BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8973_g1_i1 len=1540 path=[1:0-1328 1330:1329-1329 1331:1330-1539]

Length=1540
                                                                      Score     E

emb|CDP21416.1|  unnamed protein product                                603   0.0      
ref|XP_002321090.2|  hypothetical protein POPTR_0014s14380g             586   0.0      Populus trichocarpa [western balsam poplar]
emb|CBI39446.3|  unnamed protein product                                583   0.0      
ref|XP_011006098.1|  PREDICTED: vacuolar amino acid transporter 1...    585   0.0      
ref|XP_002266204.2|  PREDICTED: vacuolar amino acid transporter 1       583   0.0      Vitis vinifera
ref|XP_006364699.1|  PREDICTED: vacuolar amino acid transporter 1...    577   0.0      
ref|XP_004247988.1|  PREDICTED: vacuolar amino acid transporter 1       575   0.0      
ref|XP_007226886.1|  hypothetical protein PRUPE_ppa016615mg             573   0.0      
ref|XP_008244445.1|  PREDICTED: vacuolar amino acid transporter 1       571   0.0      
ref|XP_007034433.1|  Transmembrane amino acid transporter family ...    565   0.0      
gb|KDP37882.1|  hypothetical protein JCGZ_05764                         561   0.0      
ref|XP_002519635.1|  amino acid transporter, putative                   561   0.0      Ricinus communis
ref|XP_010241492.1|  PREDICTED: vesicular GABA transporter              558   0.0      
ref|XP_009371150.1|  PREDICTED: vacuolar amino acid transporter 1...    558   0.0      
ref|XP_009403652.1|  PREDICTED: vacuolar amino acid transporter 1       555   0.0      
ref|XP_004298026.1|  PREDICTED: vacuolar amino acid transporter 1...    555   0.0      
ref|XP_008356120.1|  PREDICTED: vacuolar amino acid transporter 1...    555   0.0      
ref|XP_009347361.1|  PREDICTED: vacuolar amino acid transporter 1...    553   0.0      
ref|XP_009347363.1|  PREDICTED: vacuolar amino acid transporter 1...    553   0.0      
ref|XP_010069373.1|  PREDICTED: vacuolar amino acid transporter 1...    550   0.0      
ref|XP_006493517.1|  PREDICTED: vacuolar amino acid transporter 1...    548   0.0      
ref|XP_008337527.1|  PREDICTED: vacuolar amino acid transporter 1       546   0.0      
gb|EPS70141.1|  hypothetical protein M569_04618                         541   0.0      
ref|XP_002302894.2|  hypothetical protein POPTR_0002s23430g             539   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006663371.1|  PREDICTED: vacuolar amino acid transporter 1...    538   0.0      
ref|XP_011042765.1|  PREDICTED: vacuolar amino acid transporter 1...    537   0.0      
ref|XP_010930156.1|  PREDICTED: vacuolar amino acid transporter 1...    533   0.0      
ref|XP_003601747.1|  Amino acid transporter                             530   0.0      
ref|XP_004502272.1|  PREDICTED: vacuolar amino acid transporter 1...    527   3e-180   
ref|XP_003552778.2|  PREDICTED: vacuolar amino acid transporter 1...    526   3e-180   
ref|XP_011008184.1|  PREDICTED: vacuolar amino acid transporter 1...    525   4e-180   
gb|EMT08536.1|  hypothetical protein F775_14209                         523   8e-179   
ref|NP_001132410.1|  hypothetical protein                               521   6e-178   Zea mays [maize]
gb|AAX96808.1|  Transmembrane amino acid transporter protein            521   7e-178   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010103924.1|  hypothetical protein L484_012009                   518   1e-176   
gb|EAY80689.1|  hypothetical protein OsI_35871                          518   2e-176   Oryza sativa Indica Group [Indian rice]
ref|XP_003524172.1|  PREDICTED: vacuolar amino acid transporter 1...    515   1e-175   
ref|XP_011073813.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar ami...    513   6e-175   
ref|XP_010025929.1|  PREDICTED: vacuolar amino acid transporter 1...    509   4e-173   
ref|XP_003537530.1|  PREDICTED: vacuolar amino acid transporter 1...    509   4e-173   
gb|KCW57695.1|  hypothetical protein EUGRSUZ_H00457                     508   6e-173   
ref|XP_007163781.1|  hypothetical protein PHAVU_001G263500g             508   7e-173   
ref|XP_008804195.1|  PREDICTED: vacuolar amino acid transporter 1       508   1e-172   
ref|XP_004979185.1|  PREDICTED: vacuolar amino acid transporter 1...    487   2e-164   
ref|XP_002302929.2|  hypothetical protein POPTR_0002s23420g             484   4e-164   Populus trichocarpa [western balsam poplar]
ref|XP_006858647.1|  hypothetical protein AMTR_s00066p00056580          483   4e-163   
ref|XP_008356121.1|  PREDICTED: vacuolar amino acid transporter 1...    479   4e-162   
emb|CDY38090.1|  BnaC02g06830D                                          479   8e-162   
ref|XP_009347362.1|  PREDICTED: vesicular GABA transporter-like i...    478   1e-161   
gb|KHN44455.1|  Vacuolar amino acid transporter 1                       476   2e-161   
ref|XP_010492597.1|  PREDICTED: vacuolar amino acid transporter 1...    477   4e-161   
gb|KCW57697.1|  hypothetical protein EUGRSUZ_H00460                     468   6e-159   
ref|XP_010424130.1|  PREDICTED: vacuolar amino acid transporter 1...    470   1e-158   
ref|XP_002873789.1|  amino acid transporter family protein              469   5e-158   
ref|NP_197176.1|  transmembrane amino acid transporter family pro...    466   4e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289356.1|  hypothetical protein CARUB_v10002843mg             463   7e-156   
gb|KHN24049.1|  Vacuolar amino acid transporter 1                       454   3e-153   
ref|XP_006400216.1|  hypothetical protein EUTSA_v10015719mg             454   5e-152   
ref|XP_010673266.1|  PREDICTED: vacuolar amino acid transporter 1       454   7e-152   
gb|EMS58406.1|  hypothetical protein TRIUR3_25432                       437   2e-146   
gb|KDO38650.1|  hypothetical protein CISIN_1g0425812mg                  343   4e-111   
ref|XP_010042736.1|  PREDICTED: vacuolar amino acid transporter 1...    342   6e-109   
gb|EYU32747.1|  hypothetical protein MIMGU_mgv1a019144mg                326   3e-104   
emb|CDX85489.1|  BnaA02g03240D                                          325   5e-102   
ref|XP_009126337.1|  PREDICTED: vacuolar amino acid transporter 1       291   4e-91    
ref|XP_006436472.1|  hypothetical protein CICLE_v10031131mg             285   3e-85    
gb|KFK25899.1|  hypothetical protein AALP_AA8G177100                    272   1e-83    
ref|XP_008387785.1|  PREDICTED: vacuolar amino acid transporter 1...    278   8e-83    
ref|XP_004307364.1|  PREDICTED: vacuolar amino acid transporter 1...    278   2e-82    
ref|XP_006352151.1|  PREDICTED: vacuolar amino acid transporter 1...    276   3e-82    
ref|XP_002984621.1|  hypothetical protein SELMODRAFT_181183             276   3e-82    
ref|XP_002978694.1|  hypothetical protein SELMODRAFT_152799             276   4e-82    
ref|XP_006827413.1|  hypothetical protein AMTR_s00009p00061580          276   1e-81    
ref|XP_006436470.1|  hypothetical protein CICLE_v10031131mg             270   2e-81    
ref|XP_006436471.1|  hypothetical protein CICLE_v10031131mg             271   2e-81    
emb|CDP06590.1|  unnamed protein product                                272   4e-81    
ref|XP_009116163.1|  PREDICTED: vacuolar amino acid transporter 1       273   5e-81    
ref|XP_007009920.1|  Transmembrane amino acid transporter family ...    274   6e-81    
ref|XP_008233285.1|  PREDICTED: vacuolar amino acid transporter 1       273   9e-81    
ref|XP_006291057.1|  hypothetical protein CARUB_v10017172mg             270   2e-80    
ref|XP_007009919.1|  Transmembrane amino acid transporter family ...    272   3e-80    
ref|XP_007218970.1|  hypothetical protein PRUPE_ppa003746mg             271   5e-80    
ref|XP_003556242.1|  PREDICTED: vacuolar amino acid transporter 1...    271   8e-80    
ref|XP_010555810.1|  PREDICTED: vacuolar amino acid transporter 1...    270   1e-79    
ref|XP_006403529.1|  hypothetical protein EUTSA_v10010278mg             270   1e-79    
ref|XP_003536340.1|  PREDICTED: vacuolar amino acid transporter 1...    270   1e-79    
ref|XP_006352150.1|  PREDICTED: vacuolar amino acid transporter 1...    270   1e-79    
gb|KEH43506.1|  transmembrane amino acid transporter family protein     270   1e-79    
ref|XP_008813474.1|  PREDICTED: vacuolar amino acid transporter 1...    271   2e-79    
ref|XP_007143736.1|  hypothetical protein PHAVU_007G097200g             269   3e-79    
ref|XP_010037820.1|  PREDICTED: vacuolar amino acid transporter 1       269   3e-79    
ref|XP_010464575.1|  PREDICTED: vacuolar amino acid transporter 1...    269   3e-79    
gb|KDP30471.1|  hypothetical protein JCGZ_16150                         269   4e-79    
ref|XP_004234813.1|  PREDICTED: vacuolar amino acid transporter 1...    269   5e-79    
ref|XP_009769464.1|  PREDICTED: vacuolar amino acid transporter 1...    268   7e-79    
ref|XP_010516025.1|  PREDICTED: vacuolar amino acid transporter 1...    268   1e-78    
ref|XP_010486499.1|  PREDICTED: vacuolar amino acid transporter 1...    267   2e-78    
ref|XP_007009921.1|  Transmembrane amino acid transporter family ...    267   3e-78    
ref|XP_004307365.1|  PREDICTED: vacuolar amino acid transporter 1...    267   3e-78    
ref|XP_010427204.1|  PREDICTED: vacuolar amino acid transporter 1...    266   5e-78    
ref|XP_008242521.1|  PREDICTED: vacuolar amino acid transporter 1       265   5e-78    
ref|XP_006407687.1|  hypothetical protein EUTSA_v10020500mg             265   7e-78    
gb|EYU39864.1|  hypothetical protein MIMGU_mgv1a003855mg                266   7e-78    
ref|XP_009400429.1|  PREDICTED: vacuolar amino acid transporter 1...    266   8e-78    
ref|XP_011041044.1|  PREDICTED: vacuolar amino acid transporter 1...    265   9e-78    
ref|XP_011031689.1|  PREDICTED: vacuolar amino acid transporter 1...    265   1e-77    
ref|XP_006480871.1|  PREDICTED: vacuolar amino acid transporter 1...    265   2e-77    
ref|XP_010464576.1|  PREDICTED: vacuolar amino acid transporter 1...    264   2e-77    
ref|XP_001781020.1|  predicted protein                                  264   2e-77    
ref|XP_010543282.1|  PREDICTED: vacuolar amino acid transporter 1...    264   2e-77    
ref|XP_011084300.1|  PREDICTED: vacuolar amino acid transporter 1...    265   2e-77    
ref|XP_011084301.1|  PREDICTED: vacuolar amino acid transporter 1...    265   3e-77    
ref|XP_007207639.1|  hypothetical protein PRUPE_ppa020769mg             264   3e-77    
ref|XP_006411137.1|  hypothetical protein EUTSA_v10016467mg             264   3e-77    
ref|XP_001781900.1|  predicted protein                                  259   3e-77    
ref|XP_010517249.1|  PREDICTED: vacuolar amino acid transporter 1       264   3e-77    
ref|XP_010933084.1|  PREDICTED: vacuolar amino acid transporter 1       264   4e-77    
ref|XP_010509069.1|  PREDICTED: vacuolar amino acid transporter 1...    264   4e-77    
ref|XP_010505578.1|  PREDICTED: vacuolar amino acid transporter 1...    263   5e-77    
gb|AES62112.2|  transmembrane amino acid transporter family protein     263   6e-77    
ref|XP_002987847.1|  hypothetical protein SELMODRAFT_42776              263   7e-77    
ref|XP_002881631.1|  predicted protein                                  263   7e-77    
ref|XP_002311078.2|  amino acid transporter family protein              263   1e-76    Populus trichocarpa [western balsam poplar]
ref|XP_009588888.1|  PREDICTED: vacuolar amino acid transporter 1...    263   1e-76    
emb|CDY07919.1|  BnaC03g36040D                                          262   1e-76    
ref|NP_850312.1|  transmembrane amino acid transporter                  262   1e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003591861.1|  Amino acid transporter                             262   1e-76    
ref|XP_010490633.1|  PREDICTED: vacuolar amino acid transporter 1...    261   1e-76    
ref|XP_010253961.1|  PREDICTED: vacuolar amino acid transporter 1...    262   2e-76    
gb|KFK24700.1|  hypothetical protein AALP_AA8G013400                    261   2e-76    
ref|XP_009135985.1|  PREDICTED: vacuolar amino acid transporter 1...    261   2e-76    
ref|XP_002316384.2|  hypothetical protein POPTR_0010s23280g             262   2e-76    Populus trichocarpa [western balsam poplar]
ref|XP_006429127.1|  hypothetical protein CICLE_v10011256mg             264   2e-76    
gb|AAK92736.1|  unknown protein                                         261   3e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141789.1|  PREDICTED: vacuolar amino acid transporter 1...    261   3e-76    
gb|EYU39626.1|  hypothetical protein MIMGU_mgv1a003970mg                261   3e-76    
ref|XP_006293964.1|  hypothetical protein CARUB_v10022954mg             261   3e-76    
ref|XP_009132202.1|  PREDICTED: vacuolar amino acid transporter 1...    256   4e-76    
ref|XP_010032152.1|  PREDICTED: vacuolar amino acid transporter 1       261   4e-76    
ref|XP_009390333.1|  PREDICTED: vacuolar amino acid transporter 1...    261   6e-76    
ref|XP_001758436.1|  predicted protein                                  259   6e-76    
emb|CDX78269.1|  BnaA09g34640D                                          260   6e-76    
ref|XP_002870959.1|  amino acid transporter family protein              260   7e-76    
ref|XP_002270908.1|  PREDICTED: vacuolar amino acid transporter 1       260   7e-76    Vitis vinifera
ref|XP_010505884.1|  PREDICTED: vacuolar amino acid transporter 1...    259   8e-76    
ref|NP_001052989.1|  Os04g0460300                                       257   1e-75    Oryza sativa Japonica Group [Japonica rice]
ref|NP_195838.2|  transmembrane amino acid transporter family pro...    259   1e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006648197.1|  PREDICTED: vacuolar amino acid transporter 1...    259   2e-75    
emb|CAH67082.1|  OSIGBa0097P08.12                                       256   2e-75    Oryza sativa [red rice]
gb|KDO52345.1|  hypothetical protein CISIN_1g044089mg                   258   3e-75    
ref|XP_006339019.1|  PREDICTED: vacuolar amino acid transporter 1...    258   3e-75    
ref|XP_002870958.1|  amino acid transporter family protein              258   3e-75    
ref|XP_009381415.1|  PREDICTED: vacuolar amino acid transporter 1       255   5e-75    
ref|XP_002993770.1|  hypothetical protein SELMODRAFT_42771              258   5e-75    
ref|XP_004249816.1|  PREDICTED: vacuolar amino acid transporter 1...    258   6e-75    
ref|NP_001045585.1|  Os02g0101000                                       258   6e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010452048.1|  PREDICTED: vacuolar amino acid transporter 1...    257   6e-75    
ref|XP_010453840.1|  PREDICTED: vacuolar amino acid transporter 1...    247   7e-75    
ref|XP_010471703.1|  PREDICTED: vacuolar amino acid transporter 1...    257   7e-75    
ref|XP_010906599.1|  PREDICTED: vacuolar amino acid transporter 1...    256   8e-75    
ref|XP_009621097.1|  PREDICTED: vacuolar amino acid transporter 1...    255   8e-75    
ref|XP_008446844.1|  PREDICTED: vacuolar amino acid transporter 1...    258   9e-75    
ref|NP_195837.2|  transmembrane amino acid transporter family pro...    257   9e-75    Arabidopsis thaliana [mouse-ear cress]
gb|EEE61126.1|  hypothetical protein OsJ_15055                          254   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010543284.1|  PREDICTED: vacuolar amino acid transporter 1...    257   1e-74    
ref|XP_008446843.1|  PREDICTED: vacuolar amino acid transporter 1...    258   2e-74    
emb|CDX73443.1|  BnaC08g25600D                                          256   2e-74    
ref|XP_011094890.1|  PREDICTED: vacuolar amino acid transporter 1...    256   2e-74    
ref|XP_009588885.1|  PREDICTED: vacuolar amino acid transporter 1...    257   2e-74    
ref|XP_006665080.1|  PREDICTED: vacuolar amino acid transporter 1...    254   2e-74    
ref|XP_008807703.1|  PREDICTED: vacuolar amino acid transporter 1...    256   2e-74    
ref|XP_010423892.1|  PREDICTED: vacuolar amino acid transporter 1...    254   2e-74    
ref|XP_010471796.1|  PREDICTED: vacuolar amino acid transporter 1...    256   3e-74    
ref|XP_010517607.1|  PREDICTED: vacuolar amino acid transporter 1...    256   3e-74    
gb|AAN31931.1|  unknown protein                                         252   3e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508748.1|  PREDICTED: vacuolar amino acid transporter 1...    255   4e-74    
ref|XP_009143338.1|  PREDICTED: vacuolar amino acid transporter 1...    256   5e-74    
gb|KHN00860.1|  Vacuolar amino acid transporter 1                       256   6e-74    
ref|XP_009621094.1|  PREDICTED: vacuolar amino acid transporter 1...    255   6e-74    
ref|XP_006287324.1|  hypothetical protein CARUB_v10000525mg             256   6e-74    
ref|XP_004149900.1|  PREDICTED: vacuolar amino acid transporter 1...    255   7e-74    
ref|XP_009368911.1|  PREDICTED: vacuolar amino acid transporter 1...    255   7e-74    
ref|XP_011077256.1|  PREDICTED: vacuolar amino acid transporter 1...    255   8e-74    
ref|XP_008456512.1|  PREDICTED: vacuolar amino acid transporter 1...    255   9e-74    
ref|XP_004305195.1|  PREDICTED: vacuolar amino acid transporter 1...    257   1e-73    
ref|XP_004136638.1|  PREDICTED: vacuolar amino acid transporter 1...    254   1e-73    
ref|NP_001147785.1|  amino acid permease                                255   1e-73    Zea mays [maize]
ref|XP_007026971.1|  Transmembrane amino acid transporter family ...    254   1e-73    
ref|XP_006289906.1|  hypothetical protein CARUB_v10003527mg             254   1e-73    
ref|XP_002453115.1|  hypothetical protein SORBIDRAFT_04g000290          255   2e-73    Sorghum bicolor [broomcorn]
ref|XP_006846281.1|  hypothetical protein AMTR_s00012p00249520          254   2e-73    
gb|EPS65238.1|  amino acid transporter                                  252   2e-73    
ref|XP_009782945.1|  PREDICTED: vacuolar amino acid transporter 1...    254   2e-73    
ref|XP_008813473.1|  PREDICTED: vacuolar amino acid transporter 1...    256   2e-73    
ref|XP_004250060.1|  PREDICTED: vacuolar amino acid transporter 1       254   2e-73    
gb|EMT05140.1|  hypothetical protein F775_07363                         251   2e-73    
gb|ACN34366.1|  unknown                                                 254   3e-73    Zea mays [maize]
ref|XP_009141972.1|  PREDICTED: vacuolar amino acid transporter 1...    253   3e-73    
ref|XP_003581074.2|  PREDICTED: vacuolar amino acid transporter 1...    254   3e-73    
gb|AFW89943.1|  hypothetical protein ZEAMMB73_168665                    252   3e-73    
ref|NP_030664.1|  transmembrane amino acid transporter family pro...    253   3e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452051.1|  PREDICTED: vacuolar amino acid transporter 1...    251   3e-73    
ref|XP_010423891.1|  PREDICTED: vacuolar amino acid transporter 1...    253   4e-73    
dbj|BAJ96557.1|  predicted protein                                      254   4e-73    
ref|XP_009774062.1|  PREDICTED: vacuolar amino acid transporter 1...    253   4e-73    
ref|XP_006575238.1|  PREDICTED: vacuolar amino acid transporter 1...    253   4e-73    
emb|CDY22507.1|  BnaC03g23170D                                          252   5e-73    
ref|XP_008443262.1|  PREDICTED: vacuolar amino acid transporter 1...    253   5e-73    
ref|XP_010241839.1|  PREDICTED: vacuolar amino acid transporter 1...    253   7e-73    
ref|XP_006573771.1|  PREDICTED: vesicular inhibitory amino acid t...    252   8e-73    
ref|XP_011031694.1|  PREDICTED: vacuolar amino acid transporter 1...    252   8e-73    
ref|XP_003535879.1|  PREDICTED: vacuolar amino acid transporter 1...    252   9e-73    
ref|XP_011007142.1|  PREDICTED: vacuolar amino acid transporter 1...    251   1e-72    
ref|XP_010490635.1|  PREDICTED: vacuolar amino acid transporter 1...    250   1e-72    
ref|XP_006398682.1|  hypothetical protein EUTSA_v10013167mg             252   1e-72    
gb|AGV28592.1|  transmembrane amino acid transporter                    252   1e-72    
ref|XP_008778079.1|  PREDICTED: vacuolar amino acid transporter 1...    251   2e-72    
ref|XP_004514396.1|  PREDICTED: vacuolar amino acid transporter 1...    251   2e-72    
ref|XP_004975175.1|  PREDICTED: vacuolar amino acid transporter 1...    252   2e-72    
ref|XP_009630820.1|  PREDICTED: vacuolar amino acid transporter 1...    251   2e-72    
ref|NP_001136459.1|  hypothetical protein                               251   2e-72    Zea mays [maize]
ref|XP_006361676.1|  PREDICTED: vacuolar amino acid transporter 1...    251   2e-72    
ref|XP_010683901.1|  PREDICTED: vacuolar amino acid transporter 1...    251   3e-72    
emb|CDY06942.1|  BnaA04g23730D                                          250   3e-72    
ref|XP_009141790.1|  PREDICTED: vacuolar amino acid transporter 1...    250   3e-72    
ref|XP_002881760.1|  amino acid transporter family protein              250   4e-72    
gb|KFK24702.1|  hypothetical protein AALP_AA8G013600                    255   4e-72    
ref|XP_009122801.1|  PREDICTED: vacuolar amino acid transporter 1       250   4e-72    
ref|XP_003572249.1|  PREDICTED: vacuolar amino acid transporter 1...    251   4e-72    
ref|XP_010554769.1|  PREDICTED: vacuolar amino acid transporter 1       249   6e-72    
ref|XP_009133472.1|  PREDICTED: vacuolar amino acid transporter 1...    249   6e-72    
ref|XP_002438439.1|  hypothetical protein SORBIDRAFT_10g019640          251   6e-72    Sorghum bicolor [broomcorn]
ref|XP_002323513.1|  amino acid transporter family protein              249   6e-72    Populus trichocarpa [western balsam poplar]
emb|CDY18351.1|  BnaA04g22360D                                          249   7e-72    
emb|CBI31429.3|  unnamed protein product                                250   7e-72    
emb|CDY55126.1|  BnaA03g55030D                                          249   8e-72    
ref|XP_002994629.1|  hypothetical protein SELMODRAFT_432534             246   8e-72    
emb|CDY40336.1|  BnaA10g27320D                                          249   8e-72    
gb|ACN33733.1|  unknown                                                 249   9e-72    Zea mays [maize]
ref|XP_010452050.1|  PREDICTED: vacuolar amino acid transporter 1...    249   9e-72    
ref|XP_009348276.1|  PREDICTED: vacuolar amino acid transporter 1       249   1e-71    
ref|XP_009407617.1|  PREDICTED: vacuolar amino acid transporter 1...    249   1e-71    
ref|XP_008667918.1|  PREDICTED: amino acid permease isoform X1          250   1e-71    
gb|KFK36966.1|  hypothetical protein AALP_AA4G195600                    249   1e-71    
emb|CDY67831.1|  BnaCnng56610D                                          249   1e-71    
ref|XP_004965465.1|  PREDICTED: vacuolar amino acid transporter 1...    249   1e-71    
ref|XP_004951173.1|  PREDICTED: vacuolar amino acid transporter 1...    249   2e-71    
ref|XP_002975417.1|  hypothetical protein SELMODRAFT_33314              244   2e-71    
ref|XP_010653971.1|  PREDICTED: vacuolar amino acid transporter 1...    248   2e-71    
ref|XP_010490634.1|  PREDICTED: vacuolar amino acid transporter 1...    249   2e-71    
ref|XP_010241837.1|  PREDICTED: vacuolar amino acid transporter 1...    249   2e-71    
ref|XP_010683906.1|  PREDICTED: vacuolar amino acid transporter 1       248   2e-71    
emb|CDY10463.1|  BnaCnng03640D                                          248   2e-71    
ref|NP_187545.2|  transmembrane amino acid transporter-like protein     248   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975854.1|  PREDICTED: vacuolar amino acid transporter 1...    246   3e-71    
ref|XP_008813475.1|  PREDICTED: vacuolar amino acid transporter 1...    249   3e-71    
ref|XP_002884729.1|  predicted protein                                  248   3e-71    
ref|XP_004167344.1|  PREDICTED: vacuolar amino acid transporter 1...    246   4e-71    
ref|XP_006411385.1|  hypothetical protein EUTSA_v10016504mg             247   4e-71    
emb|CDX93284.1|  BnaC04g46120D                                          248   5e-71    
gb|KGN47839.1|  hypothetical protein Csa_6G406020                       248   5e-71    
ref|XP_004157533.1|  PREDICTED: vacuolar amino acid transporter 1...    248   5e-71    
ref|XP_004142396.1|  PREDICTED: vacuolar amino acid transporter 1...    248   6e-71    
ref|XP_002963140.1|  hypothetical protein SELMODRAFT_404762             243   8e-71    
ref|XP_009142730.1|  PREDICTED: vacuolar amino acid transporter 1...    246   1e-70    
ref|NP_001150669.1|  amino acid permease                                247   1e-70    Zea mays [maize]
ref|XP_004514716.1|  PREDICTED: vacuolar amino acid transporter 1...    246   1e-70    
emb|CDX74865.1|  BnaA05g06110D                                          246   1e-70    
gb|KDO39682.1|  hypothetical protein CISIN_1g013919mg                   243   1e-70    
emb|CDY23868.1|  BnaC04g01690D                                          245   2e-70    
ref|XP_009383178.1|  PREDICTED: vacuolar amino acid transporter 1       246   2e-70    
ref|XP_003520269.1|  PREDICTED: vacuolar amino acid transporter 1...    246   2e-70    
gb|EMT21150.1|  Vacuolar amino acid transporter 1                       246   3e-70    
ref|XP_003581315.1|  PREDICTED: vacuolar amino acid transporter 1...    243   3e-70    
emb|CDY44630.1|  BnaC04g06320D                                          245   3e-70    
ref|XP_010486498.1|  PREDICTED: vacuolar amino acid transporter 1...    244   5e-70    
gb|KHN17157.1|  Vacuolar amino acid transporter 1                       244   7e-70    
ref|XP_010258339.1|  PREDICTED: vacuolar amino acid transporter 1...    240   9e-70    
ref|XP_007145478.1|  hypothetical protein PHAVU_007G242400g             244   9e-70    
ref|XP_007140511.1|  hypothetical protein PHAVU_008G118800g             244   9e-70    
ref|XP_007009918.1|  Transmembrane amino acid transporter family ...    243   1e-69    
ref|XP_006421100.1|  hypothetical protein CICLE_v10004676mg             244   1e-69    
ref|XP_002531860.1|  amino acid transporter, putative                   240   1e-69    
ref|XP_002531559.1|  amino acid transporter, putative                   243   1e-69    
ref|XP_011075635.1|  PREDICTED: vacuolar amino acid transporter 1...    240   1e-69    
gb|KHN22348.1|  Vacuolar amino acid transporter 1                       243   1e-69    
ref|NP_187544.2|  transmembrane amino acid transporter-like protein     243   2e-69    
ref|XP_010257515.1|  PREDICTED: vacuolar amino acid transporter 1       240   2e-69    
gb|ABK28550.1|  unknown                                                 243   2e-69    
ref|XP_006477498.1|  PREDICTED: vacuolar amino acid transporter 1...    243   2e-69    
ref|XP_007145646.1|  hypothetical protein PHAVU_007G256500g             242   3e-69    
gb|KDO39681.1|  hypothetical protein CISIN_1g013919mg                   239   3e-69    
ref|XP_004968431.1|  PREDICTED: vacuolar amino acid transporter 1...    239   4e-69    
ref|XP_006652107.1|  PREDICTED: vacuolar amino acid transporter 1...    243   4e-69    
emb|CBI31952.3|  unnamed protein product                                238   5e-69    
ref|XP_009793352.1|  PREDICTED: vacuolar amino acid transporter 1...    242   5e-69    
ref|XP_004506981.1|  PREDICTED: vacuolar amino acid transporter 1...    242   5e-69    
ref|XP_009130689.1|  PREDICTED: vacuolar amino acid transporter 1...    241   6e-69    
ref|XP_010258341.1|  PREDICTED: vacuolar amino acid transporter 1...    239   6e-69    
ref|XP_010097614.1|  hypothetical protein L484_002148                   238   9e-69    
ref|XP_006588913.1|  PREDICTED: vacuolar amino acid transporter 1...    241   1e-68    
ref|NP_191043.2|  transmembrane amino acid transporter family pro...    241   1e-68    
ref|XP_008379355.1|  PREDICTED: vacuolar amino acid transporter 1...    238   1e-68    
ref|XP_007022384.1|  Transmembrane amino acid transporter family ...    237   1e-68    
ref|XP_010653972.1|  PREDICTED: vacuolar amino acid transporter 1...    241   1e-68    
ref|XP_002269735.3|  PREDICTED: vacuolar amino acid transporter 1       237   1e-68    
ref|XP_009341015.1|  PREDICTED: vacuolar amino acid transporter 1...    238   2e-68    
ref|XP_008802597.1|  PREDICTED: vacuolar amino acid transporter 1...    236   2e-68    
ref|XP_006827148.1|  hypothetical protein AMTR_s00010p00251660          236   2e-68    
gb|KHN35212.1|  Vacuolar amino acid transporter 1                       240   3e-68    
tpg|DAA38550.1|  TPA: hypothetical protein ZEAMMB73_614746              240   3e-68    
ref|XP_002446139.1|  hypothetical protein SORBIDRAFT_06g002240          240   4e-68    
emb|CDY55127.1|  BnaA03g55040D                                          241   4e-68    
emb|CAB82990.1|  putative protein                                       239   5e-68    
ref|XP_006300079.1|  hypothetical protein CARUB_v10016307mg             239   5e-68    
ref|XP_008353423.1|  PREDICTED: vacuolar amino acid transporter 1...    237   6e-68    
dbj|BAK04148.1|  predicted protein                                      236   7e-68    
ref|XP_009410010.1|  PREDICTED: vacuolar amino acid transporter 1       235   8e-68    
ref|XP_006827151.1|  hypothetical protein AMTR_s00010p00252100          235   9e-68    
gb|EMS52338.1|  hypothetical protein TRIUR3_09912                       234   9e-68    
gb|KDO48799.1|  hypothetical protein CISIN_1g0087541mg                  236   1e-67    
ref|XP_009360622.1|  PREDICTED: vacuolar amino acid transporter 1...    235   1e-67    
ref|NP_001151642.1|  amino acid/polyamine transporter II                236   2e-67    
ref|XP_010683904.1|  PREDICTED: vacuolar amino acid transporter 1...    238   2e-67    
emb|CAB82991.1|  putative protein                                       238   2e-67    
emb|CAB41101.1|  putative protein                                       238   3e-67    
ref|XP_009360620.1|  PREDICTED: vacuolar amino acid transporter 1...    234   3e-67    
ref|XP_010256865.1|  PREDICTED: vacuolar amino acid transporter 1...    237   3e-67    
ref|XP_003579264.1|  PREDICTED: vacuolar amino acid transporter 1...    238   4e-67    
ref|XP_004978051.1|  PREDICTED: vacuolar amino acid transporter 1...    234   4e-67    
ref|XP_002878001.1|  hypothetical protein ARALYDRAFT_324014             237   5e-67    
ref|XP_010056045.1|  PREDICTED: vacuolar amino acid transporter 1...    237   5e-67    
ref|XP_009376272.1|  PREDICTED: vacuolar amino acid transporter 1...    233   6e-67    
ref|XP_010056065.1|  PREDICTED: vacuolar amino acid transporter 1...    236   7e-67    
ref|XP_004977940.1|  PREDICTED: vacuolar amino acid transporter 1...    233   7e-67    
emb|CDX80809.1|  BnaC03g00630D                                          238   7e-67    
gb|KDO39683.1|  hypothetical protein CISIN_1g013919mg                   233   8e-67    
gb|KDP27152.1|  hypothetical protein JCGZ_19851                         233   8e-67    
emb|CBW45787.1|  ORW1943Ba0077G13.15                                    238   9e-67    
ref|XP_009611698.1|  PREDICTED: vacuolar amino acid transporter 1...    234   9e-67    
ref|XP_006649117.1|  PREDICTED: vacuolar amino acid transporter 1...    236   1e-66    
gb|KHF99963.1|  Vacuolar amino acid transporter 1                       236   1e-66    
tpg|DAA38551.1|  TPA: hypothetical protein ZEAMMB73_614746              236   2e-66    
ref|XP_002522437.1|  amino acid transporter, putative                   234   2e-66    
ref|XP_001782533.1|  predicted protein                                  233   2e-66    
ref|XP_003633855.1|  PREDICTED: vacuolar amino acid transporter 1       231   2e-66    
ref|XP_010683905.1|  PREDICTED: vacuolar amino acid transporter 1...    234   2e-66    
ref|XP_010683902.1|  PREDICTED: vacuolar amino acid transporter 1...    234   3e-66    
ref|XP_009621563.1|  PREDICTED: vacuolar amino acid transporter 1...    231   4e-66    
ref|XP_006294002.1|  hypothetical protein CARUB_v10022989mg             234   4e-66    
gb|KEH22922.1|  transmembrane amino acid transporter family protein     231   4e-66    
gb|AAF14031.1|AC011436_15  hypothetical protein                         232   5e-66    
ref|XP_004305687.1|  PREDICTED: vacuolar amino acid transporter 1...    234   5e-66    
ref|XP_002530942.1|  amino acid transporter, putative                   231   6e-66    
ref|XP_002993099.1|  hypothetical protein SELMODRAFT_431216             229   6e-66    
ref|XP_006350162.1|  PREDICTED: vacuolar amino acid transporter 1...    230   6e-66    
ref|XP_002283468.1|  PREDICTED: vacuolar amino acid transporter 1       231   7e-66    
ref|XP_008230770.1|  PREDICTED: vacuolar amino acid transporter 1       231   7e-66    
ref|XP_009611691.1|  PREDICTED: vacuolar amino acid transporter 1...    233   9e-66    
ref|XP_008646380.1|  PREDICTED: vacuolar amino acid transporter 1...    233   1e-65    
ref|XP_006355151.1|  PREDICTED: vacuolar amino acid transporter 1...    233   1e-65    
ref|XP_007215416.1|  hypothetical protein PRUPE_ppa006034mg             230   1e-65    
ref|XP_002316138.1|  hypothetical protein POPTR_0010s17610g             229   1e-65    
ref|XP_009621095.1|  PREDICTED: vacuolar amino acid transporter 1...    232   1e-65    
ref|XP_006845524.1|  hypothetical protein AMTR_s00019p00168610          233   1e-65    
ref|XP_008779581.1|  PREDICTED: vacuolar amino acid transporter 1...    232   2e-65    
ref|XP_007032545.1|  Amino acid transporter isoform 3                   229   2e-65    
ref|XP_010066910.1|  PREDICTED: vacuolar amino acid transporter 1...    229   2e-65    
gb|EMT30351.1|  hypothetical protein F775_00645                         233   2e-65    
ref|XP_001761173.1|  predicted protein                                  228   2e-65    
ref|XP_002454681.1|  hypothetical protein SORBIDRAFT_04g035520          232   2e-65    
ref|XP_004298430.1|  PREDICTED: vacuolar amino acid transporter 1...    229   2e-65    
dbj|BAJ96897.1|  predicted protein                                      229   3e-65    
ref|XP_009341016.1|  PREDICTED: vacuolar amino acid transporter 1...    229   3e-65    
gb|KEH22923.1|  transmembrane amino acid transporter family protein     232   3e-65    
ref|XP_010914085.1|  PREDICTED: vacuolar amino acid transporter 1...    231   4e-65    
ref|XP_011017124.1|  PREDICTED: vacuolar amino acid transporter 1...    227   8e-65    
ref|XP_010693246.1|  PREDICTED: vacuolar amino acid transporter 1...    227   9e-65    
ref|XP_008669321.1|  PREDICTED: vacuolar amino acid transporter 1...    228   1e-64    
ref|XP_004513746.1|  PREDICTED: vacuolar amino acid transporter 1...    230   1e-64    
ref|XP_010673018.1|  PREDICTED: vacuolar amino acid transporter 1       230   2e-64    
ref|XP_007028448.1|  Transmembrane amino acid transporter family ...    231   2e-64    
ref|XP_006573772.1|  PREDICTED: vesicular inhibitory amino acid t...    229   2e-64    
tpg|DAA37457.1|  TPA: amino acid/polyamine transporter II               226   2e-64    
ref|XP_004954178.1|  PREDICTED: vacuolar amino acid transporter 1...    229   2e-64    
ref|XP_008443261.1|  PREDICTED: vacuolar amino acid transporter 1...    230   2e-64    
gb|KHG18705.1|  Vacuolar amino acid transporter 1                       229   3e-64    
ref|XP_008229346.1|  PREDICTED: vacuolar amino acid transporter 1...    226   3e-64    
ref|XP_007028447.1|  Transmembrane amino acid transporter family ...    230   3e-64    
ref|XP_002454679.1|  hypothetical protein SORBIDRAFT_04g035500          229   4e-64    
ref|XP_008649256.1|  PREDICTED: vacuolar amino acid transporter 1...    225   4e-64    
ref|XP_008221614.1|  PREDICTED: vacuolar amino acid transporter 1...    225   4e-64    
ref|XP_002526910.1|  amino acid transporter, putative                   228   4e-64    
ref|XP_007032544.1|  Amino acid transporter isoform 2                   226   5e-64    
gb|KCW90042.1|  hypothetical protein EUGRSUZ_A02246                     226   6e-64    
ref|XP_002980352.1|  hypothetical protein SELMODRAFT_112419             224   7e-64    
ref|XP_006483152.1|  PREDICTED: vacuolar amino acid transporter 1...    225   7e-64    
ref|NP_001169836.1|  hypothetical protein                               228   7e-64    
ref|XP_009407353.1|  PREDICTED: vacuolar amino acid transporter 1...    225   8e-64    
ref|XP_007216685.1|  hypothetical protein PRUPE_ppa027005mg             225   9e-64    
ref|XP_002311301.1|  hypothetical protein POPTR_0008s08610g             224   1e-63    
ref|XP_004491802.1|  PREDICTED: vacuolar amino acid transporter 1...    224   1e-63    
ref|XP_008243119.1|  PREDICTED: vacuolar amino acid transporter 1       228   1e-63    
ref|NP_001142087.1|  uncharacterized protein LOC100274249               228   1e-63    
gb|AAF14030.1|AC011436_14  hypothetical protein                         226   1e-63    
ref|XP_004491803.1|  PREDICTED: vacuolar amino acid transporter 1...    224   1e-63    
gb|EYU20801.1|  hypothetical protein MIMGU_mgv1a004134mg                228   1e-63    
ref|XP_006664664.1|  PREDICTED: vacuolar amino acid transporter 1...    228   1e-63    
gb|AGT39225.1|  black hull 4                                            223   2e-63    
gb|KEH19718.1|  transmembrane amino acid transporter family protein     224   2e-63    
gb|AGT39214.1|  black hull 4                                            223   2e-63    
emb|CBW45786.1|  ORW1943Ba0077G13.14                                    223   2e-63    
ref|XP_002446615.1|  hypothetical protein SORBIDRAFT_06g018960          225   2e-63    
gb|AGT39235.1|  black hull 4                                            223   2e-63    
gb|AGT39239.1|  black hull 4                                            223   2e-63    
ref|XP_007032543.1|  Amino acid transporter isoform 1                   225   3e-63    
gb|AGT39222.1|  black hull 4                                            223   3e-63    
ref|XP_004509970.1|  PREDICTED: vacuolar amino acid transporter 1...    223   3e-63    
ref|XP_006438695.1|  hypothetical protein CICLE_v10031712mg             223   4e-63    
gb|AGT39236.1|  black hull 4                                            223   4e-63    
ref|XP_007046090.1|  Transmembrane amino acid transporter family ...    224   4e-63    
ref|XP_004965043.1|  PREDICTED: vacuolar amino acid transporter 1...    223   4e-63    
ref|XP_011013465.1|  PREDICTED: vacuolar amino acid transporter 1...    223   4e-63    
gb|AGT39228.1|  black hull 4                                            222   5e-63    
ref|XP_009590876.1|  PREDICTED: vacuolar amino acid transporter 1...    223   5e-63    
gb|AGT39240.1|  black hull 4                                            222   6e-63    
ref|XP_011027233.1|  PREDICTED: vacuolar amino acid transporter 1       225   8e-63    
ref|XP_002962740.1|  hypothetical protein SELMODRAFT_78117              221   8e-63    
gb|AGT39238.1|  black hull 4                                            221   9e-63    
ref|XP_002522438.1|  amino acid transporter, putative                   221   9e-63    
ref|XP_009793362.1|  PREDICTED: vesicular GABA transporter isofor...    224   9e-63    
ref|XP_002963954.1|  hypothetical protein SELMODRAFT_405495             222   1e-62    
ref|XP_009615733.1|  PREDICTED: vesicular GABA transporter-like         225   1e-62    
ref|XP_006291203.1|  hypothetical protein CARUB_v10017331mg             222   1e-62    
gb|AGT39246.1|  black hull 4                                            221   1e-62    
ref|XP_002877146.1|  amino acid transporter family protein              221   1e-62    
gb|EYU41747.1|  hypothetical protein MIMGU_mgv1a017693mg                224   2e-62    
gb|AGT39247.1|  black hull 4                                            221   2e-62    
gb|KHG21173.1|  Vacuolar amino acid transporter 1                       221   2e-62    
ref|XP_008779583.1|  PREDICTED: vacuolar amino acid transporter 1...    224   2e-62    
ref|NP_001190204.1|  transmembrane amino acid transporter family ...    223   2e-62    
ref|XP_007222753.1|  hypothetical protein PRUPE_ppa006516mg             221   2e-62    
gb|EMS49092.1|  hypothetical protein TRIUR3_23690                       220   2e-62    
dbj|BAA95749.1|  unnamed protein product                                221   2e-62    
gb|KHN02095.1|  Vacuolar amino acid transporter 1                       221   2e-62    
gb|AGT39245.1|  black hull 4                                            220   2e-62    
emb|CBI30123.3|  unnamed protein product                                222   3e-62    
ref|XP_011079061.1|  PREDICTED: vacuolar amino acid transporter 1...    224   3e-62    
ref|XP_003551227.1|  PREDICTED: vacuolar amino acid transporter 1...    221   3e-62    
ref|XP_009793363.1|  PREDICTED: vesicular GABA transporter isofor...    222   3e-62    
emb|CDP20763.1|  unnamed protein product                                220   3e-62    
gb|EPS59523.1|  hypothetical protein M569_15281                         223   3e-62    
ref|XP_009773621.1|  PREDICTED: vacuolar amino acid transporter 1...    221   4e-62    
ref|XP_007046091.1|  Transmembrane amino acid transporter family ...    220   4e-62    
ref|XP_007146813.1|  hypothetical protein PHAVU_006G071900g             221   4e-62    
ref|XP_002988175.1|  hypothetical protein SELMODRAFT_159247             221   4e-62    
ref|XP_003564050.1|  PREDICTED: vacuolar amino acid transporter 1...    219   6e-62    
ref|XP_009793360.1|  PREDICTED: vesicular GABA transporter isofor...    222   6e-62    
ref|XP_009793359.1|  PREDICTED: vesicular GABA transporter isofor...    222   6e-62    
gb|KHN22363.1|  Vacuolar amino acid transporter 1                       223   6e-62    
ref|XP_003621233.1|  Vacuolar amino acid transporter                    220   7e-62    
ref|XP_002967966.1|  hypothetical protein SELMODRAFT_408925             220   7e-62    
gb|KDP29265.1|  hypothetical protein JCGZ_16654                         220   8e-62    
dbj|BAK07225.1|  predicted protein                                      218   9e-62    
ref|XP_010112207.1|  hypothetical protein L484_013031                   220   9e-62    
ref|XP_010317523.1|  PREDICTED: vacuolar amino acid transporter 1...    219   1e-61    
ref|XP_010492352.1|  PREDICTED: vacuolar amino acid transporter 1...    219   1e-61    
ref|XP_006602908.1|  PREDICTED: vacuolar amino acid transporter 1...    219   1e-61    
ref|NP_189538.2|  transmembrane amino acid transporter family pro...    219   1e-61    
ref|XP_004235076.1|  PREDICTED: vacuolar amino acid transporter 1       222   1e-61    
ref|XP_010543283.1|  PREDICTED: vacuolar amino acid transporter 1...    221   1e-61    
ref|XP_002265140.1|  PREDICTED: vacuolar amino acid transporter 1       219   1e-61    
gb|EAZ24888.1|  hypothetical protein OsJ_08666                          222   1e-61    
ref|XP_004136776.1|  PREDICTED: vacuolar amino acid transporter 1...    223   1e-61    
gb|KEH19717.1|  transmembrane amino acid transporter family protein     219   1e-61    
ref|XP_010693247.1|  PREDICTED: vacuolar amino acid transporter 1...    219   1e-61    
ref|XP_010420182.1|  PREDICTED: vacuolar amino acid transporter 1...    219   1e-61    
gb|KDO82929.1|  hypothetical protein CISIN_1g048146mg                   218   1e-61    
ref|XP_007217097.1|  hypothetical protein PRUPE_ppa023445mg             219   2e-61    
ref|NP_001067099.1|  Os12g0574000                                       223   2e-61    
ref|XP_006482599.1|  PREDICTED: vacuolar amino acid transporter 1...    219   2e-61    
gb|KEH19628.1|  transmembrane amino acid transporter family protein     218   2e-61    
ref|XP_003570270.1|  PREDICTED: vacuolar amino acid transporter 1       221   2e-61    
ref|XP_010088153.1|  hypothetical protein L484_013597                   219   2e-61    
ref|XP_002323862.2|  hypothetical protein POPTR_0017s12000g             219   2e-61    
ref|XP_009793350.1|  PREDICTED: vesicular GABA transporter isofor...    223   2e-61    
ref|XP_004954177.1|  PREDICTED: vacuolar amino acid transporter 1...    222   2e-61    
ref|XP_009793349.1|  PREDICTED: vesicular GABA transporter isofor...    223   2e-61    
ref|XP_008446354.1|  PREDICTED: vacuolar amino acid transporter 1...    218   3e-61    
gb|EMS47822.1|  hypothetical protein TRIUR3_09005                       218   3e-61    
ref|XP_009793351.1|  PREDICTED: vesicular GABA transporter isofor...    223   3e-61    
ref|XP_010317522.1|  PREDICTED: vacuolar amino acid transporter 1...    218   3e-61    
ref|XP_008389469.1|  PREDICTED: vacuolar amino acid transporter 1...    218   3e-61    
ref|XP_010278063.1|  PREDICTED: vacuolar amino acid transporter 1...    221   3e-61    
gb|AGT39249.1|  black hull 4                                            217   3e-61    
ref|XP_004234295.1|  PREDICTED: vacuolar amino acid transporter 1...    218   3e-61    
gb|KDO39684.1|  hypothetical protein CISIN_1g013919mg                   216   3e-61    
ref|NP_001043480.2|  Os01g0597600                                       218   4e-61    
ref|XP_009360335.1|  PREDICTED: vacuolar amino acid transporter 1...    218   4e-61    
ref|XP_009793347.1|  PREDICTED: proton-coupled amino acid transpo...    223   5e-61    



