protein CARUB_v10013886mg             112   1e-25   
ref|NP_001049674.1|  Os03g0268600                                       112   1e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CDY67257.1|  BnaAnng23920D                                          111   2e-25   
ref|XP_006846348.1|  hypothetical protein AMTR_s00012p00259520          111   2e-25   
gb|AIG52088.1|  2C-type protein phosphatase protein                     111   3e-25   
gb|EAY89397.1|  hypothetical protein OsI_10903                          110   4e-25   Oryza sativa Indica Group [Indian rice]
gb|KFK27433.1|  hypothetical protein AALP_AA8G381900                    110   4e-25   
emb|CDM84982.1|  unnamed protein product                                110   5e-25   
ref|XP_006649824.1|  PREDICTED: probable protein phosphatase 2C 3...    110   7e-25   
gb|AAL16163.1|AF428395_1  AT5g59220/mnc17_110                           109   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200730.1|  putative protein phosphatase 2C 78                    109   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003561786.1|  PREDICTED: probable protein phosphatase 2C 30      109   9e-25   
gb|AGL93150.1|  serine/threonine protein phosphatase 2C 30              109   1e-24   
ref|XP_006362702.1|  PREDICTED: probable protein phosphatase 2C 7...    109   1e-24   
ref|XP_010543770.1|  PREDICTED: protein phosphatase 2C 37 isoform X1    109   1e-24   
ref|XP_003569481.1|  PREDICTED: probable protein phosphatase 2C 8       109   1e-24   
ref|XP_008234728.1|  PREDICTED: probable protein phosphatase 2C 51      109   1e-24   
ref|XP_009757833.1|  PREDICTED: probable protein phosphatase 2C 75      108   2e-24   
dbj|BAK05256.1|  predicted protein                                      108   2e-24   
ref|XP_002456624.1|  hypothetical protein SORBIDRAFT_03g039630          108   2e-24   Sorghum bicolor [broomcorn]
ref|XP_006646161.1|  PREDICTED: probable protein phosphatase 2C 8...    108   3e-24   
ref|XP_010671484.1|  PREDICTED: probable protein phosphatase 2C 8       107   3e-24   
emb|CDM82120.1|  unnamed protein product                                107   4e-24   
gb|EEE63966.1|  hypothetical protein OsJ_18791                          107   5e-24   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85581.1|  predicted protein                                      107   5e-24   
ref|XP_009412939.1|  PREDICTED: probable protein phosphatase 2C 8       107   5e-24   
ref|NP_001043754.1|  Os01g0656200                                       107   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565884.2|  PREDICTED: probable protein phosphatase 2C 51      107   7e-24   
ref|XP_002513570.1|  protein phosphatase 2c, putative                   106   8e-24   Ricinus communis
gb|EEC71208.1|  hypothetical protein OsI_03122                          107   1e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_010247857.1|  PREDICTED: probable protein phosphatase 2C 7...    106   1e-23   
gb|EMT07491.1|  Putative protein phosphatase 2C 30                      106   1e-23   
ref|XP_009591951.1|  PREDICTED: probable protein phosphatase 2C 7...    106   1e-23   
ref|XP_007219142.1|  hypothetical protein PRUPE_ppa016016mg             106   1e-23   
ref|XP_009591950.1|  PREDICTED: probable protein phosphatase 2C 7...    106   1e-23   
gb|EAY98295.1|  hypothetical protein OsI_20203                          106   1e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_010247858.1|  PREDICTED: probable protein phosphatase 2C 7...    106   1e-23   
sp|Q65XG6.1|P2C49_ORYSJ  RecName: Full=Probable protein phosphata...    106   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970557.1|  PREDICTED: probable protein phosphatase 2C 9...    106   1e-23   
ref|XP_009778007.1|  PREDICTED: probable protein phosphatase 2C 75      105   1e-23   
gb|EEE55111.1|  hypothetical protein OsJ_02873                          107   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006362704.1|  PREDICTED: probable protein phosphatase 2C 7...    105   2e-23   
dbj|BAJ98672.1|  predicted protein                                      105   3e-23   
ref|XP_006646035.1|  PREDICTED: probable protein phosphatase 2C 6...    104   3e-23   
ref|XP_008380981.1|  PREDICTED: probable protein phosphatase 2C 51      105   4e-23   
ref|XP_009789155.1|  PREDICTED: probable protein phosphatase 2C 7...    105   4e-23   
ref|XP_009789148.1|  PREDICTED: probable protein phosphatase 2C 7...    105   4e-23   
ref|XP_009394142.1|  PREDICTED: probable protein phosphatase 2C 51      104   4e-23   
ref|XP_010557234.1|  PREDICTED: probable protein phosphatase 2C 24      105   5e-23   
ref|XP_004234148.1|  PREDICTED: probable protein phosphatase 2C 7...    104   5e-23   
ref|XP_010317462.1|  PREDICTED: probable protein phosphatase 2C 7...    104   5e-23   
ref|XP_008663080.1|  PREDICTED: probable protein phosphatase 2C 37      105   5e-23   
ref|XP_004234268.1|  PREDICTED: probable protein phosphatase 2C 7...    104   6e-23   
ref|XP_010914542.1|  PREDICTED: probable protein phosphatase 2C 51      104   6e-23   
ref|XP_010317460.1|  PREDICTED: probable protein phosphatase 2C 7...    104   6e-23   
gb|KHN06026.1|  Hypothetical protein glysoja_050019                     103   7e-23   
ref|XP_009591949.1|  PREDICTED: probable protein phosphatase 2C 75      103   8e-23   
gb|KHN19844.1|  Hypothetical protein glysoja_050012                     103   8e-23   
ref|XP_010261579.1|  PREDICTED: probable protein phosphatase 2C 51      104   8e-23   
ref|XP_004972422.1|  PREDICTED: probable protein phosphatase 2C 3...    104   8e-23   
ref|XP_001765872.1|  predicted protein                                  103   8e-23   
ref|XP_009351998.1|  PREDICTED: probable protein phosphatase 2C 51      103   9e-23   
gb|EEC70963.1|  hypothetical protein OsI_02579                          103   1e-22   Oryza sativa Indica Group [Indian rice]
gb|AFK40419.1|  unknown                                                 101   1e-22   
gb|KEH40398.1|  protein phosphatase 2C-like protein                     103   1e-22   
gb|ACJ85501.1|  unknown                                                 103   1e-22   Medicago truncatula
ref|XP_009378777.1|  PREDICTED: probable protein phosphatase 2C 51      103   1e-22   
ref|XP_004234269.1|  PREDICTED: probable protein phosphatase 2C 75      103   1e-22   
ref|XP_003553817.2|  PREDICTED: probable protein phosphatase 2C 8...    103   1e-22   
ref|XP_004240955.1|  PREDICTED: probable protein phosphatase 2C 51      103   1e-22   
ref|XP_002863039.1|  predicted protein                                  102   1e-22   
ref|XP_006362703.1|  PREDICTED: probable protein phosphatase 2C 7...    104   1e-22   
ref|XP_004961872.1|  PREDICTED: probable protein phosphatase 2C 4...    103   1e-22   
ref|XP_006596297.1|  PREDICTED: probable protein phosphatase 2C 5...    103   2e-22   
gb|KDP22158.1|  hypothetical protein JCGZ_25989                         102   2e-22   
sp|Q0JLP9.1|P2C06_ORYSJ  RecName: Full=Probable protein phosphata...    103   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAD17804.1|  nodule-enhanced protein phosphatase type 2C             102   2e-22   Lotus japonicus
gb|KDP22363.1|  hypothetical protein JCGZ_26194                         103   2e-22   
gb|EMS59347.1|  putative protein phosphatase 2C 30                      102   2e-22   
ref|XP_008671565.1|  PREDICTED: probable protein phosphatase 2C 51      101   3e-22   
ref|XP_006655374.1|  PREDICTED: probable protein phosphatase 2C 4...    102   3e-22   
ref|XP_002441544.1|  hypothetical protein SORBIDRAFT_09g029080          102   3e-22   Sorghum bicolor [broomcorn]
ref|XP_003577991.1|  PREDICTED: probable protein phosphatase 2C 68      102   3e-22   
ref|XP_010918765.1|  PREDICTED: probable protein phosphatase 2C 7...    102   4e-22   
ref|XP_010918764.1|  PREDICTED: probable protein phosphatase 2C 7...    102   4e-22   
dbj|BAD23456.1|  protein phosphatase 2C-like                            101   5e-22   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG12298.1|  protein phosphatase 2C                                 103   5e-22   
ref|NP_001062881.2|  Os09g0325700                                       101   5e-22   
gb|EAZ08623.1|  hypothetical protein OsI_30895                          101   5e-22   
ref|NP_001167952.1|  putative protein phosphatase 2C family protein     101   5e-22   
emb|CDX83901.1|  BnaC08g17440D                                          101   5e-22   
dbj|BAJ33756.1|  unnamed protein product                                100   5e-22   
gb|EYU25210.1|  hypothetical protein MIMGU_mgv1a008111mg                101   6e-22   
ref|XP_004165070.1|  PREDICTED: probable protein phosphatase 2C 8...    101   6e-22   
ref|XP_010662350.1|  PREDICTED: probable protein phosphatase 2C 75      101   6e-22   
ref|XP_004150316.1|  PREDICTED: probable protein phosphatase 2C 8...    101   6e-22   
tpg|DAA58292.1|  TPA: putative protein phosphatase 2C family protein  99.8    7e-22   
emb|CAN73343.1|  hypothetical protein VITISV_024269                     101   7e-22   
gb|EMT29148.1|  Putative protein phosphatase 2C 50                      100   7e-22   
ref|XP_011030010.1|  PREDICTED: probable protein phosphatase 2C 75      101   8e-22   
ref|NP_001288588.1|  probable protein phosphatase 2C 9                  101   8e-22   
ref|XP_004963581.1|  PREDICTED: probable protein phosphatase 2C 5...    101   8e-22   
ref|XP_006854472.1|  hypothetical protein AMTR_s00039p00235790          101   8e-22   
ref|XP_007161511.1|  hypothetical protein PHAVU_001G075400g             100   1e-21   
ref|XP_002980987.1|  hypothetical protein SELMODRAFT_113714             100   1e-21   
ref|XP_008441614.1|  PREDICTED: probable protein phosphatase 2C 8       100   1e-21   
ref|XP_009624475.1|  PREDICTED: probable protein phosphatase 2C 7...    100   1e-21   
gb|AIB05856.1|  orphans transcription factor                            100   1e-21   
ref|XP_002982468.1|  hypothetical protein SELMODRAFT_179532             100   1e-21   
ref|XP_010111687.1|  putative protein phosphatase 2C 8                  100   1e-21   
ref|XP_008675264.1|  PREDICTED: probable protein phosphatase 2C 8       100   1e-21   
ref|XP_004307973.1|  PREDICTED: probable protein phosphatase 2C 8...    100   1e-21   
ref|XP_009624474.1|  PREDICTED: probable protein phosphatase 2C 7...    100   1e-21   
emb|CDX96761.1|  BnaA08g23040D                                          100   1e-21   
ref|XP_009771243.1|  PREDICTED: probable protein phosphatase 2C 51      100   1e-21   
ref|XP_008669669.1|  PREDICTED: probable protein phosphatase 2C 37      101   1e-21   
ref|XP_011092720.1|  PREDICTED: probable protein phosphatase 2C 75      100   1e-21   
ref|XP_009110399.1|  PREDICTED: protein phosphatase 2C 7-like           100   1e-21   
emb|CBI22531.3|  unnamed protein product                              99.8    2e-21   
ref|XP_002456073.1|  hypothetical protein SORBIDRAFT_03g029890          100   2e-21   
gb|AGV54676.1|  nodule-enhanced protein phosphatase type 2C           99.4    2e-21   
gb|ACU18078.1|  unknown                                               99.8    2e-21   
ref|XP_006654816.1|  PREDICTED: probable protein phosphatase 2C 5...    100   2e-21   
gb|EEE60495.1|  hypothetical protein OsJ_13790                        98.6    2e-21   
dbj|BAH56780.1|  AT1G72770                                            99.4    2e-21   
ref|XP_004961009.1|  PREDICTED: probable protein phosphatase 2C 5...    100   3e-21   
pdb|3QN1|B  Chain B, Crystal Structure Of The Pyr1 Abscisic Acid ...  99.4    3e-21   
pdb|3RT0|A  Chain A, Crystal Structure Of Pyl10-Hab1 Complex In T...  99.4    3e-21   
pdb|4DS8|B  Chain B, Complex Structure Of Abscisic Acid Receptor ...  99.4    3e-21   
pdb|3NMT|B  Chain B, Crystal Structure Of Pyrabactin Bound Abscis...  99.4    3e-21   
pdb|3KB3|B  Chain B, Crystal Structure Of Abscisic Acid-Bound Pyl...  99.4    3e-21   
pdb|4LA7|B  Chain B, X-ray Crystal Structure Of The Pyl2-quinabac...  99.4    3e-21   
gb|EMS55824.1|  putative protein phosphatase 2C 50                    99.4    3e-21   
pdb|3UJG|B  Chain B, Crystal Structure Of Snrk2.6 In Complex With...  99.4    3e-21   
ref|XP_010049282.1|  PREDICTED: probable protein phosphatase 2C 5...  99.4    3e-21   
gb|EEC76752.1|  hypothetical protein OsI_14820                        99.8    4e-21   
gb|KCW81712.1|  hypothetical protein EUGRSUZ_C03066                     100   4e-21   
ref|XP_009384564.1|  PREDICTED: probable protein phosphatase 2C 68    99.8    4e-21   
gb|EMT03021.1|  Putative protein phosphatase 2C 6                       100   4e-21   
ref|XP_002977550.1|  hypothetical protein SELMODRAFT_451367           99.4    4e-21   
ref|XP_008439132.1|  PREDICTED: probable protein phosphatase 2C 7...  99.4    4e-21   
ref|XP_009412209.1|  PREDICTED: probable protein phosphatase 2C 6...    100   4e-21   
gb|KHF98958.1|  Protein phosphatase 2C 77 -like protein                 100   4e-21   
emb|CDM82904.1|  unnamed protein product                                100   4e-21   
ref|XP_006416690.1|  hypothetical protein EUTSA_v10007386mg             100   4e-21   
emb|CDY48313.1|  BnaC05g13670D                                          100   4e-21   
dbj|BAF62437.1|  protein phosphatase 2C                                 100   4e-21   
dbj|BAF62436.1|  protein phosphatase 2C                                 100   4e-21   
gb|AGG35980.1|  hypersensitive to ABA 2                                 100   4e-21   
dbj|BAG91921.1|  unnamed protein product                              98.6    4e-21   
ref|XP_009412210.1|  PREDICTED: probable protein phosphatase 2C 6...    100   5e-21   
ref|XP_002890233.1|  predicted protein                                99.0    5e-21   
ref|XP_002460055.1|  hypothetical protein SORBIDRAFT_02g022090        98.6    5e-21   
ref|XP_004975074.1|  PREDICTED: probable protein phosphatase 2C 3...  99.8    5e-21   
dbj|BAJ95398.1|  predicted protein                                    99.0    5e-21   
ref|XP_010049216.1|  PREDICTED: probable protein phosphatase 2C 53      100   6e-21   
ref|XP_008812562.1|  PREDICTED: probable protein phosphatase 2C 8     98.6    7e-21   
ref|XP_010324035.1|  PREDICTED: probable protein phosphatase 2C 6...  98.6    7e-21   
ref|XP_002887450.1|  hypothetical protein ARALYDRAFT_895129           99.8    7e-21   
ref|XP_008794280.1|  PREDICTED: probable protein phosphatase 2C 3...  97.4    7e-21   
ref|XP_008794282.1|  PREDICTED: probable protein phosphatase 2C 3...  97.4    7e-21   
gb|KDO46746.1|  hypothetical protein CISIN_1g017373mg                 98.2    7e-21   
ref|NP_001056378.1|  Os05g0572700                                     98.2    8e-21   
ref|NP_001151216.1|  protein phosphatase 2C                           98.2    8e-21   
ref|XP_008364588.1|  PREDICTED: probable protein phosphatase 2C 8     98.2    8e-21   
ref|XP_010231951.1|  PREDICTED: probable protein phosphatase 2C 6     99.4    8e-21   
gb|AFW83450.1|  putative protein phosphatase 2C family protein        98.2    8e-21   
emb|CDY26234.1|  BnaA06g11830D                                        99.4    9e-21   
ref|NP_177421.1|  protein phosphatase 2C 16                           99.8    9e-21   
ref|NP_001151589.1|  protein phosphatase 2C ABI1                      98.2    9e-21   
emb|CAA05875.1|  protein phosphatase 2C                               99.4    9e-21   
ref|XP_008670136.1|  PREDICTED: probable protein phosphatase 2C 68    97.8    9e-21   
ref|XP_006422177.1|  hypothetical protein CICLE_v10005200mg           97.8    1e-20   
dbj|BAK01548.1|  predicted protein                                    98.2    1e-20   
ref|XP_008338708.1|  PREDICTED: protein phosphatase 2C 16-like        99.8    1e-20   
gb|EMS62830.1|  putative protein phosphatase 2C 6                     99.0    1e-20   
ref|XP_011001894.1|  PREDICTED: probable protein phosphatase 2C 51    97.8    1e-20   
ref|XP_009149210.1|  PREDICTED: protein phosphatase 2C 7              99.4    1e-20   
gb|EMS65633.1|  putative protein phosphatase 2C 6                       100   1e-20   
ref|XP_006390620.1|  hypothetical protein EUTSA_v10018441mg           99.4    1e-20   
ref|XP_004498408.1|  PREDICTED: probable protein phosphatase 2C 5...  97.8    1e-20   
ref|XP_010428176.1|  PREDICTED: protein phosphatase 2C 16-like        99.0    1e-20   
ref|XP_004961376.1|  PREDICTED: probable protein phosphatase 2C 5...  97.8    1e-20   
ref|XP_004170562.1|  PREDICTED: probable protein phosphatase 2C 7...  97.1    1e-20   
gb|AFL56268.1|  ABI1-like protein                                     99.0    1e-20   
ref|XP_010055860.1|  PREDICTED: probable protein phosphatase 2C 8...  97.4    1e-20   
ref|XP_006342335.1|  PREDICTED: probable protein phosphatase 2C 6...  98.6    1e-20   
emb|CDX72943.1|  BnaC06g33910D                                        98.6    1e-20   
ref|XP_002318387.2|  hypothetical protein POPTR_0012s01740g           97.4    2e-20   
ref|XP_009105943.1|  PREDICTED: protein phosphatase 2C 16             98.6    2e-20   
ref|XP_002890234.1|  hypothetical protein ARALYDRAFT_889163           99.0    2e-20   
sp|Q7XP01.2|P2C37_ORYSJ  RecName: Full=Probable protein phosphata...  98.2    2e-20   
ref|XP_003549201.1|  PREDICTED: protein phosphatase 2C 7-like         99.0    2e-20   
gb|ADB22517.1|  protein phosphtase 2C                                 99.0    2e-20   
ref|XP_009603753.1|  PREDICTED: probable protein phosphatase 2C 5...  98.6    2e-20   
gb|EAY99256.1|  hypothetical protein OsI_21218                        97.8    2e-20   
ref|XP_004507966.1|  PREDICTED: probable protein phosphatase 2C 6...  99.0    2e-20   
ref|NP_001056498.1|  Os05g0592800                                     97.8    2e-20   
ref|XP_006342331.1|  PREDICTED: probable protein phosphatase 2C 6...  98.6    2e-20   
dbj|BAJ93332.1|  predicted protein                                    97.1    2e-20   
ref|XP_010471312.1|  PREDICTED: protein phosphatase 2C 16-like        98.2    2e-20   
ref|XP_006342334.1|  PREDICTED: probable protein phosphatase 2C 6...  98.6    2e-20   
ref|XP_006342333.1|  PREDICTED: probable protein phosphatase 2C 6...  98.6    2e-20   
ref|XP_009603752.1|  PREDICTED: probable protein phosphatase 2C 5...  98.6    2e-20   
ref|XP_009592346.1|  PREDICTED: probable protein phosphatase 2C 51    97.1    2e-20   
ref|XP_009603748.1|  PREDICTED: probable protein phosphatase 2C 5...  98.6    2e-20   
ref|XP_010324033.1|  PREDICTED: probable protein phosphatase 2C 5...  98.6    2e-20   
ref|XP_003568010.1|  PREDICTED: probable protein phosphatase 2C 50    96.7    2e-20   
ref|XP_006655532.1|  PREDICTED: probable protein phosphatase 2C 5...  96.3    2e-20   
emb|CDY50002.1|  BnaC08g12090D                                        94.4    3e-20   
ref|XP_010324031.1|  PREDICTED: probable protein phosphatase 2C 5...  98.6    3e-20   
gb|EMS67545.1|  putative protein phosphatase 2C 9                     96.3    3e-20   
ref|XP_004243737.1|  PREDICTED: probable protein phosphatase 2C 5...  98.6    3e-20   
gb|AFZ94860.1|  ABI1                                                  98.6    3e-20   
ref|XP_004243738.1|  PREDICTED: probable protein phosphatase 2C 5...  98.2    3e-20   
ref|XP_010324032.1|  PREDICTED: probable protein phosphatase 2C 5...  98.2    3e-20   
ref|XP_011084498.1|  PREDICTED: probable protein phosphatase 2C 51    96.7    3e-20   
ref|XP_004303667.1|  PREDICTED: protein phosphatase 2C 16-like        98.6    3e-20   
ref|XP_008793265.1|  PREDICTED: probable protein phosphatase 2C 50    98.2    3e-20   
ref|XP_009777428.1|  PREDICTED: probable protein phosphatase 2C 5...  98.2    3e-20   
ref|XP_009413161.1|  PREDICTED: probable protein phosphatase 2C 37    97.1    3e-20   
gb|KGN57314.1|  hypothetical protein Csa_3G178550                     97.1    3e-20   
ref|XP_009777432.1|  PREDICTED: probable protein phosphatase 2C 5...  97.8    3e-20   
ref|XP_011014551.1|  PREDICTED: probable protein phosphatase 2C 51    96.3    3e-20   
ref|XP_009777431.1|  PREDICTED: probable protein phosphatase 2C 5...  98.2    3e-20   
ref|XP_004148120.1|  PREDICTED: probable protein phosphatase 2C 7...  97.1    3e-20   
ref|XP_010498129.1|  PREDICTED: protein phosphatase 2C 7              96.3    3e-20   
ref|NP_001146047.1|  uncharacterized protein LOC100279578             96.3    3e-20   
tpg|DAA61043.1|  TPA: putative protein phosphatase 2C family protein  96.3    3e-20   
gb|ADE75869.1|  unknown                                               98.2    3e-20   
ref|XP_011003890.1|  PREDICTED: probable protein phosphatase 2C 51    96.3    3e-20   
ref|XP_006653165.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  95.5    3e-20   
ref|XP_002297978.2|  hypothetical protein POPTR_0001s10570g           96.7    3e-20   
gb|KHN35879.1|  Hypothetical protein glysoja_013304                   95.9    4e-20   
ref|XP_010925402.1|  PREDICTED: probable protein phosphatase 2C 50    97.8    4e-20   
ref|XP_002516100.1|  protein phosphatase 2c, putative                 98.2    4e-20   
ref|XP_004956590.1|  PREDICTED: probable protein phosphatase 2C 6...  96.3    4e-20   
ref|XP_011026901.1|  PREDICTED: probable protein phosphatase 2C 51    96.7    4e-20   
gb|KHG05918.1|  hypothetical protein F383_06733                       96.3    4e-20   
ref|XP_007138695.1|  hypothetical protein PHAVU_009G229900g           97.8    4e-20   
gb|ACF86234.1|  unknown                                               96.7    4e-20   
ref|XP_006661120.1|  PREDICTED: probable protein phosphatase 2C 6...  93.6    4e-20   
gb|AFW79364.1|  putative protein phosphatase 2C family protein        97.1    4e-20   
ref|XP_008801334.1|  PREDICTED: probable protein phosphatase 2C 75    96.3    5e-20   
ref|XP_009626022.1|  PREDICTED: probable protein phosphatase 2C 51    95.9    5e-20   
ref|XP_003580928.1|  PREDICTED: probable protein phosphatase 2C 37    95.9    5e-20   
ref|XP_010933108.1|  PREDICTED: probable protein phosphatase 2C 7...  96.7    5e-20   
ref|XP_010416043.1|  PREDICTED: protein phosphatase 2C 16-like is...  97.4    5e-20   
ref|XP_002864129.1|  hypothetical protein ARALYDRAFT_495242           96.3    6e-20   
ref|XP_009382153.1|  PREDICTED: probable protein phosphatase 2C 75    96.3    6e-20   
ref|XP_003542343.1|  PREDICTED: protein phosphatase 2C 7-like iso...  97.4    6e-20   
ref|XP_010109071.1|  putative protein phosphatase 2C 75               95.9    6e-20   
ref|XP_002441446.1|  hypothetical protein SORBIDRAFT_09g026860        94.4    6e-20   
ref|XP_010480517.1|  PREDICTED: protein phosphatase 2C 7-like         95.1    6e-20   
emb|CDP12151.1|  unnamed protein product                              96.3    6e-20   
ref|XP_007210812.1|  hypothetical protein PRUPE_ppa016954mg           95.1    7e-20   
ref|XP_010317471.1|  PREDICTED: probable protein phosphatase 2C 51    95.9    7e-20   
ref|XP_008648017.1|  PREDICTED: uncharacterized protein LOC100381...  95.5    7e-20   
ref|XP_008650084.1|  PREDICTED: probable protein phosphatase 2C 5...  97.4    7e-20   
ref|XP_006654873.1|  PREDICTED: probable protein phosphatase 2C 5...  96.3    7e-20   
ref|XP_010096827.1|  putative protein phosphatase 2C 8                95.5    7e-20   
ref|XP_004972043.1|  PREDICTED: probable protein phosphatase 2C 8...  96.3    7e-20   
ref|XP_008239117.1|  PREDICTED: probable protein phosphatase 2C 51    95.1    7e-20   
ref|XP_010915189.1|  PREDICTED: probable protein phosphatase 2C 5...  97.1    7e-20   
ref|XP_009795186.1|  PREDICTED: protein phosphatase 2C 16-like        97.1    7e-20   
ref|NP_173199.2|  protein phosphatase 2C 7                            97.1    7e-20   
ref|XP_009358598.1|  PREDICTED: probable protein phosphatase 2C 8     95.5    7e-20   
ref|XP_006490277.1|  PREDICTED: probable protein phosphatase 2C 7...  96.3    7e-20   
gb|KHG12551.1|  Protein phosphatase 2C 16 -like protein               97.4    8e-20   
ref|XP_002975146.1|  hypothetical protein SELMODRAFT_174627           96.7    8e-20   
ref|XP_006421790.1|  hypothetical protein CICLE_v10004981mg           95.9    8e-20   
ref|XP_011041658.1|  PREDICTED: probable protein phosphatase 2C 75    95.5    8e-20   
ref|XP_010476912.1|  PREDICTED: protein phosphatase 2C 7              96.7    8e-20   
gb|KEH32480.1|  protein phosphatase 2C ABI2-like protein              96.7    8e-20   
ref|XP_009358595.1|  PREDICTED: probable protein phosphatase 2C 8     95.1    8e-20   
ref|XP_007038514.1|  Phosphatase 2C family protein, putative          95.9    9e-20   
ref|XP_009355509.1|  PREDICTED: protein phosphatase 2C 16-like        97.1    9e-20   
ref|XP_001781791.1|  predicted protein                                94.7    9e-20   
gb|AHN16196.1|  AHG1.1                                                95.5    1e-19   
dbj|BAC43252.1|  unknown protein                                      96.7    1e-19   
ref|NP_199989.1|  probable protein phosphatase AHG1                   95.5    1e-19   
ref|XP_009132588.1|  PREDICTED: probable protein phosphatase 2C 75    95.5    1e-19   
ref|XP_009616042.1|  PREDICTED: protein phosphatase 2C 16-like        96.7    1e-19   
ref|XP_007154623.1|  hypothetical protein PHAVU_003G134200g           96.7    1e-19   
ref|XP_010696551.1|  PREDICTED: probable protein phosphatase 2C 50    96.3    1e-19   
ref|XP_009340690.1|  PREDICTED: protein phosphatase 2C 16-like        96.7    1e-19   
gb|EEC79599.1|  hypothetical protein OsI_20785                        94.4    1e-19   
ref|XP_009372387.1|  PREDICTED: protein phosphatase 2C 16-like        96.7    1e-19   
ref|XP_008220516.1|  PREDICTED: probable protein phosphatase 2C 6     96.7    1e-19   
ref|XP_006342957.1|  PREDICTED: protein phosphatase 2C 16-like is...  95.9    1e-19   
ref|XP_010317458.1|  PREDICTED: probable protein phosphatase 2C 7...  94.4    1e-19   
ref|XP_010443374.1|  PREDICTED: protein phosphatase 2C 77-like        95.9    1e-19   
ref|XP_003534931.1|  PREDICTED: probable protein phosphatase 2C 6...  96.3    2e-19   
ref|XP_003565810.1|  PREDICTED: probable protein phosphatase 2C 53    95.1    2e-19   
emb|CDP03129.1|  unnamed protein product                              95.9    2e-19   
ref|NP_001056169.2|  Os05g0537400                                     94.4    2e-19   
ref|XP_010061834.1|  PREDICTED: probable protein phosphatase 2C 75    94.7    2e-19   
ref|XP_010443694.1|  PREDICTED: probable protein phosphatase 2C 75    94.7    2e-19   
ref|XP_006342955.1|  PREDICTED: protein phosphatase 2C 16-like is...  95.9    2e-19   
gb|EEE64510.1|  hypothetical protein OsJ_19361                        94.4    2e-19   
gb|EYU26427.1|  hypothetical protein MIMGU_mgv1a017851mg              94.0    2e-19   
ref|XP_007207548.1|  hypothetical protein PRUPE_ppa017533mg           90.9    2e-19   
ref|XP_004303490.1|  PREDICTED: protein phosphatase 2C 16-like        95.9    2e-19   
ref|XP_006401249.1|  hypothetical protein EUTSA_v10013611mg           94.7    2e-19   
ref|XP_008356591.1|  PREDICTED: protein phosphatase 2C 7-like         96.3    2e-19   
pdb|3NMV|B  Chain B, Crystal Structure Of Pyrabactin-Bound Abscis...  93.6    3e-19   
ref|XP_011078036.1|  PREDICTED: probable protein phosphatase 2C 50    95.5    3e-19   