>emb|CDP21416.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/426 (73%), Positives = 358/426 (84%), Gaps = 2/426 (0%)
 Frame = +3

Query  156   ASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGW  335
             A   +   +   KD+ES  +  +  E+NN SF+HAVINMIGMLIGLGQLS PYALE GGW
Sbjct  50    AKESKLNFEETAKDVESLAD-QKALEENNCSFLHAVINMIGMLIGLGQLSAPYALENGGW  108

Query  336   ISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMA  515
              SAFLL+GLG+ CA+ +HLLGKCL K PKS+DYKDIGQ AFG KGRI+ ASFIY EIFMA
Sbjct  109   TSAFLLVGLGISCAYGSHLLGKCLEKYPKSRDYKDIGQNAFGAKGRIIVASFIYAEIFMA  168

Query  516   LVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSA  695
             LVSYTISLHDNLATVFLGTHLKL+   L++SQ LTV+A+LVALPSLW RDLSSISFLS+A
Sbjct  169   LVSYTISLHDNLATVFLGTHLKLSWTNLTSSQTLTVLAILVALPSLWLRDLSSISFLSTA  228

Query  696   GILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMK  875
             GILMSLLIFVTVAC A+FG V  NH IP L L NIP++SGLY FSYAGH+VFPN++ AMK
Sbjct  229   GILMSLLIFVTVACAAIFGAVKANHSIPALQLHNIPAISGLYIFSYAGHVVFPNLHAAMK  288

Query  876   DPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLT  1055
             DPSKFTKV+IVSFS+VT+LYT+LAFMGAKMFGP V+SQITLSMPR ++ TK+ALWATVLT
Sbjct  289   DPSKFTKVTIVSFSLVTVLYTSLAFMGAKMFGPEVNSQITLSMPRALILTKIALWATVLT  348

Query  1056  PMTKYALEFAPFAIELDHS-LPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
             PMTKYALEFAPFAI+L+ + LP SMK   K IIRG  GSIL+L+IL LAL VPYFE+VLS
Sbjct  349   PMTKYALEFAPFAIQLEQNILPHSMKSRTKMIIRGSVGSILLLVILVLALSVPYFEYVLS  408

Query  1233  LTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVIS  1412
             LTGSLVS+GI ++ PC FY KIFW +ISRP LI N++LI FGTLL  SGTVSS +LL+ +
Sbjct  409   LTGSLVSVGICMIFPCAFYIKIFWNQISRPTLILNMILIAFGTLLGASGTVSSSRLLLQN  468

Query  1413  LQRAHS  1430
             L+RAHS
Sbjct  469   LRRAHS  474



>ref|XP_002321090.2| hypothetical protein POPTR_0014s14380g, partial [Populus trichocarpa]
 gb|EEE99405.2| hypothetical protein POPTR_0014s14380g, partial [Populus trichocarpa]
Length=461

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/447 (68%), Positives = 359/447 (80%), Gaps = 14/447 (3%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLESS---EECVEQ-AEKNNSSFMHAVINMI  275
             + C +C       VE   G + +  T  +DL+S+   E  VE   ++ NSSF H+VINMI
Sbjct  24    VTCDAC-------VEENKGCKCDHDT--QDLKSAVVNEADVEHHTDQANSSFAHSVINMI  74

Query  276   GMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQA  455
             GMLIGLGQLSTPYALE GGW+SAFLL+GLGVICA+T+HLLGKCL K PKS+ Y DIGQ A
Sbjct  75    GMLIGLGQLSTPYALENGGWVSAFLLVGLGVICAYTSHLLGKCLAKSPKSRSYTDIGQHA  134

Query  456   FGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL-TGIQLSTSQLLTVMAV  632
             FG+ GR+LAA+FIYLEIFMALVSYTISLHDNL TVF GT L+L    +L  SQLLT+M V
Sbjct  135   FGSNGRVLAATFIYLEIFMALVSYTISLHDNLITVFAGTQLRLPIWAKLYKSQLLTLMGV  194

Query  633   LVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVS  812
             LVALPSLW RDLSSISFLSS GILMS++IF +VACTA+F VV  NH IP LHL  IP++S
Sbjct  195   LVALPSLWLRDLSSISFLSSGGILMSIVIFTSVACTAIFQVVKANHSIPALHLHKIPAIS  254

Query  813   GLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQI  992
             GLY FSYAGHIVFP++Y +MKDPSKFT VSIVSF+ VT LY +LAFMGA++FGP VSSQI
Sbjct  255   GLYIFSYAGHIVFPDLYKSMKDPSKFTMVSIVSFASVTALYASLAFMGARLFGPEVSSQI  314

Query  993   TLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSi  1172
             TLSMPRH + TK+ALWATVLTPMTKYALEFAPFAI+L+H+LP S+    KT+IRG  GS 
Sbjct  315   TLSMPRHHIITKIALWATVLTPMTKYALEFAPFAIQLEHNLPNSISSRTKTVIRGAVGSF  374

Query  1173  liliilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIV  1352
             L+L+ILALAL VPYFEHVLSLTGSLVS+ I IV PC FY K+ W +IS+P+LI NV+L+ 
Sbjct  375   LLLVILALALSVPYFEHVLSLTGSLVSVSICIVFPCAFYIKLSWAQISKPVLILNVILLA  434

Query  1353  FGTLLAVSGTVSSFKLLVISLQRAHST  1433
             FG LL V GT+SS KLL+ SL+RAH T
Sbjct  435   FGLLLGVFGTISSSKLLITSLERAHHT  461



>emb|CBI39446.3| unnamed protein product [Vitis vinifera]
Length=434

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/440 (70%), Positives = 355/440 (81%), Gaps = 12/440 (3%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLI  287
             IE +  C   H   E   G        V D +     VE+ +++NSSF HAVINMIGMLI
Sbjct  7     IEENKVCGCQHSSTEGFKG-------TVNDTD-----VERHQESNSSFAHAVINMIGMLI  54

Query  288   GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTK  467
             GLGQLSTPYALE GGW SAFLLIGLG+ CA+ +HLLGKCL K+PKS++Y DIGQQAFGTK
Sbjct  55    GLGQLSTPYALENGGWASAFLLIGLGITCAYGSHLLGKCLDKNPKSRNYTDIGQQAFGTK  114

Query  468   GRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALP  647
             GR++AA FIY+EIFMALVSYTISLHDNL+TVFLG HLK+  + LSTSQLLTVMAVLVALP
Sbjct  115   GRVIAAIFIYMEIFMALVSYTISLHDNLSTVFLGMHLKVPSLNLSTSQLLTVMAVLVALP  174

Query  648   SLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAF  827
             SLW RDLSSISFLSS GI MSLLIF TVACTA+ G V  N  IP L L NIP++SGLY F
Sbjct  175   SLWLRDLSSISFLSSGGIFMSLLIFATVACTAISGAVKANQPIPVLKLDNIPAISGLYIF  234

Query  828   SYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMP  1007
             SYAGHIVFP++Y AMKDPSKFTKVSIVSF++VT+LYT LAFMGAK+FGP V+SQITLSMP
Sbjct  235   SYAGHIVFPDLYKAMKDPSKFTKVSIVSFTLVTMLYTTLAFMGAKLFGPDVNSQITLSMP  294

Query  1008  RHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililii  1187
             RH+  TK+ALWATVLTPMTKYALEFAPFAI+L+H LP SM   +K IIRG  GSIL+L I
Sbjct  295   RHLTVTKIALWATVLTPMTKYALEFAPFAIQLEHKLPQSMSSRMKMIIRGSVGSILLLCI  354

Query  1188  lalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLL  1367
             LALAL VPYFE+VLSLTGSLVS+ I I+LP  FY KI+W ++++PLLI NV+LI  G LL
Sbjct  355   LALALSVPYFEYVLSLTGSLVSVSICIILPSTFYLKIYWAQVTKPLLILNVILIALGALL  414

Query  1368  AVSGTVSSFKLLVISLQRAH  1427
              V GT+SS K L+ S+ RAH
Sbjct  415   GVCGTISSSKSLLKSIGRAH  434



>ref|XP_011006098.1| PREDICTED: vacuolar amino acid transporter 1-like [Populus euphratica]
Length=480

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/447 (68%), Positives = 358/447 (80%), Gaps = 14/447 (3%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLES---SEECVEQ-AEKNNSSFMHAVINMI  275
             + C +C       VE   G + +  T  +DL+S   +E  VE   ++ NSSF H+VINMI
Sbjct  43    MTCDAC-------VEENKGCKCDQDT--QDLKSAVVNEADVEHHTDQANSSFAHSVINMI  93

Query  276   GMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQA  455
             GMLIGLGQLSTPYALE GGW+SAFLL+GLGVICA+T+HLLGKCL K PKS+ Y DIGQ A
Sbjct  94    GMLIGLGQLSTPYALENGGWVSAFLLVGLGVICAYTSHLLGKCLAKSPKSRSYTDIGQHA  153

Query  456   FGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL-TGIQLSTSQLLTVMAV  632
             FG+ GR+LAA+FIYLEIFMALVSYTISLHDNL TVF GT L+L    +L  SQLLT M V
Sbjct  154   FGSNGRVLAATFIYLEIFMALVSYTISLHDNLITVFAGTQLRLPIWAKLYKSQLLTAMGV  213

Query  633   LVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVS  812
             LVALPSLW RDLSSISFLSS GILMS++IF +VACTA+F VV  NH IP LHL  IP++S
Sbjct  214   LVALPSLWLRDLSSISFLSSGGILMSIVIFTSVACTAIFQVVKANHSIPALHLHKIPAIS  273

Query  813   GLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQI  992
             GLY FSYAGHIVFP++Y +MKDPSKFT VSIVSF+ V+ LY +LAFMGA++FGP VSSQI
Sbjct  274   GLYIFSYAGHIVFPDLYKSMKDPSKFTMVSIVSFASVSALYASLAFMGARLFGPEVSSQI  333

Query  993   TLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSi  1172
             TLSMPRH + TK+ALWATVLTPMTKYALEFAPFAI+L+H+LP S+    KT+IRG  GS 
Sbjct  334   TLSMPRHHIITKIALWATVLTPMTKYALEFAPFAIQLEHNLPNSISSRTKTVIRGAVGSF  393

Query  1173  liliilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIV  1352
             L+L+ILALAL VPYFEHVLSLTGSLVS+ I IV PC FY K+ W +IS+P+LI NV+L+ 
Sbjct  394   LLLVILALALSVPYFEHVLSLTGSLVSVSICIVFPCAFYIKLSWAQISKPVLILNVILLA  453

Query  1353  FGTLLAVSGTVSSFKLLVISLQRAHST  1433
             FG LL V GT+SS KLL+ SL+RAH T
Sbjct  454   FGLLLGVFGTISSSKLLITSLERAHHT  480



>ref|XP_002266204.2| PREDICTED: vacuolar amino acid transporter 1 [Vitis vinifera]
Length=470

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/440 (70%), Positives = 355/440 (81%), Gaps = 12/440 (3%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLI  287
             IE +  C   H   E   G        V D +     VE+ +++NSSF HAVINMIGMLI
Sbjct  43    IEENKVCGCQHSSTEGFKG-------TVNDTD-----VERHQESNSSFAHAVINMIGMLI  90

Query  288   GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTK  467
             GLGQLSTPYALE GGW SAFLLIGLG+ CA+ +HLLGKCL K+PKS++Y DIGQQAFGTK
Sbjct  91    GLGQLSTPYALENGGWASAFLLIGLGITCAYGSHLLGKCLDKNPKSRNYTDIGQQAFGTK  150

Query  468   GRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALP  647
             GR++AA FIY+EIFMALVSYTISLHDNL+TVFLG HLK+  + LSTSQLLTVMAVLVALP
Sbjct  151   GRVIAAIFIYMEIFMALVSYTISLHDNLSTVFLGMHLKVPSLNLSTSQLLTVMAVLVALP  210

Query  648   SLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAF  827
             SLW RDLSSISFLSS GI MSLLIF TVACTA+ G V  N  IP L L NIP++SGLY F
Sbjct  211   SLWLRDLSSISFLSSGGIFMSLLIFATVACTAISGAVKANQPIPVLKLDNIPAISGLYIF  270

Query  828   SYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMP  1007
             SYAGHIVFP++Y AMKDPSKFTKVSIVSF++VT+LYT LAFMGAK+FGP V+SQITLSMP
Sbjct  271   SYAGHIVFPDLYKAMKDPSKFTKVSIVSFTLVTMLYTTLAFMGAKLFGPDVNSQITLSMP  330

Query  1008  RHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililii  1187
             RH+  TK+ALWATVLTPMTKYALEFAPFAI+L+H LP SM   +K IIRG  GSIL+L I
Sbjct  331   RHLTVTKIALWATVLTPMTKYALEFAPFAIQLEHKLPQSMSSRMKMIIRGSVGSILLLCI  390

Query  1188  lalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLL  1367
             LALAL VPYFE+VLSLTGSLVS+ I I+LP  FY KI+W ++++PLLI NV+LI  G LL
Sbjct  391   LALALSVPYFEYVLSLTGSLVSVSICIILPSTFYLKIYWAQVTKPLLILNVILIALGALL  450

Query  1368  AVSGTVSSFKLLVISLQRAH  1427
              V GT+SS K L+ S+ RAH
Sbjct  451   GVCGTISSSKSLLKSIGRAH  470



>ref|XP_006364699.1| PREDICTED: vacuolar amino acid transporter 1-like [Solanum tuberosum]
Length=453

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/441 (71%), Positives = 358/441 (81%), Gaps = 7/441 (2%)
 Frame = +3

Query  117   SSCCPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLG  296
             S+CC       E +S    E+    KDLES      Q  K+N++F+HAVINMIGMLIGLG
Sbjct  17    STCCLPHQVTSENSSNNIGENS---KDLES--LAYHQHVKSNTTFLHAVINMIGMLIGLG  71

Query  297   QLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRI  476
             QLSTPYALE GGW+S+ +LIGLG+ICA+T+HLLGKCL K+PKSKDYKDIG QAFGTKGRI
Sbjct  72    QLSTPYALENGGWMSSIILIGLGIICAYTSHLLGKCLQKNPKSKDYKDIGHQAFGTKGRI  131

Query  477   LAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGI--QLSTSQLLTVMAVLVALPS  650
             +  SFIYLEIFMAL+SYTISLHDNL+ VF+ T+ KL GI   LSTSQ+LT +A+L+A+PS
Sbjct  132   IVTSFIYLEIFMALISYTISLHDNLSIVFINTNFKLKGILFHLSTSQILTTIAILIAIPS  191

Query  651   LWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFS  830
             LW R+ SSISFLSS GI MSLLIFVTVACTA+FG +  NH+IP LHL NIPS+SGLY FS
Sbjct  192   LWLRNFSSISFLSSGGIFMSLLIFVTVACTAIFGGIKANHQIPFLHLQNIPSISGLYIFS  251

Query  831   YAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPR  1010
             YAGHIVFPNIYTAMKDPSKFTKVSIVSFS+VT LY +L FMGAK+FGP VSSQITLSMP 
Sbjct  252   YAGHIVFPNIYTAMKDPSKFTKVSIVSFSLVTTLYISLGFMGAKLFGPQVSSQITLSMPH  311

Query  1011  HVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiil  1190
               + TK ALWAT+LTPMTKYALEFAP AIEL+ +LP SMK  +K +IRG  GSIL+L+IL
Sbjct  312   DQIITKFALWATILTPMTKYALEFAPIAIELEENLPSSMKSKVKMMIRGIVGSILLLVIL  371

Query  1191  alalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLA  1370
              LAL VPYFEHVLSLTGSLV +GI ++ PC FYTKIFW +ISR  LI NVVLIV G LL 
Sbjct  372   ILALSVPYFEHVLSLTGSLVGVGICVIFPCAFYTKIFWGEISRMSLILNVVLIVIGGLLG  431

Query  1371  VSGTVSSFKLLVISLQRAHST  1433
             V GT+SS KLL  SL+RAH +
Sbjct  432   VVGTISSSKLLAKSLKRAHDS  452



>ref|XP_004247988.1| PREDICTED: vacuolar amino acid transporter 1 [Solanum lycopersicum]
Length=440

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/438 (70%), Positives = 353/438 (81%), Gaps = 2/438 (0%)
 Frame = +3

Query  114   CSSCCPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGL  293
             C   C    K +   S          KDLES     +Q  K+N+SF+HAVINMIGMLIGL
Sbjct  2     CDKSCNSNGKQLCLDSTNYCLPNENSKDLESLAY-DDQHVKSNTSFLHAVINMIGMLIGL  60

Query  294   GQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGR  473
             GQLSTPYALE GGW+S+ +L+GLG++CA+T+HLLGKCL K+PKSKDYKDIG QAFGTKGR
Sbjct  61    GQLSTPYALENGGWMSSIILVGLGIMCAYTSHLLGKCLQKNPKSKDYKDIGHQAFGTKGR  120

Query  474   ILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSL  653
             I+   FIYLEIFMAL+SYTISLHDNL+ VFL T+LKL    LSTSQ+LT++A+L+A+PSL
Sbjct  121   IIVTCFIYLEIFMALISYTISLHDNLSIVFLNTNLKLL-FHLSTSQILTIIAILIAIPSL  179

Query  654   WFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSY  833
             W RD SSISFLSS GI MSLLIFVTVACTA+FG +  +H+IP LHL NIPS+SGLY FSY
Sbjct  180   WLRDFSSISFLSSGGIFMSLLIFVTVACTAIFGGIKADHQIPFLHLQNIPSISGLYIFSY  239

Query  834   AGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRH  1013
             AGHIVFPNIYTAMKDPS FTKVSIVSFS+VT LY +L FMGAK+FGP VSSQITLSMP  
Sbjct  240   AGHIVFPNIYTAMKDPSNFTKVSIVSFSLVTTLYVSLGFMGAKLFGPQVSSQITLSMPHD  299

Query  1014  VVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiila  1193
              + TK+ALWAT+LTPMTKYALEFAPFAIEL+ +LP SMK  +K IIRG  GSIL+L+IL 
Sbjct  300   QIITKIALWATILTPMTKYALEFAPFAIELEENLPSSMKSKVKMIIRGIVGSILLLVILI  359

Query  1194  lalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAV  1373
             LAL VPYFEHVLSLTGSLV +GI ++ PC FY K+FW +ISR  LI NVVLIV G LL V
Sbjct  360   LALSVPYFEHVLSLTGSLVGVGICVIFPCAFYIKVFWGEISRMSLILNVVLIVIGGLLGV  419

Query  1374  SGTVSSFKLLVISLQRAH  1427
              GT+SS KLL  SL+RAH
Sbjct  420   VGTISSSKLLARSLKRAH  437



>ref|XP_007226886.1| hypothetical protein PRUPE_ppa016615mg [Prunus persica]
 gb|EMJ28085.1| hypothetical protein PRUPE_ppa016615mg [Prunus persica]
Length=469

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/426 (69%), Positives = 344/426 (81%), Gaps = 6/426 (1%)
 Frame = +3

Query  171   FEDQTAVKDLESSEECV------EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGG  332
              E+  A K  +S E C       E   + N+SF H+VINM GMLIGLGQLSTPYALE GG
Sbjct  43    LEENKACKCDQSFESCKRVSGVDEHHSEGNNSFTHSVINMTGMLIGLGQLSTPYALETGG  102

Query  333   WISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFM  512
             W SAFL+IGLGVICA+ +H+LGKCL K+PKS+ Y DIGQQAFGTKG+++AA+ IY+EIFM
Sbjct  103   WSSAFLMIGLGVICAYCSHILGKCLDKNPKSRSYTDIGQQAFGTKGKLIAATLIYMEIFM  162

Query  513   ALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSS  692
             ALVSYTISLHDNL TVF GT  K++  +LS SQLLT+MAVLVALPSLW RDLSSISFLS 
Sbjct  163   ALVSYTISLHDNLNTVFSGTQFKVSWAKLSKSQLLTLMAVLVALPSLWLRDLSSISFLSF  222

Query  693   AGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAM  872
              G+LMSL+IF +VACT +FG V  NH IP L L NIP++SGLY FSYAGHIVFPN+Y AM
Sbjct  223   GGLLMSLVIFTSVACTGIFGGVKANHTIPALRLHNIPAISGLYIFSYAGHIVFPNLYKAM  282

Query  873   KDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVL  1052
             KDPSKFTKVSIVSF++ TILY  LAFMGAK+FGP V+ QITLSMP H++ TK+ALWATV+
Sbjct  283   KDPSKFTKVSIVSFTLATILYATLAFMGAKLFGPQVNPQITLSMPPHLIVTKIALWATVV  342

Query  1053  TPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
             TPMTKYALEFAP AI+L+H+LP SM    K IIRG  GS+L+L+ILALAL VPYFE+VLS
Sbjct  343   TPMTKYALEFAPMAIQLEHNLPHSMSSRTKLIIRGTVGSVLLLVILALALSVPYFEYVLS  402

Query  1233  LTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVIS  1412
             LTGSLVSIGI ++ PC FY KI W +ISRPLL+ N  LI FG LL V GT+SS KLL+ +
Sbjct  403   LTGSLVSIGICVIFPCAFYLKICWGQISRPLLLLNFTLIAFGLLLGVVGTISSSKLLIKN  462

Query  1413  LQRAHS  1430
             L RAHS
Sbjct  463   LNRAHS  468



>ref|XP_008244445.1| PREDICTED: vacuolar amino acid transporter 1 [Prunus mume]
Length=469

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/426 (69%), Positives = 345/426 (81%), Gaps = 6/426 (1%)
 Frame = +3

Query  171   FEDQTAVKDLESSEECV------EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGG  332
              E+  A K  +S E C       E   + N+SF H+VINM GMLIGLGQLSTPYALE GG
Sbjct  43    LEENKACKCDQSFESCKRVSGVDEHHAEANNSFTHSVINMTGMLIGLGQLSTPYALETGG  102

Query  333   WISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFM  512
             W SAFL+IGLGVICA+ +H+LGKCL K+PKS+ Y DIGQQAFGTKG+++AA+ IY+EIFM
Sbjct  103   WSSAFLMIGLGVICAYCSHILGKCLDKNPKSRSYTDIGQQAFGTKGKLIAATLIYMEIFM  162

Query  513   ALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSS  692
             ALVSYTISLHDNL TVF GT  K++  +LS SQLLT+MAVLVALPSLW RDLSSISFLS 
Sbjct  163   ALVSYTISLHDNLNTVFSGTQFKVSWAKLSKSQLLTLMAVLVALPSLWLRDLSSISFLSF  222

Query  693   AGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAM  872
              G+LMSL+IF +VACT +FG V  NH IP L L NIP++SGLY FSYAGHIVFPN+Y AM
Sbjct  223   GGLLMSLVIFTSVACTGIFGGVKANHTIPALRLHNIPAISGLYIFSYAGHIVFPNLYKAM  282

Query  873   KDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVL  1052
             KDPSKFT+VSIVSF++ TILY  LAFMGAK+FGP V+ Q+TLSMP H++ TK+ALWATV+
Sbjct  283   KDPSKFTRVSIVSFTLATILYATLAFMGAKLFGPHVNPQVTLSMPPHLIVTKIALWATVV  342

Query  1053  TPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
             TPMTKYALEFAP AI+L+H+LP SM    K IIRG  GS+L+L+ILALAL VPYFE+VLS
Sbjct  343   TPMTKYALEFAPMAIQLEHNLPHSMSSRTKLIIRGTVGSVLLLVILALALSVPYFEYVLS  402

Query  1233  LTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVIS  1412
             LTGSLVSIGI ++ PC FY KI W +ISRPLL+ N  LI FG LL V GT+SS KLL+ +
Sbjct  403   LTGSLVSIGICVIFPCAFYLKICWGQISRPLLLLNFTLIAFGLLLGVVGTISSSKLLIKN  462

Query  1413  LQRAHS  1430
             L+RAHS
Sbjct  463   LKRAHS  468



>ref|XP_007034433.1| Transmembrane amino acid transporter family protein [Theobroma 
cacao]
 gb|EOY05359.1| Transmembrane amino acid transporter family protein [Theobroma 
cacao]
Length=486

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/454 (66%), Positives = 354/454 (78%), Gaps = 24/454 (5%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLI  287
             IE +  C  GH  +E       + Q+ VK  +     V+Q    NSSF+HAV+NM GMLI
Sbjct  45    IEENEVCKCGHGDIE-------DVQSMVKGKD-----VDQQAGANSSFLHAVLNMSGMLI  92

Query  288   ------------GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKD  431
                         GLGQLSTPYALE GGW S FLL+GLGVIC +T+H+LGKCL ++PKS+ 
Sbjct  93    AGDNIFYFTCKAGLGQLSTPYALESGGWASVFLLVGLGVICTYTSHILGKCLERNPKSQS  152

Query  432   YKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQ  611
             Y DIG+ AFG KGR+LAA+ IYLEIFMALVSYTISLHDNL+TVF G  LKL G +LSTSQ
Sbjct  153   YADIGENAFGRKGRVLAATIIYLEIFMALVSYTISLHDNLSTVFAGAQLKLPGAKLSTSQ  212

Query  612   LLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHL  791
             L+TV+AVL+ALPSLW RDLSSISFLSS GILMS++IF +V CTA+FG V  NH IP LH+
Sbjct  213   LITVIAVLIALPSLWLRDLSSISFLSSGGILMSIIIFTSVVCTAIFGGVKANHTIPMLHM  272

Query  792   PNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFG  971
               IP++SGLY FSYAGHIVFPN+Y AMKDPSKFTKVSIVSF+ V  LYTALAF+GAK+FG
Sbjct  273   QKIPAISGLYIFSYAGHIVFPNLYKAMKDPSKFTKVSIVSFASVIALYTALAFLGAKLFG  332

Query  972   PGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTII  1151
             P V++QITLS+P+H   TK+ALWATVLTPMTKYALEFAPFAI+L+H+LP S+   +K II
Sbjct  333   PQVNAQITLSLPQHHFITKIALWATVLTPMTKYALEFAPFAIQLEHNLPESVSSRMKLII  392

Query  1152  RGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLI  1331
             RG  GSIL+L ILALAL VPYFEHVLSLTGSLVS+ I ++LP  FY K+ WP+ISR LLI
Sbjct  393   RGCVGSILLLSILALALSVPYFEHVLSLTGSLVSVCICVILPSAFYIKLSWPQISRRLLI  452

Query  1332  FNVVLIVFGTLLAVSGTVSSFKLLVISLQRAHST  1433
              N+ ++ FG LL V GT+SS KLL+ SL +AHST
Sbjct  453   LNLSVVAFGLLLGVLGTISSAKLLIKSLLKAHST  486



>gb|KDP37882.1| hypothetical protein JCGZ_05764 [Jatropha curcas]
Length=468

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/411 (70%), Positives = 342/411 (83%), Gaps = 1/411 (0%)
 Frame = +3