>dbj|BAD06583.1| protein phosphatase 2C [Nicotiana tabacum]
Length=143

 Score =   174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT+RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  24   GVLAMSRAIGDNYLKPYVISEPEVTITERTDEDECLILASDGLWDVVSNETACGVARMCL  83

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            Q R+PPSP     NDV+VT  +GESSD+ CSDASILLTKLALARH+
Sbjct  84   QSRRPPSPQGPPENDVTVT-GAGESSDQLCSDASILLTKLALARHS  128



>ref|XP_004239911.1| PREDICTED: protein phosphatase 2C 37 [Solanum lycopersicum]
Length=409

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  290  GVLAMSRAIGDNYLKPYVISEPEVTITDRTNEDECLILASDGLWDVVSNETACGVARMCL  349

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            Q R+PPSP    GND++VT  +GESSDKACSDASILLTKLALARH
Sbjct  350  QSRRPPSPAGSPGNDITVT-GAGESSDKACSDASILLTKLALARH  393



>ref|XP_006355694.1| PREDICTED: protein phosphatase 2C 37-like [Solanum tuberosum]
Length=418

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  299  GVLAMSRAIGDNYLKPYVISEPEVTITDRTNEDECLILASDGLWDVVSNETACGVARMCL  358

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            Q R+PPSP    GND++VT  +GESSDKACSDASILLTKLALARH
Sbjct  359  QSRRPPSPAGSPGNDITVT-GAGESSDKACSDASILLTKLALARH  402



>ref|XP_009604512.1| PREDICTED: protein phosphatase 2C 37-like [Nicotiana tomentosiformis]
 emb|CAC10358.1| protein phosphatase 2C [Nicotiana tabacum]
 emb|CAC84141.2| protein phosphatase 2C [Nicotiana tabacum]
Length=416

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT+RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  297  GVLAMSRAIGDNYLKPYVISEPEVTITERTEEDECLILASDGLWDVVSNETACGVARMCL  356

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            Q RKPPSP     NDV+VT  +GESSD+ CSDASILLTKLALARH+
Sbjct  357  QSRKPPSPHGSPENDVTVT-GAGESSDQLCSDASILLTKLALARHS  401



>gb|EPS71711.1| hypothetical protein M569_03048 [Genlisea aurea]
Length=394

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 99/108 (92%), Gaps = 3/108 (3%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT RTAEDE LILASDGLWDVVSNETACGVARMCL
Sbjct  276  GVLAMSRAIGDNYLKPYVISEPEVTITDRTAEDECLILASDGLWDVVSNETACGVARMCL  335

Query  182  QHRKPPSPLPLS-GNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            Q RKP +P PLS GNDV+VT S GESSDK+C+DASILLTKLALARH+ 
Sbjct  336  QSRKPNAP-PLSPGNDVAVT-SVGESSDKSCADASILLTKLALARHSG  381



>dbj|BAF43700.1| protein phosphatase 2C [Nicotiana tabacum]
Length=416

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT+RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  297  GVLAMSRAIGDNYLKPYVISEPEVTITERTDEDECLILASDGLWDVVSNETACGVARMCL  356

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            Q R+PPSP     NDV+VT  +GESSD+ CSDASILLTKLALARH+
Sbjct  357  QSRRPPSPQGPPENDVTVT-GAGESSDQLCSDASILLTKLALARHS  401



>ref|XP_009802038.1| PREDICTED: protein phosphatase 2C 37-like [Nicotiana sylvestris]
Length=416

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT+RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  297  GVLAMSRAIGDNYLKPYVISEPEVTITERTDEDECLILASDGLWDVVSNETACGVARMCL  356

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            Q R+PPSP     NDV+VT  +GESSD+ CSDASILLTKLALARH+
Sbjct  357  QSRRPPSPQGPPENDVTVT-GAGESSDQLCSDASILLTKLALARHS  401



>emb|CAB90633.1| protein phpsphatase 2C (PP2C) [Fagus sylvatica]
Length=413

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT RTAEDE LILASDGLWDVVSNETACGVARMCL
Sbjct  292  GVLAMSRAIGDNYLKPYVISEPEVTITDRTAEDECLILASDGLWDVVSNETACGVARMCL  351

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + +KP SP    GND++V  +S ESSDKACSDASILLTKLALARH+
Sbjct  352  RAQKPSSPPRSPGNDMAVGAAS-ESSDKACSDASILLTKLALARHS  396



>gb|EYU19939.1| hypothetical protein MIMGU_mgv1a007028mg [Erythranthe guttata]
Length=422

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+TIT R   DE LI+ASDGLWDVVSNETACGVARMCL
Sbjct  303  GVLAMSRAIGDNYLKPYVIPEPEVTITGRAEGDECLIIASDGLWDVVSNETACGVARMCL  362

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            Q R+PP P P  G+ ++V P+ GESSD+ACSDASILLTKLALARH+
Sbjct  363  QSRRPPPPAPEVGS-IAVAPAPGESSDQACSDASILLTKLALARHS  407



>ref|XP_011091509.1| PREDICTED: protein phosphatase 2C 37-like [Sesamum indicum]
Length=425

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT+RTAEDE LILASDGLWDVVSNETACGVARMCL
Sbjct  307  GVLAMSRAIGDNYLKPYVISEPEVTITERTAEDECLILASDGLWDVVSNETACGVARMCL  366

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            Q RKPPSP    GND+ VT  +GESSDKACSDASILLTKLALARH+
Sbjct  367  QSRKPPSPPRSPGNDIIVT-EAGESSDKACSDASILLTKLALARHS  411



>ref|XP_011076792.1| PREDICTED: protein phosphatase 2C 37-like [Sesamum indicum]
Length=415

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 92/106 (87%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT+RTA DE LILASDGLWDVVSNETACGVARMCL
Sbjct  302  GVLAMSRAIGDNYLKPYVISEPEVTITERTAGDECLILASDGLWDVVSNETACGVARMCL  361

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            Q R PPSP      + +   ++GESSD+ACSDASILLTKLALARH+
Sbjct  362  QSRLPPSP------EATPMTAAGESSDRACSDASILLTKLALARHS  401



>gb|EYU35238.1| hypothetical protein MIMGU_mgv1a006976mg [Erythranthe guttata]
Length=424

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+TIT+RTAEDE +ILASDGLWDVVSNETACGVARMCL
Sbjct  306  GVLAMSRAIGDNYLKPYVIPEPEVTITERTAEDECIILASDGLWDVVSNETACGVARMCL  365

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            Q RKPPSP    GND++VT  +GESSDKACSDASILLTKLALARH+
Sbjct  366  QSRKPPSPPRSPGNDITVT-EAGESSDKACSDASILLTKLALARHS  410



>ref|XP_002524215.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF38139.1| protein phosphatase 2c, putative [Ricinus communis]
Length=415

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+T+T+R  EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  287  GVLAMSRAIGDNYLKPYVIPEPEVTVTERREEDECLILASDGLWDVVSNETACGVARMCL  346

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            +   P SP  L+G+D  V   S ESSDKACSDASILLTKLALARH+
Sbjct  347  RAEGPLSPPGLTGSDAGVGGGSVESSDKACSDASILLTKLALARHS  392



>emb|CDP00134.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TI  R+ ED+ LILA+DGLWDVVSN+TACGVARMCL
Sbjct  309  GVLAMSRAIGDNYLKPYVISEPEVTIIDRSGEDDCLILATDGLWDVVSNDTACGVARMCL  368

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            Q   PPSP+   G+D ++  S+GESSDKACSDASILLTKLALAR +
Sbjct  369  QSGMPPSPVRSPGSDATLN-SAGESSDKACSDASILLTKLALARRS  413



>ref|XP_009772290.1| PREDICTED: protein phosphatase 2C 37-like [Nicotiana sylvestris]
Length=428

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+TIT+RT +DE LILASDGLWDVVSNETACGVARMCL
Sbjct  309  GVLAMSRAIGDNYLKPYVTSEPEVTITERTVDDECLILASDGLWDVVSNETACGVARMCL  368

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            +  +P SP     NDV+ T  SG++SD+AC+DASILLT+LALARH
Sbjct  369  RSGRPQSPPGSPANDVTPT-VSGDNSDQACTDASILLTRLALARH  412



>gb|KDP44892.1| hypothetical protein JCGZ_01392 [Jatropha curcas]
Length=420

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+T+T+RTAEDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  299  GVLAMSRAIGDNYLKPYVIPEPEVTVTERTAEDECLILASDGLWDVVSNDTACGVARMCL  358

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + ++PPSP    G+D +V   S ESSD+ACSDASILLTKLALARH+
Sbjct  359  RAQRPPSPPASPGSDAAVRSGSVESSDEACSDASILLTKLALARHS  404



>gb|KHF99990.1| Protein phosphatase 2C 37 -like protein [Gossypium arboreum]
Length=413

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+VI EPE+TIT+R+++DE LIL SDGLWDVV+NETACGVARMCL
Sbjct  291  GVLAMSRAIGDNYLKPFVIPEPEVTITERSSKDECLILGSDGLWDVVTNETACGVARMCL  350

Query  182  QHRKPPSPLPLSGNDVSVTPSSG-ESSDKACSDASILLTKLALARHT  319
            + +KP SP P+S +  +V   +G ESSDKAC DASILLTKLALARH+
Sbjct  351  RAQKPASP-PMSPDSDAVVRGAGVESSDKACWDASILLTKLALARHS  396



>gb|KDO66647.1| hypothetical protein CISIN_1g0368521mg, partial [Citrus sinensis]
Length=224

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+  RTA D+ LILA+DGLWDVVSNETACGVARMCL
Sbjct  101  GVLAMSRAIGDNYLKPYVSCEPEVTVVDRTAADDCLILATDGLWDVVSNETACGVARMCL  160

Query  182  --QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
              + R P +  P +  DVS    SGE++DK CSDAS+LLTKLALARH+
Sbjct  161  RGKGRAPLAATPGAAPDVSNNNGSGETTDKCCSDASLLLTKLALARHS  208



>ref|XP_004503174.1| PREDICTED: protein phosphatase 2C 37-like [Cicer arietinum]
Length=405

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 89/107 (83%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+R  EDE LILASDGLWDVVSN+TACGV RMCL
Sbjct  280  GVLAMSRAIGDNYLKPYVISEPEVTVTERKDEDECLILASDGLWDVVSNDTACGVVRMCL  339

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + +K PSP    GN+   T    + SD+ACSDASILLTKLALARH++
Sbjct  340  KAQKQPSPPGSPGNNDVTT----DGSDRACSDASILLTKLALARHSS  382



>ref|XP_011002618.1| PREDICTED: protein phosphatase 2C 37 [Populus euphratica]
Length=402

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EP++T+T+RTAEDEFLILASDGLWDVV N+TACGV R CL
Sbjct  281  GVLAMSRAIGDNYLKPYVIPEPDVTLTERTAEDEFLILASDGLWDVVPNDTACGVVRTCL  340

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + RKPPSP    G+D +V  ++ ESSDK+CSDAS+LLTKLALARH+
Sbjct  341  RARKPPSPPGSPGSDAAVARAAIESSDKSCSDASVLLTKLALARHS  386



>ref|XP_002282703.1| PREDICTED: protein phosphatase 2C 37-like [Vitis vinifera]
Length=400

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T   R+ EDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  282  GVLAMSRAIGDNYLKPYVISEPEVTTWDRSPEDECLILASDGLWDVVSNDTACGVARMCL  341

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
              + PPSP P+S    +   + GESSDKAC DAS+LLTKLALAR +A
Sbjct  342  NAQAPPSP-PVSPETGAGIGAGGESSDKACLDASMLLTKLALARDSA  387



>ref|XP_003552788.1| PREDICTED: protein phosphatase 2C 37 [Glycine max]
Length=400

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 89/106 (84%), Gaps = 10/106 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+ +T+RT EDE LILASDGLWDVVSNETACGV RMCL
Sbjct  278  GVLAMSRAIGDNYLKPYVISEPEVMVTERTEEDECLILASDGLWDVVSNETACGVVRMCL  337

Query  182  QHRKPP-SPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +KPP SP    G+DV     + + SD+ACSDASILLTKLALARH
Sbjct  338  KAQKPPGSP----GSDV-----AADGSDRACSDASILLTKLALARH  374



>emb|CDQ51997.1| protein phosphatase 2C, partial [Fagus sylvatica]
Length=376

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT RTAEDE LILASDGLWDVVSNETACGVARMCL
Sbjct  283  GVLAMSRAIGDNYLKPYVISEPEVTITDRTAEDECLILASDGLWDVVSNETACGVARMCL  342

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASI  286
            + +KP SP    GND++V  +S ESSDKACSDASI
Sbjct  343  RAQKPSSPPRSPGNDMAVGAAS-ESSDKACSDASI  376



>ref|XP_010262609.1| PREDICTED: protein phosphatase 2C 37-like [Nelumbo nucifera]
Length=424

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+RT ED+ LILASDGLWDVVSNETAC + RMCL
Sbjct  306  GVLAMSRAIGDNYLKPYVISEPEVTVTERTDEDDCLILASDGLWDVVSNETACSIVRMCL  365

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            +  +P  PL   GN++S    +GESSDKACSDAS+LLTKLALARH+
Sbjct  366  RG-QPLPPLVSPGNNLS-DGVAGESSDKACSDASMLLTKLALARHS  409



>ref|XP_002311183.2| Protein phosphatase 2C family protein [Populus trichocarpa]
 gb|ABK95159.1| unknown [Populus trichocarpa]
 gb|EEE88550.2| Protein phosphatase 2C family protein [Populus trichocarpa]
Length=390

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 87/106 (82%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+T+T+R  EDE LILASDGLWDVVSN+TACGV RMCL
Sbjct  277  GVLAMSRAIGDNYLKPYVIPEPEVTVTERMEEDECLILASDGLWDVVSNDTACGVVRMCL  336

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + +KPPSP P S   +        SSDKACSDAS+LLTKLALARH+
Sbjct  337  RAQKPPSP-PGSNGALG-------SSDKACSDASVLLTKLALARHS  374



>ref|XP_011033764.1| PREDICTED: protein phosphatase 2C 37-like [Populus euphratica]
Length=390

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+T+T+R  EDE LILASDGLWDVVSN+TACGV RMCL
Sbjct  277  GVLAMSRAIGDNYLKPYVIPEPEVTVTERMEEDECLILASDGLWDVVSNDTACGVVRMCL  336

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + +KPPSP    G++ ++      SSD+ACSDAS+LLTKLALARH+
Sbjct  337  RAQKPPSP---QGSNGAIG-----SSDRACSDASVLLTKLALARHS  374



>ref|XP_006488392.1| PREDICTED: probable protein phosphatase 2C 78-like [Citrus sinensis]
Length=429

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+  RTA D+ LILA+DGLWDVVSNETACGVARMCL
Sbjct  306  GVLAMSRAIGDNYLKPYVTCEPEVTVVDRTAADDCLILATDGLWDVVSNETACGVARMCL  365

Query  182  --QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
              + R P +  P +  DVS +  SGE++DK CSDAS+LLTKLALARH+
Sbjct  366  RGKGRAPLAATPGAAPDVSNSNGSGETTDKCCSDASLLLTKLALARHS  413



>ref|XP_004307470.1| PREDICTED: protein phosphatase 2C 37-like [Fragaria vesca subsp. 
vesca]
Length=422

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 87/106 (82%), Gaps = 3/106 (3%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TI  RTAEDE LILASDGLWDVVSN+TACGV RMCL
Sbjct  301  GVLAMSRAIGDNYLKPYVISEPEVTIMDRTAEDECLILASDGLWDVVSNDTACGVVRMCL  360

Query  182  QHRKPPSPLPLSGNDVSVTPSS-GESSDKACSDASILLTKLALARH  316
            + +K P      G DV+   SS G +SDKAC+DASILLTKLALAR 
Sbjct  361  RAQKTPG--ASGGGDVADGESSAGVNSDKACADASILLTKLALARQ  404



>ref|XP_007009278.1| Phosphatase PP2C isoform 1 [Theobroma cacao]
 gb|EOY18088.1| Phosphatase PP2C isoform 1 [Theobroma cacao]
Length=412

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+VI +PE+TIT+R  EDE LILASDGLWDVV+N+TACGVARMCL
Sbjct  289  GVLAMSRAIGDNYLKPFVIPDPEVTITERKCEDECLILASDGLWDVVTNDTACGVARMCL  348

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + +KPPSP    G+D +V   + ESSDKAC DASILLTKLALARH+
Sbjct  349  RAQKPPSPPGSPGSDAAVRGGAAESSDKACGDASILLTKLALARHS  394



>gb|KHG07039.1| Protein phosphatase 2C 37 -like protein [Gossypium arboreum]
Length=413

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+VISEPE+TITKR  E+E LILASDGLWDVV N+TACGVARMCL
Sbjct  291  GVLAMSRAIGDNYLKPFVISEPEVTITKRKGEEECLILASDGLWDVVPNDTACGVARMCL  350