Query  201   ESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAF  380
             ++ +E        NSSF HAVINM+GMLIGLGQLSTPYALE GGW S+FLLIGLG+ICA+
Sbjct  57    KTPDEANGSNADANSSFTHAVINMVGMLIGLGQLSTPYALENGGWASSFLLIGLGIICAY  116

Query  381   TTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATV  560
             ++HLLGKCL K+PKS+ Y DIGQ+AFG+KGR+LA++FIY+EIFMALVSYTISLHDNL TV
Sbjct  117   SSHLLGKCLDKNPKSRSYSDIGQEAFGSKGRVLASTFIYMEIFMALVSYTISLHDNLITV  176

Query  561   FLGTHLKLTGI-QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVAC  737
             F GT+L      + STSQLLT +AVL+ALPSLW R+LSSISFLSS GILMSL+IF +V  
Sbjct  177   FSGTNLVFPWTSKFSTSQLLTTIAVLIALPSLWLRNLSSISFLSSGGILMSLVIFASVPF  236

Query  738   TAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFS  917
             TA FG V  NH+IP L++  IP++SGLY FSYAGHIVFPN+Y +MKDPSKFTKVSIVSF+
Sbjct  237   TAAFGSVKANHKIPILNVKKIPAISGLYIFSYAGHIVFPNLYKSMKDPSKFTKVSIVSFA  296

Query  918   VVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAI  1097
              VT +YTALAFMGAKMFGP VSSQITLSMP H++ TK+ALWATVLTPMTKYALEFAPFAI
Sbjct  297   SVTTIYTALAFMGAKMFGPNVSSQITLSMPPHLLITKIALWATVLTPMTKYALEFAPFAI  356

Query  1098  ELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLP  1277
             +L+ SLP SM   +K +IR   GS+ +L+ILALAL VPYFEHVL LTGSL+S+ I IV P
Sbjct  357   QLEESLPHSMSPKMKMVIRATVGSLALLLILALALSVPYFEHVLGLTGSLISVSICIVFP  416

Query  1278  CGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAHS  1430
             C FYTKI WP+IS+PLLI N+ LI FG++L + GT+S+ +LL+ +L RAHS
Sbjct  417   CAFYTKISWPQISKPLLILNLSLIAFGSVLGIVGTISTSRLLMDNLIRAHS  467



>ref|XP_002519635.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF42780.1| amino acid transporter, putative [Ricinus communis]
Length=477

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/420 (71%), Positives = 352/420 (84%), Gaps = 9/420 (2%)
 Frame = +3

Query  189   VKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGG------WISAFL  350
             V DL+ +E  +  AE N S F HAVINMIGMLIGLGQLSTPYALE GG      W S FL
Sbjct  60    VGDLKCAE--IPPAEPNGS-FAHAVINMIGMLIGLGQLSTPYALENGGXLENGGWASVFL  116

Query  351   LIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYT  530
             LIGLGVICA+T+HLLGKCL ++PKS+ Y DIGQ+AFGTKGR+LAA+FIY+EIFMALVSYT
Sbjct  117   LIGLGVICAYTSHLLGKCLDRNPKSRSYSDIGQEAFGTKGRVLAATFIYMEIFMALVSYT  176

Query  531   ISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMS  710
             ISLHDN+ TVFLGT L L+  +LSTSQLLT++AVL+ALPSLW RDLSSISFLSS GILMS
Sbjct  177   ISLHDNITTVFLGTKLMLSWAKLSTSQLLTMIAVLIALPSLWLRDLSSISFLSSGGILMS  236

Query  711   LLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKF  890
              +IF++V  TA FG V  NHRIP L L NIP++SGLY FSYAGHIVFP++Y +MKDPSKF
Sbjct  237   FVIFMSVVLTAAFGGVKSNHRIPGLQLQNIPAISGLYIFSYAGHIVFPDLYKSMKDPSKF  296

Query  891   TKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKY  1070
             TKVSIVSF++VT LYTALAFMGAK+FGP V SQITLSMP H++FTK+ALWATVLTPMTKY
Sbjct  297   TKVSIVSFTLVTALYTALAFMGAKLFGPQVGSQITLSMPPHLIFTKIALWATVLTPMTKY  356

Query  1071  ALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLV  1250
             ALEFAPFAI+L+H+LP +M   +K IIRG  GS+++L++LALAL VPYFEHVL LTGSLV
Sbjct  357   ALEFAPFAIQLEHNLPDTMSSRMKMIIRGIVGSLVVLVVLALALSVPYFEHVLGLTGSLV  416

Query  1251  SIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAHS  1430
             S+ I ++LPC FY KI W +ISRPLL+ N+ LI FG+ L V+GT+S+ KLL+ +L RAHS
Sbjct  417   SVSICVILPCVFYVKISWSQISRPLLLLNIALIAFGSFLGVTGTISTSKLLIKTLLRAHS  476



>ref|XP_010241492.1| PREDICTED: vesicular GABA transporter [Nelumbo nucifera]
Length=481

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/445 (66%), Positives = 355/445 (80%), Gaps = 10/445 (2%)
 Frame = +3

Query  111   ECSSC--CPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAE---KNNSSFMHAVINMI  275
             E  SC  C + +K  +   GE  ++Q     L+    C +  +   K N+SF HAVINMI
Sbjct  41    ELKSCQVCLEENKACKCRPGEDIDEQ-----LKKEVNCTDGGDHHVKANTSFAHAVINMI  95

Query  276   GMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQA  455
             GMLIGLGQLSTPYALE GGW SAFLL+GLG++CA+TT+LLGKCL ++ KSKDY DIG+ A
Sbjct  96    GMLIGLGQLSTPYALENGGWTSAFLLVGLGIVCAYTTYLLGKCLQQNAKSKDYPDIGEHA  155

Query  456   FGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVL  635
             FG KGRI+A++FIY+EIFMALVSYTISL DNL TV  GTHL +  + LSTSQLLT MAVL
Sbjct  156   FGLKGRIIASTFIYMEIFMALVSYTISLSDNLTTVLSGTHLSVPWVHLSTSQLLTGMAVL  215

Query  636   VALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSG  815
             VALPSLW RDLSSISFLSS GILMSL+IF++V  TAVFG V  NH IP + L  IP++SG
Sbjct  216   VALPSLWLRDLSSISFLSSGGILMSLIIFLSVPFTAVFGGVRANHSIPVIQLQKIPAISG  275

Query  816   LYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQIT  995
             LYAFS+AGHIVFPNIYTAMKDPSKFTKVSIVSF++VTILYTALAFMGAK+FGP V SQIT
Sbjct  276   LYAFSFAGHIVFPNIYTAMKDPSKFTKVSIVSFTLVTILYTALAFMGAKLFGPEVKSQIT  335

Query  996   LSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSil  1175
             LSMPRH++ TK+ALWAT+LTPMTKYALEFAPFA++L+ +LP S+   +K  IR   GS+L
Sbjct  336   LSMPRHLIITKLALWATILTPMTKYALEFAPFAMQLEQNLPCSLSSRMKMFIRASVGSLL  395

Query  1176  iliilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVF  1355
             +L IL LAL VPYF+HVL LTGSLVSI ISI+ PC FYT+I+W +ISR L++ N+ LI+ 
Sbjct  396   LLGILVLALLVPYFQHVLGLTGSLVSICISIIFPCVFYTRIYWSQISRSLVVLNLTLILI  455

Query  1356  GTLLAVSGTVSSFKLLVISLQRAHS  1430
             G+LLAV G++SS   L+ S+ R H+
Sbjct  456   GSLLAVFGSISSSISLLESITRGHA  480



>ref|XP_009371150.1| PREDICTED: vacuolar amino acid transporter 1-like [Pyrus x bretschneideri]
Length=465

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/452 (64%), Positives = 356/452 (79%), Gaps = 14/452 (3%)
 Frame = +3

Query  117   SSCCPDGHKHVEPASGER--------FEDQ---TAVKDLESSEEC---VEQAEKNNSSFM  254
             S+C P  ++ +E  + +R         E+    T  +  ES +     VE   + N+S +
Sbjct  13    SNCLPHQNQVLESDAVQRANLSCNVCLEENKVCTCDQSFESGKRVTGVVEHHAEANNSVI  72

Query  255   HAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDY  434
              +V+NM GMLIGLGQLSTPYALE GGW SAFLLIGLGVICA+ +HLLGKCL K PKS+ Y
Sbjct  73    QSVVNMSGMLIGLGQLSTPYALENGGWSSAFLLIGLGVICAYCSHLLGKCLDKHPKSRSY  132

Query  435   KDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQL  614
              DIG  AFG++G+I+AASFIY+EIFMALVSYTI+LHDNLATV  G  LK++  +L  SQL
Sbjct  133   TDIGHNAFGSRGKIIAASFIYVEIFMALVSYTIALHDNLATVLSGIQLKVSWAKLQKSQL  192

Query  615   LTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLP  794
             LT++AV VALPSLW RDLSSISFLS  G+LMSL+IF++VACTA+FG V  NH IP L + 
Sbjct  193   LTLIAVFVALPSLWLRDLSSISFLSFGGVLMSLVIFISVACTAIFGGVKLNHTIPALQIH  252

Query  795   NIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGP  974
             NIP++SGLY+FS+AGH+VFPN+Y AMKDPSKFTKVSI+SF++VTILY +L F GAK+FGP
Sbjct  253   NIPAISGLYSFSFAGHVVFPNLYKAMKDPSKFTKVSIISFTLVTILYASLGFTGAKLFGP  312

Query  975   GVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIR  1154
              V+ QITLSMP H++ TK+ALWATVLTPMTKYALEFAP AI+L+H+LPPS+    K +IR
Sbjct  313   QVNPQITLSMPPHLIVTKIALWATVLTPMTKYALEFAPMAIQLEHNLPPSLSSRAKFLIR  372

Query  1155  GGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIF  1334
             G  GS+L+L+ILALAL VPYF +VLSLTGSLVS+GI I+LPC FY KI W +ISRPL++ 
Sbjct  373   GSVGSVLLLVILALALSVPYFGYVLSLTGSLVSVGICIILPCAFYLKICWGQISRPLMVL  432

Query  1335  NVVLIVFGTLLAVSGTVSSFKLLVISLQRAHS  1430
             N+ LI FGTLL ++GT+SS +LL  SL RAHS
Sbjct  433   NLTLIAFGTLLGIAGTISSSRLLFKSLSRAHS  464



>ref|XP_009403652.1| PREDICTED: vacuolar amino acid transporter 1 [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/413 (70%), Positives = 333/413 (81%), Gaps = 0/413 (0%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD E      E   K  SSF H+VINMIGMLIGLGQLSTPYALE GGW S FLL+GLGV+
Sbjct  60    KDTEVLNLQSEHHAKATSSFTHSVINMIGMLIGLGQLSTPYALENGGWSSVFLLVGLGVM  119

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
             CA+T+H++GKCL +D  SK Y+DIGQQAFG KGRI+A++ IYLEIF ALVSYTISL DNL
Sbjct  120   CAYTSHIIGKCLEEDSSSKTYQDIGQQAFGAKGRIIASTLIYLEIFFALVSYTISLSDNL  179

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
               V  G H  ++ + LS SQLLTV+AVLVALP+LW RDLSSISFLS  GI+MSLLIFVT+
Sbjct  180   PLVLSGVHAHISWLPLSASQLLTVVAVLVALPTLWLRDLSSISFLSFGGIVMSLLIFVTI  239

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
             ACTA FG V  NH IP L L  IP +SGLY FSYAGHIVFPNIYTAMKDPSKFTKVSI S
Sbjct  240   ACTAAFGGVRGNHSIPLLQLRKIPGISGLYIFSYAGHIVFPNIYTAMKDPSKFTKVSIAS  299

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F+ VT+LYTALAFMGAK+FGP VSSQITLSMP H++ TK+ALWATVLTPMTKYALEF+PF
Sbjct  300   FTTVTMLYTALAFMGAKLFGPAVSSQITLSMPPHLIATKIALWATVLTPMTKYALEFSPF  359

Query  1092  AIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIV  1271
             A +L+H LP +M    + +IRG  GSIL+L+ILALAL +PYFEHVLSLTGSLVSI IS++
Sbjct  360   ASQLEHKLPSTMSSRARMVIRGSVGSILLLVILALALSLPYFEHVLSLTGSLVSIAISLI  419

Query  1272  LPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAHS  1430
              PC FY KI WP++S+P ++ N VLIV G LL V GT+SS K L+ S+QR HS
Sbjct  420   FPCAFYLKICWPQVSKPTVVLNGVLIVLGALLGVVGTISSSKALIQSIQRGHS  472



>ref|XP_004298026.1| PREDICTED: vacuolar amino acid transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=465

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/421 (68%), Positives = 338/421 (80%), Gaps = 2/421 (0%)
 Frame = +3

Query  165   ERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISA  344
             E FE    V D + S++     E NNS   HAVINM GMLIGLGQLSTPYALE GGW+SA
Sbjct  47    ESFESCKKV-DSDVSDDEQHHGEANNS-VTHAVINMTGMLIGLGQLSTPYALESGGWVSA  104

Query  345   FLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVS  524
             FL+IGLGVICA+ +HLLGKCL K PKS+ Y DIGQ AFGTKG++LAA+FIYLEIFMALVS
Sbjct  105   FLMIGLGVICAYCSHLLGKCLDKHPKSRSYTDIGQNAFGTKGKLLAATFIYLEIFMALVS  164

Query  525   YTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGIL  704
             YTISLHDN+  VF GT +++   +LS SQLLT+ AVLVALPSLW RDLSSISFLS  G+L
Sbjct  165   YTISLHDNINRVFSGTQVQIPWAKLSRSQLLTLAAVLVALPSLWLRDLSSISFLSFGGVL  224

Query  705   MSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPS  884
             MSL IF +VACT +FG V  NH IP L + NIP++SGLY FSYAGHIVFPN+Y AMKDPS
Sbjct  225   MSLAIFASVACTGIFGGVKANHIIPVLQIQNIPAISGLYIFSYAGHIVFPNLYKAMKDPS  284

Query  885   KFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMT  1064
             KFTKVSI+SFS+VT+LY+ LAFMGAK++GP V+ QITLSMP H++ TK+ALWATVLTPMT
Sbjct  285   KFTKVSIISFSLVTLLYSTLAFMGAKLYGPHVNPQITLSMPPHLIVTKIALWATVLTPMT  344

Query  1065  KYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGS  1244
             KYALEFAP AI+++H+LP  M    K I+RG  GS L+L+ILALAL VPYFE+VLSLTGS
Sbjct  345   KYALEFAPMAIQVEHNLPDYMSSRTKLIVRGTVGSFLLLVILALALSVPYFEYVLSLTGS  404

Query  1245  LVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRA  1424
             LVSI I ++ PC FY KI W +ISRPLL+ N  LI FG +L + GT+SS KLL+ +L RA
Sbjct  405   LVSIAICVIFPCAFYLKICWSQISRPLLVLNFTLIAFGFVLGLFGTISSSKLLMQNLSRA  464

Query  1425  H  1427
             H
Sbjct  465   H  465



>ref|XP_008356120.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Malus domestica]
Length=470

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/426 (67%), Positives = 340/426 (80%), Gaps = 6/426 (1%)
 Frame = +3

Query  171   FEDQTAVKDLESSEECV------EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGG  332
              E+    K  +  E C       E   + N+S  H+VINM GMLIGLGQLSTPYALE GG
Sbjct  44    LEENKVCKCDQCFESCKRVAGADEHHAEANNSVTHSVINMTGMLIGLGQLSTPYALETGG  103

Query  333   WISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFM  512
             W SAFLLIGLG+ICA+ +HLLGKCL K PKS+ Y DIG  AFG+KG+ILAA FIY+EIFM
Sbjct  104   WSSAFLLIGLGIICAYCSHLLGKCLDKHPKSRTYTDIGYNAFGSKGKILAAYFIYMEIFM  163

Query  513   ALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSS  692
             ALVSYTISLHDNLATVF G  LK++  +L  SQLLT +A+LVALPSLW RDLSSISFLS 
Sbjct  164   ALVSYTISLHDNLATVFPGIQLKVSWAKLPKSQLLTFIAILVALPSLWLRDLSSISFLSF  223

Query  693   AGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAM  872
              G+LMSL+IF++VACTA+FG V  NH IP L + NIP++SGL  FS+AGHIVFPN+Y AM
Sbjct  224   GGVLMSLVIFISVACTAIFGGVKSNHTIPALQIHNIPAISGLCIFSFAGHIVFPNLYKAM  283

Query  873   KDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVL  1052
             KDPSKFTKVSI+SF++VT+LYT+LAFMGAK+FGP V+ QITLSMP H++ TK+ALWATVL
Sbjct  284   KDPSKFTKVSIISFTLVTMLYTSLAFMGAKLFGPQVNPQITLSMPPHLIVTKIALWATVL  343

Query  1053  TPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
             TPMTKYALEFAP AI+L+H+LP S+    K +IRG  GS+L+L+IL LAL VPYFE+VLS
Sbjct  344   TPMTKYALEFAPMAIQLEHNLPQSLSSRTKLLIRGSIGSVLLLLILVLALSVPYFEYVLS  403

Query  1233  LTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVIS  1412
             LTGSLVSIGI ++ PC FY KI W +ISRPLL+ N+ LI FG LL   GT+SS KLL+I 
Sbjct  404   LTGSLVSIGICVIFPCAFYLKICWGQISRPLLVLNLTLIAFGPLLGTVGTISSSKLLLIH  463

Query  1413  LQRAHS  1430
             L RAHS
Sbjct  464   LSRAHS  469



>ref|XP_009347361.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Pyrus x bretschneideri]
Length=470

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/426 (68%), Positives = 341/426 (80%), Gaps = 6/426 (1%)
 Frame = +3

Query  171   FEDQTAVKDLESSEECV------EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGG  332
              E+    K  +S E C       E   + N+S  H+VINM GMLIGLGQLSTPYALE GG
Sbjct  44    LEENKVCKCDQSFESCKRVAGADEHHAEANNSVTHSVINMTGMLIGLGQLSTPYALETGG  103

Query  333   WISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFM  512
             W S FLLIGLG+I A+ +HLLGKCL K PKS+ Y DIG  AFG+KG+ILAASFIY+EIFM
Sbjct  104   WPSVFLLIGLGIISAYCSHLLGKCLDKHPKSRTYTDIGHNAFGSKGKILAASFIYMEIFM  163

Query  513   ALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSS  692
             ALVSYTISLHDNLATVFLG  LK++  +L  SQLLT +AVLVALPSLW RDLSSISFLS 
Sbjct  164   ALVSYTISLHDNLATVFLGIQLKVSWAKLPKSQLLTFIAVLVALPSLWLRDLSSISFLSF  223

Query  693   AGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAM  872
              G+LMSL+IF++VACTA+FG V  NH IP L   NIP++SGLY FS+AGHIVFPN+Y AM
Sbjct  224   GGVLMSLVIFISVACTAIFGGVKLNHTIPALQNHNIPAISGLYIFSFAGHIVFPNLYKAM  283

Query  873   KDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVL  1052
             KDPSKFTKVSI+SF++VTILYT+LAFMGAK+FGP V+ QITLSMP H++ TK+ALWATVL
Sbjct  284   KDPSKFTKVSIISFTLVTILYTSLAFMGAKLFGPQVNPQITLSMPPHLIVTKIALWATVL  343

Query  1053  TPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
             TPMTKYALEFAP AI+L+H+LP S     K +IRG  GS+L+L+IL LAL VPYFE+VLS
Sbjct  344   TPMTKYALEFAPMAIQLEHNLPQSFSSRTKLLIRGSVGSVLLLLILVLALSVPYFEYVLS  403

Query  1233  LTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVIS  1412
             LTGSLVS GI ++ PC FY KI W +ISRPLL+ N+ LI FGTLL + GT+SS KLL+ +
Sbjct  404   LTGSLVSTGICVIFPCAFYLKICWGQISRPLLVLNLTLIAFGTLLGIVGTISSSKLLLKN  463

Query  1413  LQRAHS  1430
             L RAHS
Sbjct  464   LSRAHS  469



>ref|XP_009347363.1| PREDICTED: vacuolar amino acid transporter 1-like [Pyrus x bretschneideri]
Length=470

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/435 (68%), Positives = 349/435 (80%), Gaps = 8/435 (2%)
 Frame = +3

Query  126   CPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLS  305
             C +G+K  +    + FE   + K +  ++E    AE NNS   H+VINM GMLIGLGQLS
Sbjct  43    CLEGNKVCK--CDQSFE---SCKRVAGADE--HHAEANNS-VTHSVINMTGMLIGLGQLS  94

Query  306   TPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAA  485
             TPYALE GGW S FLLIGLG+I A+ +HLLGKCL K PKS+ Y DIG  AFG+KG+ILAA
Sbjct  95    TPYALETGGWPSVFLLIGLGIISAYCSHLLGKCLDKHPKSRTYTDIGHNAFGSKGKILAA  154

Query  486   SFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRD  665
             SFIY+EIFMALVSYTISLHDNLATVFLG  LK++  +L  SQLLT +AVLVALPSLW RD
Sbjct  155   SFIYMEIFMALVSYTISLHDNLATVFLGIQLKVSWAKLPKSQLLTFIAVLVALPSLWLRD  214

Query  666   LSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHI  845
             LSSISFLS  G+LMSL+IF++VACTA+FG V  NH IP L   NIP++SGLY FS+AGHI
Sbjct  215   LSSISFLSFGGVLMSLVIFISVACTAIFGGVKLNHTIPALQNHNIPAISGLYIFSFAGHI  274

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPN+Y AMKDPSKFTKVSI+SF++VTILYT+LAFMGAK+FGP V+ QITLSMP H++ T
Sbjct  275   VFPNLYKAMKDPSKFTKVSIISFTLVTILYTSLAFMGAKLFGPQVNPQITLSMPPHLIVT  334

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalC  1205
             K+ALWATVLTPMTKYALEFAP AI+L+H+LP S     K +IRG  GS+L+L+IL LAL 
Sbjct  335   KIALWATVLTPMTKYALEFAPMAIQLEHNLPQSFSSRTKLLIRGSVGSVLLLLILVLALS  394

Query  1206  VPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTV  1385
             VPYFE+VLSLTGSLVS GI ++ PC FY KI W +ISRPLL+ N+ LI FGTLL + GT+
Sbjct  395   VPYFEYVLSLTGSLVSTGICVIFPCAFYLKICWGQISRPLLVLNLTLIAFGTLLGIVGTI  454

Query  1386  SSFKLLVISLQRAHS  1430
             SS KLL+ +L RAHS
Sbjct  455   SSSKLLLKNLSRAHS  469



>ref|XP_010069373.1| PREDICTED: vacuolar amino acid transporter 1-like [Eucalyptus 
grandis]
 gb|KCW57696.1| hypothetical protein EUGRSUZ_H00460 [Eucalyptus grandis]
Length=474

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/425 (67%), Positives = 342/425 (80%), Gaps = 7/425 (2%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLI  287
             I C SC    +K        R E    + +L+  +   E+    NSSF HAVINM+GMLI
Sbjct  40    IGCESCVEGENKVC------RCECDGGMAELKL-QAVEEENTGANSSFAHAVINMVGMLI  92

Query  288   GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTK  467
             GLGQLSTPYALE GGW SAFLLIGLG++CA+T+HLLGKCL K PKS+ Y DIGQ+A+G+K
Sbjct  93    GLGQLSTPYALENGGWSSAFLLIGLGMVCAYTSHLLGKCLDKSPKSRSYTDIGQEAYGSK  152

Query  468   GRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALP  647
             GRI+AA+FIYLEIF+ALVSYTISLHDNL+ VF GT +      +S+ QLLTV+AVL+ALP
Sbjct  153   GRIIAATFIYLEIFLALVSYTISLHDNLSIVFPGTWISARWTHMSSPQLLTVIAVLIALP  212

Query  648   SLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAF  827
             SLW RDLSSISFLSS GILMS++IF +VA TA+FG V  ++ IP L + NIP +SGLY F
Sbjct  213   SLWLRDLSSISFLSSGGILMSIIIFASVALTAIFGWVRSDNEIPALRIRNIPMISGLYVF  272

Query  828   SYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMP  1007
             S+AGHIVFP++Y +MKDPSKFTKVSIVSF++VT LYTALAFMGAKMFGPGVSSQITLS+P
Sbjct  273   SFAGHIVFPDLYKSMKDPSKFTKVSIVSFTLVTALYTALAFMGAKMFGPGVSSQITLSLP  332

Query  1008  RHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililii  1187
             RH+V TKVA WATVLTP+TKYALEFAPFAI+LD SLP SM   ++T++RG  GS+L+++I
Sbjct  333   RHLVVTKVAQWATVLTPITKYALEFAPFAIQLDRSLPGSMSSCMRTVVRGTVGSMLLVVI  392

Query  1188  lalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLL  1367
             LALAL VPYFE+VLSLTGSLVSI I ++LPCGFYTKI WP +S+PL + N +LI  G +L
Sbjct  393   LALALSVPYFEYVLSLTGSLVSICICVILPCGFYTKICWPSLSKPLFLLNALLIGIGCVL  452

Query  1368  AVSGT  1382
              V GT
Sbjct  453   GVFGT  457



>ref|XP_006493517.1| PREDICTED: vacuolar amino acid transporter 1-like [Citrus sinensis]
Length=459

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/423 (69%), Positives = 341/423 (81%), Gaps = 4/423 (1%)
 Frame = +3

Query  174   EDQTAVKDLESSEECVEQAEKNN---SSFMHAVINMIGMLIGLGQLSTPYALEKGGWISA  344
             E+ +A K   ++E+ ++ +E N+   SSF HAVINM GMLIGLGQLSTPYA+E GGW SA
Sbjct  35    EECSACKRDHTTEK-LDISENNSHAGSSFAHAVINMAGMLIGLGQLSTPYAIENGGWASA  93

Query  345   FLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVS  524
             FLLIGLGVICA++ HLLGKCL K+PKS+ Y DIGQ AFG KGR  AA+FIYLEIFMALVS
Sbjct  94    FLLIGLGVICAYSAHLLGKCLDKNPKSRSYIDIGQHAFGRKGRAAAATFIYLEIFMALVS  153

Query  525   YTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGIL  704
             YTI LHDNL TVF GT L L+  +LSTSQ+LTV+AVL+ALPSLW RDLSSISFLS  GIL
Sbjct  154   YTILLHDNLITVFSGTSLDLSWAKLSTSQMLTVIAVLIALPSLWLRDLSSISFLSVGGIL  213

Query  705   MSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPS  884
             MS+LIF++VA TA+FG V  NHRIP L+L  IP +SGLY FSYAGHIVFPN+Y AMKDPS
Sbjct  214   MSVLIFLSVAFTAIFGGVKANHRIPVLNLHKIPHISGLYIFSYAGHIVFPNLYKAMKDPS  273

Query  885   KFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMT  1064
             KFTKVSIVSF++VT L TAL FMG K+FGPGV+SQITLSMP+H+V TK+ALWATVLTPMT
Sbjct  274   KFTKVSIVSFTLVTALNTALGFMGTKLFGPGVNSQITLSMPQHLVVTKIALWATVLTPMT  333

Query  1065  KYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGS  1244
             KYALEFAP AI+L++ LP S+    K +IR   GS+L++IIL LAL +PYF++VLSLTGS
Sbjct  334   KYALEFAPLAIQLENHLPISLSARSKMMIRSSVGSLLLIIILTLALSLPYFQYVLSLTGS  393

Query  1245  LVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRA  1424
             LVSI I ++ PC FY KI WP IS+ LLI NV LI FG LL  SGT  S K L+ +LQ A
Sbjct  394   LVSICICLIFPCAFYIKISWPHISQRLLILNVTLIGFGFLLGFSGTTFSLKSLIHTLQDA  453

Query  1425  HST  1433
             H T
Sbjct  454   HGT  456



>ref|XP_008337527.1| PREDICTED: vacuolar amino acid transporter 1 [Malus domestica]
Length=468

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/452 (64%), Positives = 355/452 (79%), Gaps = 14/452 (3%)
 Frame = +3

Query  117   SSCCPDGHKHVEPASGER--------FEDQ---TAVKDLESSEEC---VEQAEKNNSSFM  254
             S+C P  ++ +   +G+R         E+    T  +  ES +     VE   + N+S  
Sbjct  13    SNCLPHQNQVLVSDAGQRANLSCNVCLEENKVCTCDQGFESGKRVTGVVEHHAEANNSVT  72

Query  255   HAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDY  434
              +VINM GMLIGLGQLSTPYALE GGW SAFLLIGLGVICA+ +HLLGKCL K PKS+ Y
Sbjct  73    QSVINMSGMLIGLGQLSTPYALENGGWSSAFLLIGLGVICAYCSHLLGKCLDKHPKSRSY  132

Query  435   KDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQL  614
              DIG  AFG++G+ILAASF+Y+EIFMALVSYTISLHDNLA VF G  L ++  +L  SQL
Sbjct  133   TDIGHNAFGSRGKILAASFVYMEIFMALVSYTISLHDNLARVFSGIQLNVSWAKLPKSQL  192

Query  615   LTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLP  794
             LT++AV VALPSLW RDLSSISFLS  G++MSL+IF++VACTA+FG V  NH IP L + 
Sbjct  193   LTLIAVFVALPSLWLRDLSSISFLSFGGVIMSLVIFISVACTAIFGGVKLNHTIPALQIH  252

Query  795   NIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGP  974
             NIP++SGLY FS+AGHIVFPN+Y AMKDPSKFTKVSI+SF++VT LYT+LAFMGAK++GP
Sbjct  253   NIPAISGLYIFSFAGHIVFPNLYKAMKDPSKFTKVSIISFTLVTTLYTSLAFMGAKLYGP  312

Query  975   GVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIR  1154
              V+ QITLSMP H++ TK+ALWATVLTPMTKYALEFAP AI+L+H+LPPS+    K +IR
Sbjct  313   QVNPQITLSMPPHLIVTKIALWATVLTPMTKYALEFAPMAIQLEHNLPPSLSSRTKFLIR  372

Query  1155  GGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIF  1334
             G  GS+L+L+ILALAL VPYF +VLSLTGSLVSIGI I+ PC FY KI W +ISRPL++ 
Sbjct  373   GSVGSVLLLVILALALSVPYFGYVLSLTGSLVSIGICIIFPCAFYLKICWGQISRPLMVL  432

Query  1335  NVVLIVFGTLLAVSGTVSSFKLLVISLQRAHS  1430
             N+ LI FGTLL ++GT+SS KLL+ SL RAHS
Sbjct  433   NLTLIAFGTLLGIAGTISSSKLLLKSLSRAHS  464



>gb|EPS70141.1| hypothetical protein M569_04618, partial [Genlisea aurea]
Length=404

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/404 (69%), Positives = 331/404 (82%), Gaps = 4/404 (1%)
 Frame = +3

Query  228   AEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCL  407
             A +  SSF+HAV+NMIGMLIGLGQLSTPYALE GGW S FLL+GLG +C +T+HLLGKCL
Sbjct  1     AVEEKSSFIHAVLNMIGMLIGLGQLSTPYALENGGWTSVFLLVGLGAVCTYTSHLLGKCL  60

Query  408   GKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLT  587
              K  KS+DYKDIGQ AFG +G+I AA+F+Y+EIFM+LVSYTISLHDNLA VF G  L+L 
Sbjct  61    SKHSKSRDYKDIGQNAFGARGKITAATFVYMEIFMSLVSYTISLHDNLAVVFRGARLRLD  120

Query  588   GI---QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVV  758
              +    LS+SQ+L+ +AVLVALPSLW R+LSSISFLS+AGILMS+LIFVTVACTA+FG V
Sbjct  121   WLPWAHLSSSQMLSTVAVLVALPSLWLRNLSSISFLSTAGILMSILIFVTVACTAIFGAV  180

Query  759   NPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKV-SIVSFSVVTILY  935
               NHRIP L+L  IP++SGLY F YAGHIVFPNIY AMKDP+KFTKV SI+SFS+VT  Y
Sbjct  181   QANHRIPVLNLRAIPAISGLYMFGYAGHIVFPNIYAAMKDPAKFTKVVSIISFSIVTSWY  240

Query  936   TALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSL  1115
              ALAF GAK+FGP V SQITLSMP++++ TK+ALWATVLTPMTKYALEFAPFAIEL+  L
Sbjct  241   AALAFTGAKLFGPEVDSQITLSMPQNLLLTKIALWATVLTPMTKYALEFAPFAIELERGL  300

Query  1116  PPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTK  1295
             P S++   K +IRG  GSIL+L+ILALAL VPYFEHVLSLTGS+VS+GISIV+PC FY K
Sbjct  301   PHSLRTRTKILIRGTIGSILLLVILALALSVPYFEHVLSLTGSMVSVGISIVIPCIFYIK  360

Query  1296  IFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAH  1427
             I+W +IS P+L  N V+   G ++   GTVSS + L+ S +  H
Sbjct  361   IYWTEISTPVLALNAVIAATGVVMGAFGTVSSARSLLNSFKTTH  404



>ref|XP_002302894.2| hypothetical protein POPTR_0002s23430g [Populus trichocarpa]
 gb|EEE82167.2| hypothetical protein POPTR_0002s23430g [Populus trichocarpa]
Length=435

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/418 (67%), Positives = 334/418 (80%), Gaps = 3/418 (1%)
 Frame = +3

Query  186   AVKDLES--SEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIG  359
             + +DL+S  +E  VE   + NSSF H+VINMIGMLIGLGQLS PYALE GGW SAFLL+G
Sbjct  17    STQDLKSVVNEADVEDHTEANSSFAHSVINMIGMLIGLGQLSAPYALENGGWASAFLLVG  76

Query  360   LGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISL  539
             +GVICA+T+ LLGKCL K P S+ Y DIGQ AFG++GR+LA++FI +EIFM LVSYTISL
Sbjct  77    IGVICAYTSLLLGKCLEKSPSSRSYADIGQHAFGSRGRLLASTFINVEIFMTLVSYTISL  136

Query  540   HDNLATVFLGTHLKL-TGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLL  716
             HDNL TVF GT L+L    +LSTSQLLT++ VL+ALPS+W  DLSSISFLSS GILMS++
Sbjct  137   HDNLITVFAGTQLRLLIWTKLSTSQLLTMIGVLIALPSMWMTDLSSISFLSSGGILMSII  196

Query  717   IFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTK  896
             IF +VAC A+F VV  NH IP LHL  IP++SGLY F YAGHIVFPN+Y +MKDPSKFTK
Sbjct  197   IFTSVACIAIFQVVKANHSIPALHLHKIPAISGLYIFCYAGHIVFPNLYKSMKDPSKFTK  256

Query  897   VSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYAL  1076
             VSIVSF+ V  LYT+LAF GAK+FGP VSSQITLSMPRH++ TK+ALWATV+TPMTKYAL
Sbjct  257   VSIVSFASVIALYTSLAFTGAKLFGPEVSSQITLSMPRHLIITKIALWATVITPMTKYAL  316

Query  1077  EFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSI  1256
             E APF+++++HSLP S     KTIIRG  GS L+LIIL++AL VPYFEHVLSLTGSLVS 
Sbjct  317   ELAPFSVQIEHSLPGSFSSRTKTIIRGAVGSFLLLIILSIALSVPYFEHVLSLTGSLVSF  376

Query  1257  GISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAHS  1430
              I IV PC FY KI   ++S+  LI N  L+ FG LL V+GT+SS K +  SL+R HS
Sbjct  377   SICIVFPCAFYIKISSAQLSKFSLILNATLLAFGLLLGVAGTISSSKSIFTSLKRDHS  434



>ref|XP_006663371.1| PREDICTED: vacuolar amino acid transporter 1-like [Oryza brachyantha]
Length=446

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/442 (64%), Positives = 333/442 (75%), Gaps = 6/442 (1%)
 Frame = +3

Query  114   CSSCCPDGHKHVEPASGERFEDQTAVKDLESSEECV---EQAEKNNSSFMHAVINMIGML  284
             C S C    K  + AS      Q A++ L ++  C        K  SSF H+VINM+GML
Sbjct  7     CWSLCA---KPKQVASESVHGAQLALQRLTAARRCGGSHHHHGKPTSSFAHSVINMVGML  63

Query  285   IGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGT  464
             IGLGQLSTPYALE GGW S FLL+GLGV+CA+T H++GKCL  DP SK Y+DIG++AFG 
Sbjct  64    IGLGQLSTPYALENGGWASVFLLVGLGVMCAYTAHIIGKCLDDDPSSKTYQDIGERAFGG  123

Query  465   KGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVAL  644
             KGR+LA++FIYLEIF ALVSYTISL DNL  VF G  L L    L+T+QLLTV AVLVAL
Sbjct  124   KGRVLASAFIYLEIFFALVSYTISLSDNLPLVFAGARLHLPWAHLTTTQLLTVAAVLVAL  183

Query  645   PSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYA  824
             PSLW RDLS+ISFLS AGI+MSLLIFVTV C A FG V     IP L L  IP+VSGLY 
Sbjct  184   PSLWLRDLSTISFLSFAGIVMSLLIFVTVVCVAAFGGVGLGGHIPALRLERIPAVSGLYM  243

Query  825   FSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSM  1004
             FSYAGHIVFPNIY AMKDPS FTKVS+ SF+VVT LYTALAF+GA +FGP VSSQITLSM
Sbjct  244   FSYAGHIVFPNIYAAMKDPSAFTKVSVASFAVVTALYTALAFVGASLFGPAVSSQITLSM  303

Query  1005  PRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSilili  1184
             P  +  T++ALWATVLTP+TKYALEFAPFAI+L+H LPP+M    +T++RGG GS  +L+
Sbjct  304   PPRLAVTRIALWATVLTPVTKYALEFAPFAIQLEHHLPPTMSPRARTLVRGGVGSAALLL  363

Query  1185  ilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTL  1364
             ILALAL VPYF++VLSLTGSLVS+ IS++ PC FY KI W ++SR  +  N  +I  G +
Sbjct  364   ILALALSVPYFQYVLSLTGSLVSVAISVIFPCAFYLKIRWGRVSRSAVALNAAMIAGGVV  423

Query  1365  LAVSGTVSSFKLLVISLQRAHS  1430
             LAV GT SS K LV S+QR H+
Sbjct  424   LAVVGTASSAKSLVQSIQRGHA  445



>ref|XP_011042765.1| PREDICTED: vacuolar amino acid transporter 1-like [Populus euphratica]
Length=479

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/462 (62%), Positives = 348/462 (75%), Gaps = 27/462 (6%)
 Frame = +3

Query  126   CPDG----HKHVEPAS----GERFEDQ----------------TAVKDLES--SEECVEQ  227
             CP+     H++++P +    GE+   Q                 + +DL+S  +E  VE 
Sbjct  14    CPEADSLHHQNIQPETETVHGEKLALQWVGCDACVDNNGCMCDHSTQDLKSVVNEADVED  73

Query  228   AEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCL  407
               + NSSF H+V+NMIGMLIGLGQLS+PYALE GGW SAFLL+G+GVICA+T+HLL KCL
Sbjct  74    HTEANSSFAHSVLNMIGMLIGLGQLSSPYALESGGWASAFLLVGIGVICAYTSHLLVKCL  133

Query  408   GKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL-  584
              K P+S+ Y DIGQ AFG++GR+LA++FI +EIFM LVSYTISLHDNL TVF GT L+L 
Sbjct  134   EKSPRSRSYVDIGQHAFGSRGRLLASTFIDVEIFMTLVSYTISLHDNLITVFAGTQLRLP  193

Query  585   TGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNP  764
                +LSTSQLLT++ VL+ALPSLW  DLSSISFLSS GILMS++IF +VA  A+F VV  
Sbjct  194   IWTKLSTSQLLTMIGVLIALPSLWLTDLSSISFLSSGGILMSIVIFTSVAYIAIFQVVKA  253

Query  765   NHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTAL  944
             NH IP LHL  IP+VSGLY FSYAGHIVFPN+Y +MKDPSKFTKVSIVSF+ V  LYT+L
Sbjct  254   NHSIPVLHLHKIPAVSGLYIFSYAGHIVFPNLYKSMKDPSKFTKVSIVSFASVIALYTSL  313

Query  945   AFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS  1124
             AF GAK+FGP VSSQITLSMPRH++ TK+ALWAT +TPMTKYAL+FAPF+++++HSLP S
Sbjct  314   AFTGAKLFGPEVSSQITLSMPRHLIITKIALWATAITPMTKYALQFAPFSVQMEHSLPGS  373

Query  1125  MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFW  1304
                  K IIRG  GS L+LIIL +AL VPYFEHVLSLTGSLVS  I IV PC FY KI  
Sbjct  374   FSSRTKRIIRGAVGSFLLLIILTIALSVPYFEHVLSLTGSLVSFSICIVFPCAFYIKISS  433

Query  1305  PKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAHS  1430
              ++S+  LI N  LI FG LL V+GT+SS K +  SL+R HS
Sbjct  434   AQLSKFSLILNATLIAFGLLLGVAGTISSSKSIFTSLKRDHS  475



>ref|XP_010930156.1| PREDICTED: vacuolar amino acid transporter 1-like [Elaeis guineensis]
Length=468

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/421 (68%), Positives = 340/421 (81%), Gaps = 5/421 (1%)
 Frame = +3

Query  174   EDQTAVKDLESSEECVEQAE---KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISA  344
             E+    K  E SE    ++E   K +SSF H+VINM+GMLIGLGQLSTPYALE GGW SA
Sbjct  50    EENNVCKCREESEVLSFRSELHTKADSSFAHSVINMVGMLIGLGQLSTPYALENGGWTSA  109

Query  345   FLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVS  524
             FLL+GLG++CA+T+H++GKCL +D  +K Y+DIG+QAFGTKGRI+ ++FIYLEIF+ALVS
Sbjct  110   FLLVGLGILCAYTSHIIGKCLEEDASTKSYQDIGEQAFGTKGRIITSTFIYLEIFLALVS  169

Query  525   YTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGIL  704
             YTISL DNL     G HL  + + LST+QLLT++AVLVALPSLW RDLSSISFLS AGIL
Sbjct  170   YTISLSDNLPLALRGVHL--SWLHLSTAQLLTIIAVLVALPSLWLRDLSSISFLSFAGIL  227

Query  705   MSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPS  884
             MSLLIF TV  TA FG V  N RIP L L  IP +SGLY FSY+GHIVFPNI+TAMKDPS
Sbjct  228   MSLLIFTTVGWTAAFGGVEGNQRIPILQLRKIPGISGLYVFSYSGHIVFPNIHTAMKDPS  287

Query  885   KFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMT  1064
             KFTKV++ SF+VVT +YTALAFMGAK+FGP V+SQITLSMP H+V TK+ALWATVLTPMT
Sbjct  288   KFTKVTVTSFTVVTGIYTALAFMGAKLFGPTVNSQITLSMPHHLVVTKIALWATVLTPMT  347

Query  1065  KYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGS  1244
             KYALEFAPFAI+L+H LP S+   ++ +IRG  GSIL+L+ILALAL VPYFEHVLSLTGS
Sbjct  348   KYALEFAPFAIQLEHHLPSSVSSRVRMLIRGSIGSILLLVILALALSVPYFEHVLSLTGS  407

Query  1245  LVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRA  1424
             LVS  IS+V PC FY KI WPK+S+P L+ N VLIV GTL  V GT+SSF  L+ S+Q+ 
Sbjct  408   LVSTTISVVFPCAFYLKICWPKVSKPTLLLNGVLIVIGTLFGVVGTISSFMSLLQSIQKD  467

Query  1425  H  1427
             H
Sbjct  468   H  468



>ref|XP_003601747.1| Amino acid transporter [Medicago truncatula]
 gb|AES71998.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=476

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/446 (63%), Positives = 341/446 (76%), Gaps = 5/446 (1%)
 Frame = +3

Query  108   IECSSC--CPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGM  281
             ++ ++C  C + ++H         ED+      E     VE     +SSF HAVINM+GM
Sbjct  32    VQLANCNVCVEENRHCN-CDHTIAEDRNNTTTAEGVNVDVEHDSNADSSFAHAVINMVGM  90

Query  282   LIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFG  461
             LIGLGQLSTPYA+EKGGW S  LL+GLGVICA+T+H+LGKCL K+PK   Y DIG QAFG
Sbjct  91    LIGLGQLSTPYAVEKGGWASTLLLVGLGVICAYTSHILGKCLEKNPKLTSYVDIGNQAFG  150

Query  462   TKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVA  641
             +KGR L A+FIY+EIFM+LVSYTISLHDNL  VFLGTHLKL    LSTSQLLT++AVL+A
Sbjct  151   SKGRFLVATFIYMEIFMSLVSYTISLHDNLIIVFLGTHLKLKLAILSTSQLLTLVAVLIA  210

Query  642   LPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFG--VVNPNHRIPPLHLPNIPSVSG  815
             LPSLW RDLSSISFLSS GILMSLLIFV V+ TA+FG    N NH IP   L NIPS+SG
Sbjct  211   LPSLWIRDLSSISFLSSLGILMSLLIFVCVSVTAIFGGFQANNNHSIPVFKLHNIPSISG  270

Query  816   LYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQIT  995
             LY F Y GH+VFP++Y +MKDPSKFTKVSIVSF++VT LYT++ FMGAKMFG  V SQIT
Sbjct  271   LYVFGYGGHVVFPDLYKSMKDPSKFTKVSIVSFTIVTALYTSMGFMGAKMFGNDVKSQIT  330

Query  996   LSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSil  1175
             L+MP + + TK+ALWATVLTPMTKYALEF+PF+I+L+ +LP SM    K +IRG   S L
Sbjct  331   LNMPPNQIITKIALWATVLTPMTKYALEFSPFSIQLEQTLPNSMSGRTKLVIRGCVASFL  390

Query  1176  iliilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVF  1355
             +L IL LAL VPYFE+VLSLTGSLVS+ I ++ PC FY KIFW KI+RPLL+ N+ L++F
Sbjct  391   LLTILTLALSVPYFEYVLSLTGSLVSVAICLIFPCVFYMKIFWGKITRPLLVLNITLVIF  450

Query  1356  GTLLAVSGTVSSFKLLVISLQRAHST  1433
             G LL V GT+SS +L++  +   HST
Sbjct  451   GVLLGVIGTISSTELILRKIMSHHST  476



>ref|XP_004502272.1| PREDICTED: vacuolar amino acid transporter 1-like [Cicer arietinum]
Length=471

 Score =   527 bits (1358),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 274/445 (62%), Positives = 334/445 (75%), Gaps = 8/445 (2%)
 Frame = +3

Query  111   ECSSCCPDGHKHVEPASGERF--EDQTAVKDLESSEECVEQAEKN-NSSFMHAVINMIGM  281
              C+ C  +  +     +G+    ED+      E S     + + N + SF+HAVINM+GM
Sbjct  31    NCNVCIEENKQ----CNGDHIIVEDRNNTNTTEDSANIDTKHDANADCSFVHAVINMVGM  86

Query  282   LIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFG  461
             LIGLGQLSTPYA+EKGGW+S  LLIGLG++C +T+H+LGKCL K+PK   Y DIG QAFG
Sbjct  87    LIGLGQLSTPYAIEKGGWLSVLLLIGLGLMCTYTSHILGKCLEKNPKLTSYVDIGNQAFG  146

Query  462   TKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVA  641
             +KGR L A+ IY++IFMALVSYTISLHDNL TVF+GT L L   +L TSQLLTV+AVL+A
Sbjct  147   SKGRYLVATLIYMDIFMALVSYTISLHDNLITVFIGTRLNLQLAKLKTSQLLTVVAVLIA  206

Query  642   LPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNP-NHRIPPLHLPNIPSVSGL  818
             LPSLW RD+SSISFLSS GI+MSLL FV V  TA+FG     NH IP     NIPS+SGL
Sbjct  207   LPSLWIRDMSSISFLSSGGIIMSLLTFVCVVATAIFGGFQASNHSIPVFKPHNIPSISGL  266

Query  819   YAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITL  998
             Y F+Y GHIVFP++Y AMKDPSKFTKVSIVSF++VT L T++ FMGAKMFG  V SQITL
Sbjct  267   YIFTYGGHIVFPDLYKAMKDPSKFTKVSIVSFTIVTALNTSMGFMGAKMFGNDVKSQITL  326

Query  999   SMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSili  1178
             SMP   + TK+A+WATVLTPMTKYALEFAPFAI+L+H+LP S     K +IRG   S+L+
Sbjct  327   SMPPKKIITKIAVWATVLTPMTKYALEFAPFAIQLEHALPNSFSGRTKLVIRGFVASLLL  386

Query  1179  liilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFG  1358
             L IL +AL VPYFEHVLSLTGSLVS+ I ++ PC FY KI W KI+RPLL+ N+ L++FG
Sbjct  387   LFILTVALSVPYFEHVLSLTGSLVSVAICLIFPCVFYMKICWGKITRPLLVLNIFLVIFG  446

Query  1359  TLLAVSGTVSSFKLLVISLQRAHST  1433
              LL V GT+SS KL++ +    HST
Sbjct  447   FLLGVMGTISSTKLILENFLSHHST  471



>ref|XP_003552778.2| PREDICTED: vacuolar amino acid transporter 1-like [Glycine max]
Length=452

 Score =   526 bits (1355),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 284/438 (65%), Positives = 337/438 (77%), Gaps = 16/438 (4%)
 Frame = +3

Query  111   ECSSCCPDGH-KHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLI  287
              C  C  + +  H+  A G    D              ++    NSSF HAVINM+GMLI
Sbjct  21    NCKCCIEESNCDHINAAEGASNVD-------------AQRDANANSSFTHAVINMVGMLI  67

Query  288   GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTK  467
             GLGQLSTPYA+E GGW SAFLL+GLG++CA+++H+LG CL K+PK   + DIG+ AFG+K
Sbjct  68    GLGQLSTPYAVENGGWSSAFLLMGLGMMCAYSSHILGICLRKNPKLTSFVDIGKHAFGSK  127

Query  468   GRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALP  647
             GR +AA+ IY+EIFMALVSYTISLHDNL TVFLGT+L L     S+SQLLTV+AVL+A+P
Sbjct  128   GRNVAATIIYMEIFMALVSYTISLHDNLTTVFLGTNLNLHLPNFSSSQLLTVVAVLIAMP  187

Query  648   SLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAF  827
             SLW RDLSSISFLSS GILMSLLIF+ VA TA+ G V  NH IP LHL NIPSVSGLY F
Sbjct  188   SLWIRDLSSISFLSSVGILMSLLIFLCVAATALLGYVQSNHTIPVLHLHNIPSVSGLYVF  247

Query  828   SYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSM-  1004
              Y GHIVFP +YTAMKDPSKFTKVSIVSF+VVT +YT L FMGAKMFG  V SQITLSM 
Sbjct  248   GYGGHIVFPELYTAMKDPSKFTKVSIVSFAVVTAIYTTLGFMGAKMFGKDVKSQITLSMA  307

Query  1005  PRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSilili  1184
             P H+V TK+ALWATV+ PMTKYALEF PFAI+L+H+LP SM    KTIIRG  GS  +L+
Sbjct  308   PEHIV-TKIALWATVVAPMTKYALEFTPFAIQLEHALPSSMSARTKTIIRGCIGSFSLLV  366

Query  1185  ilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTL  1364
             IL LAL VPYFEHVLSLTGSLVS+ + ++LPC FY KI W +IS+PLL+ N+ LI+FG +
Sbjct  367   ILTLALSVPYFEHVLSLTGSLVSVAVCLILPCAFYVKICWGQISKPLLLLNLFLIIFGFV  426

Query  1365  LAVSGTVSSFKLLVISLQ  1418
             LAV GT+SS +LL+ +LQ
Sbjct  427   LAVMGTISSSQLLLKNLQ  444



>ref|XP_011008184.1| PREDICTED: vacuolar amino acid transporter 1-like [Populus euphratica]
Length=439

 Score =   525 bits (1353),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 276/403 (68%), Positives = 323/403 (80%), Gaps = 14/403 (3%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLES---SEECVEQ-AEKNNSSFMHAVINMI  275
             + C +C       VE   G + +  T  +DL+S   +E  VE   ++ NSSF H+VINMI
Sbjct  13    MTCDAC-------VEENKGCKCDQDT--QDLKSAVVNEADVEHHTDQANSSFAHSVINMI  63

Query  276   GMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQA  455
             GMLIGLGQLSTPYALE GGW+SAFLL+GLGVICA+T+HLLGKCL K PKS+ Y DIGQ A
Sbjct  64    GMLIGLGQLSTPYALENGGWVSAFLLVGLGVICAYTSHLLGKCLAKSPKSRSYTDIGQHA  123

Query  456   FGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL-TGIQLSTSQLLTVMAV  632
             FG+ GR+LAA+FIYLEIFMALVSYTISLHDNL TVF GT L+L    +L  SQLLT M V
Sbjct  124   FGSNGRVLAATFIYLEIFMALVSYTISLHDNLITVFAGTQLRLPIWAKLYKSQLLTAMGV  183

Query  633   LVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVS  812
             LVALPSLW RDLSSISFLSS GILMS++IF +VACTA+F VV  NH IP LHL  IP++S
Sbjct  184   LVALPSLWLRDLSSISFLSSGGILMSIVIFTSVACTAIFQVVKANHSIPALHLHKIPAIS  243

Query  813   GLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQI  992
             GLY FSYAGHIVFP++Y +MKDPSKFT VSIVSF+ V+ LY +LAFMGA++FGP VSSQI
Sbjct  244   GLYIFSYAGHIVFPDLYKSMKDPSKFTMVSIVSFASVSALYASLAFMGARLFGPEVSSQI  303

Query  993   TLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSi  1172
             TLSMPRH + TK+ALWATVLTPMTKYALEFAPFAI+L+H+LP S+    KT+IRG  GS 
Sbjct  304   TLSMPRHHIITKIALWATVLTPMTKYALEFAPFAIQLEHNLPNSISSRTKTVIRGAVGSF  363

Query  1173  liliilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
             L+L+ILALAL VPYFEHVLSLTGSLVS+ I IV PC F+  ++
Sbjct  364   LLLVILALALSVPYFEHVLSLTGSLVSVSICIVFPCAFFCVMY  406



>gb|EMT08536.1| hypothetical protein F775_14209 [Aegilops tauschii]
Length=467

 Score =   523 bits (1348),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 274/460 (60%), Positives = 337/460 (73%), Gaps = 22/460 (5%)
 Frame = +3

Query  114   CSSCCPDGHKHV-EPASGERFEDQTAVK-----DLESSEECVEQA---------------  230
             C   CP   +   E   G R   Q   +     D+E+ + C E                 
Sbjct  6     CELVCPQPKQVASESMHGARLAAQQLSRGRDACDVEAGKPCQEADGGGRVEAVAVTTQQH  65

Query  231   -EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCL  407
               K  S+F  +VINM+GMLIGLGQLSTPYALE GGW S FLL+GLG++CA+T +++G+CL
Sbjct  66    HSKPTSTFAQSVINMVGMLIGLGQLSTPYALENGGWASIFLLVGLGIMCAYTANIIGRCL  125

Query  408   GKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLT  587
              ++P SK Y+DIGQQAFG+KGR++A++FIYLEIF ALVSYTISL DN+  VF G  L L 
Sbjct  126   DEEPSSKTYQDIGQQAFGSKGRLIASAFIYLEIFFALVSYTISLSDNIPLVFAGVRLHLP  185

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
              ++LST+QLLTV+AVLVALPSLW R+LSSISFLS AGILMS++IFVT+ CTA F  V   
Sbjct  186   WLRLSTTQLLTVIAVLVALPSLWLRNLSSISFLSFAGILMSMVIFVTILCTAAFSNVGLG  245

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
               IP L L  IP+VSGLY FSYAGHIVFPNIYT MKDPS FTKVS+ SFS+V +LYT LA
Sbjct  246   KHIPVLRLDKIPTVSGLYMFSYAGHIVFPNIYTVMKDPSSFTKVSVTSFSMVAVLYTGLA  305

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSM  1127
             F+GA +FGP V+SQ+TLSMP  ++ TKVALWATVLTP+TKYALEFAPFAI+L+H LP +M
Sbjct  306   FVGASLFGPTVNSQVTLSMPPGLLVTKVALWATVLTPVTKYALEFAPFAIQLEHHLPATM  365

Query  1128  KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
                 + IIRG  GS  +L+ILALAL VPYF++VLSLTGSLVS+ IS++ PC FY KI W 
Sbjct  366   GPRARIIIRGSIGSAGLLLILALALSVPYFQYVLSLTGSLVSVAISVIFPCAFYLKIRWD  425

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAH  1427
             ++SRP+++ N  +I  G +LAV GT SS KLLV S+Q  H
Sbjct  426   RLSRPVVVLNAAMIAVGFVLAVVGTASSAKLLVKSIQNGH  465



>ref|NP_001132410.1| hypothetical protein [Zea mays]
 gb|ACF81238.1| unknown [Zea mays]
 tpg|DAA38851.1| TPA: hypothetical protein ZEAMMB73_211648 [Zea mays]
Length=464

 Score =   521 bits (1341),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 271/434 (62%), Positives = 328/434 (76%), Gaps = 12/434 (3%)
 Frame = +3

Query  165   ERFEDQTAVKDLESSEECV-----------EQAEKNNSSFMHAVINMIGMLIGLGQLSTP  311
             +R   +    D+E+S  C            E +   NSSF H+VINM+GMLIGLGQLSTP
Sbjct  30    QRLSRRCETCDVEASTPCSCRKEAVARDTEEDSSGPNSSFAHSVINMVGMLIGLGQLSTP  89

Query  312   YALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPK-SKDYKDIGQQAFGTKGRILAAS  488
             YALE GGW S FLLIGLGV+CA+T H++G+CL +D   SK Y+DIG++AFG KGR++A++
Sbjct  90    YALENGGWASVFLLIGLGVMCAYTAHIIGRCLDEDSAGSKTYQDIGKRAFGVKGRVIAST  149

Query  489   FIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDL  668
             F YLEIF+ALVSYTISL DNL  VF G HL L  + LS +QLLT++AVL+ALPSLW RDL
Sbjct  150   FTYLEIFLALVSYTISLSDNLPLVFAGVHLHLPWLHLSATQLLTIIAVLLALPSLWLRDL  209

Query  669   SSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIV  848
             SSISFLS AGI+MSLLIF +V C A FG V+    IP L L  IP+VSGLY FSYAGHIV
Sbjct  210   SSISFLSFAGIIMSLLIFGSVVCAAAFGRVSLGKHIPVLQLEKIPAVSGLYMFSYAGHIV  269

Query  849   FPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTK  1028
             FPNIY AMKD S FTKVS+ SF+VVT LY ALAF+G+ +FG  V+SQITLSMP H+V TK
Sbjct  270   FPNIYAAMKDTSSFTKVSVTSFAVVTALYVALAFVGSSLFGAAVNSQITLSMPPHLVVTK  329

Query  1029  VALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCV  1208
             VALWATVLTP+TKYALEFAPFAI+L H LP  M    +  +RGG GS  +L+ILALALCV
Sbjct  330   VALWATVLTPVTKYALEFAPFAIQLQHHLPEGMGPRARMFVRGGVGSAALLVILALALCV  389

Query  1209  PYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVS  1388
             PYF++VLSLTGSLVS+ IS++ PC FY KI+W ++    +  NVVLI+ G +LAV GT+S
Sbjct  390   PYFQYVLSLTGSLVSVAISVIFPCAFYLKIYWGRVPMSTVTINVVLILTGVVLAVVGTIS  449

Query  1389  SFKLLVISLQRAHS  1430
             S   LV S+QR H+
Sbjct  450   SAMSLVQSIQRGHA  463



>gb|AAX96808.1| Transmembrane amino acid transporter protein [Oryza sativa Japonica 
Group]
 gb|ABA92799.1| amino acid transporter family protein, putative [Oryza sativa 
Japonica Group]
 gb|EAY80692.1| hypothetical protein OsI_35874 [Oryza sativa Indica Group]
 gb|EAZ18147.1| hypothetical protein OsJ_33697 [Oryza sativa Japonica Group]
Length=483

 Score =   521 bits (1343),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 268/402 (67%), Positives = 318/402 (79%), Gaps = 2/402 (0%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
             K  SSF H+VINM+GMLIGLGQLSTPYALE GGW S FLL+GLGV+CA+T HL+GKCL  
Sbjct  82    KPTSSFAHSVINMVGMLIGLGQLSTPYALENGGWASVFLLVGLGVMCAYTAHLIGKCLDD  141

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLG--THLKLT  587
             DP SK Y+DIG++AFG KGR++A++FIYLEIF ALVSYTISL DNL  VF G  +HL L 
Sbjct  142   DPASKTYQDIGERAFGGKGRVVASAFIYLEIFFALVSYTISLSDNLPLVFAGAASHLHLP  201

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
              ++L+ +QLLTV AVLVALPSLW RDLS+ISFLS AGI+MSLLIF TV C A FG V   
Sbjct  202   WVRLTATQLLTVAAVLVALPSLWLRDLSTISFLSFAGIVMSLLIFGTVVCAAAFGGVGLG  261

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
               IP L L  IP+VSGLY FSYAGHIVFPNI+ AMKDPS FT+VS+ SF+VVT LYTALA
Sbjct  262   GYIPALRLERIPAVSGLYMFSYAGHIVFPNIHAAMKDPSAFTRVSVASFAVVTALYTALA  321

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSM  1127
             F+GA MFGP VSSQITLSMP  +  T++ALWATVLTP+TKYALEFAPFAI+L+  LP +M
Sbjct  322   FVGASMFGPSVSSQITLSMPPGLAVTRIALWATVLTPVTKYALEFAPFAIQLERHLPAAM  381

Query  1128  KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
                 +T++RGG GS  +L+ILALAL VPYF++VLSLTGSLVS+ ISI+ PC FY KI W 
Sbjct  382   SPRARTLVRGGVGSAALLLILALALSVPYFQYVLSLTGSLVSVAISIIFPCAFYLKIRWG  441

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAHST  1433
             ++SRP +  N  +I  G +LAV GT SS   LV S+Q+ H+ 
Sbjct  442   RVSRPAVALNAAMIAAGVVLAVVGTASSATSLVQSIQKGHAA  483



>ref|XP_010103924.1| hypothetical protein L484_012009 [Morus notabilis]
 gb|EXB97441.1| hypothetical protein L484_012009 [Morus notabilis]
Length=477

 Score =   518 bits (1334),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 276/421 (66%), Positives = 328/421 (78%), Gaps = 6/421 (1%)
 Frame = +3

Query  165   ERFEDQ--TAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWI  338
             +  +DQ   +V D+  + +   QA   NSSF HAVINMIGMLIGLGQLSTPYALE GGW 
Sbjct  58    QSADDQHLKSVTDVGHNHDGDHQA---NSSFAHAVINMIGMLIGLGQLSTPYALENGGWS  114

Query  339   SAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMAL  518
             S FLLIGLG+IC ++T LLGKCL K+  SK Y DIG QAFG KG+I+ A+FIYLEIFM L
Sbjct  115   SVFLLIGLGLICTYSTLLLGKCLDKNANSKSYTDIGHQAFGNKGKIILATFIYLEIFMTL  174

Query  519   VSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAG  698
             VSYTISLHDN+   F G  L L   +LSTSQLLT++AVLVA+PSLW R+LSSISFLS  G
Sbjct  175   VSYTISLHDNIIVAFSGVKLNLPWAKLSTSQLLTILAVLVAVPSLWLRNLSSISFLSFGG  234

Query  699   ILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKD  878
             ILMS +IF +VACTA+FG V  +H+IP L L  IP++SGLY FSYAGHIVFPN+Y  MKD
Sbjct  235   ILMSAVIFSSVACTAIFGGVKADHKIPALQLHKIPAISGLYIFSYAGHIVFPNLYVTMKD  294

Query  879   PSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTP  1058
             PSKF K +IVSF++VT LYT LAFMGAK+FGP V+ QITLSMP H + TK+ALWATVLTP
Sbjct  295   PSKFKKGTIVSFTLVTTLYTILAFMGAKLFGPQVNPQITLSMPPHFIATKIALWATVLTP  354

Query  1059  MTKYALEFAPFAIELDHS-LPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSL  1235
             MTKYALEF+P A++L+H+  P  +    KTI+RG  GS L+L+ILALAL VPYFEHVL L
Sbjct  355   MTKYALEFSPLALQLEHNYFPSKISPKTKTILRGLVGSFLLLLILALALSVPYFEHVLGL  414

Query  1236  TGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             TGSL+S G+ I+ PC  YTKI W +ISRP+L  N+VLI FG LL V GTVSS K+L+ SL
Sbjct  415   TGSLLSAGVCIIFPCALYTKICWAEISRPVLAMNLVLIGFGALLGVLGTVSSSKMLIESL  474

Query  1416  Q  1418
             +
Sbjct  475   K  475



>gb|EAY80689.1| hypothetical protein OsI_35871 [Oryza sativa Indica Group]
Length=486

 Score =   518 bits (1333),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 267/402 (66%), Positives = 317/402 (79%), Gaps = 2/402 (0%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
             K  SSF H+VINM+GMLIGLGQLSTPYALE GGW S FLL+GLGV+CA+T HL+GKCL  
Sbjct  82    KPTSSFAHSVINMVGMLIGLGQLSTPYALENGGWASVFLLVGLGVMCAYTAHLIGKCLDD  141

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLG--THLKLT  587
             DP SK Y+DIG++AFG KGR++A++FIYLEIF ALVSYTISL DNL  VF G  +HL L 
Sbjct  142   DPASKTYQDIGERAFGGKGRVVASAFIYLEIFFALVSYTISLSDNLPLVFAGAASHLHLP  201

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
              ++L+ +QLLTV AVLVALPSLW RDLS+ISFLS AGI+MSLLIF TV C A FG V   
Sbjct  202   WVRLTATQLLTVAAVLVALPSLWLRDLSTISFLSFAGIVMSLLIFGTVVCAAAFGGVGLG  261

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
               IP L L  IP+VSGLY FSYAGHIVFPNI+ AMKDPS FT+VS+ SF+VVT LYTALA
Sbjct  262   GYIPALRLERIPAVSGLYMFSYAGHIVFPNIHAAMKDPSAFTRVSVASFAVVTALYTALA  321

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSM  1127
             F+GA MFGP VSSQITLSMP  +  T++ALWATVLTP+TKYALEFAPFAI+L+  LP +M
Sbjct  322   FVGASMFGPSVSSQITLSMPPGLAVTRIALWATVLTPVTKYALEFAPFAIQLERHLPAAM  381

Query  1128  KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
                 +T++RGG GS  +L+ILALAL VPYF++VLSLTGSLVS+ ISI+ PC FY KI W 
Sbjct  382   SPRARTLVRGGVGSAALLLILALALSVPYFQYVLSLTGSLVSVAISIIFPCAFYLKIRWG  441

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAHST  1433
             ++S P +  N  +I  G +LAV GT SS   LV S+Q+ H+ 
Sbjct  442   RVSWPAVALNAAMIAAGVVLAVVGTASSATSLVQSIQKGHAA  483



>ref|XP_003524172.1| PREDICTED: vacuolar amino acid transporter 1-like [Glycine max]
Length=471

 Score =   515 bits (1327),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 277/422 (66%), Positives = 328/422 (78%), Gaps = 4/422 (1%)
 Frame = +3

Query  177   DQTAVKDLESSEECV----EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISA  344
             D   ++D +S+E       E   + N SF HAVINM+GMLIGLGQLSTPYALE+GGW SA
Sbjct  49    DHNNIEDTKSAEGGTNLDAEHDSEANCSFTHAVINMVGMLIGLGQLSTPYALEQGGWTSA  108

Query  345   FLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVS  524
             FLLIGLGVICA+++HLLGKCL K+ K + Y DIG  AFG KGRI+A +FIY+EIFMALVS
Sbjct  109   FLLIGLGVICAYSSHLLGKCLEKNTKLRSYVDIGGHAFGAKGRIMATTFIYMEIFMALVS  168

Query  525   YTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGIL  704
             YTISLHDNL ++F G HLKL   +LST QLLT+ AVL+ALPSLW RDLSSISFL + GIL
Sbjct  169   YTISLHDNLNSIFSGMHLKLQLAKLSTLQLLTIGAVLIALPSLWLRDLSSISFLLTGGIL  228

Query  705   MSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPS  884
             MSL+IFV++A T +FG V  NH+IP LHL +IPS+SGLY FSY GHIVFPN+Y AMKDPS
Sbjct  229   MSLVIFVSIASTPIFGGVQINHKIPLLHLHSIPSISGLYIFSYGGHIVFPNLYKAMKDPS  288

Query  885   KFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMT  1064
             KFTKVSIVSF++VT+LYT L FMG KMFGP V+SQ+TLSMP  +  TK+ALWATV+TPMT
Sbjct  289   KFTKVSIVSFTLVTLLYTTLGFMGGKMFGPDVNSQVTLSMPPKLFVTKIALWATVVTPMT  348

Query  1065  KYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGS  1244
             KYALEFAPFAI+L+  LP       K IIR   GS L+L+ILALAL VPYFEHVL LTGS
Sbjct  349   KYALEFAPFAIQLEKRLPKFNSGRTKMIIRSSVGSFLLLVILALALSVPYFEHVLCLTGS  408

Query  1245  LVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRA  1424
             LVS+ I ++ PC FY KI W +IS+PL + N+ +I  G LL V GT+SS  LLV    +A
Sbjct  409   LVSVAICLIFPCAFYIKICWGQISKPLFVLNLSIITCGFLLGVMGTISSSNLLVKHFLQA  468

Query  1425  HS  1430
              S
Sbjct  469   QS  470



>ref|XP_011073813.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar amino acid transporter 
1 [Sesamum indicum]
Length=453

 Score =   513 bits (1321),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 285/420 (68%), Positives = 335/420 (80%), Gaps = 21/420 (5%)
 Frame = +3

Query  186   AVKDLESSEE----CVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLL  353
             + KDLES E      VE+  + NSSF+HAV+NM+GMLIGLGQLSTPYALE GG  +    
Sbjct  51    SAKDLESLEREEKLGVEEQSEPNSSFLHAVVNMVGMLIGLGQLSTPYALENGGXAA----  106

Query  354   IGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTI  533
                   CA+++HLLGKCL  +PKS+DYKDIG  AFG+KGRI+A + IY+EIFMALVSYTI
Sbjct  107   ------CAYSSHLLGKCLHNNPKSRDYKDIGHHAFGSKGRIIATTLIYMEIFMALVSYTI  160

Query  534   SLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSL  713
             SLHDNLA VF+G  L+     L+TSQLL  +AVLVALPSLW RDLSSISFLS+AGILMSL
Sbjct  161   SLHDNLAIVFMGVDLRWA--HLTTSQLLATIAVLVALPSLWLRDLSSISFLSTAGILMSL  218

Query  714   LIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFT  893
             LIFVTVACTA+FG V  NH IPPL L         Y FS+AGHIVFPN+YTAMKDPSKFT
Sbjct  219   LIFVTVACTAIFGGVRANHDIPPLQL-----XXXXYIFSFAGHIVFPNLYTAMKDPSKFT  273

Query  894   KVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYA  1073
             +VSIVSFS+VTILYT LAFMGAK+FGP V+SQITLSMP +++ TK+ALWATVLTPMTKYA
Sbjct  274   QVSIVSFSMVTILYTGLAFMGAKLFGPQVNSQITLSMPPNLIVTKIALWATVLTPMTKYA  333

Query  1074  LEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVS  1253
             LEFAPFAI+L+ +LP SMK   +TIIRG  GSIL+L+IL LAL VPYFEHVLSLTGSLVS
Sbjct  334   LEFAPFAIQLEQTLPHSMKPRTRTIIRGTIGSILLLLILVLALSVPYFEHVLSLTGSLVS  393

Query  1254  IGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAHST  1433
             +GI I+LPC FYTKIFW +I  PLL+ N++LI  G L+   GTVSS K L+ SL+++H+ 
Sbjct  394   VGICIILPCAFYTKIFWTEIRSPLLLLNLILIAVGVLMGAFGTVSSSKSLLQSLRKSHTN  453



>ref|XP_010025929.1| PREDICTED: vacuolar amino acid transporter 1-like [Eucalyptus 
grandis]
Length=474

 Score =   509 bits (1311),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 258/387 (67%), Positives = 314/387 (81%), Gaps = 0/387 (0%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E+    NSSF HAVINM+ ML GLGQLS PYALE GGW SAFLLIGLG++CA+T+HLL K
Sbjct  71    EENAGGNSSFAHAVINMVAMLTGLGQLSIPYALENGGWSSAFLLIGLGMVCAYTSHLLAK  130

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL K P+S+ Y DIGQ+A+G+KGRI+AA+F+YLEIF ALVS TISLHDNL+ VF GT + 
Sbjct  131   CLDKRPRSRSYTDIGQEAYGSKGRIIAATFMYLEIFFALVSLTISLHDNLSLVFPGTPIS  190

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
                  +S+SQL+TV+AVL+ALPSLW RDLSSISFLSSAGI++S++IF +VA TA+FG V 
Sbjct  191   ARWAHMSSSQLMTVIAVLIALPSLWLRDLSSISFLSSAGIILSIIIFASVALTAIFGWVR  250

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              +H IP L + NIP +SGLY FS +GHI+FP++Y +MKDPSKFTKV+IVS+++V  LY A
Sbjct  251   SDHEIPALRIRNIPMISGLYVFSLSGHIIFPDLYKSMKDPSKFTKVTIVSYTLVAALYMA  310

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
             LAFMGA+MFGP VSSQITLS+P H+V  KVA WA VLTPMTKY LEFAP AI LD  L  
Sbjct  311   LAFMGARMFGPDVSSQITLSLPSHLVMAKVAQWAIVLTPMTKYVLEFAPLAIPLDRRLAG  370

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
             SM    +T +RG  GS+++++IL LAL VPYFE+VLSLTGSLVSI IS+VLPCGFYTKI 
Sbjct  371   SMSSCARTAVRGTVGSVVLVVILVLALSVPYFEYVLSLTGSLVSIFISVVLPCGFYTKIC  430

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGT  1382
             WP +S+PL + NV+LI FG +LAV GT
Sbjct  431   WPSLSKPLFVLNVLLIGFGCVLAVFGT  457



>ref|XP_003537530.1| PREDICTED: vacuolar amino acid transporter 1-like [Glycine max]
Length=482

 Score =   509 bits (1311),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 274/427 (64%), Positives = 327/427 (77%), Gaps = 11/427 (3%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKN-NSSFMHAVINMIGML  284
             + C+ CC + +K         F+   A    E +     Q + N NSSF HAVINM+GML
Sbjct  47    VNCN-CCIEENKQCN------FDHINAS---EGANNVHAQRDANANSSFTHAVINMVGML  96

Query  285   IGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGT  464
             +GLGQLSTPYA+E GGW SAFLL+GLGV+CA+++H+LG CL K+PK   + DIG+ AFG+
Sbjct  97    VGLGQLSTPYAVENGGWSSAFLLMGLGVMCAYSSHILGVCLRKNPKLTSFMDIGKHAFGS  156