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            +  KP SP     ++ +V   + ESSDKAC DASILLTKLALARH+
Sbjct  351  RAEKPLSPPVSPSSEAAVKGGTAESSDKACWDASILLTKLALARHS  396



>ref|XP_006424911.1| hypothetical protein CICLE_v10028495mg [Citrus clementina]
 gb|ESR38151.1| hypothetical protein CICLE_v10028495mg [Citrus clementina]
Length=429

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+  RTA D+ LILA+DGLWDVVSNETACGVARMCL
Sbjct  306  GVLAMSRAIGDNYLKPYVTCEPEVTVVDRTAADDCLILATDGLWDVVSNETACGVARMCL  365

Query  182  --QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
              + R P +  P +  DVS    SGE++DK CSDAS+LLTKLALARH+
Sbjct  366  RGKGRAPLAAAPGAVPDVSNNNGSGETTDKCCSDASLLLTKLALARHS  413



>ref|XP_010691227.1| PREDICTED: protein phosphatase 2C 37 [Beta vulgaris subsp. vulgaris]
Length=398

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRAIGDNYLKPYVI +PE+TIT R ++DE LILASDGLWDVVSNETA  VARMCL
Sbjct  280  GMLAMSRAIGDNYLKPYVIPDPEVTITDRASDDECLILASDGLWDVVSNETATAVARMCL  339

Query  182  -QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
                KPPSP P S  + +V  +  ESSDKACSDASILLTKLALAR +A
Sbjct  340  INAEKPPSP-PRSPGNKTVVAAQRESSDKACSDASILLTKLALARQSA  386



>ref|XP_008233481.1| PREDICTED: protein phosphatase 2C 37-like [Prunus mume]
Length=420

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 84/105 (80%), Gaps = 6/105 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TI  R+AEDE LILASDGLWDVVSN+TACGV RMCL
Sbjct  304  GVLAMSRAIGDNYLKPYVISEPEVTIMDRSAEDECLILASDGLWDVVSNDTACGVVRMCL  363

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +K  S    SG D +V       SDKACSDASILLTKLALAR 
Sbjct  364  RAQKTTSHSESSGTDAAV------RSDKACSDASILLTKLALARQ  402



>ref|XP_003538425.1| PREDICTED: protein phosphatase 2C 37 [Glycine max]
Length=401

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 5/105 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+RT EDE LILASDGLWDVVSNETACGV RMCL
Sbjct  279  GVLAMSRAIGDNYLKPYVISEPEVTVTERTEEDECLILASDGLWDVVSNETACGVVRMCL  338

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +KPPSP    G+DV     + + SD+ACSDASILLTKLALARH
Sbjct  339  KAQKPPSPPGSPGSDV-----AADGSDRACSDASILLTKLALARH  378



>gb|AAQ03211.1|AF411074_1 protein phosphatase 2C [Prunus avium]
Length=426

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 84/105 (80%), Gaps = 6/105 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TI  R+AEDE LILASDGLWDVVSN+TACGV RMCL
Sbjct  310  GVLAMSRAIGDNYLKPYVISEPEVTIMDRSAEDECLILASDGLWDVVSNDTACGVVRMCL  369

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +K  S    SG D +V       SDKACSDASILLTKLALAR 
Sbjct  370  RAQKTTSHSESSGRDAAV------RSDKACSDASILLTKLALARQ  408



>ref|XP_007163459.1| hypothetical protein PHAVU_001G236000g [Phaseolus vulgaris]
 gb|ESW35453.1| hypothetical protein PHAVU_001G236000g [Phaseolus vulgaris]
Length=408

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 6/107 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+VISEPE+T+T+R+  DE LILASDGLWDVVSNETACGV +MCL
Sbjct  281  GVLAMSRAIGDYYLKPFVISEPEVTVTERSDGDECLILASDGLWDVVSNETACGVVKMCL  340

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + +KPP+P P  G  V     + + SD+ACSDASILLTKLALARH+A
Sbjct  341  KSQKPPTP-PSPGGYV-----TADGSDRACSDASILLTKLALARHSA  381



>ref|XP_010096621.1| Protein phosphatase 2C 37 [Morus notabilis]
 gb|EXB65289.1| Protein phosphatase 2C 37 [Morus notabilis]
Length=425

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRAIGDNYLKPYVI EPE+T+T RT +DE LILASDGLWDVVSN+TACGVARMCL
Sbjct  304  GMLAMSRAIGDNYLKPYVIPEPEVTVTDRTDDDECLILASDGLWDVVSNDTACGVARMCL  363

Query  182  QHRKPPSPLPLSGNDVSVTPSSG-ESSDKACSDASILLTKLALARHT  319
            + +K PS     GN       +  ESS+KACSDASILLTKLALARH+
Sbjct  364  RAQKRPSAPRSPGNSGEDKKDAAFESSNKACSDASILLTKLALARHS  410



>ref|XP_007163460.1| hypothetical protein PHAVU_001G236000g [Phaseolus vulgaris]
 gb|ESW35454.1| hypothetical protein PHAVU_001G236000g [Phaseolus vulgaris]
Length=417

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 6/107 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+VISEPE+T+T+R+  DE LILASDGLWDVVSNETACGV +MCL
Sbjct  290  GVLAMSRAIGDYYLKPFVISEPEVTVTERSDGDECLILASDGLWDVVSNETACGVVKMCL  349

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + +KPP+P P  G  V     + + SD+ACSDASILLTKLALARH+A
Sbjct  350  KSQKPPTP-PSPGGYV-----TADGSDRACSDASILLTKLALARHSA  390



>ref|XP_002316268.2| Protein phosphatase 2C family protein [Populus trichocarpa]
 gb|EEF02439.2| Protein phosphatase 2C family protein [Populus trichocarpa]
Length=397

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 5/106 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EP++T+T+RTAEDEFLILASDGLWDVV N+TACGV R CL
Sbjct  281  GVLAMSRAIGDNYLKPYVIPEPDVTLTERTAEDEFLILASDGLWDVVPNDTACGVVRSCL  340

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + RKPPSP    G+D ++     ESSDK+CSDAS+LLTKLALARH+
Sbjct  341  RARKPPSPPGSPGSDAAI-----ESSDKSCSDASVLLTKLALARHS  381



>ref|XP_009589075.1| PREDICTED: protein phosphatase 2C 37-like [Nicotiana tomentosiformis]
Length=428

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T+RT +DE LILASDGLWDVVSNETACGVARMCL
Sbjct  309  GVLAMSRAIGDNYLKPYVTSEPEVTVTERTVDDECLILASDGLWDVVSNETACGVARMCL  368

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            +  +PPSP     NDV+ T  SGE+ D+ C+DASILLT+LALARH
Sbjct  369  RSGRPPSPPGSPFNDVTPT-VSGENFDQGCTDASILLTRLALARH  412



>gb|KHG19331.1| Protein phosphatase 2C 3 -like protein [Gossypium arboreum]
Length=416

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+T RTAEDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  294  GVLAMSRAIGDNYLKPYVSCEPEVTVTDRTAEDECLILASDGLWDVVSNDTACGVARMCL  353

Query  182  QHR-KPPSP-LPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + +    +P L L G  V  +   GE SDKAC+DAS+LLTKLALARH+
Sbjct  354  RGKCDVQAPLLSLEGEAVVGSMMGGEISDKACADASMLLTKLALARHS  401



>ref|XP_008344852.1| PREDICTED: probable protein phosphatase 2C 24 [Malus domestica]
Length=205

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV   PE+TIT RT  DE LILASDGLWDVVSNETACGV RMCL
Sbjct  89   GVLAMSRAIGDNYLKPYVSCVPEVTITDRTVXDECLILASDGLWDVVSNETACGVTRMCL  148

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + ++  S +  +G +      +  +SD+ACSDASILLTKLALARH+A
Sbjct  149  RGKRTASAMERAGAE----AVAKVASDRACSDASILLTKLALARHSA  191



>ref|XP_010256813.1| PREDICTED: protein phosphatase 2C 37-like [Nelumbo nucifera]
Length=424

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 90/106 (85%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T RT EDE LILASDGLWDVVS++TAC +ARMCL
Sbjct  306  GVLAMSRAIGDNYLKPYVISEPEVTVTDRTDEDECLILASDGLWDVVSSDTACSIARMCL  365

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
              + P  P+   GN+V+    +GESSDKACSDAS+LLTKLALAR++
Sbjct  366  GGQAPSPPVS-PGNEVN-EGVAGESSDKACSDASMLLTKLALARNS  409



>gb|KEH34758.1| protein phosphatase 2C-like protein [Medicago truncatula]
Length=388

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 89/108 (82%), Gaps = 9/108 (8%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+R  EDE LILASDGLWDVVSN+TACGV RMCL
Sbjct  266  GVLAMSRAIGDNYLKPYVISEPEVTVTERKEEDECLILASDGLWDVVSNDTACGVVRMCL  325

Query  182  QHRK-PPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + +K P +P     N+V+      + SD+ACSDASILLTKLALARH++
Sbjct  326  KAQKLPGTP---ENNEVTT-----DGSDRACSDASILLTKLALARHSS  365



>gb|KCW65565.1| hypothetical protein EUGRSUZ_G02960 [Eucalyptus grandis]
Length=358

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+VI +PE+TI  RTAEDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  236  GVLAMSRAIGDNYLKPFVIPDPEVTIVDRTAEDECLILASDGLWDVVSNDTACGVARMCL  295

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + ++PPSP    G       ++ ESSDKACSDASILLTKLALARH+
Sbjct  296  RAQRPPSPPRSPGGSDLAVGANAESSDKACSDASILLTKLALARHS  341



>ref|XP_008356724.1| PREDICTED: probable protein phosphatase 2C 24 [Malus domestica]
Length=407

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 85/107 (79%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV   PE+TIT RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  291  GVLAMSRAIGDNYLKPYVSCVPEVTITDRTVEDECLILASDGLWDVVSNETACGVARMCL  350

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + ++  S +  +G +         +SD+ACSDASILLTKLALARH+A
Sbjct  351  RGKRTASAMERAGAEAVAKV----ASDRACSDASILLTKLALARHSA  393



>ref|XP_007225540.1| hypothetical protein PRUPE_ppa026727mg, partial [Prunus persica]
 gb|EMJ26739.1| hypothetical protein PRUPE_ppa026727mg, partial [Prunus persica]
Length=162

 Score =   140 bits (354),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 86/106 (81%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RTAEDE LILASDG+WDVVSN+TACGVARMCL
Sbjct  44   GVLAMSRAIGDNYLKPYVSCEPEVTITDRTAEDECLILASDGMWDVVSNDTACGVARMCL  103

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + ++      L+  +     SS  SSD+ACSDAS+LLTKLALARH+
Sbjct  104  RGKR------LAAAEAETDGSSSSSSDRACSDASMLLTKLALARHS  143



>ref|XP_007218057.1| hypothetical protein PRUPE_ppa006174mg [Prunus persica]
 gb|EMJ19256.1| hypothetical protein PRUPE_ppa006174mg [Prunus persica]
Length=424

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 83/105 (79%), Gaps = 6/105 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TI  R+AEDE LILASDGLWDVVSN+TACGV RMCL
Sbjct  308  GVLAMSRAIGDNYLKPYVISEPEVTIMNRSAEDECLILASDGLWDVVSNDTACGVVRMCL  367

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +K  S    SG D +V       SDKAC DASILLTKLALAR 
Sbjct  368  RAQKTTSHSESSGTDAAV------RSDKACLDASILLTKLALARQ  406



>ref|XP_002314150.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE88105.1| phosphatase 2C family protein [Populus trichocarpa]
Length=385

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 89/116 (77%), Gaps = 10/116 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TI  RTAED+ LILASDGLWDVVSNETACGVARMCL
Sbjct  255  GVLAMSRAIGDNYLKPYVSCEPEVTIMDRTAEDDCLILASDGLWDVVSNETACGVARMCL  314

Query  182  ---QHRKPPSPLPLSGND-------VSVTPSSGESSDKACSDASILLTKLALARHT  319
               +H  PP P  L  N+        S +  SGE SDKACSDAS+LLTKLALARH+
Sbjct  315  RAKEHAPPPCPPRLVENNEVLGITTSSSSSGSGEMSDKACSDASMLLTKLALARHS  370



>ref|XP_011080695.1| PREDICTED: probable protein phosphatase 2C 24 [Sesamum indicum]
 ref|XP_011080696.1| PREDICTED: probable protein phosphatase 2C 24 [Sesamum indicum]
Length=400

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 87/108 (81%), Gaps = 8/108 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT+RT EDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  286  GVLAMSRAIGDNYLKPYVSCEPEVTITERTEEDECLILASDGLWDVVSNDTACGVARMCL  345

Query  182  QHR-KPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +    PPSP  + GN+       GESSD  CSDAS+LLTKLALAR +A
Sbjct  346  KGMAAPPSPSSM-GNE------GGESSDGPCSDASMLLTKLALARRSA  386



>gb|KDO69165.1| hypothetical protein CISIN_1g015135mg [Citrus sinensis]
Length=412

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+RTAEDE LILASDGLWDVVSNETAC V R C 
Sbjct  284  GVLAMSRAIGDNYLKPYVISEPEVTVTERTAEDECLILASDGLWDVVSNETACSVVRTCF  343

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +K  +     G+  S    SG+SSDKAC DASILLTKLALAR 
Sbjct  344  RAQKAAAAASPPGSPGSEVAVSGQSSDKACLDASILLTKLALARR  388



>ref|XP_006435621.1| hypothetical protein CICLE_v10031682mg [Citrus clementina]
 gb|ESR48861.1| hypothetical protein CICLE_v10031682mg [Citrus clementina]
Length=411

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+RTAEDE LILASDGLWDVVSNETAC V R C 
Sbjct  284  GVLAMSRAIGDNYLKPYVISEPEVTVTERTAEDECLILASDGLWDVVSNETACSVVRTCF  343

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +K  +     G+  S    SG+SSDKAC DASILLTKLALAR 
Sbjct  344  RAQKAAAAASPPGSPGSEVAVSGQSSDKACLDASILLTKLALARR  388



>ref|XP_006486407.1| PREDICTED: protein phosphatase 2C 37-like [Citrus sinensis]
Length=412

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+RTAEDE LILASDGLWDVVSNETAC V R C 
Sbjct  284  GVLAMSRAIGDNYLKPYVISEPEVTVTERTAEDECLILASDGLWDVVSNETACSVVRTCF  343

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +K  +     G+  S    SG+SSDKAC DASILLTKLALAR 
Sbjct  344  RAQKAAAAASPPGSPGSEVAVSGQSSDKACLDASILLTKLALARR  388



>ref|XP_010067439.1| PREDICTED: protein phosphatase 2C 37-like [Eucalyptus grandis]
 gb|KCW65564.1| hypothetical protein EUGRSUZ_G02960 [Eucalyptus grandis]
Length=413

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+VI +PE+TI  RTAEDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  291  GVLAMSRAIGDNYLKPFVIPDPEVTIVDRTAEDECLILASDGLWDVVSNDTACGVARMCL  350

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + ++PPSP    G       ++ ESSDKACSDASILLTKLALARH+
Sbjct  351  RAQRPPSPPRSPGGSDLAVGANAESSDKACSDASILLTKLALARHS  396



>ref|XP_007205293.1| hypothetical protein PRUPE_ppa006696mg [Prunus persica]
 gb|EMJ06492.1| hypothetical protein PRUPE_ppa006696mg [Prunus persica]
Length=399

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RTAEDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  285  GVLAMSRAIGDNYLKPYVSCEPEVTITDRTAEDECLILASDGLWDVVSNDTACGVARMCL  344

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + ++      L+  +     SS  SSD+ACSDAS+LLTKLALARH+
Sbjct  345  RGKR------LAAAEAETDGSS--SSDRACSDASMLLTKLALARHS  382



>ref|XP_010685683.1| PREDICTED: probable protein phosphatase 2C 24 [Beta vulgaris 
subsp. vulgaris]
Length=431

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RTA+D+ LILASDGLWDVVSN+TACGVARMCL
Sbjct  313  GVLAMSRAIGDNYLKPYVSCEPEVTITDRTADDDCLILASDGLWDVVSNDTACGVARMCL  372

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + + PP+ L     ++  T     ++DKACSDA++LLTKLALARH+
Sbjct  373  KGKVPPATLTPEVEEIIGTCEG--NADKACSDAAMLLTKLALARHS  416



>ref|XP_006344582.1| PREDICTED: protein phosphatase 2C 37-like [Solanum tuberosum]
Length=410

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 82/105 (78%), Gaps = 20/105 (19%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKPYV SEPE+TIT+RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  310  GVLAMSRAIGDSYLKPYVTSEPEVTITERTVEDECLILASDGLWDVVSNETACGVARMCL  369

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            +                    SG+SSD+AC+DASILLT+LALARH
Sbjct  370  R--------------------SGQSSDQACTDASILLTRLALARH  394



>ref|XP_008372056.1| PREDICTED: protein phosphatase 2C 37 [Malus domestica]
Length=423

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 83/105 (79%), Gaps = 7/105 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T RTAEDE LILASDGLWDVVSN+TACGV RMCL
Sbjct  308  GVLAMSRAIGDNYLKPYVISEPEVTVTDRTAEDECLILASDGLWDVVSNDTACGVVRMCL  367

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +   S   L  +       +  SSDKACSD+SILLTKLALAR 
Sbjct  368  RAQTAASQSELCCD-------AAASSDKACSDSSILLTKLALARQ  405



>ref|XP_009351424.1| PREDICTED: protein phosphatase 2C 37-like [Pyrus x bretschneideri]
Length=420

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 83/105 (79%), Gaps = 7/105 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEP++T+T RTAEDE LILASDGLWDVVSN+TACGV RMCL
Sbjct  305  GVLAMSRAIGDNYLKPYVISEPDVTVTDRTAEDECLILASDGLWDVVSNDTACGVVRMCL  364

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +   S   L  +       +  SSDKACSDASILLTKLALAR 
Sbjct  365  RAQTAASQSELCCD-------AAASSDKACSDASILLTKLALARQ  402



>emb|CBI31627.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 81/107 (76%), Gaps = 15/107 (14%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T   R+ EDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  165  GVLAMSRAIGDNYLKPYVISEPEVTTWDRSPEDECLILASDGLWDVVSNDTACGVARMCL  224

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
              + PPSP                SSDKAC DAS+LLTKLALAR +A
Sbjct  225  NAQAPPSP---------------PSSDKACLDASMLLTKLALARDSA  256



>ref|XP_011032242.1| PREDICTED: probable protein phosphatase 2C 24 [Populus euphratica]
Length=438

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 90/116 (78%), Gaps = 10/116 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TI  RTAED+ LILASDGLWDVVSNETACGVARMCL
Sbjct  308  GVLAMSRAIGDNYLKPYVSCEPEVTIMDRTAEDDCLILASDGLWDVVSNETACGVARMCL  367

Query  182  ---QHRKPPS-PLPLSGNDV------SVTPSSGESSDKACSDASILLTKLALARHT  319
               +H  PP  P  +  N+V      S +  SGE SDKACSDAS+LLTKLALARH+
Sbjct  368  RAKEHAPPPCPPRSVENNEVLGITSSSSSSGSGEMSDKACSDASMLLTKLALARHS  423



>ref|XP_004241211.1| PREDICTED: probable protein phosphatase 2C 24 [Solanum lycopersicum]
Length=410

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 85/106 (80%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+TIT RT+ED+ LILASDGLWDVVSN+TACGVA MCL
Sbjct  296  GVLAMSRAIGDNYLKPYVICEPEVTITDRTSEDDCLILASDGLWDVVSNDTACGVAGMCL  355

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            +    P+ +P +G D  V      +SD+ CSDAS+LLTKLALAR +
Sbjct  356  KGNASPASMPGNGTDGEV------NSDQCCSDASMLLTKLALARRS  395



>ref|XP_010106553.1| putative protein phosphatase 2C 24 [Morus notabilis]
 gb|EXC10729.1| putative protein phosphatase 2C 24 [Morus notabilis]
Length=412

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 87/107 (81%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RTA+D+ LILASDGLWDVVSNETACGVARMCL
Sbjct  294  GVLAMSRAIGDNYLKPYVSCEPEVTITDRTADDDCLILASDGLWDVVSNETACGVARMCL  353

Query  182  QHR-KPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + + K PS  P      S  P  GE SDKACSDAS+LLTKLALARH+
Sbjct  354  RGKAKIPSGSPQLPE--SEAP-GGEISDKACSDASMLLTKLALARHS  397



>ref|XP_007141853.1| hypothetical protein PHAVU_008G231200g [Phaseolus vulgaris]
 gb|ESW13847.1| hypothetical protein PHAVU_008G231200g [Phaseolus vulgaris]
Length=399

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 83/105 (79%), Gaps = 9/105 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+R+ EDE LIL SDGLWD V N+TAC VARMCL
Sbjct  285  GVLAMSRAIGDNYLKPYVISEPEVTVTERSEEDECLILGSDGLWDTVQNDTACKVARMCL  344

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
              +K  SP    G +++V     E SDKACSDASILLTKLAL RH
Sbjct  345  NGQKAASP----GRELAV-----ECSDKACSDASILLTKLALVRH  380



>ref|XP_007016311.1| Highly ABA-induced PP2C gene 2 isoform 1 [Theobroma cacao]
 gb|EOY33930.1| Highly ABA-induced PP2C gene 2 isoform 1 [Theobroma cacao]
Length=468

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+ IT R AED+ LILASDGLWDVVSN+TACGVARMCL
Sbjct  343  GVLAMSRAIGDNYLKPYVSCEPEVMITDRAAEDDCLILASDGLWDVVSNDTACGVARMCL  402

Query  182  Q-----HRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            +     H  P SP      +  +  + GE SDKAC+DAS+LLTKLALARH+
Sbjct  403  RGKGNLHAPPYSPAEGVEREAVLGSTMGEISDKACTDASMLLTKLALARHS  453



>ref|XP_002282608.1| PREDICTED: probable protein phosphatase 2C 24 [Vitis vinifera]
Length=408

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 85/107 (79%), Gaps = 6/107 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+V  EPE+TIT+R+AEDE LILASDGLWDVVSNETACGVARMCL
Sbjct  294  GVLAMSRAIGDNYLKPFVSCEPEVTITERSAEDECLILASDGLWDVVSNETACGVARMCL  353

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + + P           +     GE+ DKACSDAS+LLTKLALARHTA
Sbjct  354  KGKVPEGVE------GAENEGEGEAWDKACSDASMLLTKLALARHTA  394



>emb|CDP09108.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 85/107 (79%), Gaps = 7/107 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV   PE+TIT RTAED+ LILASDGLWDVVSN+TACGVARMCL
Sbjct  298  GVLAMSRAIGDNYLKPYVSCVPEVTITDRTAEDDCLILASDGLWDVVSNDTACGVARMCL  357

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +  K P   P  G +V       E+SDKACSDAS+LLTKLALAR +A
Sbjct  358  KKGKGPPCSP--GEEV-----GNENSDKACSDASMLLTKLALARRSA  397



>emb|CBI16058.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 82/107 (77%), Gaps = 21/107 (20%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+V  EPE+TIT+R+AEDE LILASDGLWDVVSNETACGVARMCL
Sbjct  294  GVLAMSRAIGDNYLKPFVSCEPEVTITERSAEDECLILASDGLWDVVSNETACGVARMCL  353

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +                     G++ DKACSDAS+LLTKLALARHTA
Sbjct  354  K---------------------GKAWDKACSDASMLLTKLALARHTA  379



>ref|XP_008457441.1| PREDICTED: probable protein phosphatase 2C 24 [Cucumis melo]
Length=427

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 86/109 (79%), Gaps = 4/109 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT RTAEDE LIL SDGLWDVV NETACGVA MCL
Sbjct  303  GVLAMSRAIGDNYLKPYVISEPEVTITNRTAEDECLILGSDGLWDVVPNETACGVASMCL  362

Query  182  QHRKPPSPLPLSGNDVSVTPSSGE---SSDKACSDASILLTKLALARHT  319
            +  K      LS +  + T   GE   ++DKAC+DAS+LLTKLALARH+
Sbjct  363  RG-KADERSALSPSREAETAVEGEERGNADKACNDASMLLTKLALARHS  410



>gb|AIA58904.1| protein phosphatase, partial [Populus deltoides]
Length=439

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 88/116 (76%), Gaps = 10/116 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIG NYLKPYV  EPE+TI  RTAED+ LILASDGLWDVVSNETACGVARMCL
Sbjct  309  GVLAMSRAIGPNYLKPYVSCEPEVTIMDRTAEDDCLILASDGLWDVVSNETACGVARMCL  368

Query  182  ---QHRKPPSPLPLSGND-------VSVTPSSGESSDKACSDASILLTKLALARHT  319
               +H  PP P  L  N+        S +  SGE SDKACSDAS+LLTKLALARH+
Sbjct  369  RAKEHAPPPCPPRLVENNEVLGITTSSSSSGSGEMSDKACSDASMLLTKLALARHS  424



>ref|XP_004490902.1| PREDICTED: protein phosphatase 2C 37-like [Cicer arietinum]
Length=416

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 86/109 (79%), Gaps = 13/109 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT+R+ EDE LILASDGLWDVV N+TAC V +MCL
Sbjct  297  GVLAMSRAIGDNYLKPYVISEPEVTITERSDEDECLILASDGLWDVVQNDTACRVVQMCL  356

Query  182  QHRK----PPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            +  K    P SP    G+DV     +G+ SDKAC DASILLTKLALARH
Sbjct  357  KAEKTLTSPGSP----GSDV-----AGDGSDKACYDASILLTKLALARH  396



>ref|XP_007203519.1| hypothetical protein PRUPE_ppa024950mg [Prunus persica]
 gb|EMJ04718.1| hypothetical protein PRUPE_ppa024950mg [Prunus persica]
Length=198

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 84/106 (79%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RTAEDE LIL SDGLWDVVSN+TACGVARMCL
Sbjct  80   GVLAMSRAIGDNYLKPYVSCEPEVTITDRTAEDECLILVSDGLWDVVSNDTACGVARMCL  139

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + ++      L+  +     SS  SSD+AC DAS+LLTKLALARH+
Sbjct  140  RGKR------LAAAEAETDGSSSSSSDRACFDASMLLTKLALARHS  179



>gb|ABC16634.1| protein phosphatase PP2C [Gossypium hirsutum]
Length=416

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+VI +PE+TIT+R +EDE LIL SDGLWDVV+N+ AC V RMCL
Sbjct  293  GVLAMSRAIGDNYLKPFVIPKPEVTITERRSEDECLILGSDGLWDVVTNDMACKVVRMCL  352

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
              RK       SGN+++V   + ES DK C DAS+LLTKLAL RH+A
Sbjct  353  CARKSSFAPGFSGNEMAVKNGALESFDKQCWDASVLLTKLALVRHSA  399



>ref|XP_009343867.1| PREDICTED: protein phosphatase 2C 37-like [Pyrus x bretschneideri]
Length=420

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 83/107 (78%), Gaps = 5/107 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RTAEDE LILASDGLWDVVSNETAC VARMCL
Sbjct  303  GVLAMSRAIGDNYLKPYVTSEPEVTVTDRTAEDECLILASDGLWDVVSNETACRVARMCL  362

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
              +K  +         S    +   SDKACSDASILLTKLALARH++
Sbjct  363  LAQKAAASRS-----ASSCCDAATRSDKACSDASILLTKLALARHSS  404



>gb|ABD65465.1| protein phosphatase 2C [Gossypium hirsutum]
Length=416

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+VI  PE+TIT+R +EDE LIL SDGLWDVV+N+ AC V RMCL
Sbjct  293  GVLAMSRAIGDNYLKPFVIPRPEVTITERRSEDECLILGSDGLWDVVTNDMACKVVRMCL  352

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
              RK       SGN+++V   + ES DK C DAS+LLTKLAL RH+A
Sbjct  353  CARKSSFAPGFSGNEMAVKNGALESFDKQCWDASVLLTKLALVRHSA  399



>gb|KDP42204.1| hypothetical protein JCGZ_02934 [Jatropha curcas]
Length=426

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 84/111 (76%), Gaps = 8/111 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+T RTAED+ LILASDGLWDVVSN+TACGVARMCL
Sbjct  304  GVLAMSRAIGDNYLKPYVSCEPEVTVTDRTAEDDCLILASDGLWDVVSNDTACGVARMCL  363

Query  182  QHRKPPSPLPLSGNDV-----SVTPSSGESSDKACSDASILLTKLALARHT  319
               K     P   N+      + +   GE SDKACSDAS+LLTKLALAR +
Sbjct  364  ---KGKGGFPADENETVLGGGNTSGCRGEMSDKACSDASMLLTKLALARRS  411



>ref|NP_001234692.1| protein phosphatase 2C AHG3 homolog [Solanum lycopersicum]
 dbj|BAI39596.1| protein phosphatase 2C AHG3 homolog [Solanum lycopersicum]
Length=406

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 80/105 (76%), Gaps = 20/105 (19%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKPYV SEPE+TIT+RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  306  GVLAMSRAIGDSYLKPYVTSEPEVTITERTVEDECLILASDGLWDVVSNETACGVARMCL  365

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            +                    SG +SD AC+DASILLT+LALARH
Sbjct  366  R--------------------SGHNSDHACTDASILLTRLALARH  390



>ref|XP_004145326.1| PREDICTED: protein phosphatase 2C 3-like [Cucumis sativus]
 ref|XP_004154054.1| PREDICTED: protein phosphatase 2C 3-like [Cucumis sativus]
 ref|XP_004163812.1| PREDICTED: protein phosphatase 2C 3-like [Cucumis sativus]
 gb|KGN65754.1| hypothetical protein Csa_1G524760 [Cucumis sativus]
Length=426

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT RTAEDE LIL SDGLWDVV NETACGVA MCL
Sbjct  302  GVLAMSRAIGDNYLKPYVISEPEVTITNRTAEDECLILGSDGLWDVVPNETACGVASMCL  361

Query  182  QHR-KPPSPL-PLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + + +  SP+ P S  + +       ++DKAC+DAS+LLTKLALARH+
Sbjct  362  RGKAEERSPVSPSSEAETAAEGEERGNADKACNDASMLLTKLALARHS  409



>ref|XP_004291511.1| PREDICTED: probable protein phosphatase 2C 24-like [Fragaria 
vesca subsp. vesca]
Length=397

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 81/106 (76%), Gaps = 7/106 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+V  EPE+T+T RTAED+ LILASDGLWDVVSNETACGVA MCL
Sbjct  284  GVLAMSRAIGDNYLKPFVCCEPEVTVTDRTAEDDCLILASDGLWDVVSNETACGVALMCL  343

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + R    P+   G  V       E+SDK CSDAS LLTKLALAR +
Sbjct  344  RGRAHAPPMESEGAGV-------ENSDKECSDASTLLTKLALARQS  382



>ref|XP_011035254.1| PREDICTED: probable protein phosphatase 2C 24 [Populus euphratica]
Length=441

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 88/114 (77%), Gaps = 8/114 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TI  RTAED+ LI+ASDGLWDVVSNETAC VAR CL
Sbjct  313  GVLAMSRAIGDNYLKPYVSCEPEVTIMDRTAEDDCLIIASDGLWDVVSNETACAVARACL  372

Query  182  QHRK----PPSPLPLSGNDVSVTPS----SGESSDKACSDASILLTKLALARHT  319
            + ++    P SP  +  N+    P+    SGE SDKACS+AS+LLTK+ALARH+
Sbjct  373  RVKEHAPTPCSPRLVENNEAVGIPAGSGGSGEMSDKACSEASMLLTKMALARHS  426



>ref|XP_008221946.1| PREDICTED: probable protein phosphatase 2C 24 [Prunus mume]
Length=401

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 86/106 (81%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RTAEDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  285  GVLAMSRAIGDNYLKPYVSCEPEVTITDRTAEDECLILASDGLWDVVSNDTACGVARMCL  344

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            + ++      L+  +     SS  SSD+ACSDA++LLTKLALARH+
Sbjct  345  RGKR------LAAAEAETDGSSSTSSDRACSDAAMLLTKLALARHS  384



>ref|XP_009364345.1| PREDICTED: probable protein phosphatase 2C 24 [Pyrus x bretschneideri]
Length=407

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV   PE+TIT RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  291  GVLAMSRAIGDNYLKPYVSCVPEVTITDRTVEDECLILASDGLWDVVSNETACGVARMCL  350

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + ++  S +  +         +  +SD+ACSDASILL KLALARH+A
Sbjct  351  RGKRAASAMERA----WAEAVAEAASDRACSDASILLMKLALARHSA  393



>gb|AFK46885.1| unknown [Medicago truncatula]
Length=391

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 83/104 (80%), Gaps = 5/104 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT+R+ EDE LILASDGLWDVV N+TAC V +MCL
Sbjct  273  GVLAMSRAIGDNYLKPYVISEPEVTITERSDEDECLILASDGLWDVVQNDTACKVVQMCL  332

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
            +  K  +P    G +V     +G  SDKACSDASILLTKLALAR
Sbjct  333  KANKTVTPPGSPGLEV-----AGNGSDKACSDASILLTKLALAR  371



>ref|XP_009599862.1| PREDICTED: probable protein phosphatase 2C 24 [Nicotiana tomentosiformis]
Length=412

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 84/105 (80%), Gaps = 3/105 (3%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+TIT RTAED+ LILASDGLWDVVSN+TACGVA MCL
Sbjct  295  GVLAMSRAIGDNYLKPYVICEPEVTITDRTAEDDCLILASDGLWDVVSNDTACGVAGMCL  354

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + + P S    S   +    + GE+ D++CSDAS+LLTKLALAR 
Sbjct  355  KGKAPVSTAAAS---MPENVAGGENPDQSCSDASMLLTKLALARR  396



>ref|XP_003616468.1| Protein phosphatase 2C [Medicago truncatula]
 gb|AES99426.1| protein phosphatase 2C-like protein [Medicago truncatula]
Length=391

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 83/104 (80%), Gaps = 5/104 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT+R+ EDE LILASDGLWDVV N+TAC V +MCL
Sbjct  273  GVLAMSRAIGDNYLKPYVISEPEVTITERSDEDECLILASDGLWDVVQNDTACKVVQMCL  332

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
            +  K  +P    G +V     +G  SDKACSDASILLTKLALAR
Sbjct  333  KANKTVTPPGSPGLEV-----AGNGSDKACSDASILLTKLALAR  371



>ref|XP_006369545.1| hypothetical protein POPTR_0001s25200g [Populus trichocarpa]
 gb|ERP66114.1| hypothetical protein POPTR_0001s25200g [Populus trichocarpa]
Length=411

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 87/114 (76%), Gaps = 8/114 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TI  RTAED+ LI+ASDGLWDVVSNETAC VAR CL
Sbjct  283  GVLAMSRAIGDNYLKPYVSCEPEVTIMDRTAEDDCLIIASDGLWDVVSNETACVVARTCL  342

Query  182  QHR----KPPSPLPLSGNDVSVTPS----SGESSDKACSDASILLTKLALARHT  319
            + +     P SP  +  N+    P+    SGE SDKACS+AS+LLTK+ALARH+
Sbjct  343  RGKGHAPAPCSPRLVENNEAVGIPAGSSGSGEMSDKACSEASMLLTKMALARHS  396



>gb|KHN17892.1| Protein phosphatase 2C 37 [Glycine soja]
Length=398

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 78/105 (74%), Gaps = 21/105 (20%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+ +T+RT EDE LILASDGLWDVVSNETACGV RMCL
Sbjct  292  GVLAMSRAIGDNYLKPYVISEPEVMVTERTEEDECLILASDGLWDVVSNETACGVVRMCL  351

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            +                      + SD+ACSDASILLTKLALARH
Sbjct  352  K---------------------ADGSDRACSDASILLTKLALARH  375



>ref|XP_006350789.1| PREDICTED: protein phosphatase 2C 37-like [Solanum tuberosum]
Length=410

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 8/107 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+T+T RTAED+ LILASDGLWDVVSN+TACGVA MCL
Sbjct  296  GVLAMSRAIGDNYLKPYVICEPEVTVTDRTAEDDCLILASDGLWDVVSNDTACGVAGMCL  355

Query  182  QHRKPPSPLPLSGNDVSVTPSSGE-SSDKACSDASILLTKLALARHT  319
              ++  SP   SGN      + GE +SD+ CSDAS+LLTKLALAR +
Sbjct  356  --KRNASPASTSGNG-----ADGEMNSDQCCSDASMLLTKLALARRS  395



>emb|CAC10359.1| protein phosphatase 2C [Nicotiana tabacum]
Length=378

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+TIT+RT EDE LILASDGLWDVVSNETACGVARMCL
Sbjct  297  GVLAMSRAIGDNYLKPYVISEPEVTITERTDEDECLILASDGLWDVVSNETACGVARMCL  356

Query  182  QHRKPPSPLPLSGNDVSVT  238
            Q R+PPSP     NDV+VT
Sbjct  357  QSRRPPSPQGPPENDVTVT  375



>ref|XP_009773018.1| PREDICTED: probable protein phosphatase 2C 24 isoform X2 [Nicotiana 
sylvestris]
Length=337

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+TIT RT ED+ LILASDGLWDVVSN+TACGVA MCL
Sbjct  219  GVLAMSRAIGDNYLKPYVICEPEVTITDRTVEDDCLILASDGLWDVVSNDTACGVAGMCL  278

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
               K  +P+  +   +    + GE+ D+ C+DAS+LLTKLALAR 
Sbjct  279  N--KGKAPVSSAAASMPENVAGGENPDQGCADASMLLTKLALARR  321



>ref|XP_002299846.2| hypothetical protein POPTR_0001s25200g [Populus trichocarpa]
 gb|EEE84651.2| hypothetical protein POPTR_0001s25200g [Populus trichocarpa]
Length=392

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 81/106 (76%), Gaps = 11/106 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TI  RTAED+ LI+ASDGLWDVVSNETAC VAR CL
Sbjct  283  GVLAMSRAIGDNYLKPYVSCEPEVTIMDRTAEDDCLIIASDGLWDVVSNETACVVARTCL  342

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            +           G   +  P SGE SDKACS+AS+LLTK+ALARH+
Sbjct  343  R-----------GKGHAPAPGSGEMSDKACSEASMLLTKMALARHS  377



>ref|XP_009773017.1| PREDICTED: probable protein phosphatase 2C 24 isoform X1 [Nicotiana 
sylvestris]
Length=410

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+TIT RT ED+ LILASDGLWDVVSN+TACGVA MCL
Sbjct  292  GVLAMSRAIGDNYLKPYVICEPEVTITDRTVEDDCLILASDGLWDVVSNDTACGVAGMCL  351

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
               K  +P+  +   +    + GE+ D+ C+DAS+LLTKLALAR 
Sbjct  352  NKGK--APVSSAAASMPENVAGGENPDQGCADASMLLTKLALARR  394



>gb|AHA43410.1| ABA-induced PP2C [Solanum nigrum]
Length=412

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 82/107 (77%), Gaps = 8/107 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI EPE+TIT R  ED+ LILASDGLWDVVSNE ACGVA MCL
Sbjct  298  GVLAMSRAIGDNYLKPYVICEPEVTITDRKPEDDCLILASDGLWDVVSNEIACGVAGMCL  357

Query  182  QHRKPPSPLPLSGNDVSVTPSSGE-SSDKACSDASILLTKLALARHT  319
            +    P+  P +G       + GE +SD+ CSDAS+LLTKLALAR +
Sbjct  358  KGNAAPASKPENG-------AGGEVNSDQGCSDASMLLTKLALARRS  397



>ref|XP_003519357.1| PREDICTED: protein phosphatase 2C 37-like [Glycine max]
Length=407

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 9/105 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+R+ +DE LIL SDGLWD V N+TAC V RMCL
Sbjct  287  GVLAMSRAIGDNYLKPYVISEPEVTVTERSDKDECLILGSDGLWDTVQNDTACKVVRMCL  346

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
              +KP SP         V   + + SDK+CSDASILLTKLAL R 
Sbjct  347  NAQKPASP---------VKEMAVDCSDKSCSDASILLTKLALVRQ  382



>gb|KHN41115.1| Protein phosphatase 2C 37 [Glycine soja]
Length=406

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 9/105 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+R+ +DE LIL SDGLWD V N+TAC V RMCL
Sbjct  286  GVLAMSRAIGDNYLKPYVISEPEVTVTERSDKDECLILGSDGLWDTVQNDTACKVVRMCL  345

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
              +KP SP         V   + + SDK+CSDASILLTKLAL R 
Sbjct  346  NAQKPASP---------VKEMAVDCSDKSCSDASILLTKLALVRQ  381



>ref|XP_010033093.1| PREDICTED: probable protein phosphatase 2C 24 [Eucalyptus grandis]
 gb|KCW52632.1| hypothetical protein EUGRSUZ_J02003 [Eucalyptus grandis]
Length=443

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 83/110 (75%), Gaps = 4/110 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  +PE+T+ +RTA+DE LILASDGLWDVVSN+TACGVARMCL
Sbjct  319  GVLAMSRAIGDNYLKPYVSCDPEVTVMERTADDECLILASDGLWDVVSNDTACGVARMCL  378

Query  182  QH--RKPPSPLPLSGNDVSVTPSSG--ESSDKACSDASILLTKLALARHT  319
            +   R PP     +          G    SD+ACSDAS+LLTKLALARH+
Sbjct  379  RGKIRPPPEDAGAAAEPAPPAGMVGGERRSDRACSDASLLLTKLALARHS  428



>ref|XP_010541411.1| PREDICTED: probable protein phosphatase 2C 78 [Tarenaya hassleriana]
Length=437

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 88/107 (82%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+++RTA+D+FLILASDGLWDVVSNETACGVARMCL
Sbjct  315  GVLAMSRAIGDNYLKPYVICKPEVTVSERTADDDFLILASDGLWDVVSNETACGVARMCL  374

Query  182  QHRKPPSPLPLSGND-VSVTPSSGE-SSDKACSDASILLTKLALARH  316
            + ++   P P    + V V   +G+  SD+AC++AS+LL KLALA H
Sbjct  375  RGKRRARPRPWPPCEAVEVAAETGDVESDRACTEASMLLVKLALAGH  421



>ref|NP_001044788.1| Os01g0846300 [Oryza sativa Japonica Group]
 sp|Q5N9N2.1|P2C09_ORYSJ RecName: Full=Probable protein phosphatase 2C 9; Short=OsPP2C09 
[Oryza sativa Japonica Group]
 dbj|BAD81824.1| putative protein phosphatase 2C [Oryza sativa Japonica Group]
 dbj|BAF06702.1| Os01g0846300 [Oryza sativa Japonica Group]
 gb|EEC71790.1| hypothetical protein OsI_04415 [Oryza sativa Indica Group]
 gb|EEE55662.1| hypothetical protein OsJ_04060 [Oryza sativa Japonica Group]
Length=414

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 86/122 (70%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKPYV SEPE+T+T+RT +DE LILASDGLWDVV+NE AC V R C 
Sbjct  279  GVLAMSRAIGDGYLKPYVTSEPEVTVTERTDDDECLILASDGLWDVVTNEMACEVVRACF  338

Query  182  QHRKPPSP------LPLS--------GNDVSVTP-SSGESSDKACSDASILLTKLALARH  316
             +  PP+P      +P S        G   SV   S  ESSDKACSDA++LLTKLALAR 
Sbjct  339  HNNGPPAPAARPSGVPSSAEAAETENGGAASVKGISKAESSDKACSDAAMLLTKLALARR  398

Query  317  TA  322
            +A
Sbjct  399  SA  400



>ref|XP_006401003.1| hypothetical protein EUTSA_v10013567mg [Eutrema salsugineum]
 gb|ESQ42456.1| hypothetical protein EUTSA_v10013567mg [Eutrema salsugineum]
Length=423

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 81/109 (74%), Gaps = 4/109 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS+PE+T+T R  ED+FLILASDGLWDVVSNETAC V RMCL
Sbjct  299  GVLAMSRAIGDNYLKPYVISKPEVTVTDRVNEDDFLILASDGLWDVVSNETACNVVRMCL  358

Query  182  QHRK----PPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +     P SP        +V    GE  DKAC +ASILLT+LALAR 
Sbjct  359  RGKVNSQLPASPERDVAGAGNVVVGGGEMPDKACEEASILLTRLALARQ  407



>ref|XP_006401004.1| hypothetical protein EUTSA_v10013567mg [Eutrema salsugineum]
 gb|ESQ42457.1| hypothetical protein EUTSA_v10013567mg [Eutrema salsugineum]
Length=439

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 81/109 (74%), Gaps = 4/109 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS+PE+T+T R  ED+FLILASDGLWDVVSNETAC V RMCL
Sbjct  315  GVLAMSRAIGDNYLKPYVISKPEVTVTDRVNEDDFLILASDGLWDVVSNETACNVVRMCL  374

Query  182  QHRK----PPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            + +     P SP        +V    GE  DKAC +ASILLT+LALAR 
Sbjct  375  RGKVNSQLPASPERDVAGAGNVVVGGGEMPDKACEEASILLTRLALARQ  423



>gb|KHG14347.1| Protein phosphatase 2C 3 -like protein [Gossypium arboreum]
Length=408

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 8/114 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSR+IGD YLKPYV  EPE+T+T RT +DE LI+ASDGLWDVVSN+TAC VARMCL
Sbjct  280  GVLAMSRSIGDTYLKPYVSCEPEVTVTDRTVDDECLIIASDGLWDVVSNDTACRVARMCL  339

Query  182  QHR----KPPSPLPLSGNDVSVTPS----SGESSDKACSDASILLTKLALARHT  319
            + +     PP  +     +V V  +     GE SDKACSDAS+LLTKLALARH+
Sbjct  340  RGKVDVHAPPCLVKGMEGEVVVGSTKGGEGGEISDKACSDASLLLTKLALARHS  393



>ref|XP_010520253.1| PREDICTED: probable protein phosphatase 2C 78 isoform X1 [Tarenaya 
hassleriana]
Length=442

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  +PE+T+T+R  +D+ LILASDGLWDVVSNETACGVARMCL
Sbjct  316  GVLAMSRAIGDNYLKPYVTCKPEVTVTERADDDDCLILASDGLWDVVSNETACGVARMCL  375

Query  182  QHRKPPSPL--PLSGNDVSV----TPSSGESSDKACSDASILLTKLALARH  316
            + +     +  P + N+  V       S E SDKAC+DASILL KLALARH
Sbjct  376  RGKPGGGGVAQPPNHNENQVMGGGGGGSDEVSDKACTDASILLMKLALARH  426



>ref|XP_009120420.1| PREDICTED: probable protein phosphatase 2C 78 [Brassica rapa]
Length=412

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS+PE+T+T R  +DEFLILASDGLWDVVSNETAC V RMCL
Sbjct  288  GVLAMSRAIGDNYLKPYVISKPEVTVTDRVKQDEFLILASDGLWDVVSNETACNVVRMCL  347

Query  182  QHRKPPSPLPLS-GND----VSVTPSSGESSDKACSDASILLTKLALARH  316
            + RK  S L  S  ND     +V    G+ S+KAC +ASILLT+LALAR 
Sbjct  348  K-RKVNSQLTSSPENDVAGAGNVVVVGGDVSNKACDEASILLTRLALARQ  396



>ref|XP_006645000.1| PREDICTED: probable protein phosphatase 2C 9-like [Oryza brachyantha]
Length=413