Query  465   KGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVAL  644
             KGR +AA+ IY+EIFM+LVSYTISLHDNL TVFLGT+LKL     S+SQLLT +AV +A+
Sbjct  157   KGRNVAATIIYMEIFMSLVSYTISLHDNLITVFLGTNLKLHLPNFSSSQLLTAVAVFIAM  216

Query  645   PSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYA  824
             PSLW RDLSSISFLSS GILMSLLIF+ VA TA+ G V  NH IP LHL NIPSVSGLY 
Sbjct  217   PSLWIRDLSSISFLSSVGILMSLLIFLCVAATALLGHVQSNHSIPVLHLHNIPSVSGLYV  276

Query  825   FSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSM  1004
             F Y GHIVFP +YTAMKDPSKFTKVSIVSF+VVT +YT L FMGAKMFG  V SQITLSM
Sbjct  277   FGYGGHIVFPELYTAMKDPSKFTKVSIVSFAVVTAIYTTLGFMGAKMFGKDVKSQITLSM  336

Query  1005  PRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSilili  1184
             P+  + TK+ALWATV+ PMTKYALEF PFAI+L+H+LP SM    K IIRG  GS  +L 
Sbjct  337   PQEHIVTKIALWATVVAPMTKYALEFTPFAIQLEHALPTSMSVRTKMIIRGCVGSFSLLF  396

Query  1185  ilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTL  1364
             IL LAL VPYFEHVLSLTGSLVS+ + ++LP  FY KI W +IS+P L+ N+ LI+FG +
Sbjct  397   ILTLALSVPYFEHVLSLTGSLVSVAVCLILPSAFYVKICWGQISKPHLLLNLFLIIFGFV  456

Query  1365  LAVSGTV  1385
             LAV GT+
Sbjct  457   LAVMGTI  463



>gb|KCW57695.1| hypothetical protein EUGRSUZ_H00457 [Eucalyptus grandis]
Length=447

 Score =   508 bits (1307),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 258/387 (67%), Positives = 314/387 (81%), Gaps = 0/387 (0%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E+    NSSF HAVINM+ ML GLGQLS PYALE GGW SAFLLIGLG++CA+T+HLL K
Sbjct  44    EENAGGNSSFAHAVINMVAMLTGLGQLSIPYALENGGWSSAFLLIGLGMVCAYTSHLLAK  103

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL K P+S+ Y DIGQ+A+G+KGRI+AA+F+YLEIF ALVS TISLHDNL+ VF GT + 
Sbjct  104   CLDKRPRSRSYTDIGQEAYGSKGRIIAATFMYLEIFFALVSLTISLHDNLSLVFPGTPIS  163

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
                  +S+SQL+TV+AVL+ALPSLW RDLSSISFLSSAGI++S++IF +VA TA+FG V 
Sbjct  164   ARWAHMSSSQLMTVIAVLIALPSLWLRDLSSISFLSSAGIILSIIIFASVALTAIFGWVR  223

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              +H IP L + NIP +SGLY FS +GHI+FP++Y +MKDPSKFTKV+IVS+++V  LY A
Sbjct  224   SDHEIPALRIRNIPMISGLYVFSLSGHIIFPDLYKSMKDPSKFTKVTIVSYTLVAALYMA  283

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
             LAFMGA+MFGP VSSQITLS+P H+V  KVA WA VLTPMTKY LEFAP AI LD  L  
Sbjct  284   LAFMGARMFGPDVSSQITLSLPSHLVMAKVAQWAIVLTPMTKYVLEFAPLAIPLDRRLAG  343

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
             SM    +T +RG  GS+++++IL LAL VPYFE+VLSLTGSLVSI IS+VLPCGFYTKI 
Sbjct  344   SMSSCARTAVRGTVGSVVLVVILVLALSVPYFEYVLSLTGSLVSIFISVVLPCGFYTKIC  403

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGT  1382
             WP +S+PL + NV+LI FG +LAV GT
Sbjct  404   WPSLSKPLFVLNVLLIGFGCVLAVFGT  430



>ref|XP_007163781.1| hypothetical protein PHAVU_001G263500g [Phaseolus vulgaris]
 gb|ESW35775.1| hypothetical protein PHAVU_001G263500g [Phaseolus vulgaris]
Length=474

 Score =   508 bits (1309),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 271/442 (61%), Positives = 333/442 (75%), Gaps = 14/442 (3%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLI  287
             ++C +C  + +K          +DQ                  +NSSF H+VINM+GMLI
Sbjct  44    VQCCNCSTEENKQCNCDHIHAADDQ--------------NHANSNSSFTHSVINMVGMLI  89

Query  288   GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTK  467
             GLGQLSTPYA+  GGW+SAFLLIGLGV+CA+++H+LG CL K+PK + + DIG+ AFG+K
Sbjct  90    GLGQLSTPYAIVSGGWVSAFLLIGLGVMCAYSSHILGTCLRKNPKLRSFVDIGKHAFGSK  149

Query  468   GRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALP  647
             GR++AA+ IY+E+FMALVSYTISLHDNL  VF+GT LK    + S+SQLLTV+AVL+ LP
Sbjct  150   GRLVAATIIYMEVFMALVSYTISLHDNLTRVFMGTSLKHHFPKFSSSQLLTVVAVLICLP  209

Query  648   SLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAF  827
             SLW RDLSSISFLS+ GILMSLLIFV VA TA+ G +  NH IP L L NIPSVSGLY F
Sbjct  210   SLWIRDLSSISFLSTLGILMSLLIFVCVAATALLGHIPSNHAIPVLQLHNIPSVSGLYVF  269

Query  828   SYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMP  1007
              Y GHIVFP +YT+MKDPSKFTKVSIVSF+VVT +YT L FMGA+MFG  V SQITLSMP
Sbjct  270   GYGGHIVFPELYTSMKDPSKFTKVSIVSFAVVTGIYTTLGFMGARMFGKDVKSQITLSMP  329

Query  1008  RHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililii  1187
                + TK+ALWATV+ PMTKYALEF P AI+L+H+LP +M    K IIRG  GS  +L+I
Sbjct  330   PEKIVTKIALWATVVAPMTKYALEFTPLAIQLEHALPSTMSCRTKMIIRGCVGSFSLLVI  389

Query  1188  lalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLL  1367
             L+LAL VPYFEHVLSLTGSLVS+ + ++LPC FY KI W ++S PLL+ N+ LI+FG LL
Sbjct  390   LSLALSVPYFEHVLSLTGSLVSVAVCLILPCSFYLKICWAQMSYPLLLLNLFLIIFGFLL  449

Query  1368  AVSGTVSSFKLLVISLQRAHST  1433
             A+ GT+SS   L+ + Q  HST
Sbjct  450   ALIGTISSSSFLLKTFQLHHST  471



>ref|XP_008804195.1| PREDICTED: vacuolar amino acid transporter 1 [Phoenix dactylifera]
Length=468

 Score =   508 bits (1307),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 275/422 (65%), Positives = 331/422 (78%), Gaps = 6/422 (1%)
 Frame = +3

Query  174   EDQTAVKDLESSEECV---EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISA  344
             E+  A K  E S       E   K +SSF H+ INM+GMLIGLGQLSTPYALE GGW SA
Sbjct  49    EENNACKCREGSGVLSFGSENHTKADSSFAHSAINMVGMLIGLGQLSTPYALENGGWTSA  108

Query  345   FLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVS  524
             FLL+GLG++CA+T+H++GKCL +D  SK Y+DIG+QAFGTKGRI+ ++FIYLEIF++LVS
Sbjct  109   FLLVGLGIMCAYTSHIIGKCLEEDASSKSYQDIGEQAFGTKGRIITSTFIYLEIFLSLVS  168

Query  525   YTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGIL  704
             YTISL DNL     G HL  + + LS +QLLT +AVLVALPS+W RDLSSISFLS  GIL
Sbjct  169   YTISLSDNLPLALRGVHL--SWLHLSEAQLLTSIAVLVALPSIWLRDLSSISFLSFGGIL  226

Query  705   MSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPS  884
             MSLLI +T+  TA FG +  N RIP L L  IP +SGLY FSYAGHIVFPNIYTAMKDPS
Sbjct  227   MSLLICITIGWTAAFGGIKSNQRIPILQLRKIPGISGLYIFSYAGHIVFPNIYTAMKDPS  286

Query  885   KFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMT  1064
             KFTKV++ SF+VVT LYTALAFMGAK+FGP V+SQITLSMP+H+V TK+ALWATVLTPMT
Sbjct  287   KFTKVTVTSFTVVTGLYTALAFMGAKLFGPTVNSQITLSMPQHLVVTKIALWATVLTPMT  346

Query  1065  KYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGS  1244
             KYALEFAPFAI+L+ +L  S    ++ +IRG  GS L+L+ILALAL +PYFEHVLSLTGS
Sbjct  347   KYALEFAPFAIQLEQNL-TSTSSRVRMLIRGIIGSSLLLVILALALSIPYFEHVLSLTGS  405

Query  1245  LVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRA  1424
             LVS  IS+V PC FY KI WP++S+P L+ N V++V G L  V GT+SS   L+ ++QR 
Sbjct  406   LVSTAISVVFPCAFYLKICWPRVSKPALLLNGVVVVIGALFGVVGTISSSMALLQNIQRG  465

Query  1425  HS  1430
             HS
Sbjct  466   HS  467



>ref|XP_004979185.1| PREDICTED: vacuolar amino acid transporter 1-like [Setaria italica]
Length=482

 Score =   487 bits (1254),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 274/444 (62%), Positives = 330/444 (74%), Gaps = 8/444 (2%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLI  287
             +E    C  G K  E  +GE    + A  ++ + EE      K NSSF H+VINM+GMLI
Sbjct  45    VEAGEPCKCGGK--EAVAGEA-GGRVAAVEVNNGEE---GHSKPNSSFAHSVINMVGMLI  98

Query  288   GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTK  467
             GLGQLSTPYALE GGW S FLLIGLGV+C +T H++GKCL +D  SK Y+DIG++AFG +
Sbjct  99    GLGQLSTPYALENGGWASVFLLIGLGVMCCYTAHIIGKCLDEDSGSKTYQDIGERAFGVR  158

Query  468   GRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALP  647
             GR +A+ FIYLEIF ALVSYTISL DNL  VF G HL+L  ++L+T+QLLT +AVL+ALP
Sbjct  159   GRAVASVFIYLEIFFALVSYTISLSDNLPLVFAGAHLRLPWLRLTTTQLLTAIAVLLALP  218

Query  648   SLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGV--VNPNHRIPPLHLPNIPSVSGLY  821
             SLW RDLSSISFLS  GI+MSLLIF +V  TA  G   VN    IP L L  IP+VSGLY
Sbjct  219   SLWLRDLSSISFLSLGGIVMSLLIFSSVVFTAALGGGGVNMGQHIPVLRLERIPAVSGLY  278

Query  822   AFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLS  1001
              FSYAGHIVFPNIYTAMKDPS FTKV++ SF+VVT LY ALA +GA +FGP VSSQ+TLS
Sbjct  279   MFSYAGHIVFPNIYTAMKDPSSFTKVTVTSFAVVTALYVALALVGASLFGPAVSSQVTLS  338

Query  1002  MPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSilil  1181
             MP  +  TKVALWATVLTP+TKYALEFAP A++L   LP +M    + ++RGG GS  +L
Sbjct  339   MPPRLAATKVALWATVLTPVTKYALEFAPLAVQLQRRLPAAMGARARLLVRGGVGSAALL  398

Query  1182  iilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGT  1361
             +ILALAL VPYFEHVLSLTGSLVS+ I +V PC FY +I W ++SRP +  NV ++V G 
Sbjct  399   LILALALAVPYFEHVLSLTGSLVSVAICVVFPCAFYLRICWGRVSRPAVALNVGMMVAGV  458

Query  1362  LLAVSGTVSSFKLLVISLQRAHST  1433
             +LAV GTVSS K LV  +QR H+ 
Sbjct  459   VLAVVGTVSSAKSLVQRIQRGHAA  482



>ref|XP_002302929.2| hypothetical protein POPTR_0002s23420g [Populus trichocarpa]
 gb|EEE82202.2| hypothetical protein POPTR_0002s23420g [Populus trichocarpa]
Length=435

 Score =   484 bits (1247),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 253/418 (61%), Positives = 304/418 (73%), Gaps = 37/418 (9%)
 Frame = +3

Query  186   AVKDLES--SEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIG  359
             + +DL+S  +E  VE   + NSSF H+VINMIGMLIGLG +S PYALE GGW SAFLL+G
Sbjct  51    STQDLKSVVNEADVEDHTEANSSFAHSVINMIGMLIGLG-ISAPYALENGGWASAFLLVG  109

Query  360   LGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISL  539
             +GVICA+T+ LLGKCL K P+S+ Y DIGQ AFG++GR+LA +FI LEIFM LVS+TISL
Sbjct  110   IGVICAYTSLLLGKCLEKSPRSRSYADIGQHAFGSRGRVLATTFIDLEIFMTLVSFTISL  169

Query  540   HDNLATVFLGTHLKL-TGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLL  716
             HDNL TVF GT L+L    +LSTSQLLT++ VL+ALPSLW  DLSSISFLS  GILMS++
Sbjct  170   HDNLITVFAGTQLRLPLWTKLSTSQLLTMIGVLIALPSLWLTDLSSISFLSFGGILMSII  229

Query  717   IFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTK  896
             IF +VAC A+F VV  NHRIP LHL  IP++SGLY F YAGHIVFPN+Y +MKDPSKFTK
Sbjct  230   IFTSVACIAIFQVVKANHRIPVLHLHKIPAISGLYIFCYAGHIVFPNLYKSMKDPSKFTK  289

Query  897   VSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYAL  1076
             VSIVSF+ V  LYT+LAF GAK+FGP VSSQITLSMPRH++ TK+ALWATV+TPMTKYAL
Sbjct  290   VSIVSFASVIALYTSLAFTGAKLFGPEVSSQITLSMPRHLIITKIALWATVITPMTKYAL  349

Query  1077  EFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSI  1256
              FAPF+++++HSLP S     KTIIRG                                 
Sbjct  350   MFAPFSVQIEHSLPSSFSSRTKTIIRGAH-------------------------------  378

Query  1257  GISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAHS  1430
                IV PC FY KI   ++S+  LI N  L+ FG LL V+GT+SS K +  SL+R HS
Sbjct  379   --CIVFPCAFYIKISSAQLSKFSLILNATLLAFGLLLGVAGTISSSKSIFTSLKRDHS  434



>ref|XP_006858647.1| hypothetical protein AMTR_s00066p00056580 [Amborella trichopoda]
 gb|ERN20114.1| hypothetical protein AMTR_s00066p00056580 [Amborella trichopoda]
Length=472

 Score =   483 bits (1244),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 248/448 (55%), Positives = 323/448 (72%), Gaps = 15/448 (3%)
 Frame = +3

Query  111   ECSSC------CPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINM  272
              C SC      C  G K  E  S    + +  V         V    K +SSF+H+VINM
Sbjct  32    RCDSCVEKNQLCKCGSKEGEYVS-SNLKGKVGVSG-------VRHHLKASSSFLHSVINM  83

Query  273   IGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQ  452
             +GMLIGLGQLSTPYALEKGGW S FLLIG G+IC +  H++G+CL ++P SK+++DIG  
Sbjct  84    VGMLIGLGQLSTPYALEKGGWSSIFLLIGFGIICTYGAHVMGRCLDENPNSKNFQDIGDH  143

Query  453   AFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG-IQLSTSQLLTVMA  629
             AFG KGRI+ A+ IYLEIF+ LV+YTISL DNL T+F+   + +   + LS +  LTV+A
Sbjct  144   AFGKKGRIVVAAIIYLEIFLTLVNYTISLGDNLGTIFINKSIGVAAYVHLSPTHFLTVLA  203

Query  630   VLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSV  809
             VL+ALPSLW  DLSSISFLSS GI+MSLL+F T+  TA  G    N RIPPL L NIP +
Sbjct  204   VLMALPSLWLSDLSSISFLSSGGIVMSLLLFTTIGWTAALGGSAVNQRIPPLQLHNIPGI  263

Query  810   SGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQ  989
             SGLY FSYAGH+VFPNIY AMKDPSKFTKV+IVSF+VVT LYTA+AF GAK+FGPG++ Q
Sbjct  264   SGLYMFSYAGHVVFPNIYRAMKDPSKFTKVAIVSFTVVTSLYTAIAFTGAKLFGPGINPQ  323

Query  990   ITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGS  1169
             +TLSMPR  V TK+ALWATV+TPMTKYALEF+P A+++++ LP ++   ++ +IR   GS
Sbjct  324   VTLSMPRDNVMTKIALWATVITPMTKYALEFSPIALQIENKLPSTLGPRLRMVIRASIGS  383

Query  1170  ililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLI  1349
             +++L+IL LAL  PYF  VL  TGSL+ + +SI+ PC FYTKIF  ++S+P++  N++ I
Sbjct  384   MILLLILLLALIFPYFSDVLGFTGSLLCVFVSIIFPCAFYTKIFRSQLSKPIVALNLLFI  443

Query  1350  VFGTLLAVSGTVSSFKLLVISLQRAHST  1433
               G    V GT++S K L++++ +  ST
Sbjct  444   TIGAFFGVVGTIASGKSLLLNISQGSST  471



>ref|XP_008356121.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Malus domestica]
Length=418

 Score =   479 bits (1232),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 249/367 (68%), Positives = 296/367 (81%), Gaps = 6/367 (2%)
 Frame = +3

Query  171   FEDQTAVKDLESSEECV------EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGG  332
              E+    K  +  E C       E   + N+S  H+VINM GMLIGLGQLSTPYALE GG
Sbjct  44    LEENKVCKCDQCFESCKRVAGADEHHAEANNSVTHSVINMTGMLIGLGQLSTPYALETGG  103

Query  333   WISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFM  512
             W SAFLLIGLG+ICA+ +HLLGKCL K PKS+ Y DIG  AFG+KG+ILAA FIY+EIFM
Sbjct  104   WSSAFLLIGLGIICAYCSHLLGKCLDKHPKSRTYTDIGYNAFGSKGKILAAYFIYMEIFM  163

Query  513   ALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSS  692
             ALVSYTISLHDNLATVF G  LK++  +L  SQLLT +A+LVALPSLW RDLSSISFLS 
Sbjct  164   ALVSYTISLHDNLATVFPGIQLKVSWAKLPKSQLLTFIAILVALPSLWLRDLSSISFLSF  223

Query  693   AGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAM  872
              G+LMSL+IF++VACTA+FG V  NH IP L + NIP++SGL  FS+AGHIVFPN+Y AM
Sbjct  224   GGVLMSLVIFISVACTAIFGGVKSNHTIPALQIHNIPAISGLCIFSFAGHIVFPNLYKAM  283

Query  873   KDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVL  1052
             KDPSKFTKVSI+SF++VT+LYT+LAFMGAK+FGP V+ QITLSMP H++ TK+ALWATVL
Sbjct  284   KDPSKFTKVSIISFTLVTMLYTSLAFMGAKLFGPQVNPQITLSMPPHLIVTKIALWATVL  343

Query  1053  TPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
             TPMTKYALEFAP AI+L+H+LP S+    K +IRG  GS+L+L+IL LAL VPYFE+VLS
Sbjct  344   TPMTKYALEFAPMAIQLEHNLPQSLSSRTKLLIRGSIGSVLLLLILVLALSVPYFEYVLS  403

Query  1233  LTGSLVS  1253
             LTGSL+ 
Sbjct  404   LTGSLLE  410



>emb|CDY38090.1| BnaC02g06830D [Brassica napus]
Length=433

 Score =   479 bits (1232),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 258/416 (62%), Positives = 312/416 (75%), Gaps = 6/416 (1%)
 Frame = +3

Query  180   QTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIG  359
             +  VK+L  S E  E     NSS +H+VINM+GMLIGLGQLS PYA+E GGWIS FLLI 
Sbjct  22    ENPVKELGLSHEASE-----NSSVLHSVINMVGMLIGLGQLSMPYAVESGGWISIFLLIS  76

Query  360   LGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISL  539
             LGV+  +T+H+LG CL ++PKSK Y DIG  AFG  G +LA+ FIYLEIFMALVSYTISL
Sbjct  77    LGVLTTYTSHILGNCLRRNPKSKSYSDIGYSAFGRHGHLLASLFIYLEIFMALVSYTISL  136

Query  540   HDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLI  719
             HDN+A  F  T   L       ++L T +AV +ALPSLW R+LSSISFLSS GILMS +I
Sbjct  137   HDNIAAAFPATFTNLHNGSFPAAKL-TAVAVAIALPSLWIRNLSSISFLSSGGILMSAVI  195

Query  720   FVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKV  899
             F++V  TAVFG V  + RIP L L NIP+VSG+Y F + GHIVFPN+YT+MKDPSKFTKV
Sbjct  196   FMSVVYTAVFGGVLDDGRIPVLRLRNIPTVSGVYLFGFGGHIVFPNLYTSMKDPSKFTKV  255

Query  900   SIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALE  1079
             SIVSF+ VT LYTALA  GAKMFGP ++ Q+TLS+P+H++ TK+ALWATVLTPMTKYALE
Sbjct  256   SIVSFATVTALYTALAITGAKMFGPNINPQVTLSLPKHLLVTKIALWATVLTPMTKYALE  315

Query  1080  FAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIG  1259
             FAP AI+L+ SLP +M    K + RG  GS L+L+ILALAL VPYF +VLSLTGSLVS+ 
Sbjct  316   FAPLAIQLERSLPLTMSDRTKLVTRGLVGSTLLLVILALALTVPYFGYVLSLTGSLVSVT  375

Query  1260  ISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAH  1427
             I+++LPC FY KI W  +S+     NVV +VFG +L V G+  S KLLV  L R H
Sbjct  376   IAVILPCAFYVKICWDGMSKFTRAANVVFVVFGCVLGVLGSFDSSKLLVNKLVRVH  431



>ref|XP_009347362.1| PREDICTED: vesicular GABA transporter-like isoform X2 [Pyrus 
x bretschneideri]
Length=418

 Score =   478 bits (1229),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 253/367 (69%), Positives = 296/367 (81%), Gaps = 6/367 (2%)
 Frame = +3

Query  171   FEDQTAVKDLESSEECV------EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGG  332
              E+    K  +S E C       E   + N+S  H+VINM GMLIGLGQLSTPYALE GG
Sbjct  44    LEENKVCKCDQSFESCKRVAGADEHHAEANNSVTHSVINMTGMLIGLGQLSTPYALETGG  103

Query  333   WISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFM  512
             W S FLLIGLG+I A+ +HLLGKCL K PKS+ Y DIG  AFG+KG+ILAASFIY+EIFM
Sbjct  104   WPSVFLLIGLGIISAYCSHLLGKCLDKHPKSRTYTDIGHNAFGSKGKILAASFIYMEIFM  163

Query  513   ALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSS  692
             ALVSYTISLHDNLATVFLG  LK++  +L  SQLLT +AVLVALPSLW RDLSSISFLS 
Sbjct  164   ALVSYTISLHDNLATVFLGIQLKVSWAKLPKSQLLTFIAVLVALPSLWLRDLSSISFLSF  223

Query  693   AGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAM  872
              G+LMSL+IF++VACTA+FG V  NH IP L   NIP++SGLY FS+AGHIVFPN+Y AM
Sbjct  224   GGVLMSLVIFISVACTAIFGGVKLNHTIPALQNHNIPAISGLYIFSFAGHIVFPNLYKAM  283

Query  873   KDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVL  1052
             KDPSKFTKVSI+SF++VTILYT+LAFMGAK+FGP V+ QITLSMP H++ TK+ALWATVL
Sbjct  284   KDPSKFTKVSIISFTLVTILYTSLAFMGAKLFGPQVNPQITLSMPPHLIVTKIALWATVL  343

Query  1053  TPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
             TPMTKYALEFAP AI+L+H+LP S     K +IRG  GS+L+L+IL LAL VPYFE+VLS
Sbjct  344   TPMTKYALEFAPMAIQLEHNLPQSFSSRTKLLIRGSVGSVLLLLILVLALSVPYFEYVLS  403

Query  1233  LTGSLVS  1253
             LTGSL+ 
Sbjct  404   LTGSLLE  410



>gb|KHN44455.1| Vacuolar amino acid transporter 1, partial [Glycine soja]
Length=388

 Score =   476 bits (1225),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 252/366 (69%), Positives = 296/366 (81%), Gaps = 0/366 (0%)
 Frame = +3

Query  288   GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTK  467
             GLGQLSTPYA+E GGW SAFLL+GLGV+CA+++H+LG CL K+PK   + DIG+ AFG+K
Sbjct  4     GLGQLSTPYAVENGGWSSAFLLMGLGVMCAYSSHILGVCLRKNPKLTSFMDIGKHAFGSK  63

Query  468   GRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALP  647
             GR +AA+ IY+EIFM+LVSYTISLHDNL TVFLGT+LKL     S+SQLLT +AV +A+P
Sbjct  64    GRNVAATIIYMEIFMSLVSYTISLHDNLITVFLGTNLKLHLPNFSSSQLLTAVAVFIAMP  123

Query  648   SLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAF  827
             SLW RDLSSISFLSS GILMSLLIF+ VA TA+ G V  NH IP LHL NIPSVSGLY F
Sbjct  124   SLWIRDLSSISFLSSVGILMSLLIFLCVAATALLGHVQSNHSIPVLHLHNIPSVSGLYVF  183

Query  828   SYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMP  1007
              Y GHIVFP +YTAMKDPSKFTKVSIVSF+VVT +YT L FMGAKMFG  V SQITLSMP
Sbjct  184   GYGGHIVFPELYTAMKDPSKFTKVSIVSFAVVTGIYTTLGFMGAKMFGKDVKSQITLSMP  243

Query  1008  RHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililii  1187
             +  + TK+ALWATV+ PMTKYALEF PFAI+L+H+LP SM    K IIRG  GS  +L I
Sbjct  244   QEHIVTKIALWATVVAPMTKYALEFTPFAIQLEHALPTSMSVRTKMIIRGCVGSFSLLFI  303

Query  1188  lalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLL  1367
             L LAL VPYFEHVLSLTGSLVS+ + ++LP  FY KI W +IS+P L+ N+ LI+FG +L
Sbjct  304   LTLALSVPYFEHVLSLTGSLVSVAVCLILPSAFYVKICWGQISKPHLLLNLFLIIFGFVL  363

Query  1368  AVSGTV  1385
             AV GT+
Sbjct  364   AVMGTI  369



>ref|XP_010492597.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=432

 Score =   477 bits (1227),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 258/430 (60%), Positives = 319/430 (74%), Gaps = 13/430 (3%)
 Frame = +3

Query  147   VEPASGERFEDQTAVKDL---ESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             VE   G   E +T VK+L   E+SE         NSSF+H+VINM+GMLIGLGQLS PYA
Sbjct  11    VEENKGCECELETGVKELGLLEASE---------NSSFLHSVINMVGMLIGLGQLSMPYA  61

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
             +E GGWIS FLLI  G++ ++T+H+LG CL ++PKSK Y DIG  AFG  GR++A+ FIY
Sbjct  62    VESGGWISIFLLISFGILTSYTSHILGHCLRRNPKSKSYSDIGHSAFGRHGRLIASLFIY  121

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             LEIFMALVSYTISLHDN++  F  T    +      ++L T +AV++ALPSLW RDLSSI
Sbjct  122   LEIFMALVSYTISLHDNISAAFPATFSHHSNGHFPAAKL-TAVAVVIALPSLWIRDLSSI  180

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             SFLSS GILMS +IF +V  TAVFG V  + RIP L L N+P+VSG+Y F + GHIVFPN
Sbjct  181   SFLSSGGILMSAIIFCSVVYTAVFGGVTDDGRIPALRLGNLPTVSGIYLFGFGGHIVFPN  240

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             +YT+MKDPSKFTKVSIVSF+ VT LYTALA  GAKMFGP V+ QITLS+P+H++ TK+AL
Sbjct  241   LYTSMKDPSKFTKVSIVSFATVTALYTALAITGAKMFGPSVNPQITLSLPKHLLVTKIAL  300

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYF  1217
             WATVLTPMTKYALEFAP AI+L+ SLPP+M    K + RG  GS L+L+ILALAL VPYF
Sbjct  301   WATVLTPMTKYALEFAPLAIQLERSLPPTMTDRTKLVARGLMGSALLLVILALALTVPYF  360

Query  1218  EHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFK  1397
              +VLSL+GSLVS+ I++ LP  FY KI W  +S+   + N+  +V G +L V G+  S K
Sbjct  361   GYVLSLSGSLVSVTIALTLPSAFYLKICWDGMSKFTRVANLGFVVLGCVLGVLGSFESSK  420

Query  1398  LLVISLQRAH  1427
             LLV  + RAH
Sbjct  421   LLVKEIFRAH  430



>gb|KCW57697.1| hypothetical protein EUGRSUZ_H00460 [Eucalyptus grandis]
Length=356

 Score =   468 bits (1205),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 237/339 (70%), Positives = 288/339 (85%), Gaps = 0/339 (0%)
 Frame = +3

Query  366   VICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHD  545
             ++CA+T+HLLGKCL K PKS+ Y DIGQ+A+G+KGRI+AA+FIYLEIF+ALVSYTISLHD
Sbjct  1     MVCAYTSHLLGKCLDKSPKSRSYTDIGQEAYGSKGRIIAATFIYLEIFLALVSYTISLHD  60

Query  546   NLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFV  725
             NL+ VF GT +      +S+ QLLTV+AVL+ALPSLW RDLSSISFLSS GILMS++IF 
Sbjct  61    NLSIVFPGTWISARWTHMSSPQLLTVIAVLIALPSLWLRDLSSISFLSSGGILMSIIIFA  120

Query  726   TVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSI  905
             +VA TA+FG V  ++ IP L + NIP +SGLY FS+AGHIVFP++Y +MKDPSKFTKVSI
Sbjct  121   SVALTAIFGWVRSDNEIPALRIRNIPMISGLYVFSFAGHIVFPDLYKSMKDPSKFTKVSI  180

Query  906   VSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFA  1085
             VSF++VT LYTALAFMGAKMFGPGVSSQITLS+PRH+V TKVA WATVLTP+TKYALEFA
Sbjct  181   VSFTLVTALYTALAFMGAKMFGPGVSSQITLSLPRHLVVTKVAQWATVLTPITKYALEFA  240

Query  1086  PFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGIS  1265
             PFAI+LD SLP SM   ++T++RG  GS+L+++ILALAL VPYFE+VLSLTGSLVSI I 
Sbjct  241   PFAIQLDRSLPGSMSSCMRTVVRGTVGSMLLVVILALALSVPYFEYVLSLTGSLVSICIC  300

Query  1266  IVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGT  1382
             ++LPCGFYTKI WP +S+PL + N +LI  G +L V GT
Sbjct  301   VILPCGFYTKICWPSLSKPLFLLNALLIGIGCVLGVFGT  339



>ref|XP_010424130.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=432

 Score =   470 bits (1210),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 259/437 (59%), Positives = 318/437 (73%), Gaps = 19/437 (4%)
 Frame = +3

Query  126   CPDGHKHVEPASGERFEDQTAVKDL---ESSEECVEQAEKNNSSFMHAVINMIGMLIGLG  296
             C + +K  E       E +T VK+L   E+SE         NSSF+H+VINM+GMLIGLG
Sbjct  10    CVEENKRCE------CELETGVKELLLLEASE---------NSSFLHSVINMVGMLIGLG  54

Query  297   QLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRI  476
             QLS PYA+E GGWIS FLLI  G++  +T+H+LG CL ++PKSK Y DIG  AFG  GR+
Sbjct  55    QLSMPYAVETGGWISIFLLISFGILTTYTSHILGNCLRRNPKSKSYSDIGHSAFGRHGRL  114

Query  477   LAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLW  656
             +A+ FIY+EIFMALVSYTISLHDN++  F  T           ++L T +AV +ALPSLW
Sbjct  115   IASLFIYVEIFMALVSYTISLHDNISAAFPATFSHHPNGHFPAAKL-TAVAVAIALPSLW  173

Query  657   FRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYA  836
              RDLSSISFLSS GILMS +IF +V  TAVFG V  + RIP L L NIP+VSG+Y F + 
Sbjct  174   IRDLSSISFLSSGGILMSAIIFGSVVYTAVFGGVIDDGRIPALRLGNIPTVSGIYLFGFG  233

Query  837   GHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHV  1016
             GHIVFPN+YT+MKDPSKFTKVSIVSF++VT LYTALA  GAKMFGP V+ QITLS+P+H+
Sbjct  234   GHIVFPNLYTSMKDPSKFTKVSIVSFAMVTALYTALAITGAKMFGPSVNPQITLSLPKHL  293

Query  1017  VFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilal  1196
             + TK+ALWATVLTPMTKYALEFAP AI+L+ SLPP+M +  K + RG  GS L+L+ILAL
Sbjct  294   LVTKIALWATVLTPMTKYALEFAPLAIQLERSLPPTMTNRTKLVARGLMGSALLLVILAL  353

Query  1197  alCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVS  1376
             AL VPYF +VLSL+GSLVSI I++ LP  FY KI W  +S+     N+  +V G +L V 
Sbjct  354   ALTVPYFGYVLSLSGSLVSITIAVTLPSAFYLKICWDGMSKLTRAANLGFVVLGCVLGVL  413

Query  1377  GTVSSFKLLVISLQRAH  1427
             G+  S KLLV  L R H
Sbjct  414   GSFESSKLLVKELVRVH  430



>ref|XP_002873789.1| amino acid transporter family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50048.1| amino acid transporter family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   469 bits (1206),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 256/427 (60%), Positives = 315/427 (74%), Gaps = 10/427 (2%)
 Frame = +3

Query  147   VEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEK  326
             VE   G   E +  VK+L      +E +E  NSSF+H+VINM+GMLIGLGQLS PYA+E 
Sbjct  7     VEENKGCECEHEKPVKEL-----ALEASE--NSSFLHSVINMVGMLIGLGQLSMPYAVES  59

Query  327   GGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEI  506
             GGW+S FLLI  G++  +T+H+LG C+ ++PKSK Y DIG  AFG  GR++ + FIYLEI
Sbjct  60    GGWMSIFLLIFFGILTTYTSHILGNCIRRNPKSKSYSDIGYSAFGRHGRLITSLFIYLEI  119

Query  507   FMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFL  686
             FMALVSYTISLHDN++  F  T    +      +  LT +AV +ALPSLW RDLSSISFL
Sbjct  120   FMALVSYTISLHDNISAAFPAT---FSNHGHFPAAKLTAVAVAIALPSLWIRDLSSISFL  176

Query  687   SSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYT  866
             SS GILMS +IF +V  TAVFG V  + RIP L L NIP+VSG+Y FS+ GHIVFPN+YT
Sbjct  177   SSGGILMSAIIFGSVVYTAVFGGVIDDGRIPVLRLGNIPTVSGIYLFSFGGHIVFPNLYT  236

Query  867   AMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWAT  1046
             +MKDPSKFTKVSIVSF+ VT LYTALA  GAKMFGP V+SQITLS+P+H++ TK+ALWAT
Sbjct  237   SMKDPSKFTKVSIVSFATVTALYTALAMTGAKMFGPSVNSQITLSLPKHLLVTKIALWAT  296

Query  1047  VLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHV  1226
             VLTPMTKYALEFAP AI+L+ SLP +M    K + RG TGS L+L+ILALAL VPYF +V
Sbjct  297   VLTPMTKYALEFAPLAIQLERSLPSTMSDRTKLLARGLTGSSLLLVILALALTVPYFGYV  356

Query  1227  LSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             LSL+GSLVS+ I++ LP  FY KI W  +S+   + N+  +V G +L V G+  S KLLV
Sbjct  357   LSLSGSLVSVTIAVTLPAAFYLKICWDGMSKFTRVANLGFVVLGCVLGVLGSFESSKLLV  416

Query  1407  ISLQRAH  1427
               L R H
Sbjct  417   KELIRVH  423



>ref|NP_197176.1| transmembrane amino acid transporter family protein [Arabidopsis 
thaliana]
 emb|CAC01838.1| putative protein [Arabidopsis thaliana]
 gb|AED92332.1| transmembrane amino acid transporter family protein [Arabidopsis 
thaliana]
Length=426

 Score =   466 bits (1200),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 253/427 (59%), Positives = 311/427 (73%), Gaps = 9/427 (2%)
 Frame = +3

Query  147   VEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEK  326
             VE   G   E +  V++L      V +A   NSSF+H+VINM+GMLIGLGQLS PYA+E 
Sbjct  7     VEENKGCECEHEKPVREL------VLEAASENSSFLHSVINMVGMLIGLGQLSMPYAVES  60

Query  327   GGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEI  506
             GGW+S FLLI  G++  +T+H+LGKC+ ++PKSK Y DIG  AFG  GR++   FIYLEI
Sbjct  61    GGWMSIFLLISFGILTTYTSHILGKCIRRNPKSKSYSDIGYSAFGRHGRLIVCLFIYLEI  120

Query  507   FMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFL  686
             FMALVSYTISLHDN++  F  T    +      +  LT +AV +ALPSLW RDLSSISFL
Sbjct  121   FMALVSYTISLHDNISAAFPAT---FSNHGHFPAAKLTAVAVAIALPSLWIRDLSSISFL  177

Query  687   SSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYT  866
             SS GILMS +IF +V  TA+FG V  + +IP L L NIP+VSG+Y FS+ GHIVFPN+YT
Sbjct  178   SSGGILMSAIIFGSVVYTAIFGGVIDDGKIPVLRLENIPTVSGIYLFSFGGHIVFPNLYT  237