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 84/119 (71%), Gaps = 12/119 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKPYV SEPE+T+T+RT +DE LILASDGLWDVV+NE AC V + C 
Sbjct  281  GVLAMSRAIGDGYLKPYVTSEPEVTVTERTDDDECLILASDGLWDVVTNEMACEVVKACF  340

Query  182  QHRKPPSP------LPLSG------NDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
             +  PP+P      +P S        D SV   +   SDKACSDA++LLTKLALAR +A
Sbjct  341  HNNGPPAPAARPVGVPPSAEVEAEDGDASVKGINRAESDKACSDAAMLLTKLALARRSA  399



>gb|AGG35960.1| ABA hypersensitive PP2C protein AHG3/PP2CA [Brassica napus]
Length=401

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 78/105 (74%), Gaps = 12/105 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT +DE LILASDGLWDVV+NETACGVARMCL
Sbjct  287  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDDDECLILASDGLWDVVTNETACGVARMCL  346

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            Q           G D        +++  ACSDAS+LLTKLALAR 
Sbjct  347  Q-----GAAAADGGD-------SDTAHNACSDASLLLTKLALARQ  379



>gb|KHN20909.1| Protein phosphatase 2C 3 [Glycine soja]
Length=283

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 81/105 (77%), Gaps = 5/105 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+R+ EDE LIL SDGLWD V N+ AC V RMCL
Sbjct  169  GVLAMSRAIGDNYLKPYVISEPEVTVTERSEEDECLILGSDGLWDTVQNDIACKVVRMCL  228

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
              +KPPSP      +++V     + SDKACS+ASILLTKLAL R 
Sbjct  229  NAQKPPSPPSSPRREMAV-----DCSDKACSNASILLTKLALVRQ  268



>ref|XP_008384916.1| PREDICTED: probable protein phosphatase 2C 24 [Malus domestica]
Length=405

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 84/106 (79%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRA+GDNYLKPYV  +PE+TIT RT EDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  291  GVLAMSRALGDNYLKPYVSCDPEVTITDRTVEDECLILASDGLWDVVSNDTACGVARMCL  350

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            +  +  +    +G + +V      +SDKACSDAS+LLTKLALAR +
Sbjct  351  RRERAAAAAERAGPEAAV------ASDKACSDASMLLTKLALARQS  390



>ref|XP_009146731.1| PREDICTED: protein phosphatase 2C 37 [Brassica rapa]
Length=399

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 77/108 (71%), Gaps = 18/108 (17%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT +DE LILASDGLWDVV+NETACGVARMCL
Sbjct  285  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDDDECLILASDGLWDVVTNETACGVARMCL  344

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSD---KACSDASILLTKLALARH  316
            Q                   + G  SD    ACSDAS+LLTKLALAR 
Sbjct  345  Q---------------GAAAADGGDSDTVHNACSDASLLLTKLALARQ  377



>emb|CDY08530.1| BnaA05g27660D [Brassica napus]
Length=393

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 76/105 (72%), Gaps = 20/105 (19%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT +DE LILASDGLWDVV+NETACGVARMCL
Sbjct  287  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDDDECLILASDGLWDVVTNETACGVARMCL  346

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            Q                      +++  ACSDAS+LLTKLALAR 
Sbjct  347  Q--------------------DSDTAHNACSDASLLLTKLALARQ  371



>ref|NP_172223.1| protein phosphatase 2C 3 [Arabidopsis thaliana]
 sp|Q9LNW3.1|P2C03_ARATH RecName: Full=Protein phosphatase 2C 3; Short=AtPP2C03; AltName: 
Full=Protein AKT1-INTERACTING 1; AltName: Full=Protein phosphatase 
2C AIP1; Short=PP2C AIP1 [Arabidopsis thaliana]
 gb|AAF79555.1|AC022464_13 F22G5.22 [Arabidopsis thaliana]
 gb|AAL49783.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 gb|AAM14280.1| putative phosphatase 2C [Arabidopsis thaliana]
 gb|AEE28124.1| protein phosphatase 2C 3 [Arabidopsis thaliana]
Length=442

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 84/125 (67%), Gaps = 18/125 (14%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT EDEFLILA+DGLWDVV+NE AC + RMCL
Sbjct  299  GVLAMSRAIGDNYLKPYVTSEPEVTVTDRTEEDEFLILATDGLWDVVTNEAACTMVRMCL  358

Query  182  QHR--------KPPSPLPLSGNDVSV----------TPSSGESSDKACSDASILLTKLAL  307
              +        +  +P   S  +                 GE +DKAC++AS+LLTKLAL
Sbjct  359  NRKSGRGRRRGETQTPGRRSEEEGKEEEEKVVGSRKNGKRGEITDKACTEASVLLTKLAL  418

Query  308  ARHTA  322
            A+H++
Sbjct  419  AKHSS  423



>gb|AAM61361.1| protein phosphatase 2C, putative [Arabidopsis thaliana]
Length=442

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 84/125 (67%), Gaps = 18/125 (14%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT EDEFLILA+DGLWDVV+NE AC + RMCL
Sbjct  299  GVLAMSRAIGDNYLKPYVTSEPEVTVTDRTEEDEFLILATDGLWDVVTNEAACTMVRMCL  358

Query  182  QHR--------KPPSPLPLSGNDVSV----------TPSSGESSDKACSDASILLTKLAL  307
              +        +  +P   S  +                 GE +DKAC++AS+LLTKLAL
Sbjct  359  NRKSGRGRRRGETQTPGRRSEEEGKEEEEKVVGSRKNGKRGEITDKACTEASVLLTKLAL  418

Query  308  ARHTA  322
            A+H++
Sbjct  419  AKHSS  423



>ref|XP_002892398.1| hypothetical protein ARALYDRAFT_470764 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68657.1| hypothetical protein ARALYDRAFT_470764 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 83/123 (67%), Gaps = 16/123 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT EDEFLILASDGLWDVV+NE AC +   CL
Sbjct  296  GVLAMSRAIGDNYLKPYVTSEPEVTVTDRTEEDEFLILASDGLWDVVTNEAACSMVHTCL  355

Query  182  QHR----------KPPSPLPLSGNDVSVTPSS------GESSDKACSDASILLTKLALAR  313
              +          +  +P   S  +      S      GE +DKAC++AS+LLTKLALA+
Sbjct  356  NRKSGRGRRRGETQTQTPGTRSEEEEEKVVGSRKNGKKGEITDKACTEASVLLTKLALAK  415

Query  314  HTA  322
            H++
Sbjct  416  HSS  418



>ref|XP_009384837.1| PREDICTED: probable protein phosphatase 2C 68 [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 77/107 (72%), Gaps = 13/107 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKPYVISEPE+T+  R   DE LILASDGLWDVVSNETAC +ARMCL
Sbjct  279  GVLAMSRAIGDSYLKPYVISEPEVTVLDREEGDECLILASDGLWDVVSNETACDIARMCL  338

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            Q           G D     + G   D +CSDA++LLTKLA ARH+A
Sbjct  339  Q----------GGGDEEEEVAGG---DASCSDAAVLLTKLAFARHSA  372



>ref|XP_010510497.1| PREDICTED: probable protein phosphatase 2C 24 [Camelina sativa]
Length=367

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 81/110 (74%), Gaps = 17/110 (15%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  253  GVLAMSRAIGDNYLKPYVSCEPEVTITDRT-DDDCLILASDGLWDVVSNETACSVARMCL  311

Query  182  ---QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
               Q R+     P              +SDKAC++AS+LLTKLALARH++
Sbjct  312  RGGQKRRGGHEDPA-------------TSDKACTEASVLLTKLALARHSS  348



>ref|XP_003544192.2| PREDICTED: protein phosphatase 2C 37-like [Glycine max]
Length=498

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 81/105 (77%), Gaps = 5/105 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+T+T+R+ EDE LIL SDGLWD V N+ AC V RMCL
Sbjct  384  GVLAMSRAIGDNYLKPYVISEPEVTVTERSEEDECLILGSDGLWDTVQNDIACKVVRMCL  443

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
              +KPPSP      +++V     + SDKACS+ASILLTKLAL R 
Sbjct  444  NAQKPPSPPSSPRREMAV-----DCSDKACSNASILLTKLALVRQ  483



>ref|XP_010414391.1| PREDICTED: probable protein phosphatase 2C 24 [Camelina sativa]
Length=367

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 79/107 (74%), Gaps = 11/107 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  253  GVLAMSRAIGDNYLKPYVSCEPEVTITDRT-DDDCLILASDGLWDVVSNETACSVARMCL  311

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +           G     +      SDKAC++AS+LLTKLALARH++
Sbjct  312  R----------GGQKRRSSHEDPAISDKACTEASVLLTKLALARHSS  348



>ref|XP_007016312.1| Highly ABA-induced PP2C gene 2 isoform 2 [Theobroma cacao]
 gb|EOY33931.1| Highly ABA-induced PP2C gene 2 isoform 2 [Theobroma cacao]
Length=456

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 78/107 (73%), Gaps = 5/107 (5%)
 Frame = +2

Query  14   MSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCLQ---  184
            +S   GDNYLKPYV  EPE+ IT R AED+ LILASDGLWDVVSN+TACGVARMCL+   
Sbjct  335  LSANTGDNYLKPYVSCEPEVMITDRAAEDDCLILASDGLWDVVSNDTACGVARMCLRGKG  394

Query  185  --HRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
              H  P SP      +  +  + GE SDKAC+DAS+LLTKLALARH+
Sbjct  395  NLHAPPYSPAEGVEREAVLGSTMGEISDKACTDASMLLTKLALARHS  441



>gb|ABW81144.1| unknown [Capsella rubella]
Length=382

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 79/107 (74%), Gaps = 11/107 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  252  GVLAMSRAIGDNYLKPYVSCEPEVTITDRT-DDDCLILASDGLWDVVSNETACSVARMCL  310

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +           G     +    E  DKAC++AS+LLTKLALARH++
Sbjct  311  R----------GGQKQRGSYEDPEVPDKACTEASVLLTKLALARHSS  347



>ref|XP_006295431.1| hypothetical protein CARUB_v10024530mg [Capsella rubella]
 gb|EOA28329.1| hypothetical protein CARUB_v10024530mg [Capsella rubella]
Length=366

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 79/107 (74%), Gaps = 11/107 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  252  GVLAMSRAIGDNYLKPYVSCEPEVTITDRT-DDDCLILASDGLWDVVSNETACSVARMCL  310

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +           G     +    E  DKAC++AS+LLTKLALARH++
Sbjct  311  R----------GGQKQRGSYEDPEVPDKACTEASVLLTKLALARHSS  347



>emb|CDY10275.1| BnaC05g05180D [Brassica napus]
Length=430

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 83/120 (69%), Gaps = 15/120 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT EDEFLILASDGLWDVV+NE AC +  M L
Sbjct  288  GVLAMSRAIGDNYLKPYVSSEPEVTVTDRTEEDEFLILASDGLWDVVTNEAACAMVHMYL  347

Query  182  QH-----RKPPSPLPLSGND--VSVTP--------SSGESSDKACSDASILLTKLALARH  316
                   R+  +P  + G D    V P          GE +DKAC++AS+LLTKLALA+H
Sbjct  348  SKRGGRGRRRETPECIEGKDEEEKVVPVVGSKKSGKKGEIADKACTEASVLLTKLALAKH  407



>ref|XP_009375956.1| PREDICTED: probable protein phosphatase 2C 24 [Pyrus x bretschneideri]
Length=404

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 77/106 (73%), Gaps = 7/106 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRA+GDNYLKPYV  +PE+TIT RT EDE LILASDGLWDVVSN+TACGVARMCL
Sbjct  291  GVLAMSRALGDNYLKPYVSCDPEVTITDRTVEDECLILASDGLWDVVSNDTACGVARMCL  350

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            +          +            + DKACSDAS+LLTKLALAR +
Sbjct  351  R-------RERAAAAAERAGPEAAALDKACSDASMLLTKLALARQS  389



>emb|CDY40181.1| BnaC04g14090D [Brassica napus]
Length=366

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 78/109 (72%), Gaps = 13/109 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+T RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  250  GVLAMSRAIGDNYLKPYVTCEPEVTVTDRT-DDDCLILASDGLWDVVSNETACSVARMCL  308

Query  182  QHRKPPSPLPLSGNDVSVTPSSGES--SDKACSDASILLTKLALARHTA  322
                        G     TP       SDKAC +AS+LLTKLALARH++
Sbjct  309  S----------GGRRRRGTPEQAVETISDKACMEASVLLTKLALARHSS  347



>gb|AHN16199.1| HAI3.1 [Brassica napus]
Length=366

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 77/109 (71%), Gaps = 13/109 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+T RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  250  GVLAMSRAIGDNYLKPYVTCEPEVTVTDRT-DDDCLILASDGLWDVVSNETACSVARMCL  308

Query  182  QHRKPPSPLPLSGNDVSVTPSSGES--SDKACSDASILLTKLALARHTA  322
                        G     TP       SDKAC +AS+LLTKLALARH+ 
Sbjct  309  S----------GGRRRRGTPEQAVETISDKACMEASVLLTKLALARHSG  347



>gb|KFK22788.1| hypothetical protein AALP_AAs59949U000200 [Arabis alpina]
Length=323

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 11/108 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT R+ +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  223  GVLAMSRAIGDNYLKPYVSCEPEVTITDRS-DDDCLILASDGLWDVVSNETACSVARMCL  281

Query  182  QHRKPPSPLP-LSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +  +     P L  N +         SDKAC++AS+LLTKLALARH++
Sbjct  282  RGGRRRRGSPDLEINSI---------SDKACTEASVLLTKLALARHSS  320



>ref|XP_009144382.1| PREDICTED: probable protein phosphatase 2C 24 [Brassica rapa]
Length=366

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 78/109 (72%), Gaps = 13/109 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+T RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  250  GVLAMSRAIGDNYLKPYVTCEPEVTVTDRT-DDDCLILASDGLWDVVSNETACSVARMCL  308

Query  182  QHRKPPSPLPLSGNDVSVTPSSGES--SDKACSDASILLTKLALARHTA  322
                        G     TP       SDKAC +AS+LLTKLALARH++
Sbjct  309  S----------GGRRRRGTPEQAVETISDKACMEASVLLTKLALARHSS  347



>ref|XP_008803118.1| PREDICTED: probable protein phosphatase 2C 24 [Phoenix dactylifera]
Length=387

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 78/107 (73%), Gaps = 15/107 (14%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKPYVIS+PE+T+T+R   DE LILASDGLWDVV+N+ AC +ARMCL
Sbjct  282  GVLAMSRAIGDGYLKPYVISDPEVTVTEREEGDECLILASDGLWDVVTNKMACDIARMCL  341

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
                  S  P  G         G  SDKACSDA++LLTKLALAR +A
Sbjct  342  ------SAAPAEG---------GSGSDKACSDAAMLLTKLALARQSA  373



>ref|XP_002879213.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55472.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 78/107 (73%), Gaps = 12/107 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  268  GVLAMSRAIGDNYLKPYVSCEPEVTITDRT-DDDCLILASDGLWDVVSNETACSVARMCL  326

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +           G            SDKAC++AS+LLTKLALARH++
Sbjct  327  R-----------GGQKQEGSEDPTISDKACTEASVLLTKLALARHSS  362



>gb|ABW81041.1| protein-phosphatase-2C [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 81/109 (74%), Gaps = 16/109 (15%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  268  GVLAMSRAIGDNYLKPYVSCEPEVTITDRT-DDDCLILASDGLWDVVSNETACSVARMCL  326

Query  182  Q--HRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +   ++  S  P               SDKAC++AS+LLTKLALARH++
Sbjct  327  RGGQKQEGSEDPT-------------ISDKACTEASVLLTKLALARHSS  362



>emb|CDY45436.1| BnaA05g12650D [Brassica napus]
Length=366

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 77/109 (71%), Gaps = 13/109 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+T RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  250  GVLAMSRAIGDNYLKPYVTCEPEVTVTDRT-DDDCLILASDGLWDVVSNETACSVARMCL  308

Query  182  QHRKPPSPLPLSGNDVSVTPSSGES--SDKACSDASILLTKLALARHTA  322
                        G     TP       SDKAC +AS+LLTKLALARH+ 
Sbjct  309  S----------GGRRRRGTPEQAVETISDKACMEASVLLTKLALARHSG  347



>ref|XP_010469960.1| PREDICTED: probable protein phosphatase 2C 24 [Camelina sativa]
Length=366

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 79/107 (74%), Gaps = 11/107 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RT +D+ LILA+DGLWDVVSNETAC VARMCL
Sbjct  252  GVLAMSRAIGDNYLKPYVSCEPEVTITDRT-DDDCLILATDGLWDVVSNETACSVARMCL  310

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +           G     +      SDKAC++AS+LLTKLALARH++
Sbjct  311  R----------GGQKRRGSHEDPAISDKACTEASVLLTKLALARHSS  347



>ref|XP_010937563.1| PREDICTED: probable protein phosphatase 2C 24 [Elaeis guineensis]
Length=402

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 16/107 (15%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKPYV S+PE+T+T+R   DE LILASDGLWDVV+N+ AC +ARMCL
Sbjct  298  GVLAMSRAIGDSYLKPYVTSDPEVTVTEREEGDECLILASDGLWDVVTNKMACDIARMCL  357

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
                            S  P+ G  S+KACSDA++LLTKLALAR +A
Sbjct  358  ----------------SAPPTEGSGSNKACSDAAMLLTKLALARQSA  388



>gb|ABW74582.1| putative protein phosphatase [Boechera divaricarpa]
Length=386

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 78/107 (73%), Gaps = 11/107 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  272  GVLAMSRAIGDNYLKPYVSCEPEVTITDRT-DDDCLILASDGLWDVVSNETACSVARMCL  330

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +           G     +      SDKAC +AS+LLTKLALARH++
Sbjct  331  R----------GGQKWRGSLEDPAISDKACKEASVLLTKLALARHSS  367



>ref|XP_002465495.1| hypothetical protein SORBIDRAFT_01g039890 [Sorghum bicolor]
 gb|EER92493.1| hypothetical protein SORBIDRAFT_01g039890 [Sorghum bicolor]
Length=401

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 85/140 (61%), Gaps = 33/140 (24%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKP+VIS+PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  246  GMLAMSRAIGDSYLKPFVISDPEVRVVERKDGEDEFLILASDGLWDVVSNEVACKVVRTC  305

Query  179  LQHRKPPSPLPLSGNDVSVT----------------------PSSG----------ESSD  262
            L++R PP P    G   S T                      PS G           S D
Sbjct  306  LRNRAPPHPHGGDGERSSPTSNLSPRQSSGSGSSSGDEEGAGPSDGAGSESDGDGESSED  365

Query  263  KACSDASILLTKLALARHTA  322
            +ACS+A+ILLTKLALAR TA
Sbjct  366  RACSEAAILLTKLALARQTA  385



>ref|XP_006307527.1| hypothetical protein CARUB_v10009150mg [Capsella rubella]
 gb|EOA40425.1| hypothetical protein CARUB_v10009150mg [Capsella rubella]
Length=442

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 79/126 (63%), Gaps = 21/126 (17%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV S+PE+T+T RT EDEFLILASDGLWDVV+NE AC +  MCL
Sbjct  296  GVLAMSRAIGDNYLKPYVTSDPEVTVTDRTEEDEFLILASDGLWDVVTNEAACAMVHMCL  355

Query  182  QHRKPPSPLPLSGNDVSV---------------------TPSSGESSDKACSDASILLTK  298
              +         G   ++                         GE +DKAC++AS+LLTK
Sbjct  356  NRKGGRGGGRRRGETQTLGRRSEEEESKEEEEEVVGSRKNGKRGEITDKACTEASVLLTK  415

Query  299  LALARH  316
            LALA+H
Sbjct  416  LALAKH  421



>ref|XP_008441392.1| PREDICTED: probable protein phosphatase 2C 24 [Cucumis melo]
Length=383

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 76/107 (71%), Gaps = 12/107 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+ LKPYVI EPE+ I  R  EDEF+ILA+DGLWDVV+NETAC V R C+
Sbjct  270  GVLAMSRAIGDSSLKPYVIPEPEVVIMDRRMEDEFIILATDGLWDVVTNETACDVVRACM  329

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            Q ++P               S G  SDK CSDASILLTKLA+A+ ++
Sbjct  330  QAQQPS------------VGSMGGGSDKTCSDASILLTKLAIAKRSS  364



>ref|XP_010457921.1| PREDICTED: protein phosphatase 2C 3 [Camelina sativa]
Length=438

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 79/128 (62%), Gaps = 24/128 (19%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT EDEFLILASDGLWDVV+NE AC +  MCL
Sbjct  291  GVLAMSRAIGDNYLKPYVTSEPEVTVTDRTEEDEFLILASDGLWDVVTNEAACAMVHMCL  350

Query  182  QHRKPPSPLPLSGNDVSVTPSS-----------------------GESSDKACSDASILL  292
              +           +   TP                         GE +DKAC++AS+LL
Sbjct  351  NRKGGRGGSGRRRGETQ-TPGGRSEEEGKEEENEKVVGSRKNGKRGEITDKACTEASVLL  409

Query  293  TKLALARH  316
            TKLALA+H
Sbjct  410  TKLALAKH  417



>ref|XP_009387749.1| PREDICTED: probable protein phosphatase 2C 68 [Musa acuminata 
subsp. malaccensis]
Length=388

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 77/104 (74%), Gaps = 13/104 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKPYV SEPE+T+T+R+ EDE LIL SDGLWDVV+N+ AC VARMCL
Sbjct  280  GVLAMSRAIGDSYLKPYVTSEPEVTVTERSEEDECLILGSDGLWDVVTNDMACHVARMCL  339

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
            +    P+ +P            GE  D ACSDA+ LLTKLALAR
Sbjct  340  RA-SSPARVP------------GERRDGACSDAATLLTKLALAR  370



>ref|XP_010487459.1| PREDICTED: protein phosphatase 2C 3-like [Camelina sativa]
Length=439

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 79/128 (62%), Gaps = 24/128 (19%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT EDEFLILASDGLWDVV+NE AC +  MCL
Sbjct  292  GVLAMSRAIGDNYLKPYVTSEPEVTVTDRTEEDEFLILASDGLWDVVTNEAACAMVHMCL  351

Query  182  QHRKPPSPLPLSGNDVSVTPSS-----------------------GESSDKACSDASILL  292
              +           +   TP                         GE +DKAC++AS+LL
Sbjct  352  NRKGGRGGSGRRRGETQ-TPGGRSEEEGKEEENEKVVGSRKNGKRGEITDKACTEASVLL  410

Query  293  TKLALARH  316
            TKLALA+H
Sbjct  411  TKLALAKH  418



>ref|XP_006417805.1| hypothetical protein EUTSA_v10007705mg [Eutrema salsugineum]
 gb|ESQ36158.1| hypothetical protein EUTSA_v10007705mg [Eutrema salsugineum]
Length=427

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 80/117 (68%), Gaps = 12/117 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT EDEFLILASDGLWDVV+NE AC +  M L
Sbjct  288  GVLAMSRAIGDNYLKPYVSSEPEVTVTDRTEEDEFLILASDGLWDVVTNEAACAMVLMYL  347

Query  182  Q-------HRKPPSPLPLSGNDVSVTPS-----SGESSDKACSDASILLTKLALARH  316
                     R+ P        +  V  S      GE +DKAC++AS+LLTKLALA+H
Sbjct  348  NRKGRGGRRRETPESHEEGKEEAKVVGSRKNGKKGEITDKACTEASVLLTKLALAKH  404



>ref|XP_010558044.1| PREDICTED: protein phosphatase 2C 37-like [Tarenaya hassleriana]
Length=405