Query  867   AMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWAT  1046
             +MKDPSKFTKVSIVSF+ VT LY ALA  GAKMFGP V+SQITLS+P+H+V TK+ALWAT
Sbjct  238   SMKDPSKFTKVSIVSFATVTALYGALAITGAKMFGPSVNSQITLSLPKHLVVTKIALWAT  297

Query  1047  VLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHV  1226
             VLTPMTKYALEFAP AI+L+ SLP +M    K + RG  GS L+L+ILALAL VPYF +V
Sbjct  298   VLTPMTKYALEFAPLAIQLERSLPSTMTDRTKLVARGLMGSALLLVILALALTVPYFGYV  357

Query  1227  LSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             LSLTGSLVS+ I++ LP  FY KI W  +++     N+  +V G +L V G+  S KLLV
Sbjct  358   LSLTGSLVSVTIAVTLPSAFYLKICWDGMTKFTRAANLGFVVLGCVLGVLGSFESSKLLV  417

Query  1407  ISLQRAH  1427
               L R H
Sbjct  418   KELVRVH  424



>ref|XP_006289356.1| hypothetical protein CARUB_v10002843mg [Capsella rubella]
 gb|EOA22254.1| hypothetical protein CARUB_v10002843mg [Capsella rubella]
Length=434

 Score =   463 bits (1192),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 247/406 (61%), Positives = 303/406 (75%), Gaps = 3/406 (1%)
 Frame = +3

Query  210   EECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTH  389
             E  +E +E  NSSF+H+V NM+GMLIGL QLS PYA+E GGW+S FLLI LG++  +T+H
Sbjct  30    ELVLEPSE--NSSFLHSVTNMVGMLIGLSQLSMPYAVESGGWVSIFLLISLGILTTYTSH  87

Query  390   LLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLG  569
             +LG CL ++PKSK Y DIG  AFG  GR++A+ FIYLEIFMALVSYTISLHDN+   F  
Sbjct  88    ILGNCLRRNPKSKSYSDIGHSAFGRHGRLIASLFIYLEIFMALVSYTISLHDNIYAAFPA  147

Query  570   THLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVF  749
             T    +      S+L TV+AV +ALPSLW RDLSSISFLSS GILMS +IF +V  TAVF
Sbjct  148   TFSHHSNGHFPASKL-TVVAVAIALPSLWIRDLSSISFLSSGGILMSAIIFGSVVYTAVF  206

Query  750   GVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTI  929
             G V  + +IP L L NIP VSG+Y F + GHIVFPN+YT+MKDPSKFTKVSIVSF+ VT 
Sbjct  207   GGVINDGKIPVLRLGNIPMVSGIYLFGFGGHIVFPNLYTSMKDPSKFTKVSIVSFATVTA  266

Query  930   LYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDH  1109
             LY ALA  GAKMFGP V+ QITLS+P+H++ TK+ALWATVLTPMTKYALEFAP AI+L+H
Sbjct  267   LYAALAITGAKMFGPSVNPQITLSLPKHLLVTKIALWATVLTPMTKYALEFAPLAIQLEH  326

Query  1110  SLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFY  1289
             SLP +M    K + RG  GS ++L+IL LAL VPYF +VLSLTGSLVS+ I+++LP  FY
Sbjct  327   SLPSTMTDRAKLVARGLFGSTMLLVILTLALTVPYFSYVLSLTGSLVSVTIAVILPSAFY  386

Query  1290  TKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAH  1427
              KI W  +S+     N+  ++ G +L V G+  S KLLV  L R H
Sbjct  387   LKICWDGMSKLTRAANIGFVILGCVLGVLGSFESSKLLVKELVRVH  432



>gb|KHN24049.1| Vacuolar amino acid transporter 1 [Glycine soja]
Length=363

 Score =   454 bits (1167),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 245/356 (69%), Positives = 291/356 (82%), Gaps = 2/356 (1%)
 Frame = +3

Query  354   IGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTI  533
             +GLG++CA+++H+LG CL K+PK   + DIG+ AFG+KGR +AA+ IY+EIFMALVSYTI
Sbjct  1     MGLGMMCAYSSHILGICLRKNPKLTSFVDIGKHAFGSKGRNVAATIIYMEIFMALVSYTI  60

Query  534   SLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSL  713
             SLHDNL TVFLGT+L L     S+SQLLTV+AVL+A+PSLW RDLSSISFLSS GILMSL
Sbjct  61    SLHDNLTTVFLGTNLNLHLPNFSSSQLLTVVAVLIAMPSLWIRDLSSISFLSSVGILMSL  120

Query  714   LIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFT  893
             LIF+ VA TA+ G V  NH IP LHL NIPSVSGLY F Y GHIVFP +YTAMKDPSKFT
Sbjct  121   LIFLCVAATALLGYVQSNHTIPVLHLHNIPSVSGLYVFGYGGHIVFPELYTAMKDPSKFT  180

Query  894   KVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSM-PRHVVFTKVALWATVLTPMTKY  1070
             KVSIVSF+VVT +YT L FMGAKMFG  V SQITLSM P H+V TK+ALWATV+ PMTKY
Sbjct  181   KVSIVSFAVVTAIYTTLGFMGAKMFGKDVKSQITLSMAPEHIV-TKIALWATVVAPMTKY  239

Query  1071  ALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLV  1250
             ALEF PFAI+L+H+LP SM    KTIIRG  GS  +L+IL LAL VPYFEHVLSLTGSLV
Sbjct  240   ALEFTPFAIQLEHALPSSMSARTKTIIRGCIGSFSLLVILTLALSVPYFEHVLSLTGSLV  299

Query  1251  SIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             S+ + ++LPC FY KI W +IS+PLL+ N+ LI+FG +LAV GT+SS +LL+ +LQ
Sbjct  300   SVAVCLILPCAFYVKICWGQISKPLLLLNLFLIIFGFVLAVMGTISSSQLLLKNLQ  355



>ref|XP_006400216.1| hypothetical protein EUTSA_v10015719mg [Eutrema salsugineum]
 gb|ESQ41669.1| hypothetical protein EUTSA_v10015719mg [Eutrema salsugineum]
Length=435

 Score =   454 bits (1167),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 257/434 (59%), Positives = 315/434 (73%), Gaps = 10/434 (2%)
 Frame = +3

Query  126   CPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLS  305
             C + +K  E    ++ +D     DL S      +A   NSSF+H+VINM+GMLIGLGQLS
Sbjct  10    CVEENKRCECGHEKQVKD-----DLGSDH----KASDENSSFLHSVINMVGMLIGLGQLS  60

Query  306   TPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAA  485
              PYA+E GGWIS  LLI LG++  +T+H+LG CL ++PKSK Y DIG  AFG  GR++A+
Sbjct  61    MPYAVEHGGWISILLLIFLGILTTYTSHILGNCLRRNPKSKSYTDIGYSAFGRHGRLVAS  120

Query  486   SFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRD  665
              FIYLEIFMALVSYTISLHDN++  F  T           ++L T +AV +ALPSLW RD
Sbjct  121   LFIYLEIFMALVSYTISLHDNISAAFPATFTNHHDGYFPAAKL-TAVAVAIALPSLWIRD  179

Query  666   LSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHI  845
             LSSISFLSS GILMS +IF +V  TA+FG V  + RIP L L NIP+VSG+Y F + GHI
Sbjct  180   LSSISFLSSGGILMSAIIFGSVVYTALFGGVIDDGRIPVLRLRNIPTVSGIYLFGFGGHI  239

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPN+YT+MKDPSKFTKVS+VSF+ VT LYTALAF GAKMFGP V+ QITLS+P+H++ T
Sbjct  240   VFPNLYTSMKDPSKFTKVSMVSFATVTALYTALAFTGAKMFGPTVNPQITLSLPKHLLVT  299

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalC  1205
             K+ALWATVLTPMTKYALEFAP AI+L+ SLP +M    K + RG  GS L+L+ILALAL 
Sbjct  300   KIALWATVLTPMTKYALEFAPLAIQLERSLPLTMSDRTKLVARGLVGSTLLLVILALALT  359

Query  1206  VPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTV  1385
             VPYF +VLSLTGSLVS+ I+++LP  FY KI W  +S      N+  +VFG LL V G+ 
Sbjct  360   VPYFGYVLSLTGSLVSVTIAVILPSAFYLKICWDGMSNFTRAANLGFVVFGCLLGVLGSF  419

Query  1386  SSFKLLVISLQRAH  1427
              S KLLV  L R H
Sbjct  420   DSSKLLVKELVRVH  433



>ref|XP_010673266.1| PREDICTED: vacuolar amino acid transporter 1 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   454 bits (1167),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 253/438 (58%), Positives = 324/438 (74%), Gaps = 15/438 (3%)
 Frame = +3

Query  108   IECSSC--CPDGHKHVEPASGE-RFEDQTAVKDLESSEEC--VEQAEKNNSSFMHAVINM  272
             +EC SC  C + +K  E    E +F+ +        S EC  ++Q  + + SF  ++INM
Sbjct  12    VECVSCELCVEENKMSECEHVEGKFKTE--------SNECTDIKQPVQRSCSFTQSIINM  63

Query  273   IGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQ  452
              GM+IGLGQLS  Y L+  GW+S FLL+GLG+ICA+T  L+GKCL K P+S+ + DIGQQ
Sbjct  64    TGMVIGLGQLSNSYGLQHAGWVSIFLLLGLGMICAYTACLIGKCLNKIPESRSFTDIGQQ  123

Query  453   AFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAV  632
             AFGTKG+I+AA F Y EIFM LVSYTI LHDNL  VF G   K+    L  S++LT +AV
Sbjct  124   AFGTKGKIIAAIFSYTEIFMGLVSYTILLHDNLDMVFTGIPFKVP--ILEKSKILTTIAV  181

Query  633   LVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVS  812
              + LPSLW RDLSSI+FLS+ GI+MS LIF+TV  TA+ GVV  NH IP L L  IP VS
Sbjct  182   FITLPSLWLRDLSSIAFLSAGGIIMSALIFLTVTSTAISGVVKANHNIPVLRLNEIPHVS  241

Query  813   GLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQI  992
             GLYA+SYAGH+VFPNIYT+MKDPSK+ KV +VSF++V  LYTALAF+GAKMFG  +SSQI
Sbjct  242   GLYAYSYAGHVVFPNIYTSMKDPSKYMKVVVVSFTIVMSLYTALAFLGAKMFGTDISSQI  301

Query  993   TLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSi  1172
             TLSMP+  V TK+ALWATVLTPMTKYAL+FAPFA++L+H+L    K   + IIR   GSI
Sbjct  302   TLSMPQDRVATKIALWATVLTPMTKYALQFAPFAVQLEHNLSSFKKSRTRKIIRSSIGSI  361

Query  1173  liliilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIV  1352
             +++ IL LAL VPYF++VLSLTGS VSI I I++PC FYTKI+  +IS+P L  NV++I 
Sbjct  362   ILITILTLALSVPYFQYVLSLTGSFVSISICIIIPCTFYTKIYLTEISKPRLFLNVIIIT  421

Query  1353  FGTLLAVSGTVSSFKLLV  1406
              G+++++ GT++S K L+
Sbjct  422   IGSVISIIGTIASSKSLI  439



>gb|EMS58406.1| hypothetical protein TRIUR3_25432 [Triticum urartu]
Length=375

 Score =   437 bits (1123),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 236/404 (58%), Positives = 289/404 (72%), Gaps = 39/404 (10%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             +   K  S+F  +VINM+GMLIGLGQLSTPYALE GGW S FLL+GLG++CA+T H++GK
Sbjct  7     QHHSKPTSTFAQSVINMVGMLIGLGQLSTPYALENGGWASIFLLVGLGIMCAYTAHIIGK  66

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGT--H  575
             CL ++P+SK                                      D +  VF G   H
Sbjct  67    CLDEEPRSKT-------------------------------------DTIPLVFAGVRLH  89

Query  576   LKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGV  755
             L +  ++LST+QLLTV+AVLVALPSLW R+LSSIS LS AGILMS++IFVT+ CTA FG 
Sbjct  90    LPIPWLRLSTTQLLTVIAVLVALPSLWLRNLSSISCLSFAGILMSMVIFVTILCTAAFGS  149

Query  756   VNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILY  935
             V     IP L L  IP+VSGLY FSYAGHIVFPNIYTAMKDPS FTKVS+ SFS+V +LY
Sbjct  150   VGLGKHIPVLRLDKIPTVSGLYMFSYAGHIVFPNIYTAMKDPSSFTKVSVTSFSMVALLY  209

Query  936   TALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSL  1115
             TALAF+GA +FGP V+SQ+TLSMP  ++ TKVALWATVLTP+TKYALEFAPFAI+L+H L
Sbjct  210   TALAFVGASLFGPSVNSQVTLSMPPGLLVTKVALWATVLTPVTKYALEFAPFAIQLEHHL  269

Query  1116  PPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTK  1295
             P +M    + IIRG  GS  +LIILALAL VPYF++VLSLTGSL+S+ IS++ PC FY K
Sbjct  270   PATMGPRARIIIRGSIGSAGLLIILALALSVPYFQYVLSLTGSLISVAISVIFPCAFYVK  329

Query  1296  IFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAH  1427
             I W ++SR +++ N  +I  G +LAV GT SS KLLV S+Q  H
Sbjct  330   IRWGRLSRHVVVLNAAMIAVGFVLAVVGTASSAKLLVKSIQNGH  373



>gb|KDO38650.1| hypothetical protein CISIN_1g0425812mg, partial [Citrus sinensis]
Length=277

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 174/244 (71%), Positives = 201/244 (82%), Gaps = 4/244 (2%)
 Frame = +3

Query  174  EDQTAVKDLESSEECVEQAEKNN---SSFMHAVINMIGMLIGLGQLSTPYALEKGGWISA  344
            E+ +A K   ++E+ ++ +E N+   SSF HAVINM GMLIGLGQLSTPYA+E GGW SA
Sbjct  35   EECSACKRDHTTEK-LDISENNSHAGSSFAHAVINMAGMLIGLGQLSTPYAIENGGWASA  93

Query  345  FLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVS  524
            FLLIGLGVICA++ HLLGKCL K+PKS+ Y DIGQ AFG KGR  AA+FIYLEIFMALVS
Sbjct  94   FLLIGLGVICAYSAHLLGKCLDKNPKSRSYIDIGQHAFGRKGRAAAATFIYLEIFMALVS  153

Query  525  YTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGIL  704
            YTI LHDNL TVF GT L L+  +LSTSQ+LTV+AVL+ALPSLW RDLSSISFLS  GIL
Sbjct  154  YTILLHDNLITVFSGTSLDLSWAKLSTSQMLTVIAVLIALPSLWLRDLSSISFLSVGGIL  213

Query  705  MSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPS  884
            MS+LIF++VA TA+FG V  NHRIP L+L  IP +SGLY FSYAGHIVFPN+Y AMKDPS
Sbjct  214  MSVLIFLSVAFTAIFGGVKANHRIPVLNLHKIPHISGLYIFSYAGHIVFPNLYKAMKDPS  273

Query  885  KFTK  896
            KFTK
Sbjct  274  KFTK  277



>ref|XP_010042736.1| PREDICTED: vacuolar amino acid transporter 1-like, partial [Eucalyptus 
grandis]
Length=403

 Score =   342 bits (877),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 164/230 (71%), Positives = 195/230 (85%), Gaps = 0/230 (0%)
 Frame = +3

Query  222  EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
            E+    NSSF HAVINM+GMLIGLGQLSTPYALE GGW SAFLLIGLG++CA+T+HLLGK
Sbjct  174  EENTGANSSFAHAVINMVGMLIGLGQLSTPYALENGGWSSAFLLIGLGMVCAYTSHLLGK  233

Query  402  CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
            CL K PKS+ Y DIGQ+A+G+KGRI+AA+FIYLEIF+ALVSYTISLHDNL+ VF GT + 
Sbjct  234  CLDKSPKSRSYTDIGQEAYGSKGRIIAATFIYLEIFLALVSYTISLHDNLSIVFPGTWIS  293

Query  582  LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
                 +S+ QLLTV+AVL+ALPSLW RDLSSISFLSS GILMS++IF +VA TA+FG V 
Sbjct  294  ARWTHMSSPQLLTVIAVLIALPSLWLRDLSSISFLSSGGILMSIIIFASVALTAIFGWVR  353

Query  762  PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
             ++ IP L + NIP +SGLY FS+AGHIVFP++Y +MKDPSKFTKVSIVS
Sbjct  354  SDNEIPALRIRNIPMISGLYVFSFAGHIVFPDLYKSMKDPSKFTKVSIVS  403



>gb|EYU32747.1| hypothetical protein MIMGU_mgv1a019144mg, partial [Erythranthe 
guttata]
Length=301

 Score =   326 bits (836),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 192/238 (81%), Gaps = 4/238 (2%)
 Frame = +3

Query  195  DLESSEECVEQA---EKNNS-SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGL  362
            +LE + + V+     ++NNS SF+HAVINM+GMLIGLGQLS PYALE GGW +AFLL+GL
Sbjct  64   ELERNNDDVKAGHAEDRNNSTSFLHAVINMVGMLIGLGQLSIPYALENGGWSTAFLLVGL  123

Query  363  GVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLH  542
            G  C++TTHLLG+C+ K+PKS+DYKDIG  AFG+KGRI++ +FIY+EIFMALVSYTISLH
Sbjct  124  GAACSYTTHLLGQCMAKNPKSRDYKDIGNHAFGSKGRIISTTFIYMEIFMALVSYTISLH  183

Query  543  DNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIF  722
            DNLAT F G H+     ++S  QLL  +AVLVA+P+LW RDLSSISFLS+AGIL+S+LIF
Sbjct  184  DNLATAFSGVHISSGWARMSPPQLLAAIAVLVAVPTLWLRDLSSISFLSTAGILLSVLIF  243

Query  723  VTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTK  896
              VAC A FG V  +  IP L +  IP+V GLY FS+AGHIVFPNIYTAMKDPSKFTK
Sbjct  244  AMVACAAAFGGVRADRGIPVLQMQRIPAVYGLYIFSFAGHIVFPNIYTAMKDPSKFTK  301



>emb|CDX85489.1| BnaA02g03240D [Brassica napus]
Length=432

 Score =   325 bits (833),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 198/435 (46%), Positives = 255/435 (59%), Gaps = 41/435 (9%)
 Frame = +3

Query  180   QTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIG  359
             +  VK+L  S E  E     NSSF+H+VINM+GMLIGLGQLS PYA+E GGWIS FLLI 
Sbjct  22    ENPVKELGLSHEASE-----NSSFLHSVINMVGMLIGLGQLSMPYAVESGGWISIFLLIS  76

Query  360   LGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISL  539
             LGV+  +T+H+LG CL ++PKSK Y DIG  AFG  GR+LA+ FIYLEIFMALVSYTISL
Sbjct  77    LGVLTTYTSHILGNCLRRNPKSKSYSDIGYSAFGLHGRLLASLFIYLEIFMALVSYTISL  136

Query  540   HDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLI  719
             HDN+A  F  T   L       ++ LT +AV +ALPSLW R+LSSIS+LSS GI MS +I
Sbjct  137   HDNIAAAFPATFTNLHNGSFPAAK-LTAVAVAIALPSLWIRNLSSISYLSSGGIFMSAVI  195

Query  720   FVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKV  899
             F++V  TAVFG V  + RIP L L NIP+VSG+Y F + GHIVFPN+YT+MKDPSKFTK+
Sbjct  196   FMSVVYTAVFGGVIDDGRIPVLRLGNIPTVSGVYLFGFGGHIVFPNLYTSMKDPSKFTKI  255

Query  900   --SIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPR------------HVVFTKVAL  1037
               SI+ F+ + +    +  +  K   P       L                HV   +V L
Sbjct  256   TGSILDFATLNV--QKMNLVNRKFADPRFKYYYRLKYMNYYYLHFFMEYCLHVKIIRVFL  313

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPPS--MKHHIKTIIRGGTGSililiilalalCVP  1211
              + +   M K  L+   F +       P   + +    I+ G                 P
Sbjct  314   TSFLRIKM-KNPLQAYSFTLRRKMYQRPRVVLNYRFYFILTG---------------IPP  357

Query  1212  YFEHV-LSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVS  1388
              F+ +  S+    +S+ IS++LPC FY KI W  +S+     NVV +VFG +L V G+  
Sbjct  358   NFQFLSFSIAPRFLSVTISVILPCAFYVKICWDGMSKFTRAANVVFVVFGCVLGVLGSFD  417

Query  1389  SFKLLVISLQRAHST  1433
             S KLLV  L R H  
Sbjct  418   SSKLLVNKLVRVHGN  432



>ref|XP_009126337.1| PREDICTED: vacuolar amino acid transporter 1 [Brassica rapa]
Length=256

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 180/240 (75%), Gaps = 6/240 (3%)
 Frame = +3

Query  180  QTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIG  359
            +  VK+L  S E  E     NSSF+H+VINM+GMLIGLGQLS PYA+E GGWIS FLLI 
Sbjct  22   ENPVKELGLSHEASE-----NSSFLHSVINMVGMLIGLGQLSMPYAVESGGWISIFLLIS  76

Query  360  LGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISL  539
            LGV+  +T+H+LG CL ++PKSK Y DIG  AFG  GR+LA+ FIYLEIFMALVSYTISL
Sbjct  77   LGVLTTYTSHILGNCLRRNPKSKSYSDIGYSAFGLHGRLLASLFIYLEIFMALVSYTISL  136

Query  540  HDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLI  719
            HDN+A  F  T   L       ++ LT +AV +ALPSLW R+LSSIS+LSS GI MS +I
Sbjct  137  HDNIAAAFPATFTNLHNGSFPAAK-LTAVAVAIALPSLWIRNLSSISYLSSGGIFMSAVI  195

Query  720  FVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKV  899
            F++V  TAVFG V  + RIP L L NIP+VSG+Y F + GHIVFPN+YT+MKDPSKFTKV
Sbjct  196  FMSVVYTAVFGGVIDDGRIPVLRLGNIPTVSGVYLFGFGGHIVFPNLYTSMKDPSKFTKV  255



>ref|XP_006436472.1| hypothetical protein CICLE_v10031131mg [Citrus clementina]
 ref|XP_006485611.1| PREDICTED: vacuolar amino acid transporter 1-like [Citrus sinensis]
 gb|ESR49712.1| hypothetical protein CICLE_v10031131mg [Citrus clementina]
 gb|KDO48798.1| hypothetical protein CISIN_1g0087541mg [Citrus sinensis]
Length=554

 Score =   285 bits (729),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 157/411 (38%), Positives = 247/411 (60%), Gaps = 6/411 (1%)
 Frame = +3

Query  189   VKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGV  368
             +KD +SS    E      SS+  A++N + +L G+G LSTPYA ++GGW    +L+  GV
Sbjct  146   IKDSKSSRVSHEHPISRQSSYAQALLNGMNVLCGVGILSTPYAAKEGGWFGLLILVAFGV  205

Query  369   ICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDN  548
             +  +T  LL +CL  +P  + Y DIGQ AFGT GRI  +  +Y E++   + Y I   DN
Sbjct  206   LSFYTGILLRRCLDSEPGLETYPDIGQAAFGTAGRIAVSVILYAELYACCIEYIILESDN  265

Query  549   LATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVT  728
             L+++F   HL   G  L++  L  +M  L  LP+ W RDL+ +S++S+ G++ S+L+ + 
Sbjct  266   LSSLFPNAHLSFGGFYLNSHHLFALMTTLAVLPTCWLRDLTVLSYISAGGVIASILVVLC  325

Query  729   VACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIV  908
             +    +   VN + +  PL+L  +P   GLY + Y+GH VFPNIYT+M  P++F KV I 
Sbjct  326   LFWVGLVDQVNIHSKGTPLNLATLPVAIGLYGYCYSGHAVFPNIYTSMAQPNQFPKVLIT  385

Query  909   SFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAP  1088
              F + T +Y  +A+MG  MFG    SQ TL+MP+ +V TK+A+W TV+ P TKYAL  +P
Sbjct  386   CFLICTAMYAGVAYMGYTMFGESTLSQFTLNMPQDLVATKIAVWTTVVNPFTKYALTISP  445

Query  1089  FAIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGI  1262
              A+ L+  +P + +K HI  I IR    + L++  L + L +P+F  V+SL GSL+++ +
Sbjct  446   VAMSLEELIPSNHLKSHIYAICIR----TALVISTLLVGLAIPFFGLVMSLIGSLLTMLV  501

Query  1263  SIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             +++LPC  +  I   K +R  +   V++IV G + +  G+ S+   +V SL
Sbjct  502   TLILPCLCFLSILRGKATRLQVALCVIIIVAGVVSSAIGSYSAILKIVESL  552



>gb|KFK25899.1| hypothetical protein AALP_AA8G177100 [Arabis alpina]
Length=278

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/306 (54%), Positives = 200/306 (65%), Gaps = 30/306 (10%)
 Frame = +3

Query  510   MALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLS  689
             MALVSYTISLHDN+A  F  T           ++L T +AV +ALPSLW RDLSS+SFLS
Sbjct  1     MALVSYTISLHDNIAAAFPATFTNYHNGHFPAAKL-TAVAVAIALPSLWIRDLSSMSFLS  59

Query  690   SAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTA  869
             S GILMS +IF +V  TAVFG +  + RIP L L NIP VSG+Y F + GHIVFPN+YT+
Sbjct  60    SGGILMSAIIFGSVVYTAVFGGIIGDGRIPVLRLGNIPRVSGIYLFGFGGHIVFPNLYTS  119

Query  870   MKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATV  1049
             MKDPSKFTKVSIVSF++VT LYTALA  GA                             +
Sbjct  120   MKDPSKFTKVSIVSFTMVTALYTALAITGA-----------------------------I  150

Query  1050  LTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVL  1229
             LTPMTKYALEFAP AI+L+ SLP +M    K + RG  GS L+L+ILALAL VPYF +VL
Sbjct  151   LTPMTKYALEFAPLAIQLERSLPSTMTDRTKLVARGLVGSALLLVILALALTVPYFGYVL  210

Query  1230  SLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVI  1409
             SLTGSLVS  I++ LP  FY KI W  +S+     N+ ++VFG +L V G+  S K+LV 
Sbjct  211   SLTGSLVSGTIAVTLPSAFYLKICWDGMSKFKRAVNLGIVVFGCVLGVMGSFDSSKMLVK  270

Query  1410  SLQRAH  1427
              L R H
Sbjct  271   ELIRVH  276



>ref|XP_008387785.1| PREDICTED: vacuolar amino acid transporter 1-like [Malus domestica]
Length=544

 Score =   278 bits (712),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 150/388 (39%), Positives = 239/388 (62%), Gaps = 4/388 (1%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             ++   SF  AVIN + +L G+G L+TPYA+ +GGW+S  LL   GVIC +T  LL +CL 
Sbjct  150   QERCCSFSQAVINGVNVLCGIGLLTTPYAIREGGWLSLILLAFFGVICCYTGILLKRCLE  209

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG  590
               P  + Y DIGQ AFG+ GR   +  +YLE++ A V +   + DNLA+ F  TH+   G
Sbjct  210   SCPGLRTYPDIGQAAFGSAGRFFLSIILYLELYAACVEFLTMMXDNLASAFPNTHMTFAG  269

Query  591   IQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNH  770
             I L   Q+  +++ LV LP++W ++LS +S+LS  G++ S+L+ + +    V   V  +H
Sbjct  270   IDLDCHQIFAIISTLVILPTVWLQNLSLLSYLSVGGVVASILVALCLLWVGVVNQVGFHH  329

Query  771   RIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAF  950
             +   L+L +I    G+Y F +AGH VFPNIYT+M++PS+F+ V I S +    +YT +A 
Sbjct  330   KGSALNLADISVTIGIYGFGFAGHSVFPNIYTSMREPSQFSAVLITSVTFCFFIYTGVAV  389

Query  951   MGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-M  1127
              G  MFG  + SQ TL+MP+  V +K+++W TV+ PMTKYAL   P A+ L+   P + M
Sbjct  390   CGFMMFGDSIHSQFTLNMPKQFVASKISVWTTVVIPMTKYALTMTPVALSLEELFPDAWM  449

Query  1128  KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
               H+ +II     ++L+L  L +A+  PYF  V++L GS V++ +++V PC  Y K+   
Sbjct  450   GSHLVSII---VRTLLVLSTLXVAMNFPYFGSVMALIGSFVAMLVAVVFPCVCYLKLHSG  506

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             ++++  +   +++I  G + ++ GT S+
Sbjct  507   RLTKLQIATCIMIISVGVVCSIIGTYSA  534



>ref|XP_004307364.1| PREDICTED: vacuolar amino acid transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=551

 Score =   278 bits (710),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/408 (37%), Positives = 238/408 (58%), Gaps = 4/408 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD +S           +SSF  AV+N I +L G+G LSTPYA+++GGWI   +L    V+
Sbjct  146   KDDKSKISQDHHPMSRHSSFAQAVVNGINVLCGVGILSTPYAVKEGGWIGLSILFIFAVL  205

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL   P  + Y DIGQ AFGT GRI  +  +Y+E++   + Y I   DNL
Sbjct  206   SFYTGLLLRYCLDSQPGLETYPDIGQAAFGTPGRIAISIILYVELYACCIEYIILEGDNL  265

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             +++F   HL L G +L+   L  ++  L  LP++W RDLS +S++S+ G++ S+++ + +
Sbjct  266   SSLFPNAHLNLGGYELNAHVLFAILTTLAVLPTVWLRDLSVLSYISAGGVIASIMVVLCL  325

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V    +  PL+L  +P   GLY + Y+GH VFPNIYT+++ P+++  + +  
Sbjct  326   FWVGLVDGVGFESKGTPLNLATLPVAMGLYGYCYSGHAVFPNIYTSLEKPNQYPLILLTC  385

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F + TI+Y  +A MG  MFG    SQ TL+MP  +V TK+A+W TV+ P TKYAL  +P 
Sbjct  386   FCICTIMYAGVAVMGYTMFGEATLSQFTLNMPHDLVATKIAVWTTVVNPFTKYALTMSPV  445

Query  1092  AIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIV  1271
             A+ L+  +P          IR G    L+   L + LC+P+F  ++SL GSL ++ ++++
Sbjct  446   AMSLEELVPSDKSRMYSIFIRTG----LVFSTLVVGLCIPFFGLMMSLIGSLFTMLVALI  501

Query  1272  LPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             LPC  Y  I   +++R  +I  +++I  G + +V GT S+   +V +L
Sbjct  502   LPCACYLTIRKEQVTRFQMILCIIIITVGVVASVFGTYSAVSKIVENL  549



>ref|XP_006352151.1| PREDICTED: vacuolar amino acid transporter 1-like [Solanum tuberosum]
Length=525

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 161/434 (37%), Positives = 250/434 (58%), Gaps = 11/434 (3%)
 Frame = +3

Query  129   PDGHKHVEPASGERFEDQTAVKDLESSEECVEQAE----KNNSSFMHAVINMIGMLIGLG  296
             P  HK + P + E   ++   K +   E+  + A+       SS+  AV+N + +L G+G
Sbjct  97    PSLHKPLIPPAEE---EKAVYKHISHDEKPSKDADGLPISRQSSYGQAVVNGMNVLCGVG  153

Query  297   QLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRI  476
              LSTPYA+++GGW    +L   GV+  +T  LL  CL   P  + Y DIGQ AFGT GRI
Sbjct  154   ILSTPYAVKEGGWAGLPILFIFGVLSFYTGMLLRYCLDSQPGIETYPDIGQAAFGTTGRI  213

Query  477   LAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLW  656
               +  +Y+E++ + V   I   DNL+ +F   HL L G +L    L  V+A L  LP++W
Sbjct  214   FVSIILYVELYASCVDIIIVEGDNLSAIFPNAHLSLGGFELDARHLFVVLATLAVLPTVW  273

Query  657   FRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYA  836
              RDLS +S++S  G++ S+L+ + +    +   V    +   L+LP +P   GLY F + 
Sbjct  274   MRDLSVLSYISVGGVIASVLVVLCLYWAGLVDHVGFESKGTVLNLPTLPVAIGLYGFCFG  333

Query  837   GHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHV  1016
             GH VFPNIYT++ D S+F  V + SF VVT+LY   A +G  MFG    SQ TL++P+ +
Sbjct  334   GHAVFPNIYTSLADRSQFPAVLLTSFVVVTLLYGGTAVLGYLMFGDSTESQFTLNLPKGL  393

Query  1017  VFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiila  1193
             + +KVA+W TV+ P TKYAL  +P A+ L+  LPP   K H+  I+     + L +    
Sbjct  394   IASKVAVWTTVVNPFTKYALTLSPVAMSLEELLPPKHAKSHVYPIL---IRTALTISTSL  450

Query  1194  lalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAV  1373
             + L VP+F  +L+LTGSL+++ ++++LPC  + +I   KIS   +   V++I  GT  A+
Sbjct  451   VGLAVPFFGLMLALTGSLLTMLVTLILPCVCFLRILKGKISHLQVTICVLIITIGTASAL  510

Query  1374  SGTVSSFKLLVISL  1415
              G+ S+   ++ S+
Sbjct  511   IGSYSALSNIIQSM  524



>ref|XP_002984621.1| hypothetical protein SELMODRAFT_181183 [Selaginella moellendorffii]
 gb|EFJ14266.1| hypothetical protein SELMODRAFT_181183 [Selaginella moellendorffii]
Length=531

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/403 (37%), Positives = 239/403 (59%), Gaps = 6/403 (1%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
              + +     F  A++N + +L G+G L+TPYA+++GGWI   LL  L VIC +T  +L K
Sbjct  132   REPQDEGCGFTQALLNGMNVLAGVGILTTPYAVKQGGWIGLVLLFSLAVICCYTGIILRK  191

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL   P  K Y DIGQ AFG+ GR++ +  +Y+E++   V + I   DNL+ +F GT L 
Sbjct  192   CLESRPGLKTYPDIGQAAFGSIGRLIISIVLYVELYACCVEFLILEGDNLSVLFPGTQLS  251

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             L G  L + +L  ++A L  LP++W R+L  +S++S+ G++ SL++  TV        + 
Sbjct  252   LFGYTLDSHKLFAILAALFILPTVWLRNLHLLSYVSAGGVVASLIVVFTVFWVGAVDGIG  311

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              +     + +  +P   GLY F Y+GH VFPNIYT+MK+ S++ +V  +SF +   L+ A
Sbjct  312   FHETGKFIDIAGLPVSLGLYGFCYSGHAVFPNIYTSMKNKSRYNRVLTISFVLCAGLFGA  371

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLP-  1118
             +A MG KMFG    SQ+TL+MP+  V +K+ALW  V+ P TKYAL   P A+ L+  LP 
Sbjct  372   VAAMGYKMFGDKTRSQVTLNMPKEFVASKIALWTIVINPFTKYALTITPVALSLEELLPI  431

Query  1119  --PSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYT  1292
                  + H+ +I+     ++L+   + +A+ VP+F  V++  GS +S+ +S++LPC  Y 
Sbjct  432   NSSRFQQHLASIV---IRTLLVASTVVVAISVPFFGFVMAFIGSFLSMAVSLILPCACYM  488

Query  1293  KIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQR  1421
             +I   K+S   L   + +++ G + AV GT+SS   ++  L+ 
Sbjct  489   RIRGSKLSLMELTLGIGIMLVGIVCAVGGTLSSLDAIIKQLKN  531



>ref|XP_002978694.1| hypothetical protein SELMODRAFT_152799 [Selaginella moellendorffii]
 gb|EFJ20141.1| hypothetical protein SELMODRAFT_152799 [Selaginella moellendorffii]
Length=532

 Score =   276 bits (707),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/403 (37%), Positives = 239/403 (59%), Gaps = 6/403 (1%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
              + +     F  A++N + +L G+G L+TPYA+++GGWI   LL  L VIC +T  +L K
Sbjct  133   REPQDEGCGFTQALLNGMNVLAGVGILTTPYAVKQGGWIGLVLLFSLAVICCYTGIILRK  192

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL   P  K Y DIGQ AFG+ GR++ +  +Y+E++   V + I   DNL+ +F GT L 
Sbjct  193   CLESRPGLKTYPDIGQAAFGSIGRLIISIVLYVELYACCVEFLILEGDNLSVLFPGTQLS  252

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             L G  L + +L  ++A L  LP++W R+L  +S++S+ G++ SL++  TV        + 
Sbjct  253   LFGYTLDSHKLFAILAALFILPTVWLRNLHLLSYVSAGGVVASLIVVFTVFWVGAVDGIG  312

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              +     + +  +P   GLY F Y+GH VFPNIYT+MK+ S++ +V  +SF +   L+ A
Sbjct  313   FHETGKFIDIAGLPVSLGLYGFCYSGHAVFPNIYTSMKNKSRYNRVLTISFVLCAGLFGA  372

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLP-  1118
             +A MG KMFG    SQ+TL+MP+  V +K+ALW  V+ P TKYAL   P A+ L+  LP 
Sbjct  373   VAAMGYKMFGDKTRSQVTLNMPKEFVASKIALWTIVINPFTKYALTITPVALSLEELLPI  432

Query  1119  --PSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYT  1292
                  + H+ +I+     ++L+   + +A+ VP+F  V++  GS +S+ +S++LPC  Y 
Sbjct  433   NSSRFQQHLASIV---IRTLLVASTVVVAISVPFFGFVMAFIGSFLSMAVSLILPCACYM  489

Query  1293  KIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQR  1421
             +I   K+S   L   + +++ G + AV GT+SS   ++  L+ 
Sbjct  490   RIRGSKLSLMELTLGIGIMLVGIVCAVGGTLSSLDAIIKQLKN  532



>ref|XP_006827413.1| hypothetical protein AMTR_s00009p00061580 [Amborella trichopoda]
 gb|ERM94829.1| hypothetical protein AMTR_s00009p00061580 [Amborella trichopoda]
Length=557

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 157/426 (37%), Positives = 257/426 (60%), Gaps = 14/426 (3%)
 Frame = +3

Query  165   ERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISA  344
             +R   Q A+ + + ++   E       SF  AV+N + ++ G+G LSTP+A+++GGW+  
Sbjct  136   KRVPSQKALAEQKPAKISHEVPLSRQCSFGQAVLNGMNVMCGVGILSTPFAIKEGGWMGI  195

Query  345   FLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVS  524
             F+LI   +I  +T  LL  CL  +P  + Y DIGQ AFGT GR   +  +Y+E++   V 
Sbjct  196   FVLIAFALIALYTGILLRDCLDSEPGLQTYPDIGQAAFGTIGRFAISIILYVELYACCVE  255

Query  525   YTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGIL  704
             + I   DNL+++F G HL L G+QL++ QL  V+A L  LP++W RDLS +S++S+ G++
Sbjct  256   FIILEGDNLSSLFPGAHLNLAGLQLNSHQLFAVVATLAVLPTVWLRDLSILSYISAGGVI  315

Query  705   MSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPS  884
              S+L+ + +    V   V   ++   L+L ++P   GLY + Y+GH VFPNIYT+MK PS
Sbjct  316   SSMLVVLCLFWVGVVDQVGLQYKPHALNLSSLPVAIGLYGYCYSGHAVFPNIYTSMKKPS  375

Query  885   KFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMT  1064
             +F  V I SF++ T +Y  +AFMG  MFG  + SQ TL+MP  +  +K+A+W TV+ P T
Sbjct  376   QFPVVLITSFAICTAMYAGVAFMGYSMFGESIVSQFTLNMPHQLTASKIAVWTTVVNPFT  435

Query  1065  KYALEFAP------FAIELDHSLPPSM---KHHIKTIIRGGTGSililiilalalCVPYF  1217
             KY   F+        A+ L+  L PSM    + I  +IR    + L++  L +AL VP+F
Sbjct  436   KYPSHFSYTDIGMFLALSLEE-LIPSMHLKSYFIAILIR----TALVVSTLLVALSVPFF  490

Query  1218  EHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFK  1397
               V++L GSL+++ ++++LPC  Y  I   K++   ++  ++++V G + +V GT ++  
Sbjct  491   GLVMALIGSLLTMLVTMILPCACYLSIVRRKVTIFQVLLCILILVIGIISSVVGTYTAVA  550

Query  1398  LLVISL  1415
              ++ S+
Sbjct  551   GIIRSM  556



>ref|XP_006436470.1| hypothetical protein CICLE_v10031131mg [Citrus clementina]
 gb|ESR49710.1| hypothetical protein CICLE_v10031131mg [Citrus clementina]
Length=381

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/384 (39%), Positives = 233/384 (61%), Gaps = 6/384 (2%)
 Frame = +3

Query  273   IGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQ  452
             + +L G+G LSTPYA ++GGW    +L+  GV+  +T  LL +CL  +P  + Y DIGQ 
Sbjct  1     MNVLCGVGILSTPYAAKEGGWFGLLILVAFGVLSFYTGILLRRCLDSEPGLETYPDIGQA  60

Query  453   AFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAV  632
             AFGT GRI  +  +Y E++   + Y I   DNL+++F   HL   G  L++  L  +M  
Sbjct  61    AFGTAGRIAVSVILYAELYACCIEYIILESDNLSSLFPNAHLSFGGFYLNSHHLFALMTT  120

Query  633   LVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVS  812
             L  LP+ W RDL+ +S++S+ G++ S+L+ + +    +   VN + +  PL+L  +P   
Sbjct  121   LAVLPTCWLRDLTVLSYISAGGVIASILVVLCLFWVGLVDQVNIHSKGTPLNLATLPVAI  180

Query  813   GLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQI  992
             GLY + Y+GH VFPNIYT+M  P++F KV I  F + T +Y  +A+MG  MFG    SQ 
Sbjct  181   GLYGYCYSGHAVFPNIYTSMAQPNQFPKVLITCFLICTAMYAGVAYMGYTMFGESTLSQF  240

Query  993   TLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-MKHHIKTI-IRGGTG  1166
             TL+MP+ +V TK+A+W TV+ P TKYAL  +P A+ L+  +P + +K HI  I IR    
Sbjct  241   TLNMPQDLVATKIAVWTTVVNPFTKYALTISPVAMSLEELIPSNHLKSHIYAICIR----  296

Query  1167  SililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVL  1346
             + L++  L + L +P+F  V+SL GSL+++ ++++LPC  +  I   K +R  +   V++
Sbjct  297   TALVISTLLVGLAIPFFGLVMSLIGSLLTMLVTLILPCLCFLSILRGKATRLQVALCVII  356

Query  1347  IVFGTLLAVSGTVSSFKLLVISLQ  1418
             IV G + +  G+ S+   +V SL 
Sbjct  357   IVAGVVSSAIGSYSAILKIVESLS  380



>ref|XP_006436471.1| hypothetical protein CICLE_v10031131mg [Citrus clementina]
 gb|ESR49711.1| hypothetical protein CICLE_v10031131mg [Citrus clementina]
Length=404

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/384 (39%), Positives = 233/384 (61%), Gaps = 6/384 (2%)
 Frame = +3

Query  273   IGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQ  452
             + +L G+G LSTPYA ++GGW    +L+  GV+  +T  LL +CL  +P  + Y DIGQ 
Sbjct  24    MNVLCGVGILSTPYAAKEGGWFGLLILVAFGVLSFYTGILLRRCLDSEPGLETYPDIGQA  83

Query  453   AFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAV  632
             AFGT GRI  +  +Y E++   + Y I   DNL+++F   HL   G  L++  L  +M  
Sbjct  84    AFGTAGRIAVSVILYAELYACCIEYIILESDNLSSLFPNAHLSFGGFYLNSHHLFALMTT  143

Query  633   LVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVS  812
             L  LP+ W RDL+ +S++S+ G++ S+L+ + +    +   VN + +  PL+L  +P   
Sbjct  144   LAVLPTCWLRDLTVLSYISAGGVIASILVVLCLFWVGLVDQVNIHSKGTPLNLATLPVAI  203

Query  813   GLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQI  992
             GLY + Y+GH VFPNIYT+M  P++F KV I  F + T +Y  +A+MG  MFG    SQ 
Sbjct  204   GLYGYCYSGHAVFPNIYTSMAQPNQFPKVLITCFLICTAMYAGVAYMGYTMFGESTLSQF  263

Query  993   TLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-MKHHIKTI-IRGGTG  1166
             TL+MP+ +V TK+A+W TV+ P TKYAL  +P A+ L+  +P + +K HI  I IR    
Sbjct  264   TLNMPQDLVATKIAVWTTVVNPFTKYALTISPVAMSLEELIPSNHLKSHIYAICIR----  319

Query  1167  SililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVL  1346
             + L++  L + L +P+F  V+SL GSL+++ ++++LPC  +  I   K +R  +   V++
Sbjct  320   TALVISTLLVGLAIPFFGLVMSLIGSLLTMLVTLILPCLCFLSILRGKATRLQVALCVII  379

Query  1347  IVFGTLLAVSGTVSSFKLLVISLQ  1418
             IV G + +  G+ S+   +V SL 
Sbjct  380   IVAGVVSSAIGSYSAILKIVESLS  403



>emb|CDP06590.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   272 bits (696),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 163/423 (39%), Positives = 245/423 (58%), Gaps = 37/423 (9%)
 Frame = +3

Query  156   ASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGW  335
             ASG R     ++++L + ++C         S++  ++N I  L G+G LSTPYA+++GGW
Sbjct  84    ASGSRL----SIEELPTPKQC---------SYVQTILNAINALCGIGILSTPYAVKEGGW  130

Query  336   ISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMA  515
             +S  LL+  GVI  +T  LL +CL   P+ + Y DIGQ AFG  GRI  A  +YLE++ +
Sbjct  131   LSLILLLIFGVITCYTGILLKRCLESSPELETYPDIGQAAFGMIGRICIAIVLYLELYSS  190

Query  516   LVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSA  695
              V Y I + DN+A++F   HL   GI + + QL  +++ LV LP++W R+LSS+S++S  
Sbjct  191   CVEYLIMMSDNMASMFPHAHLDFAGIHMDSYQLCAIVSTLVILPTVWLRNLSSLSYISVG  250

Query  696   GILMSLLIFVTVACTAVFGVVN-----PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNI  860
             G++M   + V V C    GV+N     P  R+    L  +P   GLY+F Y  H VFP+I
Sbjct  251   GVIM---LVVVVICLLWVGVINEVGFHPGGRV--FDLAKLPLTIGLYSFCYGSHSVFPDI  305

Query  861   YTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALW  1040
             Y++MK+PS+F  + ++SFS    LYT +A  G  MFG  V  Q TL++P     + VA  
Sbjct  306   YSSMKEPSQFPSILVISFSTAFFLYTGVAICGFSMFGDAVKPQFTLNLPTTFTASGVAAL  365

Query  1041  ATVLTPMTKYALEFAPFAIELDHSLPPSMKHH------IKTIIRGGTGSililiilalal  1202
               VLTP++KYAL   P A  L+  LP S          I+T++ G T        LA+AL
Sbjct  366   VVVLTPVSKYALTLIPVAFGLEDLLPSSRLRSYGVSMLIRTMLVGST--------LAIAL  417

Query  1203  CVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGT  1382
              VPYF  V++L GSL+ + +S++LPC  Y +I   K++   +    V++V G L ++ GT
Sbjct  418   TVPYFGSVMALIGSLLVMLVSLILPCACYIRISGGKLTNLQIAVCTVIMVVGLLCSIVGT  477

Query  1383  VSS  1391
              S+
Sbjct  478   YSA  480



>ref|XP_009116163.1| PREDICTED: vacuolar amino acid transporter 1 [Brassica rapa]
Length=533

 Score =   273 bits (699),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 151/423 (36%), Positives = 237/423 (56%), Gaps = 2/423 (0%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKG  329
             E A+  +    + +    SS    E    N+SSF  AV+N + +L G+G LSTPYA+++G
Sbjct  112   EEAAKRKRSSHSLLPSKASSRVSHEMGISNDSSFGQAVLNGVNVLCGVGILSTPYAVKEG  171

Query  330   GWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIF  509
             GW+   +L   GV+C +T  LL  CL   P  + Y DIG  AFGT GRIL +  +YLE++
Sbjct  172   GWLGLLILFAFGVLCFYTGLLLRYCLDSHPDLQTYPDIGHAAFGTTGRILVSVILYLELY  231

Query  510   MALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLS  689
                V Y I   DNL+++F    L + G  L    L  ++  +  LP++W RDLS +S++S
Sbjct  232   AMSVEYIILESDNLSSLFPNAALSIGGFHLDAPHLFALLTTIAVLPTVWLRDLSILSYIS  291

Query  690   SAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTA  869
             + G++ S+L+ + +    +   V  + +  PL+L  +P   GLY + Y+GH VFPNIYT+
Sbjct  292   AGGVIASVLVVLCLFWVGLIDEVGIHSKGTPLNLATLPVSVGLYGYCYSGHGVFPNIYTS  351

Query  870   MKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATV  1049
             M  PS+F  V +  F + T++Y  +A MG  MFG    SQ TL++P+ +V +K+ALW TV
Sbjct  352   MAKPSQFPAVLVTCFGICTLMYAGVAVMGYSMFGESTESQFTLNLPQDLVASKIALWTTV  411

Query  1050  LTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVL  1229
             ++P TKYAL  +P A+ L+  LP    H           S L    L + L +P+F  V+
Sbjct  412   VSPFTKYALTLSPVAMSLEELLPS--NHGKSRFYAIAIRSALAFSTLLVGLAIPFFGLVM  469

Query  1230  SLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVI  1409
             SL GS +++ I+++LP   +  I   K++   +   +V+I  G + +  GT S+   ++ 
Sbjct  470   SLIGSFLTMLITLILPPACFLSILRTKVTPTQVALCIVIITVGAVCSAMGTYSALSKIIE  529

Query  1410  SLQ  1418
              L 
Sbjct  530   KLS  532



>ref|XP_007009920.1| Transmembrane amino acid transporter family protein isoform 3 
[Theobroma cacao]
 ref|XP_007009922.1| Transmembrane amino acid transporter family protein isoform 3 
[Theobroma cacao]
 gb|EOY18730.1| Transmembrane amino acid transporter family protein isoform 3 
[Theobroma cacao]
 gb|EOY18732.1| Transmembrane amino acid transporter family protein isoform 3 
[Theobroma cacao]
Length=551

 Score =   274 bits (700),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 153/428 (36%), Positives = 251/428 (59%), Gaps = 7/428 (2%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P    R   Q+   D ++S+   E      SS+  AV+N I +L G+G LSTPYA
Sbjct  129   HSLLPPIPSRR---QSVRVDDKTSKVSHELPISRQSSYGQAVLNGINVLCGVGILSTPYA  185

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
              ++GGW+   +L    V+  +T  LL +CL  +P  + Y DIGQ AFGT GRI  +  +Y
Sbjct  186   AKEGGWLGLIILFTFAVLSFYTGLLLRQCLDSEPGLETYPDIGQAAFGTAGRIAVSIILY  245

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   V Y I   DNL+++F   H+ L G +L++ +L  +M  L  LP++W RDLS +
Sbjct  246   VELYACCVEYIILEGDNLSSLFPNAHISLGGFELNSQRLFALMTTLAVLPTVWLRDLSVL  305

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+L+ + +    +   V  +++   L+L ++P   GLY + Y+GH VFPN
Sbjct  306   SYISAGGVVASVLVVLCLFWVGLVDQVGFHNKGTTLNLASLPVAVGLYGYCYSGHAVFPN  365

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT+M  P++F  V I  F + ++LY   A MG  MFG    SQ TL+MP+ ++ +K+A+
Sbjct  366   IYTSMAKPNQFPSVLIACFGICSLLYAGTAIMGYTMFGEATESQFTLNMPKDLIASKIAV  425

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPY  1214
             W TV+ P TKYAL  +P A+ L+  +P S +K HI  I+     + L++  L + L +P+
Sbjct  426   WTTVVNPFTKYALTMSPVAMSLEELIPSSHLKSHIYAIL---IRTSLVISTLIVGLSIPF  482

Query  1215  FEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSF  1394
             F  V+SL GS +++ ++++LP   Y  I   K++R      +++I  G + +  GT S+ 
Sbjct  483   FGLVMSLIGSSLTMLVTLILPPACYLSIVRGKVTRIQTTLCIIVIAVGVVSSAFGTYSAL  542

Query  1395  KLLVISLQ  1418
               +V +L+
Sbjct  543   SKIVENLR  550



>ref|XP_008233285.1| PREDICTED: vacuolar amino acid transporter 1 [Prunus mume]
 ref|XP_008233286.1| PREDICTED: vacuolar amino acid transporter 1 [Prunus mume]
 ref|XP_008233287.1| PREDICTED: vacuolar amino acid transporter 1 [Prunus mume]
Length=551

 Score =   273 bits (699),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 155/426 (36%), Positives = 242/426 (57%), Gaps = 13/426 (3%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P    R   +   K    S E        +SSF  AVIN I +L G+G LSTPYA
Sbjct  130   HSLLPPIHSRRSSIRKDDKPSRVSHE--HHPISRHSSFTQAVINGINVLCGVGILSTPYA  187

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
             +++GGW+   +L+   V+  +T  LL +CL   P  + Y DIGQ AFGT GRI  +  +Y
Sbjct  188   IKEGGWLGLSILLIFAVLSFYTGLLLRRCLDSQPGLETYPDIGQAAFGTGGRIAISIILY  247

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   + Y I   DNL+++F   HL L G  L +  L  ++  L  LP++W RDLS +
Sbjct  248   VELYACCIEYIILESDNLSSLFPNAHLSLGGYMLDSRILFAILTTLAVLPTVWLRDLSVL  307

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+++ + +    +   V   ++  PL+L  +P   GLY + Y+GH VFPN
Sbjct  308   SYISAGGVIASIVVVLCLFWVGLVDGVGFENKGTPLNLSTLPVAMGLYGYCYSGHAVFPN  367

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT++  P+++  + +  F + TILY  +A MG  MFG   +SQ TL+MP  +V +K+AL
Sbjct  368   IYTSLAKPNQYPAILLTCFVICTILYGGVAVMGYTMFGESTASQFTLNMPHDLVASKIAL  427

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYF  1217
             W TV+ P TKYAL  +P A+ L+  +P +  H    +IR    + L++  L + LC+P+F
Sbjct  428   WTTVVNPFTKYALTISPVAMSLEELVPSNKSHIYAILIR----TALVVSTLVVGLCIPFF  483

Query  1218  EHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISR-------PLLIFNVVLIVFGTLLAVS  1376
               V+S  GSL ++ ++++LPC  Y  I   +++R        ++I  VV   FGT  AVS
Sbjct  484   GLVMSFIGSLFTMLVTLILPCACYLSILRGRVTRLQATLCIIIIIVGVVSSAFGTYSAVS  543

Query  1377  GTVSSF  1394
               + S 
Sbjct  544   KIIQSL  549



>ref|XP_006291057.1| hypothetical protein CARUB_v10017172mg [Capsella rubella]
 gb|EOA23955.1| hypothetical protein CARUB_v10017172mg [Capsella rubella]
Length=471

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/400 (37%), Positives = 235/400 (59%), Gaps = 4/400 (1%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E A   +SSF  AV+N + +L G+G LSTPYA+++GGW+   +L   G++C +T  LL  
Sbjct  74    EMAISKDSSFGQAVLNGVNVLCGVGILSTPYAVKEGGWLGLIILFAFGILCFYTGLLLRY  133

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL   P  + Y DIG  AFG+ GRIL +  +YLE++   V Y I   DNL+++F    L 
Sbjct  134   CLDSHPDLQTYPDIGHAAFGSFGRILVSIILYLELYAMSVEYIILESDNLSSMFPNATLS  193

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             + G QL    L  ++  L  LP++W RDLS +S++S+ G++ S+L+ + +    V   V 
Sbjct  194   IGGFQLDAPHLFALLTTLAVLPTVWLRDLSVLSYISAGGVIASVLVVLCLFWIGVVDDVG  253

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              + +  PL+L  +P   GLY + Y+GH VFPNIYT+M  PS+F  V +  F + T++Y  
Sbjct  254   IHSKGTPLNLATLPVSVGLYGYCYSGHGVFPNIYTSMAKPSQFPAVLLTCFGICTLMYAG  313

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
             +A MG  MFG    SQ TL+MP+ +V +K+ALW TV+ P TKYAL  +P A+ L+  +P 
Sbjct  314   VAVMGYSMFGESTESQFTLNMPQDLVASKIALWTTVVNPFTKYALTLSPVAMSLEELIP-  372

Query  1122  SMKHHIKTIIRGGT-GSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKI  1298
                +H K+     T  S L    L + L +P+F  V+SL GS +++ I+++LP   +  I
Sbjct  373   --SNHGKSRFYAITIRSALAFSTLLVGLAIPFFGLVMSLIGSFLTMLITLILPPACFLSI  430

Query  1299  FWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
                K++   +   +++++ G + +V GT S+   ++  L 
Sbjct  431   VRSKVTPTQVTICILIMIVGAVCSVIGTYSALAKIIEKLN  470



>ref|XP_007009919.1| Transmembrane amino acid transporter family protein isoform 2, 
partial [Theobroma cacao]
 gb|EOY18729.1| Transmembrane amino acid transporter family protein isoform 2, 
partial [Theobroma cacao]
Length=544

 Score =   272 bits (695),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 151/421 (36%), Positives = 246/421 (58%), Gaps = 7/421 (2%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P    R   Q+   D ++S+   E      SS+  AV+N I +L G+G LSTPYA
Sbjct  129   HSLLPPIPSRR---QSVRVDDKTSKVSHELPISRQSSYGQAVLNGINVLCGVGILSTPYA  185

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
              ++GGW+   +L    V+  +T  LL +CL  +P  + Y DIGQ AFGT GRI  +  +Y
Sbjct  186   AKEGGWLGLIILFTFAVLSFYTGLLLRQCLDSEPGLETYPDIGQAAFGTAGRIAVSIILY  245

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   V Y I   DNL+++F   H+ L G +L++ +L  +M  L  LP++W RDLS +
Sbjct  246   VELYACCVEYIILEGDNLSSLFPNAHISLGGFELNSQRLFALMTTLAVLPTVWLRDLSVL  305

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+L+ + +    +   V  +++   L+L ++P   GLY + Y+GH VFPN
Sbjct  306   SYISAGGVVASVLVVLCLFWVGLVDQVGFHNKGTTLNLASLPVAVGLYGYCYSGHAVFPN  365

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT+M  P++F  V I  F + ++LY   A MG  MFG    SQ TL+MP+ ++ +K+A+
Sbjct  366   IYTSMAKPNQFPSVLIACFGICSLLYAGTAIMGYTMFGEATESQFTLNMPKDLIASKIAV  425

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPY  1214
             W TV+ P TKYAL  +P A+ L+  +P S +K HI  I+     + L++  L + L +P+
Sbjct  426   WTTVVNPFTKYALTMSPVAMSLEELIPSSHLKSHIYAIL---IRTSLVISTLIVGLSIPF  482

Query  1215  FEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSF  1394
             F  V+SL GS +++ ++++LP   Y  I   K++R      +++I  G + +  GT S+ 
Sbjct  483   FGLVMSLIGSSLTMLVTLILPPACYLSIVRGKVTRIQTTLCIIVIAVGVVSSAFGTYSAL  542

Query  1395  K  1397
              
Sbjct  543   S  543



>ref|XP_007218970.1| hypothetical protein PRUPE_ppa003746mg [Prunus persica]
 gb|EMJ20169.1| hypothetical protein PRUPE_ppa003746mg [Prunus persica]
Length=551

 Score =   271 bits (694),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/394 (37%), Positives = 229/394 (58%), Gaps = 6/394 (2%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P    R   +   K    S E        +SSF  AVIN I +L G+G LSTPYA
Sbjct  130   HSLLPPIHSRRSSIRKDDKPSRVSHE--HHPISRHSSFTQAVINGINVLCGVGILSTPYA  187

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
             +++GGW+   +L+   V+  +T  LL +CL   P  + Y DIGQ AFGT GRI  +  +Y
Sbjct  188   IKEGGWLGLSILLIFAVLSFYTGLLLRRCLDSQPGLETYPDIGQAAFGTGGRIAISIILY  247

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   + Y I   DNL+++F   HL L G  L +  L  ++  L  LP++W RDLS +
Sbjct  248   VELYACCIEYIILESDNLSSLFPNAHLSLGGYMLDSRILFAILTTLAVLPTVWLRDLSVL  307

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+++ + +    +   V   ++  PL+L  +P   GLY + Y+GH VFPN
Sbjct  308   SYISAGGVIASIVVVLCLFWVGLVDGVGFENKGTPLNLSTLPVAMGLYGYCYSGHAVFPN  367

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT++  P+++  + +  F + TILY  +A MG  MFG   +SQ TL+MP  +V +K+AL
Sbjct  368   IYTSLAKPNQYPAILLTCFVICTILYGGVAVMGYTMFGESTASQFTLNMPHDLVASKIAL  427

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYF  1217
             W TV+ P TKYAL  +P A+ L+  +P +  H    +IR    + L++  L + LC+P+F
Sbjct  428   WTTVVNPFTKYALTISPVAMSLEELVPSNKSHIYAILIR----TALVVSTLVVGLCIPFF  483

Query  1218  EHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISR  1319
               V+S  GSL ++ ++++LPC  Y  I   +++R
Sbjct  484   GLVMSFIGSLFTMLVTLILPCACYLSILRGRVTR  517



>ref|XP_003556242.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Glycine max]
 ref|XP_006606264.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Glycine max]
 ref|XP_006606265.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X3 
[Glycine max]
Length=544

 Score =   271 bits (692),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 154/402 (38%), Positives = 244/402 (61%), Gaps = 11/402 (3%)
 Frame = +3

Query  225   QAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKC  404
             +    + SF  AV+N I +L G+G LSTPYA + GGW+   +L+   +I  +T  LL  C
Sbjct  149   EVPSGHCSFGQAVLNGINVLCGVGILSTPYAAKVGGWLGLSILVIFAIISFYTGLLLRSC  208

Query  405   LGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL  584
             L  +P+ + Y DIGQ AFGT GRI  +  +Y+E++   + Y I   DNL+++F   HL L
Sbjct  209   LDSEPELETYPDIGQAAFGTTGRIAISIVLYVELYACCIEYIILEGDNLSSLFPSAHLNL  268

Query  585   TGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGV--V  758
              GI+L++  L  V+  L  LP++W RDLS +S++S+ G++ S+L+   V C    G+  V
Sbjct  269   GGIELNSHTLFAVITTLAVLPTVWLRDLSILSYISAGGVVASILV---VLCLLWVGIEDV  325

Query  759   NPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYT  938
               + +   L+L  +P   GLY + Y+GH VFPNIYT+M +P++F  V +  F + T+LY 
Sbjct  326   GFHSKGTTLNLATLPVAVGLYGYCYSGHAVFPNIYTSMANPNQFPGVLLACFGICTLLYA  385

Query  939   ALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLP  1118
               A +G  MFG  + SQ TL+MP+ +V TK+A+W TV+ P TKYAL  +P A+ L+  +P
Sbjct  386   GAAVLGYTMFGEAILSQFTLNMPKELVATKIAVWTTVVNPFTKYALTISPVAMSLEELIP  445

Query  1119  PS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYT  1292
              +  K ++ +I IR G    L+L  L + L VP+F  V+SL GSL+++ ++++LPC  + 
Sbjct  446   SNHAKSYLYSIFIRTG----LVLSTLVIGLSVPFFGLVMSLIGSLLTMLVTLILPCACFL  501

Query  1293  KIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             +I   K++R      + +I  G + +  G+ S+   +V SL+
Sbjct  502   RILRGKVTRTQAALCITIITVGVVCSAFGSYSALAEIVKSLR  543



>ref|XP_010555810.1| PREDICTED: vacuolar amino acid transporter 1-like [Tarenaya hassleriana]
 ref|XP_010555811.1| PREDICTED: vacuolar amino acid transporter 1-like [Tarenaya hassleriana]
 ref|XP_010555812.1| PREDICTED: vacuolar amino acid transporter 1-like [Tarenaya hassleriana]
Length=548

 Score =   270 bits (691),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/409 (37%), Positives = 245/409 (60%), Gaps = 4/409 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD + S    E     NSSF  AV+N + +L G+G LSTPYA ++GGW+   +L   G++
Sbjct  141   KDEKPSMVSHEMPISRNSSFGQAVMNGMNVLCGVGILSTPYAAKEGGWLGLLVLFAFGIL  200

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +P+ + Y DIGQ AFGT GRI+ +  +YLE++ + V Y I   DNL
Sbjct  201   SFYTGLLLRYCLDSEPELETYPDIGQAAFGTTGRIIVSIILYLELYASCVEYIILESDNL  260

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             +++F    L + G QL +  L  ++  L  LP++W RDLS +S++S+ G++ S+L+ + +
Sbjct  261   SSLFPNAGLSIGGYQLDSHHLFALITTLSVLPTVWLRDLSVLSYISAGGVIASVLVVLCL  320

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  + +   L+L  +P   GLY F Y+GH VFPNIYT+M  PS++  V +  
Sbjct  321   FWVGLVDDVGIHSKGTVLNLGTLPVAIGLYGFCYSGHAVFPNIYTSMAKPSQYPAVLLTC  380

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F + T++Y  +AFMG  MFG    SQ TL+MP+ +V +K+A+W TV+ P TKYAL  +P 
Sbjct  381   FGISTLMYAGVAFMGYTMFGESTQSQFTLNMPQDLVASKIAVWTTVVNPFTKYALTLSPV  440

Query  1092  AIELDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISI  1268
             A+ L+  +P S  K H+  I   G  ++L++  L + L +P+F  V+SL GS +++ I++
Sbjct  441   AMSLEELIPSSHSKSHLYAI---GIRTLLVVSTLFVGLSIPFFGLVMSLIGSFLTMLITL  497

Query  1269  VLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             +LP   +  I   K++   ++  +++I+ G + +  GT S+   ++  L
Sbjct  498   ILPPACFLSILGRKVTPLQVMVCILIIIVGGVSSTIGTYSALSKIIDQL  546



>ref|XP_006403529.1| hypothetical protein EUTSA_v10010278mg [Eutrema salsugineum]
 gb|ESQ44982.1| hypothetical protein EUTSA_v10010278mg [Eutrema salsugineum]
Length=535

 Score =   270 bits (690),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/398 (37%), Positives = 231/398 (58%), Gaps = 2/398 (1%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E A  N+SSF  AV+N + +L G+G LSTPYA+++GGW+   +L   G++C +T  LL  
Sbjct  138   EMAISNDSSFGQAVLNGVNVLCGVGILSTPYAVKEGGWLGLLILFAFGILCFYTGLLLRY  197

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL   P  + Y DIG  AFGT GRIL +  +YLE++   V Y I   DNL+++F    L 
Sbjct  198   CLDSHPDLQTYPDIGHAAFGTTGRILVSIILYLELYAMSVEYIILESDNLSSLFPNAALS  257

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             + G  L    L  ++  L  LP++W RDLS +S++S+ G++ S+L+ + +    +   V 
Sbjct  258   IGGFHLDAPHLFALLTTLAVLPTVWLRDLSILSYISAGGVIASVLVVMCLFWIGLVDEVG  317

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              + +  PL+L  +P   GLY + Y+GH VFPNIYT+M  PS+F  V +  F + T++Y  
Sbjct  318   IHSKGTPLNLATLPVSVGLYGYCYSGHGVFPNIYTSMAKPSQFPAVLLTCFGICTLMYAG  377

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
             +A MG  MFG  + SQ TL++P+++V +K+ALW TV+ P TKYAL  +P A+ L+  +P 
Sbjct  378   VAVMGYSMFGESIESQFTLNLPQNLVASKIALWTTVVNPFTKYALTLSPVAMSLEELIPS  437

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
                H           S L    L + L +P+F  V+SL GS +++ I+++LP   +  I 
Sbjct  438   --NHGKSRFYAIAIRSALAFSTLLVGLAIPFFGLVMSLIGSFLTMLITLILPPACFLSIL  495

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
               K++   +   +++I  G + +  GT S+   ++  L
Sbjct  496   RTKVTPTQVTICILIITVGAVCSAIGTYSALSKIIEKL  533



>ref|XP_003536340.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Glycine max]
 ref|XP_006589407.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Glycine max]
Length=545

 Score =   270 bits (691),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 154/403 (38%), Positives = 243/403 (60%), Gaps = 11/403 (3%)
 Frame = +3

Query  225   QAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKC  404
             +    + SF  A++N I +L G+G LSTPYA + GGW+   +L+   +I  +T  LL  C
Sbjct  150   EVPSRHCSFGQAMLNGINVLCGVGILSTPYAAKVGGWLGLSILVIFAIISFYTGLLLRSC  209

Query  405   LGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL  584
             L  +P+ + Y DIGQ AFGT GRI  +  +Y+E++   + Y I   DNL+++F   HL L
Sbjct  210   LDSEPELETYPDIGQAAFGTTGRIAISIVLYVELYACCIEYIILEGDNLSSLFPSAHLNL  269

Query  585   TGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGV--V  758
              GI+L++  L  V+  L  LP++W RDLS +S++S+ G++ S+L+   V C    G+  V
Sbjct  270   GGIELNSRTLFAVITTLAVLPTVWLRDLSILSYISAGGVVASILV---VLCLLWVGIEDV  326

Query  759   NPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYT  938
               + +   L+L  +P   GLY + Y+GH VFPNIYT+M +P++F  V +  F + T+LY 
Sbjct  327   GFHSKGTTLNLSTLPVAVGLYGYCYSGHAVFPNIYTSMANPNQFPGVLLACFGICTLLYA  386

Query  939   ALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLP  1118
               A MG  MFG  + SQ TL+MP+ +V T +A+W TV+ P TKYAL  +P A+ L+  +P
Sbjct  387   GAAVMGYTMFGEAILSQFTLNMPKELVATNIAVWTTVVNPFTKYALTISPVAMSLEELIP  446

Query  1119  PS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYT  1292
              +  K ++ +I IR G    L+L  L + L VP+F  V+SL GSL+++ ++++LPC  + 
Sbjct  447   SNHAKSYLYSIFIRTG----LVLSTLFIGLSVPFFGLVMSLIGSLLTMLVTLILPCACFL  502

Query  1293  KIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQR  1421
             +I   K++R      + +I  G + +  GT S+   +V SL+ 
Sbjct  503   RILRGKVTRIQAALCITIITVGVVCSAFGTYSALSEIVKSLRE  545



>ref|XP_006352150.1| PREDICTED: vacuolar amino acid transporter 1-like [Solanum tuberosum]
Length=551

 Score =   270 bits (691),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/417 (37%), Positives = 245/417 (59%), Gaps = 8/417 (2%)
 Frame = +3

Query  180   QTAVKDLESSEECVEQAE----KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAF  347
             ++++K +   E   + A      N S++  AV+N + +L G+G LSTPYA+++GGW    
Sbjct  137   KSSIKKIPDIERPSKDAHGLPISNQSTYGQAVVNGMNVLCGVGLLSTPYAVKEGGWAGLS  196

Query  348   LLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSY  527
             +L   G++  +T  LL  CL   P  + Y DIGQ AFGT GRI+ +  +Y+E++ + V Y
Sbjct  197   ILFIFGILSFYTGMLLRYCLDSQPGLETYPDIGQAAFGTMGRIVISIILYVELYASCVEY  256

Query  528   TISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILM  707
              I   DNL+ +F   HL L G +L    L  V+A L  LP++W RDLS +S++S  G++ 
Sbjct  257   IILEGDNLSAIFPNAHLSLGGFELDARHLFVVIAALAILPTVWLRDLSVLSYISVGGVIA  316

Query  708   SLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSK  887
             S+L+ + +    +   V    +   L+LP +P   GLY F Y+GH VFPNIYT++ D S+
Sbjct  317   SILVVLCLYWAGLVDHVGFESKGTVLNLPTLPVAIGLYGFCYSGHAVFPNIYTSLADRSQ  376

Query  888   FTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTK  1067
             F  V + SF +VT+LY   A +G  MFG    SQ TL++P+ ++ +KVA+W TV+ P TK
Sbjct  377   FPAVLLTSFGLVTLLYGGTAVLGYLMFGDSAESQFTLNLPKGLMASKVAVWTTVVNPFTK  436

Query  1068  YALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGS  1244
             +AL  +P A+ L+  LP    K H+  I+     + L +  + + L VP+F  V++L GS
Sbjct  437   FALTLSPVAMSLEELLPSKHTKSHVYPILN---RTALTISTVVVGLAVPFFGLVMALIGS  493

Query  1245  LVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             L+++ ++++LPC  + +I   K SR  +   V +I  GT  A+ G+ S+   ++ S+
Sbjct  494   LLTMLVTLILPCVCFLRILKGKTSRLQVTICVFIITVGTASALIGSYSAISKIIQSM  550



>gb|KEH43506.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=541

 Score =   270 bits (690),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 160/410 (39%), Positives = 242/410 (59%), Gaps = 11/410 (3%)
 Frame = +3

Query  198   LESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICA  377
             L+   +   +    + SF  AV+N I +L G+G LSTPYA ++GGW+   +L   G++  
Sbjct  137   LKKESKVSHEVPSRHCSFGQAVLNGINVLCGVGILSTPYAAKEGGWLGLSILFIFGILSF  196

Query  378   FTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLAT  557
             +T  LL  CL  +P  + Y DIGQ AFGT GRI  +  +Y+E++   + Y I   DNLA+
Sbjct  197   YTGLLLRSCLDSEPGLETYPDIGQAAFGTAGRIAISIVLYVELYGCCIEYIILEGDNLAS  256

Query  558   VFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVAC  737
             +F   +L L GI+L+   L  V+A L  LP++W RDLS +S++S+ G++ S+L+   V C
Sbjct  257   LFPNAYLNLGGIELNPQTLFAVVAALAVLPTVWLRDLSVLSYISAGGVIASVLV---VLC  313

Query  738   TAVFGV--VNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 G+  V        L+L  +P   GLY + Y+GH VFPNIYT+M  P++F  V +  
Sbjct  314   LLWIGIEDVGFQRSGTTLNLGTLPVAIGLYGYCYSGHAVFPNIYTSMAKPNQFPAVLVAC  373

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F V T+LY   A MG KMFG    SQ TL++P+ +V TK+A+W TV+ P TKYAL  +P 
Sbjct  374   FGVCTLLYAGGAVMGYKMFGEDTLSQFTLNLPQDLVATKIAVWTTVVNPFTKYALTISPV  433

Query  1092  AIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGIS  1265
             A+ L+  +P +  K ++ +I IR G    L+   L + L VP+F  V+SL GSL+++ ++
Sbjct  434   AMSLEELIPANHAKSYLFSIFIRTG----LVFSTLVIGLSVPFFGLVMSLIGSLLTMLVT  489

Query  1266  IVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             ++LPC  Y +I   K++R      + +IV G   +  GT S+   +V SL
Sbjct  490   LILPCVCYLRILRGKVTRIQAGLCITIIVVGVACSSVGTYSALAEIVKSL  539



>ref|XP_008813474.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Phoenix dactylifera]
Length=602

 Score =   271 bits (693),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/394 (38%), Positives = 237/394 (60%), Gaps = 4/394 (1%)
 Frame = +3