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 74/105 (70%), Gaps = 19/105 (18%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKP+VI +PE+T+T RT EDE LI+ASDGLWDVV NETACGVARMCL
Sbjct  303  GVLAMSRAIGDNYLKPFVIPDPEVTVTDRTDEDECLIIASDGLWDVVPNETACGVARMCL  362

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            +                   ++ E    ACSDA+ LLTKLALAR 
Sbjct  363  R-------------------AAAEEGHSACSDAAKLLTKLALARQ  388



>ref|XP_010521895.1| PREDICTED: protein phosphatase 2C 3-like [Tarenaya hassleriana]
Length=395

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 8/114 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SRAIGDNYLKPYVI EPE+TIT RT +DE LILASDGLWDVVSNETAC VA MCL
Sbjct  266  GVLATSRAIGDNYLKPYVICEPEVTITDRTDDDECLILASDGLWDVVSNETACAVASMCL  325

Query  182  QHR----KPPSPLPLSGNDVSVTP----SSGESSDKACSDASILLTKLALARHT  319
            + +    +  +   ++  +  V       SGE SD+AC  AS+LLT+LALAR++
Sbjct  326  RGKVRTGRRRAAARVTEEEEKVGSRNRRRSGEISDQACGVASVLLTRLALARYS  379



>gb|ABW81089.1| unknown [Cleome spinosa]
Length=395

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 8/114 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SRAIGDNYLKPYVI EPE+TIT RT +DE LILASDGLWDVVSNETAC VA MCL
Sbjct  266  GVLATSRAIGDNYLKPYVICEPEVTITDRTDDDECLILASDGLWDVVSNETACAVASMCL  325

Query  182  QHR----KPPSPLPLSGNDVSVTP----SSGESSDKACSDASILLTKLALARHT  319
            + +    +  +   ++  +  V       SGE SD+AC  AS+LLT+LALAR++
Sbjct  326  RGKVRTGRRRAAARVTEEEEKVGSRNRRRSGEISDQACGVASVLLTRLALARYS  379



>gb|EYU45960.1| hypothetical protein MIMGU_mgv1a008586mg [Erythranthe guttata]
Length=369

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 79/107 (74%), Gaps = 3/107 (3%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+T RT EDE LILASDGLWDVVS +TACG+A MCL
Sbjct  251  GVLAMSRAIGDNYLKPYVSCEPEVTMTDRTEEDECLILASDGLWDVVSEDTACGIALMCL  310

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
               K  +          +     ESSDKAC+DAS+LLTKLALAR ++
Sbjct  311  ---KGGTTAAPPPPPPPLPSPESESSDKACNDASMLLTKLALARRSS  354



>ref|XP_008777431.1| PREDICTED: probable protein phosphatase 2C 24 [Phoenix dactylifera]
Length=434

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKPYV+SEPE+++T+R   DE LILASDGLWDVV+NETAC +ARMCL
Sbjct  317  GVLAMSRAIGDSYLKPYVVSEPEVSVTEREEGDECLILASDGLWDVVTNETACDIARMCL  376

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +   P +    +  +           DKACSDA++LLT+LALAR +A
Sbjct  377  RSGAPAA----AAEEEEEEEERRRFKDKACSDAAMLLTRLALARQSA  419



>gb|ABW81185.1| protein-phosphatase1 [Arabidopsis cebennensis]
Length=385

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 82/110 (75%), Gaps = 18/110 (16%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT RT +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  272  GVLAMSRAIGDNYLKPYVSCEPEVTITDRT-DDDCLILASDGLWDVVSNETACSVARMCL  330

Query  182  Q--HRKPPSPLP-LSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +   ++  S  P +SG              KAC++AS+LLTKLALARH++
Sbjct  331  RGGRKREGSEDPTISG--------------KACTEASVLLTKLALARHSS  366



>ref|XP_009402271.1| PREDICTED: probable protein phosphatase 2C 30 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 77/107 (72%), Gaps = 11/107 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKPYV+SEPE+T+T+R   DE LILASDGLWDVVSNETACG+ARMCL
Sbjct  286  GVLAMSRAIGDSYLKPYVVSEPEVTVTEREEGDECLILASDGLWDVVSNETACGIARMCL  345

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +           G   S+           CSDA+ILLTKLALAR +A
Sbjct  346  RGGGDDEEEEGGGGGDSL-----------CSDAAILLTKLALARQSA  381



>ref|XP_010920508.1| PREDICTED: probable protein phosphatase 2C 68 [Elaeis guineensis]
Length=395

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 81/108 (75%), Gaps = 17/108 (16%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKPYV++EPE+T+T+R   D+ LILASDGLWDVV+NE AC +ARMCL
Sbjct  290  GVLAMSRAIGDSYLKPYVMAEPEVTVTEREEGDDCLILASDGLWDVVTNEMACDIARMCL  349

Query  182  QHRKPPSPLPLSGNDVSVTPSSGES-SDKACSDASILLTKLALARHTA  322
                            S  P+ GES S++ACS+A++LLTKLA+AR +A
Sbjct  350  ----------------SAPPADGESGSNRACSEAAVLLTKLAIARQSA  381



>gb|ACR36367.1| unknown [Zea mays]
 gb|AIB05797.1| orphans transcription factor, partial [Zea mays]
Length=187

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 86/137 (63%), Gaps = 30/137 (22%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKP+VIS+PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  35   GMLAMSRAIGDSYLKPFVISDPEVLVVERKDGEDEFLILASDGLWDVVSNEVACKVVRTC  94

Query  179  LQHRKPPSPLPLSGNDVSVTP----------------------------SSGESS-DKAC  271
            L++R P      S    +++P                            S GES+ D+AC
Sbjct  95   LRNRAPRGGRERSSPTSNLSPRQSSASGGSSSSGDEEAGGPSGDGAGSESDGESAEDRAC  154

Query  272  SDASILLTKLALARHTA  322
            ++A+ILLTKLALAR +A
Sbjct  155  AEAAILLTKLALARQSA  171



>gb|KHN07593.1| Protein phosphatase 2C 37 [Glycine soja]
Length=287

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 5/84 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVISEPE+ +T+RT EDE LILASDGLWDVVSNETACGV RMCL
Sbjct  208  GVLAMSRAIGDNYLKPYVISEPEVMVTERTEEDECLILASDGLWDVVSNETACGVVRMCL  267

Query  182  QHRKPP-SPLPLSGNDVSVTPSSG  250
            + +KPP SP    G+DV+   + G
Sbjct  268  KAQKPPGSP----GSDVAADGAVG  287



>gb|AHN16197.1| HAI2.1 [Brassica napus]
Length=436

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 79/123 (64%), Gaps = 22/123 (18%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SRAIGDNYLKPYV SEPE+T+T RT EDEF+ILASDGLWDVV+NE AC   +M L
Sbjct  299  GVLATSRAIGDNYLKPYVSSEPEVTVTDRTEEDEFMILASDGLWDVVTNEAACATVQMYL  358

Query  182  -----------------QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALA  310
                             + RK    +    N        GE +DKAC++AS+LLTKLALA
Sbjct  359  NKKGGRGGGRRREATECEERKEEKAVGSRKNG-----KRGEITDKACTEASVLLTKLALA  413

Query  311  RHT  319
            +H+
Sbjct  414  KHS  416



>ref|XP_010931227.1| PREDICTED: probable protein phosphatase 2C 24 [Elaeis guineensis]
Length=429

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 79/107 (74%), Gaps = 9/107 (8%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKPYVISEPE+++T R   DE LILASDGLWDVV+NETAC +ARMCL
Sbjct  316  GVLAMSRAIGDSYLKPYVISEPEVSVTLREEGDECLILASDGLWDVVNNETACDIARMCL  375

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +   P +     G  +          DKACS+A++LLTKLALAR +A
Sbjct  376  RSAAPAAAAAEEGRYM---------EDKACSNAAMLLTKLALARQSA  413



>ref|XP_009118961.1| PREDICTED: protein phosphatase 2C 3 [Brassica rapa]
Length=487

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 78/122 (64%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT EDEFLILASDGLWDVV+NE AC +  M L
Sbjct  347  GVLAMSRAIGDNYLKPYVSSEPEVTVTDRTEEDEFLILASDGLWDVVTNEAACAMVHMYL  406

Query  182  QHRKPPSPLPLSGNDVSV---------------TPSSGESSDKACSDASILLTKLALARH  316
              R                              +   GE SD+AC++AS+LLTKLALA+H
Sbjct  407  SKRGGRGGGRRRETKECGEGKEEEEKVVVGSKKSGKKGEISDRACTEASVLLTKLALAKH  466

Query  317  TA  322
            ++
Sbjct  467  SS  468



>emb|CDY06259.1| BnaA09g49440D [Brassica napus]
Length=436

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 79/119 (66%), Gaps = 12/119 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SRAIGDNYLKPYV SEPE+T+T RT EDEF+ILASDGLWDVV+NE AC   +M L
Sbjct  299  GVLATSRAIGDNYLKPYVSSEPEVTVTDRTEEDEFMILASDGLWDVVTNEAACATVQMYL  358

Query  182  QHRKPPSPLPLSG-------NDVSVTPS-----SGESSDKACSDASILLTKLALARHTA  322
              +                  D  V  S      GE +D+AC++AS+LLTKLALA+H++
Sbjct  359  NKKGGRGEGRRREATEGEERKDEEVVGSRKNGKRGEITDRACTEASVLLTKLALAKHSS  417



>gb|AHN16198.1| HAI2.2 [Brassica napus]
Length=421

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 78/122 (64%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT EDEFLILASDGLWDVV+NE AC +  M L
Sbjct  281  GVLAMSRAIGDNYLKPYVSSEPEVTVTDRTEEDEFLILASDGLWDVVTNEAACAMVHMYL  340

Query  182  QHRKPPSPLPLSGNDVSV---------------TPSSGESSDKACSDASILLTKLALARH  316
              R                              +   GE SD+AC++AS+LLTKLALA+H
Sbjct  341  SKRGGRGGGRRRETKECGEGKEEEEKVVVGSKKSGKKGEISDRACTEASVLLTKLALAKH  400

Query  317  TA  322
            ++
Sbjct  401  SS  402



>ref|XP_009118439.1| PREDICTED: protein phosphatase 2C 3-like [Brassica rapa]
Length=436

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 79/119 (66%), Gaps = 12/119 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SRAIGDNYLKPYV SEPE+T+T RT EDEF+ILASDGLWDVV+NE AC   +M L
Sbjct  299  GVLATSRAIGDNYLKPYVSSEPEVTVTDRTEEDEFMILASDGLWDVVTNEAACATVQMYL  358

Query  182  QHRKPPSPLPLSG-------NDVSVTPS-----SGESSDKACSDASILLTKLALARHTA  322
              +                  D  V  S      GE +D+AC++AS+LLTKLALA+H++
Sbjct  359  NKKGGRGEGRRREATEGEERKDEEVVGSRKNGKRGEITDRACTEASVLLTKLALAKHSS  417



>ref|NP_180499.1| highly ABA-induced PP2C protein 3 [Arabidopsis thaliana]
 sp|Q9ZW21.1|P2C24_ARATH RecName: Full=Probable protein phosphatase 2C 24; Short=AtPP2C24 
[Arabidopsis thaliana]
 gb|AAC95200.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 gb|AAY25459.1| At2g29380 [Arabidopsis thaliana]
 gb|AAY57322.1| At2g29380 [Arabidopsis thaliana]
 gb|AAY78704.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 gb|AEC08244.1| highly ABA-induced PP2C protein 3 [Arabidopsis thaliana]
Length=362

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 77/107 (72%), Gaps = 12/107 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+TIT R  +D+ LILASDGLWDVVSNETAC VARMCL
Sbjct  256  GVLAMSRAIGDNYLKPYVSCEPEVTITDRR-DDDCLILASDGLWDVVSNETACSVARMCL  314

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +           G            SDKAC++AS+LLTKLALAR+++
Sbjct  315  R-----------GGGRRQDNEDPAISDKACTEASVLLTKLALARNSS  350



>ref|NP_001130968.1| uncharacterized protein LOC100192073 [Zea mays]
 gb|ACF79376.1| unknown [Zea mays]
Length=256

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 86/137 (63%), Gaps = 30/137 (22%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKP+VIS+PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  104  GMLAMSRAIGDSYLKPFVISDPEVLVVERKDGEDEFLILASDGLWDVVSNEVACKVVRTC  163

Query  179  LQHRKPPSPLPLSGNDVSVTP----------------------------SSGESS-DKAC  271
            L++R P      S    +++P                            S GES+ D+AC
Sbjct  164  LRNRAPRGGRERSSPTSNLSPRQSSASGGSSSSGDEEAGGPSGDGAGSESDGESAEDRAC  223

Query  272  SDASILLTKLALARHTA  322
            ++A+ILLTKLALAR +A
Sbjct  224  AEAAILLTKLALARQSA  240



>ref|XP_004984925.1| PREDICTED: probable protein phosphatase 2C 30-like [Setaria italica]
Length=397

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 84/130 (65%), Gaps = 23/130 (18%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKP+VIS+PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  252  GMLAMSRAIGDSYLKPFVISDPEVRVVERKDGEDEFLILASDGLWDVVSNEVACKVVRAC  311

Query  179  LQH---RKPPSPLPLSG-----------NDVSVTPSSGESS--------DKACSDASILL  292
            L++   R+     P S             D    PS G +S        DKAC++A+ILL
Sbjct  312  LRNGAVRRGERSSPTSNLSPRQSSGSSSGDEEAGPSDGAASDSDGEGGEDKACAEAAILL  371

Query  293  TKLALARHTA  322
            TKLALAR TA
Sbjct  372  TKLALARQTA  381



>ref|XP_004172971.1| PREDICTED: LOW QUALITY PROTEIN: protein phosphatase 2C 3-like 
[Cucumis sativus]
Length=402

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+ LKPYVISEPE+ +  R  EDEF+ILA+DGLWDVV+NETAC   R C+
Sbjct  273  GVLAMSRAIGDSSLKPYVISEPEVVVMDRRMEDEFIILATDGLWDVVTNETACDAVRTCM  332

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + ++  S L L       + S G  SDK CSDASILLTKLA+A+H++
Sbjct  333  RAQRASSSLSLL---EESSGSMGGGSDKTCSDASILLTKLAIAKHSS  376



>ref|NP_001266874.1| uncharacterized protein LOC101027236 [Zea mays]
 gb|ACR34958.1| unknown [Zea mays]
Length=394

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 86/137 (63%), Gaps = 30/137 (22%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKP+VIS+PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  242  GMLAMSRAIGDSYLKPFVISDPEVRVVERKDGEDEFLILASDGLWDVVSNEVACKVVRTC  301

Query  179  LQHRKPPSPLPLSGNDVSVTP----------------------------SSGESS-DKAC  271
            L++R P      S    +++P                            S GES+ D+AC
Sbjct  302  LRNRAPRGGREQSSPTSNLSPRQSSGSGSGSSSGDEEAGGPSGDGAGSESDGESAEDRAC  361

Query  272  SDASILLTKLALARHTA  322
            ++A+ILLTKLALAR +A
Sbjct  362  AEAAILLTKLALARQSA  378



>gb|KGN45741.1| hypothetical protein Csa_6G008720 [Cucumis sativus]
Length=402

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+ LKPYVISEPE+ +  R  EDEF+ILA+DGLWDVV+NETAC   R C+
Sbjct  273  GVLAMSRAIGDSSLKPYVISEPEVVVMDRRMEDEFIILATDGLWDVVTNETACDAVRTCM  332

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + ++  S L L       + S G  SDK CSDASILLTKLA+A+H++
Sbjct  333  RAQRASSSLSLL---EESSGSMGGGSDKTCSDASILLTKLAIAKHSS  376



>ref|XP_004138578.1| PREDICTED: protein phosphatase 2C 3-like [Cucumis sativus]
Length=387

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 3/107 (3%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+ LKPYVISEPE+ +  R  EDEF+ILA+DGLWDVV+NETAC   R C+
Sbjct  258  GVLAMSRAIGDSSLKPYVISEPEVVVMDRRMEDEFIILATDGLWDVVTNETACDAVRTCM  317

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + ++  S L L       + S G  SDK CSDASILLTKLA+A+H++
Sbjct  318  RAQRASSSLSLL---EESSGSMGGGSDKTCSDASILLTKLAIAKHSS  361



>emb|CDY06705.1| BnaA10g04840D [Brassica napus]
Length=390

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 72/107 (67%), Gaps = 21/107 (20%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT EDEFLILASDGLWDVV+NE AC +  M L
Sbjct  286  GVLAMSRAIGDNYLKPYVSSEPEVTVTDRTEEDEFLILASDGLWDVVTNEAACAMVHMYL  345

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
              R                         AC++AS+LLTKLALA+H++
Sbjct  346  SKR---------------------GGRGACTEASVLLTKLALAKHSS  371



>ref|XP_008676186.1| PREDICTED: uncharacterized protein LOC100192073 isoform X1 [Zea 
mays]
 gb|AIG52099.1| 2C-type protein phosphatase protein [Zea mays]
Length=396

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 86/137 (63%), Gaps = 30/137 (22%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKP+VIS+PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  244  GMLAMSRAIGDSYLKPFVISDPEVLVVERKDGEDEFLILASDGLWDVVSNEVACKVVRTC  303

Query  179  LQHRKPPSPLPLSGNDVSVTP----------------------------SSGESS-DKAC  271
            L++R P      S    +++P                            S GES+ D+AC
Sbjct  304  LRNRAPRGGRERSSPTSNLSPRQSSASGGSSSSGDEEAGGPSGDGAGSESDGESAEDRAC  363

Query  272  SDASILLTKLALARHTA  322
            ++A+ILLTKLALAR +A
Sbjct  364  AEAAILLTKLALARQSA  380



>ref|XP_006827523.1| hypothetical protein AMTR_s00009p00196700 [Amborella trichopoda]
 gb|ERM94939.1| hypothetical protein AMTR_s00009p00196700 [Amborella trichopoda]
Length=415

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKPY+ SEPEITIT  T +DE LILASDGLWDV+ NE  C VAR CL
Sbjct  294  GVLAMSRAIGDRYLKPYITSEPEITITDITPDDECLILASDGLWDVLPNELVCNVARQCL  353

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
              R PP       +D+  +    + S   C+ A+ LLTKLALAR ++
Sbjct  354  FGRSPPRLTQPESSDLVGSQGLDDGSQSPCTLAATLLTKLALARKSS  400



>ref|XP_006279627.1| hypothetical protein CARUB_v10026477mg [Capsella rubella]
 gb|EOA12525.1| hypothetical protein CARUB_v10026477mg [Capsella rubella]
Length=420

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 4/109 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS+PE+T+  R   D+FLILASDGLWDVV NE AC V  MCL
Sbjct  296  GVLAMSRAIGDNYLKPYVISKPEVTVMDRVNGDDFLILASDGLWDVVPNEVACSVVHMCL  355

Query  182  QH----RKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARH  316
            +     +   SP        +V    G+ SD+AC  AS+LLT+LALAR 
Sbjct  356  RGEVNCQLTSSPERDGAGAGNVVVGGGDVSDEACEKASVLLTRLALARR  404



>gb|ACG39816.1| protein phosphatase 2C [Zea mays]
Length=365

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 84/137 (61%), Gaps = 30/137 (22%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKP+VIS+PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  213  GMLAMSRAIGDSYLKPFVISDPEVLVVERKDGEDEFLILASDGLWDVVSNEVACKVVRTC  272

Query  179  LQHRKPPSPLPLSGNDVSVTP----------------------------SSGESS-DKAC  271
            L++R P      S    +++P                            S GES+ D+AC
Sbjct  273  LRNRAPRGGRERSSPTSNLSPRQSSASXGSSSSGDEEAGGPSGDGAGSESDGESAEDRAC  332

Query  272  SDASILLTKLALARHTA  322
            ++A+ILLTKL  AR +A
Sbjct  333  AEAAILLTKLGXARQSA  349



>ref|XP_006409984.1| hypothetical protein EUTSA_v10017797mg [Eutrema salsugineum]
 gb|ESQ51437.1| hypothetical protein EUTSA_v10017797mg [Eutrema salsugineum]
Length=391

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 74/107 (69%), Gaps = 12/107 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPE+T+T RT +D+ LILASDGLWDVVSNETAC VA MCL
Sbjct  278  GVLAMSRAIGDNYLKPYVSCEPEVTVTDRT-DDDCLILASDGLWDVVSNETACSVASMCL  336

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +                        S+KAC +AS+LLTKLALAR ++
Sbjct  337  RGGG-----------RRRRGGQDWVSEKACMEASVLLTKLALARQSS  372



>ref|XP_006407450.1| hypothetical protein EUTSA_v10020827mg [Eutrema salsugineum]
 gb|ESQ48903.1| hypothetical protein EUTSA_v10020827mg [Eutrema salsugineum]
Length=412

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT EDE LILASDGLWDVV NETACGVARMCL
Sbjct  298  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTEEDECLILASDGLWDVVPNETACGVARMCL  357

Query  182  Q  184
            Q
Sbjct  358  Q  358



>gb|EPS58614.1| hypothetical protein M569_16200 [Genlisea aurea]
Length=330

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 73/104 (70%), Gaps = 16/104 (15%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKP+V S PE+T+T+RT  DE LILASDGLWDVVSN+TAC VARMCL
Sbjct  213  GVLAMSRAIGDSYLKPFVSSIPEVTVTERTESDELLILASDGLWDVVSNDTACAVARMCL  272

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
                     P +G            +D+ C  AS++LT+LALAR
Sbjct  273  S----GGAFPPAG------------TDETCGYASMMLTQLALAR  300



>emb|CDY67227.1| BnaA01g37370D [Brassica napus]
Length=371

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT EDE LILASDGLWDVV+NETACGVARMCL
Sbjct  269  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTEEDECLILASDGLWDVVTNETACGVARMCL  328

Query  182  Q  184
            +
Sbjct  329  K  329



>emb|CDY33008.1| BnaA10g12140D [Brassica napus]
Length=395

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS+PE+T+T R  +DEFLILASDGLWDVVSNETAC V RMCL
Sbjct  288  GVLAMSRAIGDNYLKPYVISKPEVTVTDRVKQDEFLILASDGLWDVVSNETACNVVRMCL  347

Query  182  QHRKPPSPL  208
            + RK  S L
Sbjct  348  K-RKVNSQL  355



>ref|XP_010464843.1| PREDICTED: protein phosphatase 2C 37 [Camelina sativa]
Length=394

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 65/92 (71%), Gaps = 15/92 (16%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT EDE LILASDGLWDVV NETACGVARMCL
Sbjct  287  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDEDECLILASDGLWDVVPNETACGVARMCL  346

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSD  277
            +           G D       GE S  ACSD
Sbjct  347  R-----------GAD----SVDGEDSHNACSD  363



>ref|XP_009121141.1| PREDICTED: protein phosphatase 2C 37-like [Brassica rapa]
Length=380

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 67/92 (73%), Gaps = 11/92 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT +DE LILASDGLWDVV+NE ACGVARMCL
Sbjct  269  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTEDDECLILASDGLWDVVTNEMACGVARMCL  328

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSD  277
            +           G DV+      +++  ACSD
Sbjct  329  K-----------GADVAEGGGDSDAAHNACSD  349



>emb|CDX80307.1| BnaC09g34350D [Brassica napus]
Length=396

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS+PE+T+T R  +DEFLILASDGLWDVVSNETAC V RMCL
Sbjct  289  GVLAMSRAIGDNYLKPYVISKPEVTVTDRVKQDEFLILASDGLWDVVSNETACNVVRMCL  348

Query  182  Q  184
            +
Sbjct  349  K  349



>ref|XP_010486793.1| PREDICTED: protein phosphatase 2C 37-like [Camelina sativa]
Length=398

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 66/92 (72%), Gaps = 15/92 (16%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT +DE LILASDGLWDVV NETACGVARMCL
Sbjct  283  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDDDECLILASDGLWDVVPNETACGVARMCL  342

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSD  277
            +           G D     + GE S  ACSD
Sbjct  343  R-----------GADA----ADGEDSHNACSD  359



>ref|XP_010495429.1| PREDICTED: protein phosphatase 2C 37 isoform X1 [Camelina sativa]
 ref|XP_010495472.1| PREDICTED: protein phosphatase 2C 37 isoform X2 [Camelina sativa]
Length=403

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 66/92 (72%), Gaps = 15/92 (16%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT +DE LILASDGLWDVV NETACGVARMCL
Sbjct  289  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDDDECLILASDGLWDVVPNETACGVARMCL  348

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSD  277
            +           G D     + GE S  ACSD
Sbjct  349  R-----------GADA----ADGEDSHNACSD  365



>tpg|DAA56862.1| TPA: putative protein phosphatase 2C family protein [Zea mays]
Length=408

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 85/120 (71%), Gaps = 13/120 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+V SEPE+T+T+RT +DE LILASDGLWDVV+NE AC V R C 
Sbjct  275  GVLAMSRAIGDRYLKPFVSSEPEVTVTERTDDDECLILASDGLWDVVTNEMACEVVRACF  334

Query  182  QHRKPPSP--------LPLSG----NDVSVTPSSG-ESSDKACSDASILLTKLALARHTA  322
            +   PP+P        LP +G    +  +V    G E SDKACSDA++LL KLALAR +A
Sbjct  335  RSNGPPAPAARPNGVALPAAGAGAEDGSAVVKGVGKEDSDKACSDAAMLLAKLALARRSA  394



>ref|NP_001149037.1| protein phosphatase 2C [Zea mays]
 gb|ACG33911.1| protein phosphatase 2C [Zea mays]
Length=408

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 85/120 (71%), Gaps = 13/120 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+V SEPE+T+T+RT +DE LILASDGLWDVV+NE AC V R C 
Sbjct  275  GVLAMSRAIGDRYLKPFVSSEPEVTVTERTDDDECLILASDGLWDVVTNEMACEVVRACF  334

Query  182  QHRKPPSP--------LPLSG----NDVSVTPSSG-ESSDKACSDASILLTKLALARHTA  322
            +   PP+P        LP +G    +  +V    G E SDKACSDA++LL KLALAR +A
Sbjct  335  RSNGPPAPAARPNGVALPAAGAGAEDGSAVVKGVGKEDSDKACSDAAMLLAKLALARRSA  394



>gb|KFK43050.1| hypothetical protein AALP_AA1G071700 [Arabis alpina]
Length=443

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 82/122 (67%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T RT ED+FLILASDGLWDVV+NE AC +  MCL
Sbjct  303  GVLAMSRAIGDNYLKPYVTSEPEVTVTDRTEEDDFLILASDGLWDVVTNEAACAMVHMCL  362

Query  182  QHRK-----PPSPLPLSGNDVSV----------TPSSGESSDKACSDASILLTKLALARH  316
              +           P SG +                 GE +DKAC++AS+LLTKLALA+H
Sbjct  363  NRKNGGRGRRRETTPASGGERKEEEVVVVGSRKNGKKGEITDKACTEASLLLTKLALAKH  422

Query  317  TA  322
            ++
Sbjct  423  SS  424



>gb|AIB05995.1| orphans transcription factor, partial [Zea mays]
Length=408

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 85/120 (71%), Gaps = 13/120 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+V SEPE+T+T+RT +DE LILASDGLWDVV+NE AC V R C 
Sbjct  275  GVLAMSRAIGDRYLKPFVSSEPEVTVTERTDDDECLILASDGLWDVVTNEMACEVVRACF  334

Query  182  QHRKPPSP--------LPLSG----NDVSVTPSSG-ESSDKACSDASILLTKLALARHTA  322
            +   PP+P        LP +G    +  +V    G E SDKACSDA++LL KLALAR +A
Sbjct  335  RSNGPPAPAARPNGVALPAAGAGAEDGSAVVKGVGKEDSDKACSDAAMLLAKLALARRSA  394



>pdb|4N0G|A Chain A, Crystal Structure Of Pyl13-pp2ca Complex
 pdb|4N0G|B Chain B, Crystal Structure Of Pyl13-pp2ca Complex
Length=328

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT EDE LILASDGLWDVV NETACGVARMCL
Sbjct  216  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDEDECLILASDGLWDVVPNETACGVARMCL  275

Query  182  Q  184
            +
Sbjct  276  R  276



>ref|XP_002864609.1| hypothetical protein ARALYDRAFT_496034 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40868.1| hypothetical protein ARALYDRAFT_496034 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 69/101 (68%), Gaps = 8/101 (8%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS+PE+T+T R   D+FLILASDGLWDVVSNETAC V RMCL
Sbjct  285  GVLAMSRAIGDNYLKPYVISKPEVTVTDRVNGDDFLILASDGLWDVVSNETACSVVRMCL  344

Query  182  QHR-------KPPSPLPLSGNDVSVTPSSGESSDKACSDAS  283
              +        P   +   G   +V    G+  DKAC +AS
Sbjct  345  SGKANGQLSTSPEREMTGVGAG-NVMVGGGDLPDKACEEAS  384



>ref|NP_187748.1| protein phosphatase 2CA [Arabidopsis thaliana]
 sp|P49598.1|P2C37_ARATH RecName: Full=Protein phosphatase 2C 37; Short=AtPP2C37; AltName: 
Full=Protein ABA-HYPERSENSITIVE GERMINATION 3; AltName: 
Full=Protein phosphatase 2C A; Short=PP2CA [Arabidopsis thaliana]
 gb|AAG51448.1|AC008153_21 protein phosphatase 2C (PP2C); 28184-26716 [Arabidopsis thaliana]
 dbj|BAA07287.1| protein phosphatase 2C [Arabidopsis thaliana]
 gb|AAL67064.1| putative protein phosphatase PP2C [Arabidopsis thaliana]
 gb|AAM14330.1| putative protein phosphatase 2C (PP2C) [Arabidopsis thaliana]
 gb|AEE75044.1| protein phosphatase 2C 37 [Arabidopsis thaliana]
Length=399

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT EDE LILASDGLWDVV NETACGVARMCL
Sbjct  287  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDEDECLILASDGLWDVVPNETACGVARMCL  346

Query  182  Q  184
            +
Sbjct  347  R  347



>emb|CDY01017.1| BnaC05g41830D [Brassica napus]
Length=393

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+ +T RT +DE LILASDGLWDVV+NETACGVARMCL
Sbjct  287  GVLAMSRAIGDNYLKPYVIPDPEVAVTDRTDDDECLILASDGLWDVVTNETACGVARMCL  346

Query  182  Q  184
            Q
Sbjct  347  Q  347



>ref|XP_010483528.1| PREDICTED: probable protein phosphatase 2C 78 [Camelina sativa]
Length=410

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS+PE+T+T R  ED+FLILASDGLWDVVSNETAC V RMCL
Sbjct  285  GVLAMSRAIGDNYLKPYVISKPEVTVTDRVNEDDFLILASDGLWDVVSNETACSVVRMCL  344

Query  182  Q  184
            +
Sbjct  345  R  345



>gb|EMT28836.1| Putative protein phosphatase 2C 8 [Aegilops tauschii]
Length=143

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKPYVI+EPE+T+  RT +DEFLILASDGLWDVVSN+ AC +AR C 
Sbjct  21   GVLATSRSIGDYYLKPYVIAEPEVTVMDRTDKDEFLILASDGLWDVVSNDVACKIARNC-  79

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
                      LSG   S  P S   S  A  DA+ LL +LA+AR
Sbjct  80   ----------LSGRAASKYPESVSGSTAA--DAAALLVELAIAR  111



>gb|KFK38501.1| hypothetical protein AALP_AA3G121300 [Arabis alpina]
Length=382

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT EDE LI+ASDGLWDVV NETACGVARMCL
Sbjct  273  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTEEDECLIIASDGLWDVVPNETACGVARMCL  332

Query  182  Q  184
            +
Sbjct  333  K  333



>ref|XP_010443659.1| PREDICTED: probable protein phosphatase 2C 78 [Camelina sativa]
Length=419

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS+PE+T+T R  ED+FLILASDGLWDVVSNETAC V RMCL
Sbjct  294  GVLAMSRAIGDNYLKPYVISKPEVTVTDRVNEDDFLILASDGLWDVVSNETACSVVRMCL  353

Query  182  Q  184
            +
Sbjct  354  R  354



>ref|XP_003564598.1| PREDICTED: probable protein phosphatase 2C 9 [Brachypodium distachyon]
Length=403

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 6/98 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+V +EPE+T+T+R  +DE LILASDGLWDVV+NE ACGV R C 
Sbjct  277  GVLAMSRAIGDGYLKPFVTAEPEVTVTERADDDECLILASDGLWDVVTNEMACGVVRACF  336

Query  182  QHRKPPSPL--PLSGNDVSVTPSSGE----SSDKACSD  277
            +   PP P     +GND + + S        SDKACSD
Sbjct  337  RSNGPPEPFAEAEAGNDGASSSSGKGVSKAESDKACSD  374



>ref|XP_010454666.1| PREDICTED: probable protein phosphatase 2C 78 [Camelina sativa]
Length=419

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 69/99 (70%), Gaps = 5/99 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRAIGDNYLKPYVIS+PE+T+T R  ED+FLILASDGLWDVVSNETAC V RMCL
Sbjct  294  GILAMSRAIGDNYLKPYVISKPEVTVTDRVNEDDFLILASDGLWDVVSNETACSVVRMCL  353

Query  182  QHRKPPSPLPLSGND-----VSVTPSSGESSDKACSDAS  283
            + +           D       V    G+ SDKAC +AS
Sbjct  354  RGKVNGQLTSSPETDGAGAGNVVVGGGGDVSDKACEEAS  392



>ref|XP_009404586.1| PREDICTED: probable protein phosphatase 2C 49 [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 10/110 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKPYV SEPE+T+T+R  +DEFLIL SDGLWDVV+NE AC V R CL
Sbjct  283  GVLAMSRAIGDGYLKPYVTSEPEVTVTERRDDDEFLILGSDGLWDVVTNEMACDVVRTCL  342

Query  182  QHRKP---PSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            + + P   P    + G D       G  SD+ACSDA+ LLTKLALAR +A
Sbjct  343  RAKAPLKEPIGEEVVGRD-------GRCSDRACSDAAALLTKLALARQSA  385



>ref|XP_002884844.1| AHG3/ATPP2CA [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61103.1| AHG3/ATPP2CA [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT +DE LILASDGLWDVV NETACGVARMCL
Sbjct  284  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDDDECLILASDGLWDVVPNETACGVARMCL  343

Query  182  QHRKP  196
            +   P
Sbjct  344  RGAGP  348



>ref|XP_006297848.1| hypothetical protein CARUB_v10013886mg [Capsella rubella]
 gb|EOA30746.1| hypothetical protein CARUB_v10013886mg [Capsella rubella]
Length=396

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT +DE LILASDGLWDVV NETACGVARMCL
Sbjct  277  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDDDECLILASDGLWDVVPNETACGVARMCL  336

Query  182  Q  184
            +
Sbjct  337  R  337



>ref|NP_001049674.1| Os03g0268600 [Oryza sativa Japonica Group]
 sp|Q84JI0.1|P2C30_ORYSJ RecName: Full=Probable protein phosphatase 2C 30; Short=OsPP2C30 
[Oryza sativa Japonica Group]
 gb|AAP06902.1| putative Serine/threonine phosphatases [Oryza sativa Japonica 
Group]
 gb|AAP06912.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF95181.1| Protein phosphatase 2C, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11588.1| Os03g0268600 [Oryza sativa Japonica Group]
 gb|EAZ26392.1| hypothetical protein OsJ_10276 [Oryza sativa Japonica Group]
 dbj|BAG91354.1| unnamed protein product [Oryza sativa Japonica Group]
Length=404

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 82/133 (62%), Gaps = 26/133 (20%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKPYVI +PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  257  GMLAMSRAIGDSYLKPYVICDPEVRVMERKDGEDEFLILASDGLWDVVSNEVACNVVRAC  316

Query  179  LQ---HRKPPSPLPLSGNDVSVTPSSGESS----------------------DKACSDAS  283
            L+    R+     P S      + SSG+ +                      DKAC++A+
Sbjct  317  LRSSGRRERNRSSPTSNLSPRQSSSSGDEAPNDGAPSAAAGSESDEESAAEEDKACAEAA  376

Query  284  ILLTKLALARHTA  322
            +LLTKLALAR T+
Sbjct  377  VLLTKLALARQTS  389



>emb|CDY67257.1| BnaAnng23920D [Brassica napus]
Length=371

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVI +PE+T+T RT +DE LILASDGLWDVV+NE ACGVARMCL
Sbjct  269  GVLAMSRAIGDNYLKPYVIPDPEVTVTDRTEDDECLILASDGLWDVVTNEMACGVARMCL  328

Query  182  Q  184
            +
Sbjct  329  K  329



>ref|XP_006846348.1| hypothetical protein AMTR_s00012p00259520 [Amborella trichopoda]
 gb|ERN08023.1| hypothetical protein AMTR_s00012p00259520 [Amborella trichopoda]
Length=426

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 66/91 (73%), Gaps = 10/91 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV SEPE+T+T+R AEDE LILASDGLWDVVSNE AC +AR CL
Sbjct  300  GVLAMSRAIGDNYLKPYVSSEPEVTVTERAAEDECLILASDGLWDVVSNEVACEIARRCL  359

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACS  274
            Q R P +    SG +          SD ACS
Sbjct  360  Q-RAPENGASSSGVN---------GSDPACS  380



>gb|AIG52088.1| 2C-type protein phosphatase protein [Zea mays]
Length=408

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 84/120 (70%), Gaps = 13/120 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+V SEPE+T+T+RT +DE LILASDG WDVV+NE AC V R C 
Sbjct  275  GVLAMSRAIGDRYLKPFVSSEPEVTVTERTDDDECLILASDGPWDVVTNEMACEVVRACF  334

Query  182  QHRKPPSP--------LPLSG----NDVSVTPSSG-ESSDKACSDASILLTKLALARHTA  322
            +   PP+P        LP +G    +  +V    G E SDKACSDA++LL KLALAR +A
Sbjct  335  RSNGPPAPAARPNGVALPAAGAGAEDGSAVVKGVGKEDSDKACSDAAMLLAKLALARRSA  394



>gb|EAY89397.1| hypothetical protein OsI_10903 [Oryza sativa Indica Group]
Length=406

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 82/136 (60%), Gaps = 29/136 (21%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKPYVI +PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  256  GMLAMSRAIGDSYLKPYVICDPEVRVMERKDGEDEFLILASDGLWDVVSNEVACNVVRAC  315

Query  179  LQ---HRKPPSPLPLSGNDVSVTPSSGESS-------------------------DKACS  274
            L+    R+     P S      + SSG+ +                         DKAC+
Sbjct  316  LRSSGRRERNRSSPTSNLSPRQSSSSGDEAPNDGAPSAAAAAAGSESDEESAAEEDKACA  375

Query  275  DASILLTKLALARHTA  322
            +A++LLTKLALAR T+
Sbjct  376  EAAVLLTKLALARQTS  391



>gb|KFK27433.1| hypothetical protein AALP_AA8G381900 [Arabis alpina]
Length=397

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS+PE+T+T R  ED+F+ILASDGLWDVVSN TAC V RMCL
Sbjct  271  GVLAMSRAIGDNYLKPYVISKPEVTVTDRVKEDDFIILASDGLWDVVSNVTACNVVRMCL  330

Query  182  QHR------KPPSPLPLSGNDVSVTPSSGESSDKACSDAS  283
            + +        P          +V    GE SDKAC +AS
Sbjct  331  RGKVNGQLSSSPERDIAGAGVGNVVVGEGEVSDKACEEAS  370



>emb|CDM84982.1| unnamed protein product [Triticum aestivum]
Length=397

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+V +EPE+T+T+R+  DE LILASDGLWDVV+NE AC VAR C 
Sbjct  273  GVLAMSRAIGDGYLKPFVTAEPEVTVTERSDADECLILASDGLWDVVTNEMACDVARACF  332

Query  182  QHRKPPSPLPL----SGNDVSVTPSSGESSDKACSD  277
            +   PP P       SG   +    S   SD+ACSD
Sbjct  333  RSNGPPEPATAQAQPSGEAKASEGVSKAESDRACSD  368



>ref|XP_006649824.1| PREDICTED: probable protein phosphatase 2C 30-like [Oryza brachyantha]
Length=404

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 77/133 (58%), Gaps = 26/133 (20%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKPYVI +PE+ + +R  +EDEFLILASDGLWDVV++E AC V R C
Sbjct  256  GMLAMSRAIGDSYLKPYVICDPEVRVMERKDSEDEFLILASDGLWDVVTDEVACNVVRAC  315

Query  179  LQ-------------------------HRKPPSPLPLSGNDVSVTPSSGESSDKACSDAS  283
            L+                            P    P +         S    DKAC++A+
Sbjct  316  LRSSGRRGRNRSSPTSSLSPRQSSSSGDEAPNDGAPSAAAGSESDDESAAEEDKACTEAA  375

Query  284  ILLTKLALARHTA  322
            +LLTKLALAR TA
Sbjct  376  VLLTKLALARQTA  388



>gb|AAL16163.1|AF428395_1 AT5g59220/mnc17_110 [Arabidopsis thaliana]
Length=413

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS PE+T+T R   D+FLILASDGLWDVVSNETAC V RMCL
Sbjct  287  GVLAMSRAIGDNYLKPYVISRPEVTVTDRANGDDFLILASDGLWDVVSNETACSVVRMCL  346

Query  182  Q  184
            +
Sbjct  347  R  347



>ref|NP_200730.1| putative protein phosphatase 2C 78 [Arabidopsis thaliana]
 sp|Q9FIF5.1|P2C78_ARATH RecName: Full=Probable protein phosphatase 2C 78; Short=AtPP2C78 
[Arabidopsis thaliana]
 dbj|BAB09767.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL06824.1| AT5g59220/mnc17_110 [Arabidopsis thaliana]
 gb|AAL67095.1| AT5g59220/mnc17_110 [Arabidopsis thaliana]
 gb|AED97159.1| putative protein phosphatase 2C 78 [Arabidopsis thaliana]
Length=413

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYVIS PE+T+T R   D+FLILASDGLWDVVSNETAC V RMCL
Sbjct  287  GVLAMSRAIGDNYLKPYVISRPEVTVTDRANGDDFLILASDGLWDVVSNETACSVVRMCL  346

Query  182  Q  184
            +
Sbjct  347  R  347



>ref|XP_003561786.1| PREDICTED: probable protein phosphatase 2C 30 [Brachypodium distachyon]
Length=405

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 79/138 (57%), Gaps = 31/138 (22%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            GVLAMSRAIGD+YLKP+VIS+PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  252  GVLAMSRAIGDSYLKPFVISDPEVRVVERKDGEDEFLILASDGLWDVVSNEVACNVVRSC  311

Query  179  L---------QHRKPPS---------------------PLPLSGNDVSVTPSSGESSDKA  268
            +         + R  P+                     P    G   S +       DKA
Sbjct  312  VRGNAKRRDDRGRSSPTSNLSPRQSSGSGSGSSSGDEAPNDDCGGAGSESDEESCEVDKA  371

Query  269  CSDASILLTKLALARHTA  322
            C +A+ILLTKLALAR T+
Sbjct  372  CGEAAILLTKLALARQTS  389



>gb|AGL93150.1| serine/threonine protein phosphatase 2C 30 [Triticum aestivum]
Length=409

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 81/139 (58%), Gaps = 32/139 (23%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            GVLAMSRAIGD+YLKP+VIS+PE+ +  R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  254  GVLAMSRAIGDSYLKPFVISDPEVRVLDRKDGEDEFLILASDGLWDVVSNEVACHVVRSC  313

Query  179  LQ---HRKPPSPLPLSG--------------------ND--------VSVTPSSGESSDK  265
            ++    R+     P S                     ND              SGE  D+
Sbjct  314  VRSKAKRRGGRSSPTSNLSPRQSSGSGSGSSSGDEAQNDGGGCADARSESDEESGEDVDE  373

Query  266  ACSDASILLTKLALARHTA  322
            AC++A+ILLTKLA+AR ++
Sbjct  374  ACAEAAILLTKLAIARQSS  392



>ref|XP_006362702.1| PREDICTED: probable protein phosphatase 2C 75-like [Solanum tuberosum]
Length=431

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 68/99 (69%), Gaps = 15/99 (15%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVL+MSRAIGDN LKPY+ SEPE+T TKR AEDE LILASDGLWDV+S++ AC V R CL
Sbjct  308  GVLSMSRAIGDNNLKPYMTSEPEMTFTKREAEDECLILASDGLWDVISSDIACAVGRECL  367

Query  182  QHRKPPSPLPLSGNDVSVTPSSGE--------SSDKACS  274
            +HR P         D+S  PSS E        SS +ACS
Sbjct  368  RHRDP-------AGDLSSRPSSVEGDSRGAMFSSRRACS  399



>ref|XP_010543770.1| PREDICTED: protein phosphatase 2C 37 isoform X1 [Tarenaya hassleriana]
 ref|XP_010543771.1| PREDICTED: protein phosphatase 2C 37 isoform X2 [Tarenaya hassleriana]
Length=412

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 77/107 (72%), Gaps = 19/107 (18%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD+YLKP+VI +PE+T+T RT EDE LI+ASDGLWDVV NETACGVARMCL
Sbjct  305  GVLAMSRAIGDSYLKPFVIPDPEVTVTDRTDEDECLIIASDGLWDVVPNETACGVARMCL  364

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +                    + E   KACSDA++LLTKLALAR +A
Sbjct  365  R-------------------GASEEGHKACSDAALLLTKLALARQSA  392



>ref|XP_003569481.1| PREDICTED: probable protein phosphatase 2C 8 [Brachypodium distachyon]
Length=392

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKPYVI+EPE+T+  RT +DEFLILASDGLWDVVSNE AC +AR C 
Sbjct  273  GVLATSRSIGDYYLKPYVIAEPEVTVMDRTDKDEFLILASDGLWDVVSNEVACKIARNC-  331

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
                      LSG   S  P S   S    +DA+ LL +LA++R
Sbjct  332  ----------LSGRAASKYPES--VSGSTAADAAALLVELAMSR  363



>ref|XP_008234728.1| PREDICTED: probable protein phosphatase 2C 51 [Prunus mume]
Length=392

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 6/104 (6%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD Y++PYVIS+PE+T+TKRT EDEFLILASDGLWDV+SNE AC V   CL
Sbjct  278  GVLATSRSIGDKYMRPYVISKPEVTVTKRTEEDEFLILASDGLWDVISNEVACKVVNKCL  337

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
              R     + + G D            ++ S+A+ +L  LA+AR
Sbjct  338  DGR--IRRISIHGED----HHHDHVRSRSTSEAAAVLADLAMAR  375



>ref|XP_009757833.1| PREDICTED: probable protein phosphatase 2C 75 [Nicotiana sylvestris]
Length=424

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 73/111 (66%), Gaps = 12/111 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRAIGD YL PYVISEPEIT TKR AEDE LILASDGLWDV+SN+ AC VA  CL
Sbjct  303  GILAMSRAIGDKYLSPYVISEPEITFTKREAEDECLILASDGLWDVISNDMACEVASECL  362

Query  182  QHRKPPSPLPLSGNDVSVTP-----SSGESSDKACSDASILLTKLALARHT  319
            +   P +       D S +P     S G       + A+ LLT+LA+ R++
Sbjct  363  REEDPAA-------DHSFSPLVEGDSGGSVYSSRSASAAALLTRLAMGRNS  406



>dbj|BAK05256.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKPYVI+EPE+T+  RT +DEFLILASDGLWDVVSN+ AC +AR C 
Sbjct  279  GVLATSRSIGDYYLKPYVIAEPEVTVMDRTDKDEFLILASDGLWDVVSNDVACKIARNC-  337

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
                      LSG   S  P S   S    +DA+ LL +LA+AR
Sbjct  338  ----------LSGRAASKYPES--VSGSTAADAAALLVELAMAR  369



>ref|XP_002456624.1| hypothetical protein SORBIDRAFT_03g039630 [Sorghum bicolor]
 gb|EES01744.1| hypothetical protein SORBIDRAFT_03g039630 [Sorghum bicolor]
Length=412

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 80/122 (66%), Gaps = 15/122 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+V SEPE+T+T+RT +DE LILASDGLWDVV+NE AC V R C 
Sbjct  277  GVLAMSRAIGDGYLKPFVSSEPEVTVTERTDDDECLILASDGLWDVVTNEMACEVVRACF  336

Query  182  QHRKPPSPLPLSGNDVS---------------VTPSSGESSDKACSDASILLTKLALARH  316
            +   PP       N V+               V   S E SD+ACSDA++LL KLALAR 
Sbjct  337  RSNGPPQAPAARPNGVAALPAADADDENGPAVVKGVSKEDSDRACSDAAMLLAKLALARR  396

Query  317  TA  322
            +A
Sbjct  397  SA  398



>ref|XP_006646161.1| PREDICTED: probable protein phosphatase 2C 8-like [Oryza brachyantha]
Length=365

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKPYVI+EPE+T+  RT +DEFLILASDGLWDVVSNE AC +AR C 
Sbjct  246  GVLATSRSIGDYYLKPYVIAEPEVTVMDRTDKDEFLILASDGLWDVVSNEVACKIARNC-  304

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
                      LSG   S  P S   S  A  DA+ LL +LA++R
Sbjct  305  ----------LSGRAASRYPESVPGSTAA--DAAALLVELAISR  336



>ref|XP_010671484.1| PREDICTED: probable protein phosphatase 2C 8 [Beta vulgaris subsp. 
vulgaris]
Length=354

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 72/104 (69%), Gaps = 9/104 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKPYV S PEITI+KRT  DEFLILASDGLWDV+SNE AC V R CL
Sbjct  238  GVLATSRSIGDYYLKPYVSSTPEITISKRTEADEFLILASDGLWDVISNEVACQVVRRCL  297

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
              R          N+V     S  SS+KA   A++LLT+LA+A+
Sbjct  298  TGR-------FKSNEV-FNQISKISSNKA-EVAAVLLTELAIAK  332



>emb|CDM82120.1| unnamed protein product [Triticum aestivum]
Length=390

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 19/107 (18%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKPYVI+EPE+T+  RT +DEFLILASDGLWDVVSN+ AC +AR CL
Sbjct  270  GVLATSRSIGDYYLKPYVIAEPEVTVMDRTDKDEFLILASDGLWDVVSNDVACKIARNCL  329

Query  182  QHR---KPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
              R   K P  +P S                  +DA+ LL +LA+AR
Sbjct  330  SGRAASKYPESVPGS----------------TAADAAALLVELAIAR  360



>gb|EEE63966.1| hypothetical protein OsJ_18791 [Oryza sativa Japonica Group]
Length=313

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKPYV SEPE+T+T+R  +DE LILASDGLWDVV+NE AC V R C 
Sbjct  176  GVLAMSRAIGDGYLKPYVTSEPEVTVTERADDDECLILASDGLWDVVTNEMACEVVRACF  235

Query  182  QHRKPPSP  205
            +   PPSP
Sbjct  236  RSNGPPSP  243



>dbj|BAJ85581.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89169.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 80/134 (60%), Gaps = 28/134 (21%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            GVLAMSRAIGD+YLKP+VI +PE+ + +R   EDEFLILASDGLWDVVSNE AC V R C
Sbjct  250  GVLAMSRAIGDSYLKPFVIPDPEVRVLERKDGEDEFLILASDGLWDVVSNEVACHVVRSC  309

Query  179  LQ---HRKPPSPLPLSG-------------NDVSVTPSSG-----------ESSDKACSD  277
            ++    R+     P S               D +   S G           E  D+AC++
Sbjct  310  VRSKAKRRGGRSSPTSNLSPRQSSGSGSSSGDEAQNESGGCAAGAGSESDDEEVDEACAE  369

Query  278  ASILLTKLALARHT  319
            A+ILLTKLA+AR +
Sbjct  370  AAILLTKLAIARQS  383



>ref|XP_009412939.1| PREDICTED: probable protein phosphatase 2C 8 [Musa acuminata 
subsp. malaccensis]
Length=338

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD+YL+PYVI+EPE+T+T RT EDE L+LASDGLWDV+SNE  C VAR C 
Sbjct  235  GVLATSRSIGDHYLRPYVIAEPEVTVTNRTEEDELLVLASDGLWDVISNEVVCKVARQC-  293

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
                      LSG  V   P    + +    +A+++L +LAL+R
Sbjct  294  ----------LSGQLVRKVPDG--AREHRAKEAAVILAELALSR  325



>ref|NP_001043754.1| Os01g0656200 [Oryza sativa Japonica Group]
 sp|Q5SN75.1|P2C08_ORYSJ RecName: Full=Probable protein phosphatase 2C 8; Short=OsPP2C08 
[Oryza sativa Japonica Group]
 dbj|BAD72331.1| protein phosphatase 2C-like [Oryza sativa Japonica Group]
 dbj|BAF05668.1| Os01g0656200 [Oryza sativa Japonica Group]
 dbj|BAG90835.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKPYVI+EPE+T+  RT +DEFLILASDGLWDVVSN+ AC +AR C 
Sbjct  285  GVLATSRSIGDYYLKPYVIAEPEVTVMDRTDKDEFLILASDGLWDVVSNDVACKIARNC-  343

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
                      LSG   S  P S   S    +DA+ LL +LA++R
Sbjct  344  ----------LSGRAASKYPES--VSGSTAADAAALLVELAISR  375



>ref|XP_003565884.2| PREDICTED: probable protein phosphatase 2C 51 [Brachypodium distachyon]
Length=401

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 70/105 (67%), Gaps = 15/105 (14%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVL+ SR+IGD YLKPYV +EPE+T+  RT +DEFL+LASDGLWDVVSNE AC VAR CL
Sbjct  271  GVLSTSRSIGDYYLKPYVSAEPEVTVCDRTEQDEFLVLASDGLWDVVSNEMACRVARSCL  330

Query  182  QHRKPPS-PLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
              R   + P  +SG              +  +DA+ LL +LA+AR
Sbjct  331  DGRAAAAFPESVSG--------------RTAADAAALLVELAIAR  361



>ref|XP_002513570.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF48973.1| protein phosphatase 2c, putative [Ricinus communis]
Length=352

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 13/103 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKP+VIS+PE+T+ KRT +DEFLILASDGLWDV+SNE AC V R CL
Sbjct  248  GVLATSRSIGDQYLKPFVISKPEVTVNKRTEKDEFLILASDGLWDVISNEVACQVGRRCL  307

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALA  310
              R       +             SS+   ++A+ +L +LA+A
Sbjct  308  MGRMRRKSQEV-------------SSEGRAAEAAAILVELAIA  337



>gb|EEC71208.1| hypothetical protein OsI_03122 [Oryza sativa Indica Group]
Length=459

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKPYVI+EPE+T+  RT +DEFLILASDGLWDVVSN+ AC +AR C 
Sbjct  267  GVLATSRSIGDYYLKPYVIAEPEVTVMDRTDKDEFLILASDGLWDVVSNDVACKIARNC-  325

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
                      LSG   S  P S   S  A  DA+ LL +LA++R
Sbjct  326  ----------LSGRAASKYPESVSGSTAA--DAAALLVELAISR  357



>ref|XP_010247857.1| PREDICTED: probable protein phosphatase 2C 75 isoform X1 [Nelumbo 
nucifera]
Length=423

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 7/82 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRA+GD YLKP VISEPE+TIT+RT EDE LILASDGLWDV+SN+ AC VAR CL
Sbjct  303  GILAMSRALGDKYLKPIVISEPELTITERTPEDECLILASDGLWDVLSNDMACDVARRCL  362

Query  182  QHRKPP-------SPLPLSGND  226
            Q  +P        S   L GND
Sbjct  363  QEAEPSNGTRILNSEPQLEGND  384



>gb|EMT07491.1| Putative protein phosphatase 2C 30 [Aegilops tauschii]
Length=320

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 82/138 (59%), Gaps = 31/138 (22%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRT-AEDEFLILASDGLWDVVSNETACGVARMC  178
            G+LAMSRAIGD+YLKP+VI +PE+ + +R   +DEFLILASDGLWDVVSNE AC V R C
Sbjct  166  GLLAMSRAIGDSYLKPFVIPDPEVRVLERKDGDDEFLILASDGLWDVVSNEVACHVVRSC  225

Query  179  LQ---HRKPPSPLPLSG------------------NDV---------SVTPSSGESSDKA  268
            ++    R+     P S                   ND          S    SGE  D+A
Sbjct  226  VRSKAKRRGGRSSPTSNLSPRQSSGSGSSSGDEAQNDGGGCADARSDSDDEESGEEVDEA  285

Query  269  CSDASILLTKLALARHTA  322
            C++A+ILLTKLA+AR ++
Sbjct  286  CAEAAILLTKLAIARQSS  303



>ref|XP_009591951.1| PREDICTED: probable protein phosphatase 2C 75 isoform X2 [Nicotiana 
tomentosiformis]
Length=371

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRAIGD YLKPYVISEPEIT TKR AED+ LILASDGLWDV+SNE AC VA  CL
Sbjct  250  GILAMSRAIGDKYLKPYVISEPEITFTKREAEDDCLILASDGLWDVISNEMACEVASECL  309

Query  182  QHRKP  196
            +   P
Sbjct  310  REEYP  314



>ref|XP_007219142.1| hypothetical protein PRUPE_ppa016016mg [Prunus persica]
 gb|EMJ20341.1| hypothetical protein PRUPE_ppa016016mg [Prunus persica]
Length=386

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 71/104 (68%), Gaps = 10/104 (10%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD Y++PYVIS+PE+T+TKRT EDEFLILASDGLWDV+SNE AC V   CL
Sbjct  276  GVLATSRSIGDKYMRPYVISKPEVTVTKRTEEDEFLILASDGLWDVISNEVACRVVNKCL  335

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
              +     + + G D   + ++        S+A+ +L  LA+AR
Sbjct  336  DGK--IRRISIHGEDHVQSHTT--------SEAAAVLADLAMAR  369



>ref|XP_009591950.1| PREDICTED: probable protein phosphatase 2C 75 isoform X1 [Nicotiana 
tomentosiformis]
Length=424

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRAIGD YLKPYVISEPEIT TKR AED+ LILASDGLWDV+SNE AC VA  CL
Sbjct  303  GILAMSRAIGDKYLKPYVISEPEITFTKREAEDDCLILASDGLWDVISNEMACEVASECL  362

Query  182  QHRKP  196
            +   P
Sbjct  363  REEYP  367



>gb|EAY98295.1| hypothetical protein OsI_20203 [Oryza sativa Indica Group]
Length=416

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKPYV SEPE+T+T+R  +DE LILASDGLWDVV+NE AC V R C 
Sbjct  279  GVLAMSRAIGDGYLKPYVTSEPEVTVTERADDDECLILASDGLWDVVTNEMACEVVRACF  338

Query  182  QHRKPPSP  205
            +   PPSP
Sbjct  339  RSNGPPSP  346



>ref|XP_010247858.1| PREDICTED: probable protein phosphatase 2C 75 isoform X2 [Nelumbo 
nucifera]
Length=417

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 7/82 (9%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRA+GD YLKP VISEPE+TIT+RT EDE LILASDGLWDV+SN+ AC VAR CL
Sbjct  297  GILAMSRALGDKYLKPIVISEPELTITERTPEDECLILASDGLWDVLSNDMACDVARRCL  356

Query  182  QHRKPP-------SPLPLSGND  226
            Q  +P        S   L GND
Sbjct  357  QEAEPSNGTRILNSEPQLEGND  378



>sp|Q65XG6.1|P2C49_ORYSJ RecName: Full=Probable protein phosphatase 2C 49; Short=OsPP2C49 
[Oryza sativa Japonica Group]
 gb|AAU44010.1| unknown protein [Oryza sativa Japonica Group]
Length=416

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKPYV SEPE+T+T+R  +DE LILASDGLWDVV+NE AC V R C 
Sbjct  279  GVLAMSRAIGDGYLKPYVTSEPEVTVTERADDDECLILASDGLWDVVTNEMACEVVRACF  338

Query  182  QHRKPPSP  205
            +   PPSP
Sbjct  339  RSNGPPSP  346



>ref|XP_004970557.1| PREDICTED: probable protein phosphatase 2C 9-like [Setaria italica]
Length=401

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 82/123 (67%), Gaps = 18/123 (15%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+V SEPE+T+T+RT +DEFLILASDGLWDVV N  ACGV R C 
Sbjct  267  GVLAMSRAIGDGYLKPFVSSEPEVTVTERTDDDEFLILASDGLWDVVDNVMACGVVRACF  326

Query  182  QHRKPPSPLPLSGNDVSVTPSSGES----------------SDKACSDASILLTKLALAR  313
            +   PP+      N   V P +G++                SDKACSDA++LL KLALAR
Sbjct  327  RSNGPPAAPAARAN--GVAPPAGDADAENGSAVVKGVSKVDSDKACSDAAMLLAKLALAR  384

Query  314  HTA  322
             +A
Sbjct  385  RSA  387



>ref|XP_009778007.1| PREDICTED: probable protein phosphatase 2C 75 [Nicotiana sylvestris]
Length=341

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRAIGD YLKPYV SEPEIT TKR AEDE LILASDGLWDV+S E AC VAR CL
Sbjct  220  GILAMSRAIGDKYLKPYVTSEPEITFTKREAEDECLILASDGLWDVISTEMACEVARECL  279

Query  182  QHRKP  196
            +   P
Sbjct  280  REENP  284



>gb|EEE55111.1| hypothetical protein OsJ_02873 [Oryza sativa Japonica Group]
Length=509

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 70/104 (67%), Gaps = 13/104 (13%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKPYVI+EPE+T+  RT +DEFLILASDGLWDVVSN+ AC +AR C 
Sbjct  317  GVLATSRSIGDYYLKPYVIAEPEVTVMDRTDKDEFLILASDGLWDVVSNDVACKIARNC-  375

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
                      LSG   S  P S   S  A  DA+ LL +LA++R
Sbjct  376  ----------LSGRAASKYPESVSGSTAA--DAAALLVELAISR  407



>ref|XP_006362704.1| PREDICTED: probable protein phosphatase 2C 75-like [Solanum tuberosum]
Length=343

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G LAMSRAIGD+YLKPYVISEPE T  KR   DE LILASDGLWDVVSNETAC +AR+CL
Sbjct  243  GFLAMSRAIGDSYLKPYVISEPEFTFVKRKVNDECLILASDGLWDVVSNETACRMARVCL  302

Query  182  Q  184
            Q
Sbjct  303  Q  303



>dbj|BAJ98672.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 71/107 (66%), Gaps = 22/107 (21%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGD YLKP+V + PE+T+T R A DE LILASDGLWDVVSNETAC VAR CL
Sbjct  293  GVLAMSRAIGDGYLKPFVTAVPEVTVTDRAAGDECLILASDGLWDVVSNETACQVARACL  352

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHTA  322
            +  +                      ++ C++A+ +LTK+AL ++++
Sbjct  353  RRGR----------------------ERWCAEAAAMLTKMALTKNSS  377



>ref|XP_006646035.1| PREDICTED: probable protein phosphatase 2C 6-like, partial [Oryza 
brachyantha]
Length=354

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 73/106 (69%), Gaps = 9/106 (8%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVA--RM  175
            GVLAMSR+IGD YLKP++I  PE+TI  R  +DE L+LASDGLWDV+SNE  C VA  R+
Sbjct  233  GVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLVLASDGLWDVMSNEEVCDVARKRI  292

Query  176  CLQHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
             L H+K       +G++ S  P SG+SSD A   A+  L+KLAL +
Sbjct  293  LLWHKK-------NGSNSSSAPRSGDSSDPAAEAAAECLSKLALQK  331



>ref|XP_008380981.1| PREDICTED: probable protein phosphatase 2C 51 [Malus domestica]
Length=380

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 73/104 (70%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD+YL+PYVIS PE+T+T+RT +DEFLILASDGLWDV+SN+ AC V + CL
Sbjct  265  GVLATSRSIGDHYLRPYVISRPEVTVTRRTDQDEFLILASDGLWDVISNDVACQVVKKCL  324

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
            + R     +    ++  V  + G  +    S+A+ +L  LA+AR
Sbjct  325  RGRMKRISIH---DEHRVLLNVGSRT----SEAAAVLVDLAMAR  361



>ref|XP_009789155.1| PREDICTED: probable protein phosphatase 2C 75 isoform X2 [Nicotiana 
sylvestris]
Length=403

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LA+SRAIGDNYLKPYV SEPEIT TKR AEDE LILASDGLWDV+S+E AC VAR CL
Sbjct  285  GILAISRAIGDNYLKPYVTSEPEITFTKREAEDECLILASDGLWDVLSSEMACAVARECL  344

Query  182  QH  187
            + 
Sbjct  345  RE  346



>ref|XP_009789148.1| PREDICTED: probable protein phosphatase 2C 75 isoform X1 [Nicotiana 
sylvestris]
Length=407

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LA+SRAIGDNYLKPYV SEPEIT TKR AEDE LILASDGLWDV+S+E AC VAR CL
Sbjct  289  GILAISRAIGDNYLKPYVTSEPEITFTKREAEDECLILASDGLWDVLSSEMACAVARECL  348

Query  182  Q  184
            +
Sbjct  349  R  349



>ref|XP_009394142.1| PREDICTED: probable protein phosphatase 2C 51 [Musa acuminata 
subsp. malaccensis]
Length=378

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKP+VISEP++T+T+RT +DEFLILASDGLWDVVSNE AC +AR CL
Sbjct  267  GVLATSRSIGDCYLKPFVISEPDVTVTERTEKDEFLILASDGLWDVVSNEAACKIARQCL  326

Query  182  QHR  190
              R
Sbjct  327  SGR  329



>ref|XP_010557234.1| PREDICTED: probable protein phosphatase 2C 24 [Tarenaya hassleriana]
Length=432

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 77/119 (65%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLAMSRAIGDNYLKPYV  EPEITIT RT +D+ LILASDGLWDVVSNETAC VA MCL
Sbjct  298  GVLAMSRAIGDNYLKPYVSCEPEITITDRTDDDDCLILASDGLWDVVSNETACAVAHMCL  357

Query  182  QHR-------------KPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
              +             +        G         GE SD+AC+ AS+LLTKLAL R++
Sbjct  358  SGKARGGRRRSTDEEEEEEEEKEKVGTRRKRKGRKGEISDQACTAASVLLTKLALTRNS  416



>ref|XP_004234148.1| PREDICTED: probable protein phosphatase 2C 75 isoform X2 [Solanum 
lycopersicum]
Length=376

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVL+MSRAIGDN LKPY+ SEPE+T TKR AEDE LILASDGLWDVVS++ AC V R CL
Sbjct  253  GVLSMSRAIGDNNLKPYITSEPEMTFTKREAEDECLILASDGLWDVVSSDIACAVGRECL  312

Query  182  QHRKP  196
            + R P
Sbjct  313  RQRDP  317



>ref|XP_010317462.1| PREDICTED: probable protein phosphatase 2C 75 isoform X1 [Solanum 
lycopersicum]
Length=380

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVL+MSRAIGDN LKPY+ SEPE+T TKR AEDE LILASDGLWDVVS++ AC V R CL
Sbjct  257  GVLSMSRAIGDNNLKPYITSEPEMTFTKREAEDECLILASDGLWDVVSSDIACAVGRECL  316

Query  182  QHRKP  196
            + R P
Sbjct  317  RQRDP  321



>ref|XP_008663080.1| PREDICTED: probable protein phosphatase 2C 37 [Zea mays]
 gb|AFW57886.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB05775.1| orphans transcription factor, partial [Zea mays]
 gb|AIG52098.1| 2C-type protein phosphatase protein [Zea mays]
Length=464

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRA+GD  L+P VI+EPEIT+T+RT EDE LILASDG+WDV+SN+ AC VAR CL
Sbjct  339  GILAMSRALGDRLLRPEVIAEPEITVTERTVEDECLILASDGMWDVISNDIACNVARQCL  398

Query  182  QHRKPPSPLP-----LSGNDVSVTPSSGESSDKACSDASILLTKLALARHT  319
            +   PP   P            V   +   ++  C  A+ LL +LA+ R T
Sbjct  399  EDGNPPPADPTAGGGGGAPAAGVVVVAAREAEPRCLRAASLLARLAIGRET  449



>ref|XP_004234268.1| PREDICTED: probable protein phosphatase 2C 75 isoform X2 [Solanum 
lycopersicum]
Length=339

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LA+SRAIGD YLK Y+ISEPE T TKR AEDE LILASDGLW+VVSN+ AC VAR CL
Sbjct  234  GILAISRAIGDKYLKKYIISEPEFTFTKREAEDECLILASDGLWNVVSNDDACMVARECL  293

Query  182  QHRKP  196
            Q  KP
Sbjct  294  QKEKP  298



>ref|XP_010914542.1| PREDICTED: probable protein phosphatase 2C 51 [Elaeis guineensis]
Length=393

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YLKPYV SEPE+T+T RT +DEFLILASDGLWDVVSNE AC + R CL
Sbjct  285  GVLATSRSIGDYYLKPYVTSEPEVTVTNRTGKDEFLILASDGLWDVVSNEVACRITRQCL  344

Query  182  QHR  190
              R
Sbjct  345  SGR  347



>ref|XP_010317460.1| PREDICTED: probable protein phosphatase 2C 75 isoform X1 [Solanum 
lycopersicum]
Length=345

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LA+SRAIGD YLK Y+ISEPE T TKR AEDE LILASDGLW+VVSN+ AC VAR CL
Sbjct  240  GILAISRAIGDKYLKKYIISEPEFTFTKREAEDECLILASDGLWNVVSNDDACMVARECL  299

Query  182  QHRKP  196
            Q  KP
Sbjct  300  QKEKP  304



>gb|KHN06026.1| Hypothetical protein glysoja_050019, partial [Glycine soja]
Length=275

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 12/104 (12%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            GVLA SR+IGD YL+PYVIS+PE+T+T+R+++DEFLILAS GLWDV+S+E AC V R C 
Sbjct  164  GVLATSRSIGDQYLRPYVISKPEVTVTQRSSKDEFLILASGGLWDVMSSEVACQVVRKCF  223

Query  182  QHRKPPSPLPLSGNDVSVTPSSGESSDKACSDASILLTKLALAR  313
            Q           G    V    G   ++A +DA+ LL ++ALA+
Sbjct  224  Q-----------GQIRRVCDGVGNHQNRA-TDAADLLAEIALAK  255



>ref|XP_009591949.1| PREDICTED: probable protein phosphatase 2C 75 [Nicotiana tomentosiformis]
Length=343

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GVLAMSRAIGDNYLKPYVISEPEITITKRTAEDEFLILASDGLWDVVSNETACGVARMCL  181
            G+LAMSRAIGD YLKPYV SEPEIT TKR  EDE LILASDGLWDV+S E AC VAR CL
Sbjct  222  GILAMSRAIGDTYLKPYVTSEPEITFTKREPEDECLILASDGLWDVISTEMACEVARECL  281

Query  182  QHRKP  196
            +   P
Sbjct  282  REENP  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 789084978192