Query  237   NNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKD  416
                S+  AV+N I +L G+G LSTPYA+++GGW+   +L+  GV+  +T  LL  CL  +
Sbjct  211   RQCSYGQAVLNGINVLCGVGILSTPYAMKEGGWMGLSILLIFGVLAWYTGILLRYCLDSE  270

Query  417   PKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQ  596
             P  + + DIGQ AFGT GR   +  +YLE++   V Y I   DNL+++F   HL + G+ 
Sbjct  271   PGLETFPDIGQAAFGTTGRFAVSIILYLELYACCVEYIILESDNLSSLFPNAHLNIGGLH  330

Query  597   LSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRI  776
             LS+  L  +MA LV LP+ W RDLS +S++S+ G++ SLL+  ++    +   V   H  
Sbjct  331   LSSHPLFAIMATLVVLPTTWLRDLSLLSYISAGGVIASLLVVFSLFWVGLVDQVGFRHGG  390

Query  777   PPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMG  956
               L+L  IP   GLY + Y+GH VFPNIY+++K P+++  V   SF++ T+++  +A MG
Sbjct  391   TSLNLSGIPIAVGLYGYCYSGHAVFPNIYSSLKKPNQYPSVLFTSFAICTVMFAGVAVMG  450

Query  957   AKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-MKH  1133
               MFG    SQ TL+MP ++V +KVA+W TV+ P+TKYAL   P A+ L+  +P + +K 
Sbjct  451   YIMFGDSTLSQFTLNMPHNLVVSKVAVWTTVVNPLTKYALTLTPMALSLEELIPANHLKS  510

Query  1134  HIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKI  1313
             H+  II     + L+   L +AL VP+F  V+SL GS+++  ++++LPC  +  I   K+
Sbjct  511   HMYAII---IRTALVFSTLFVALSVPFFGLVMSLIGSMLTTLVTMILPCACFLGILRGKV  567

Query  1314  SRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             +   +   + +I  G L    GT S+   ++ SL
Sbjct  568   TWTQVSLCIFIITVGVLSCTFGTFSALSKIIQSL  601



>ref|XP_007143736.1| hypothetical protein PHAVU_007G097200g [Phaseolus vulgaris]
 gb|ESW15730.1| hypothetical protein PHAVU_007G097200g [Phaseolus vulgaris]
Length=543

 Score =   269 bits (688),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 160/429 (37%), Positives = 249/429 (58%), Gaps = 13/429 (3%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P S  R       KD + S E        + +F  AV+N I +L G+G LSTPYA
Sbjct  125   HSLLPPLSSRR--SSLIKKDSKVSHE----VPSRHCTFGQAVLNGINVLCGVGILSTPYA  178

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
              ++GGW    +L    +I  +T  LL  CL  DP+ + Y DIGQ AFGT GRI  +  +Y
Sbjct  179   AKEGGWFGLSVLFLFAIISFYTGLLLRSCLDSDPELETYPDIGQAAFGTTGRIAISIVLY  238

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   + Y I   DNL+++F   HL L GI+L +  L  V+  L  LP++W RDLS +
Sbjct  239   VELYACCIEYIILEGDNLSSLFPNAHLNLGGIELDSRTLFAVITALAVLPTVWLRDLSIL  298

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+L+ + +    V  V  P+ +  PL+L   P   GLY + Y+GH VFPN
Sbjct  299   SYISAGGVVASILVVLCLLWVGVDEVGFPS-KGTPLNLATFPVAVGLYGYCYSGHAVFPN  357

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT+M + ++F  V +  F + T+LY   A MG  MFG  + SQ TL++P+ +V TK+A+
Sbjct  358   IYTSMANRNQFPGVLLACFGICTLLYAGAAVMGYTMFGEAILSQFTLNLPQELVATKIAV  417

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPPSM-KHHIKTI-IRGGTGSililiilalalCVP  1211
             W TV+ P TK+AL  +P A+ L+  +P +  K ++ +I IR    + L+L  L + L +P
Sbjct  418   WTTVVNPFTKFALTISPVAMSLEELIPSNQAKSYLYSIFIR----TALVLSTLVIGLSIP  473

Query  1212  YFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             +F  V+SL GSL ++ +S++LPC  + KI   K++R      + +I  G + +  GT S+
Sbjct  474   FFGLVMSLIGSLFTMLVSLILPCVCFLKILRGKVTRVQATVCITIITVGAVCSAFGTYSA  533

Query  1392  FKLLVISLQ  1418
                ++ SL+
Sbjct  534   LSEIIKSLR  542



>ref|XP_010037820.1| PREDICTED: vacuolar amino acid transporter 1 [Eucalyptus grandis]
 gb|KCW49584.1| hypothetical protein EUGRSUZ_K03109 [Eucalyptus grandis]
Length=534

 Score =   269 bits (687),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 241/393 (61%), Gaps = 6/393 (2%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
             +   S   A +N I ++ GLG L+ PYA+ +GGW+S  LL+   +I  +T  LL +CL  
Sbjct  142   REQCSLAQAALNGINVICGLGTLAVPYAVHEGGWLSLLLLLLFCIISFYTAMLLKRCLEV  201

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGI  593
              P  K Y DIGQ AFG  GR++ A  +Y+E++ + + YTI + DNLAT+F  TH+ + GI
Sbjct  202   SPGLKTYLDIGQAAFGISGRLVIAIILYMELYASCIEYTIMMSDNLATMFPKTHMYIGGI  261

Query  594   QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHR  773
              L++ Q   + A LV LP++W R+L  +S+LS+ G++ S+L+ + +    V   V  + R
Sbjct  262   YLTSHQFFAITATLVVLPTVWLRNLGLLSYLSAGGVVASILVVICLLWLGVVDQVGFHPR  321

Query  774   IPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFM  953
                ++L N+P   G+Y F YAGH V PNIY++MK+PSKF  V + +    +++Y  ++  
Sbjct  322   GTIINLANLPFTLGIYGFCYAGHSVLPNIYSSMKEPSKFPWVLVATMGFSSLIYIGVSVC  381

Query  954   GAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMK-  1130
             G  MFG  + SQ TL+MP+  + TKVA+W  V+ PMTKYAL   P A+ L+  LP S + 
Sbjct  382   GFLMFGDNIKSQFTLNMPQQYMATKVAIWTAVVNPMTKYALTIMPVALSLEELLPSSHRK  441

Query  1131  -HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
              H +  IIR    S+L++ IL +AL VP+F  V++L GSL+++ ++I+ PC  Y KI+  
Sbjct  442   SHGMALIIR----SVLVMSILIVALAVPFFGLVMALMGSLLAMLVAIIFPCVCYLKIWKG  497

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             ++++  +     +I FG   +  GT S+F  L+
Sbjct  498   RLTKLEIAACGSIITFGIFCSGIGTYSAFANLM  530



>ref|XP_010464575.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=530

 Score =   269 bits (687),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 153/428 (36%), Positives = 247/428 (58%), Gaps = 16/428 (4%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLESSE-----ECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPY  314
             +P   ++ +D + VK   SS+       +  A+ +  SF  +V+N I +L G+G L+ PY
Sbjct  106   QPLLTQKDDDDSVVKSFLSSQLKLSITDLSYAKPDLCSFPQSVLNAINILCGVGLLTMPY  165

Query  315   ALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFI  494
              +++GGW+  F+L   G+I  +T  LL +CL   P    Y DIGQ AFG  GR++ +  +
Sbjct  166   GVKEGGWLGLFILFFFGIITCYTCILLKRCLESSPGLHTYPDIGQAAFGITGRLIISILL  225

Query  495   YLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSS  674
             Y+E++   V Y I + DNL+ +F    L + G+ L +SQ+  + A L+ LP++W RDLS 
Sbjct  226   YMELYAGCVEYIIMMSDNLSRIFPNMSLNIVGLSLDSSQIFAISATLIVLPTVWLRDLSL  285

Query  675   ISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIP---PLHLPNIPSVSGLYAFSYAGHI  845
             +S+LS+ G+  S+++ +   C    G V+     P    L L N+P   G+Y F Y+GH 
Sbjct  286   LSYLSAGGVFSSIMMAL---CLFWVGTVDGVGFRPGGQALDLANLPVAIGIYGFGYSGHA  342

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPNIY++MK+PSKF  V ++SF    +LY  +A  G  MFG  + SQ TL+MP+    +
Sbjct  343   VFPNIYSSMKEPSKFPLVVVISFGFCVLLYIVVAICGYSMFGEAIQSQFTLNMPQQFTSS  402

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHH-IKTIIRGGTGSililiilalal  1202
             K+A+W  V+TPMTKYAL   P  + L+  +P S + + +   +R    +IL+L  L +AL
Sbjct  403   KIAVWLAVITPMTKYALSITPIVLSLEELMPSSQRSYGVSIFLR----TILVLSTLVVAL  458

Query  1203  CVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGT  1382
              +P+F  + +L GS +++ ++ +LPC  Y  I   ++S+  +   V +I+ G +    GT
Sbjct  459   TLPFFAIMGALMGSSLAMLVAFILPCLCYLSILKGRLSQIQIGLCVFIIIVGVVSGCCGT  518

Query  1383  VSSFKLLV  1406
              S+   LV
Sbjct  519   YSAIVRLV  526



>gb|KDP30471.1| hypothetical protein JCGZ_16150 [Jatropha curcas]
Length=547

 Score =   269 bits (687),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 146/399 (37%), Positives = 238/399 (60%), Gaps = 17/399 (4%)
 Frame = +3

Query  162   GERFEDQTAVKDLESSEECVEQAEK-----------NNSSFMHAVINMIGMLIGLGQLST  308
              E+    +A+  + S    + + EK             SSF  AV+N + +L G+G LST
Sbjct  119   NEQLSSHSALPPIPSRRSSIRKDEKPSQVAHGLPLSGQSSFGQAVLNGMNVLCGVGILST  178

Query  309   PYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAAS  488
             PYA+++GGW+   +L+   V+  +T  LL  CL  +P  + Y DIGQ AFGT GRI  + 
Sbjct  179   PYAVKEGGWLGLSILLIFAVLSFYTGMLLRYCLDSEPGLETYPDIGQAAFGTIGRIAISI  238

Query  489   FIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDL  668
              +Y+E++   V Y I   DNL+++F   H+ L G++L++  L  +M+ L  LP++W RDL
Sbjct  239   ILYVELYACCVEYIILESDNLSSLFPNAHISLGGLELNSYHLFALMSTLAVLPTVWLRDL  298

Query  669   SSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIV  848
             + +S++S+ G++ S+L+ + +    +   V    +   L+L  +P   GLY + Y+GH V
Sbjct  299   TVLSYISAGGVIASVLVVICLFWIGLVDHVGIRSKGTVLNLGTLPVAIGLYGYCYSGHAV  358

Query  849   FPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTK  1028
             FPNIYT+M  P+KF  V +  F +  ++Y  +AFMG  MFG    SQ TL+MP+ ++ +K
Sbjct  359   FPNIYTSMAQPNKFPMVLLTCFVLCALMYAGVAFMGYTMFGESTVSQFTLNMPQDLIASK  418

Query  1029  VALWATVLTPMTKYALEFAPFAIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalal  1202
             +A+W TV+ P TKYAL  +P A+ L+  +PP+ +K HI  I IR    + L++  L + L
Sbjct  419   IAVWTTVVNPFTKYALTISPVAMSLEELIPPNHLKSHIYAICIR----TALVISTLLVGL  474

Query  1203  CVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISR  1319
              +P+F  V+SL GSL+++ ++++LPC  +  I   K++R
Sbjct  475   TIPFFGLVMSLIGSLLTMLVTLILPCACFLSILRCKVTR  513



>ref|XP_004234813.1| PREDICTED: vacuolar amino acid transporter 1-like [Solanum lycopersicum]
 ref|XP_010317902.1| PREDICTED: vacuolar amino acid transporter 1-like [Solanum lycopersicum]
Length=551

 Score =   269 bits (687),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 151/417 (36%), Positives = 246/417 (59%), Gaps = 8/417 (2%)
 Frame = +3

Query  180   QTAVKDLESSEECVEQAE----KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAF  347
             ++++K +   E   + A      + S++  AV+N + +L G+G LSTPYA+++GGW    
Sbjct  137   KSSIKKIPDIERPSKDAHGLPISHQSTYGQAVVNGMNVLCGVGLLSTPYAVKEGGWAGLS  196

Query  348   LLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSY  527
             +L   G++  +T  LL  CL   P  + Y DIGQ AFGT GRI+ +  +Y+E++ + V Y
Sbjct  197   ILFIFGILSFYTGMLLRYCLDSQPGLETYPDIGQAAFGTMGRIVISIILYVELYASCVEY  256

Query  528   TISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILM  707
              I   DNL+ +F   HL L G +L    L  ++A L  LP++W RDLS +S++S  G++ 
Sbjct  257   MILEGDNLSAIFPNAHLSLGGFELDARHLFVLIATLAILPTVWLRDLSVLSYISVGGVIA  316

Query  708   SLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSK  887
             S+L+ + +    +   V    +   L+LP +P   GLY F Y+GH VFPNIYT++ D S+
Sbjct  317   SILVVLCLYWAGLVDHVGFESKETILNLPTLPVAIGLYGFCYSGHAVFPNIYTSLADRSQ  376

Query  888   FTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTK  1067
             F  V + SF +VT+LY   A +G  MFG    SQ TL++P+ ++ +KVA+W TV+ P TK
Sbjct  377   FPAVLLTSFGLVTLLYGGTAVLGYLMFGDSAESQFTLNLPKELMVSKVAVWTTVVNPFTK  436

Query  1068  YALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGS  1244
             +AL  +P A+ L+  LP    K H+  I+     + L +  + + L VP+F  V++L GS
Sbjct  437   FALTLSPVAMSLEELLPSKHTKSHLYPIL---IRTALTISTVVVGLAVPFFGLVMALIGS  493

Query  1245  LVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             L+++ ++++LPC  + +I   K SR  +   V++I  GT  A+ G+ S+   ++ S+
Sbjct  494   LLTMLVTLILPCVCFLRILKGKTSRLQVTICVLIITVGTASALVGSYSALSKIIQSM  550



>ref|XP_009769464.1| PREDICTED: vacuolar amino acid transporter 1-like [Nicotiana 
sylvestris]
 ref|XP_009769465.1| PREDICTED: vacuolar amino acid transporter 1-like [Nicotiana 
sylvestris]
 ref|XP_009769466.1| PREDICTED: vacuolar amino acid transporter 1-like [Nicotiana 
sylvestris]
Length=556

 Score =   268 bits (686),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 154/406 (38%), Positives = 238/406 (59%), Gaps = 4/406 (1%)
 Frame = +3

Query  201   ESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAF  380
             E S++         SS+  AV+N + +L G+G LSTPYA+++GGW    +L   GV+  +
Sbjct  153   EPSKDAHGITMSRQSSYGQAVVNGMNVLCGVGILSTPYAMKEGGWSGLSILFIFGVLSFY  212

Query  381   TTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATV  560
             T  LL  CL   P  + Y DIGQ AFGT GRI  +  +Y+E++ + + Y I   DNL+ +
Sbjct  213   TGILLRSCLDSQPGLETYPDIGQAAFGTPGRIFISIILYVELYFSCIEYIILEGDNLSAI  272

Query  561   FLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACT  740
             F   HL L G +L    L  ++A L  LP++W RDLS +S++S  G++ S+L+ + +   
Sbjct  273   FPNAHLSLGGFELDARHLFVLIATLAVLPTVWLRDLSVLSYISVGGVVASVLVVLCLYWA  332

Query  741   AVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSV  920
              +   V    +   L+L  +P   GLY F Y+GH VFPNIYT++ D S+F  V +  F +
Sbjct  333   GLVDHVGFESKGTVLNLSTLPVAIGLYGFCYSGHAVFPNIYTSLADRSQFPAVLLTCFGM  392

Query  921   VTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIE  1100
             VT+LY   A MG  MFG    SQ TL++P+ ++ +KVA+W TV+ P TKYAL  +P A+ 
Sbjct  393   VTLLYGGTAVMGYLMFGDSADSQFTLNLPKGLIASKVAVWTTVVNPFTKYALTLSPVAMS  452

Query  1101  LDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLP  1277
             L+  LP    K H+  I+     + L    L + L +P+F  V++L GSL+++ ++++LP
Sbjct  453   LEELLPSKHAKSHVYPIL---IRTALAFSTLVVGLSIPFFGLVMALIGSLLTMLVTLILP  509

Query  1278  CGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             C  + +I   K SR  +   V++I+ GTL AV G+ S+   ++ SL
Sbjct  510   CVCFLRILKGKTSRLQVSVCVLIIIVGTLSAVIGSYSAVSNIIQSL  555



>ref|XP_010516025.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=542

 Score =   268 bits (684),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/399 (37%), Positives = 233/399 (58%), Gaps = 2/399 (1%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E A   +SSF  AV+N + +L G+G LSTPYA+++GGW+  F+L   G++C +T  LL  
Sbjct  145   EMAISKDSSFGQAVLNGVNVLCGVGILSTPYAVKEGGWLGLFILFAFGILCFYTGLLLRY  204

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL   P  + Y DIG  AFG+ GRIL +  +YLE++   V Y I   DNL+++F    L 
Sbjct  205   CLDSHPDIQTYPDIGHAAFGSFGRILVSIILYLELYAMSVEYIILESDNLSSMFPNASLS  264

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             + G+QL    L  ++  L  LP++W RDLS +S++S  G++ S+L+ + +    +   V 
Sbjct  265   IGGLQLDAPHLFALLTTLAVLPTVWLRDLSMLSYISVGGVIASVLVVLCLFWIGLVDDVG  324

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              + +  PL+L  +P   GLY + Y+GH VFPNIYT+M  PS+F  V +  F + T++Y  
Sbjct  325   IHSKGTPLNLATLPVSVGLYGYCYSGHGVFPNIYTSMAKPSQFPAVLLTCFGICTLMYAG  384

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
             +A MG  MFG    SQ TL+MP+ +V +K+ALW TV+ P TKYAL  +P A+ L+  +P 
Sbjct  385   VAVMGYSMFGELTESQFTLNMPQDLVASKIALWTTVVNPFTKYALTISPVAMSLEELIPS  444

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
                H           S L+   L + L +P+F  V+SL GS +++ I+++LP   +  I 
Sbjct  445   --NHGKSRFYAIAIRSALVFSTLLVGLAIPFFGLVMSLIGSFLTMLITLILPPACFLSIV  502

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
               K++   ++  +++++ G + +  GT S+   ++  L 
Sbjct  503   RSKVTPTQVMVCILIMIVGAVCSAIGTYSALAKIIEKLN  541



>ref|XP_010486499.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=532

 Score =   267 bits (682),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/434 (35%), Positives = 248/434 (57%), Gaps = 18/434 (4%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLESSE-----ECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPY  314
             +P   ++ +D + VK   SS+       +  A+ +  SF  +V+N I +L G+G L+ PY
Sbjct  106   QPLLTQKDDDDSVVKSFLSSQLKLSITDLSYAKPDLCSFPQSVLNGINILCGVGLLTMPY  165

Query  315   ALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFI  494
              +++GGW+  F+L   G+I  +T  LL +CL   P    Y DIGQ AFG  GR++ +  +
Sbjct  166   GVKEGGWLGLFILFFFGIITCYTCILLKRCLESSPGLHTYPDIGQAAFGFTGRLIISILL  225

Query  495   YLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSS  674
             Y+E++   V Y I + DNL+ +F    L + G+ L +SQ+  + A L+ +P++W RDLS 
Sbjct  226   YMELYAGCVEYIIMMSDNLSRMFPNMSLNIVGLSLDSSQIFAISATLIVVPTVWLRDLSL  285

Query  675   ISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIP---PLHLPNIPSVSGLYAFSYAGHI  845
             +S+LS+ G+  S+++     C  + G V+     P    L L N+P   G+Y F ++GH 
Sbjct  286   LSYLSAGGVFSSIMM---ALCLFLVGTVDEVGFRPGGQALDLANLPVAIGIYGFGFSGHA  342

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPNIY++MK+PSKF  V ++SF     LY  +A  G  MFG  + SQ TL+MP+    +
Sbjct  343   VFPNIYSSMKEPSKFPLVVVISFGFCVFLYIVVAICGYSMFGEAIQSQFTLNMPQQFTSS  402

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPPSMK---HHIKTIIRGGTGSililiilal  1196
             K+A+W  V+TPMTKYAL   P  + L+  +P S K   + +   +R    +IL+L  L +
Sbjct  403   KIAVWLAVITPMTKYALSITPIVLSLEELMPSSRKMRSYGVSIFLR----TILVLSTLVV  458

Query  1197  alCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVS  1376
             AL +P+F  + +L GS +++ ++ +LPC  Y  I   ++S+  +   V +I+ G +    
Sbjct  459   ALTLPFFAIMGALMGSFLAMLVAFILPCLCYLSILKSRLSQTQIGLCVFIIIVGVVSGCC  518

Query  1377  GTVSSFKLLVISLQ  1418
             GT S+   L+  L+
Sbjct  519   GTYSAIVRLIGELK  532



>ref|XP_007009921.1| Transmembrane amino acid transporter family protein isoform 4 
[Theobroma cacao]
 gb|EOY18731.1| Transmembrane amino acid transporter family protein isoform 4 
[Theobroma cacao]
Length=549

 Score =   267 bits (682),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 155/427 (36%), Positives = 250/427 (59%), Gaps = 9/427 (2%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P    R   Q+   D ++S+   E      SS+  AV+N I +L G+G LSTPYA
Sbjct  129   HSLLPPIPSRR---QSVRVDDKTSKVSHELPISRQSSYGQAVLNGINVLCGVGILSTPYA  185

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
              ++GGW+   +L    V+  +T  LL +CL  +P  + Y DIGQ AFGT GRI  +  +Y
Sbjct  186   AKEGGWLGLIILFTFAVLSFYTGLLLRQCLDSEPGLETYPDIGQAAFGTAGRIAVSIILY  245

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   V Y I   DNL+++F   H+ L G +L++ +L  +M  L  LP++W RDLS +
Sbjct  246   VELYACCVEYIILEGDNLSSLFPNAHISLGGFELNSQRLFALMTTLAVLPTVWLRDLSVL  305

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+L+ + +    +   V  +++   L+L ++P   GLY + Y+GH VFPN
Sbjct  306   SYISAGGVVASVLVVLCLFWVGLVDQVGFHNKGTTLNLASLPVAVGLYGYCYSGHAVFPN  365

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT+M  P++F  V I  F + ++LY   A MG  MFG    SQ TL+MP+ ++ +K+A+
Sbjct  366   IYTSMAKPNQFPSVLIACFGICSLLYAGTAIMGYTMFGEATESQFTLNMPKDLIASKIAV  425

Query  1038  WAT-VLTPMTKYALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVP  1211
             W T V+ P TKYAL  +P A+ L+  +P S +K HI  I+     + L++  L + L +P
Sbjct  426   WTTVVVNPFTKYALTMSPVAMSLEELIPSSHLKSHIYAIL---IRTSLVISTLIVGLSIP  482

Query  1212  YFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVS-  1388
             +F  V+SL GS +++ ++++LP   Y  I   K++R      +++I  G + +  GT S 
Sbjct  483   FFGLVMSLIGSSLTMLVTLILPPACYLSIVRGKVTRIQTTLCIIVIAVGVVSSAFGTYSH  542

Query  1389  SFKLLVI  1409
             S +LL I
Sbjct  543   SPRLLRI  549



>ref|XP_004307365.1| PREDICTED: vacuolar amino acid transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=549

 Score =   267 bits (682),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 150/426 (35%), Positives = 245/426 (58%), Gaps = 13/426 (3%)
 Frame = +3

Query  165   ERFEDQTAVKDLESSEECVEQAEK---------NNSSFMHAVINMIGMLIGLGQLSTPYA  317
             ER   Q+    + S    + + ++         + SSF  AV+N I +L G+G LSTPYA
Sbjct  126   ERPSSQSVHSQIPSRRSSIRKDDRPRIDHHPMSSQSSFAQAVLNGINVLCGVGILSTPYA  185

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
             +++GGWI   +L    V+  +T  LL  CL   P+ + Y DIGQ AFGT GRI  +  +Y
Sbjct  186   VKEGGWIGLSILFIFAVLSFYTGLLLRYCLDSQPELETYPDIGQAAFGTPGRIAISIVLY  245

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++++ + Y I   DNL+++F  THL L G +L+   L  +   L  LP++W RDLS +
Sbjct  246   VELYVSCIDYIIMEGDNLSSLFPNTHLNLGGFELNAHVLFAIFTTLAVLPTVWLRDLSVL  305

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ ++L+ + +    +   V    +  PL+L  +P   GLY F Y+GH VFPN
Sbjct  306   SYISAGGVIATILVLLCLFWVGLVDDVGFESKGTPLNLATLPVAMGLYGFCYSGHAVFPN  365

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IY+++  P+++  + +  F + T +Y  +A MG  MFG    SQ TL+MP  +V +K+A+
Sbjct  366   IYSSLDKPNQYPAILLTCFCICTFMYAGVAVMGYTMFGEATLSQFTLNMPHDLVASKIAV  425

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYF  1217
             W+TV+ P TKYAL   P A+ L+  +P          IR G    L+   L + LC+P+F
Sbjct  426   WSTVVNPFTKYALSLNPVAMSLEELIPAEKSRMYSFFIRTG----LVFSTLVIGLCIPFF  481

Query  1218  EHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFK  1397
               +LSL GSL ++ ++++LPC  Y  I   +++R  +I  ++++  G + +V GT S+  
Sbjct  482   GLLLSLIGSLFTMLVTLILPCACYLTIRKGQVTRFQMILCIIIMTVGVVASVIGTYSAVS  541

Query  1398  LLVISL  1415
              +V +L
Sbjct  542   KIVENL  547



>ref|XP_010427204.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=541

 Score =   266 bits (680),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 146/399 (37%), Positives = 231/399 (58%), Gaps = 2/399 (1%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E A   +SSF  AV+N + +L G+G LSTPYA+++GGW+  F+L   G++C +T  LL  
Sbjct  144   EMAIAKDSSFGQAVLNGVNVLCGVGILSTPYAVKEGGWLGLFILFAFGILCFYTGLLLRY  203

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL   P  + Y DIG  AFGT GRIL +  +YLE++   V Y I   DNL+++F    L 
Sbjct  204   CLDSHPDIQTYPDIGHAAFGTFGRILVSIILYLELYAMSVEYIILESDNLSSMFPNASLS  263

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             + G  L    L  ++  L  LP++W RDLS +S++S  G++ S+L+ + +    +   V 
Sbjct  264   IGGFHLDAPHLFALLTTLAVLPTVWLRDLSMLSYISVGGVIASVLVVLCLFWIGLVDDVG  323

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              + +  PL+L  +P   GLY + Y+GH VFPNIYT+M  PS+F  V +  F + T++Y  
Sbjct  324   IHSKGTPLNLATLPVSVGLYGYCYSGHGVFPNIYTSMAKPSQFPAVLLTCFGICTLMYAG  383

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
             +A MG  MFG    SQ TL+MP+ +V +K+ALW TV+ P TKYAL  +P A+ L+  +P 
Sbjct  384   VAVMGYSMFGELTESQFTLNMPQDLVASKIALWTTVVNPFTKYALTISPVAMSLEELIPS  443

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
                H           S L+   L + L +P+F  V+SL GS +++ I+++LP   +  I 
Sbjct  444   --NHGKSRFYAIAIRSALVFSTLLVGLAIPFFGLVMSLIGSFLTMLITLILPPACFLSIV  501

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
               K++   ++  +++++ G + +  GT S+   ++  L 
Sbjct  502   RSKVTPTQVMVCILIMIVGAVCSAIGTYSALAKIIEKLN  540



>ref|XP_008242521.1| PREDICTED: vacuolar amino acid transporter 1 [Prunus mume]
Length=521

 Score =   265 bits (678),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 146/390 (37%), Positives = 226/390 (58%), Gaps = 28/390 (7%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             ++   SF  AV+N   +L G+G L+TPYA+++GGW+S  LL   GVIC +T  LL +CL 
Sbjct  149   KERCCSFSQAVLNGTNVLCGIGLLTTPYAIKEGGWLSLILLALYGVICCYTGILLKRCLE  208

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG  590
               P  + Y DIGQ AFG+ GR   +  +YLE++ A V +   + DNLA+VF  T + L G
Sbjct  209   SCPGLRTYPDIGQAAFGSTGRFFLSIILYLELYGACVEFLTMMSDNLASVFPDTQMTLGG  268

Query  591   IQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNH  770
             I L +  +  + A LV LP++W ++LS +S+LS  G++ S+L+ + +    V   V  +H
Sbjct  269   IHLDSHHIFGITATLVILPTVWLQNLSLLSYLSVGGVVASILVALCLLWVGVVNQVGFHH  328

Query  771   RIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAF  950
             R P L+L +I    G+Y F +AGH VFPNIYT+MK+PS+F+ V I S +    +YT +A 
Sbjct  329   RGPALNLSDISVTIGIYGFGFAGHSVFPNIYTSMKEPSQFSAVLITSVTFCFFIYTGVAV  388

Query  951   MGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAI---ELDHSLPP  1121
              G  MFG  + SQ TL+MP   V +K+A+W T++ PMTKYAL   P A+   EL  +L  
Sbjct  389   FGFLMFGDSIHSQFTLNMPTQFVASKIAVWTTIVNPMTKYALTMTPVALSVEELSSTLGV  448

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
             +M                           P+F  V++L GSLV++ +++V PC  Y  + 
Sbjct  449   AMSF-------------------------PFFGSVMALIGSLVAMLVAVVFPCVCYLILL  483

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
               ++++  +   +++I  G + ++ GT S+
Sbjct  484   RGRLTKLQIATCILIITVGVVCSIIGTYSA  513



>ref|XP_006407687.1| hypothetical protein EUTSA_v10020500mg [Eutrema salsugineum]
 gb|ESQ49140.1| hypothetical protein EUTSA_v10020500mg [Eutrema salsugineum]
Length=526

 Score =   265 bits (677),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 155/419 (37%), Positives = 239/419 (57%), Gaps = 12/419 (3%)
 Frame = +3

Query  174   EDQTAVKDLESSE---ECVEQA--EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWI  338
             +D+ +VK   SS+      E A  E N  SF  +V+N I +L G+G L+ PYA+++GGW+
Sbjct  108   KDEVSVKSYISSQLSLSITELAFEEHNLCSFPQSVLNGINILCGVGLLTMPYAVKEGGWL  167

Query  339   SAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMAL  518
               F+L   G+I  +T  LL +CL   P    Y DIGQ AFG  GR++ +  +Y+E++   
Sbjct  168   GLFILFFFGIITCYTGILLKRCLESSPNLHTYPDIGQAAFGFTGRLIISILLYMELYACC  227

Query  519   VSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAG  698
             V Y I + DNL+ +F    L + G+ L +SQ+  +   L+ LP++W RDLS +S+LS+ G
Sbjct  228   VEYIIMMSDNLSRLFPNILLNIAGVSLDSSQIFAIATTLIVLPTVWLRDLSLLSYLSAGG  287

Query  699   ILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKD  878
             +  S+L+ + +        V  +     L L N+P   G++ F ++GH VFPNIY++MKD
Sbjct  288   VFSSILLALCLFWVGSVDGVGFHSGGQSLDLSNLPVAIGIFGFGFSGHAVFPNIYSSMKD  347

Query  879   PSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTP  1058
             PSKF  V + SF    I Y A+A  G  MFG  + SQ TL+MP+    +K+A+W  V+TP
Sbjct  348   PSKFPLVLLASFGFCVIFYIAVAICGYSMFGEAIQSQFTLNMPQQFTSSKIAVWTAVITP  407

Query  1059  MTKYALEFAPFAIELDHSLPPSMK---HHIKTIIRGGTGSililiilalalCVPYFEHVL  1229
             MTKYAL   P  + L+  LP S K   + +   +R    +IL+L  L +AL  P+F  + 
Sbjct  408   MTKYALSLTPIVLSLEELLPSSEKMRFYGVSMFLR----TILVLSTLVVALTFPFFAIMG  463

Query  1230  SLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             +L GS +S+ ++ + PC  Y  I   ++S+  +   V +I+ G +    GT S+   LV
Sbjct  464   ALMGSFLSMLVAFIFPCLCYLSILKGRLSKTQMGICVFIIISGIVSGCCGTYSAIGRLV  522



>gb|EYU39864.1| hypothetical protein MIMGU_mgv1a003855mg [Erythranthe guttata]
Length=559

 Score =   266 bits (679),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 156/431 (36%), Positives = 253/431 (59%), Gaps = 12/431 (3%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P    +   +  + D +SS    E      SS+  AV+N + +L G+G LSTPYA
Sbjct  135   HSLLPPIPSRKSSLKKIIPDGKSSVSH-ELPLSRQSSYGQAVLNGMNVLCGVGILSTPYA  193

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
             +++GGWI   +L    ++  +T  LL  CL   P  + Y DIGQ AFGT GRI  +  +Y
Sbjct  194   VKEGGWIGLSILFIYAILSYYTGILLRHCLDSQPGLETYPDIGQAAFGTVGRIAISIILY  253

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   V Y I   DNL+++F   HL +   +L++  L  VM  L  LP++W RDLS +
Sbjct  254   VELYACCVEYIILESDNLSSLFPNAHLNIGSFELNSHHLFAVMTALAVLPTVWLRDLSIL  313

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPN----HRIPPLHLPNIPSVSGLYAFSYAGHI  845
             S++S+ G++ S+L+   V C    G+V+       +   L+L  +P   GLY + Y+GH 
Sbjct  314   SYISAGGVIASILV---VGCLFWVGLVDQAGFEPQKTTTLNLSTLPVAIGLYGYCYSGHA  370

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPNIYT+M  PS++  V ++SF + T++Y A+A +G  MFG    SQ TL+MP+ ++ +
Sbjct  371   VFPNIYTSMAKPSQYPSVLLLSFGICTVMYAAVAVLGYTMFGESTQSQFTLNMPQDLIAS  430

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalal  1202
             K+A+W TV+ P TKYAL  +P A+ L+  +P S +K H+ +I+     + L++  L +AL
Sbjct  431   KIAVWTTVVNPFTKYALTMSPVAMSLEELIPSSHVKSHVYSIL---IRTALVISTLLVAL  487

Query  1203  CVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGT  1382
              +P+F  V++L GSL+++ ++++LPC  Y  I   KIS       V++I  G + A+ G+
Sbjct  488   SIPFFGLVMALIGSLLTMLVTLILPCACYMSIVKRKISLFQGSMCVLVIGVGLVSAIFGS  547

Query  1383  VSSFKLLVISL  1415
              S+   ++ +L
Sbjct  548   YSALSQIIQNL  558



>ref|XP_009400429.1| PREDICTED: vacuolar amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=558

 Score =   266 bits (679),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 150/408 (37%), Positives = 240/408 (59%), Gaps = 8/408 (2%)
 Frame = +3

Query  195   DLESSEECV--EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGV  368
              LE  +E V  E     NSS+  AV N + +L G+G LSTPYA+++GGW+   +L+   V
Sbjct  150   SLEKIQEKVFHELPSSRNSSYGQAVFNGMNVLCGVGILSTPYAVKEGGWLGLSILLTYAV  209

Query  369   ICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDN  548
             +  +T  LL  CL        Y DIGQ AFGT GRI  +  +YLE++ + V Y I   DN
Sbjct  210   LAWYTGILLRHCLDSQQGLATYPDIGQAAFGTTGRIAISIILYLELYASCVEYIILERDN  269

Query  549   LATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVT  728
             L+++F    L + G  + +  L   +  ++ LP+ W RDLS +S++S  G++ S+L+ ++
Sbjct  270   LSSLFPNAQLNIGGTHIDSHLLFATLTTVIVLPTTWLRDLSVLSYISVGGVIASVLVVLS  329

Query  729   VACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIV  908
             +     F  V   ++  PL+L  IP   G+Y F Y+GH VFPNIY+++K P++F  V  V
Sbjct  330   LFWVGQFDHVGFQNKGTPLNLSGIPIAIGIYGFCYSGHAVFPNIYSSLKKPNQFPSVLFV  389

Query  909   SFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAP  1088
             SF + T++Y A+A MG  M G    SQ TL+MP++++ +KVA+W TV+ P+TKYAL   P
Sbjct  390   SFVICTVMYAAVAVMGYTMNGESTLSQFTLNMPQNLLASKVAVWTTVVNPITKYALTLTP  449

Query  1089  FAIELDHSLPP--SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGI  1262
              A+ L+  LP   S  H    +IR    + L+L  L +AL +P+F  V++L GSL+++ +
Sbjct  450   LALSLEELLPANSSNSHLYAIMIR----TTLVLSTLIVALSIPFFGLVMALIGSLLTMLV  505

Query  1263  SIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             +++LPC  +  I   +++R   +    +I  G + ++ GT +S   ++
Sbjct  506   TLILPCACFLSILRGRVTRTQGLLCTFIIAIGAVSSIIGTTTSLSKII  553



>ref|XP_011041044.1| PREDICTED: vacuolar amino acid transporter 1-like [Populus euphratica]
 ref|XP_011041045.1| PREDICTED: vacuolar amino acid transporter 1-like [Populus euphratica]
 ref|XP_011041047.1| PREDICTED: vacuolar amino acid transporter 1-like [Populus euphratica]
 ref|XP_011041048.1| PREDICTED: vacuolar amino acid transporter 1-like [Populus euphratica]
 ref|XP_011041049.1| PREDICTED: vacuolar amino acid transporter 1-like [Populus euphratica]
 ref|XP_011041050.1| PREDICTED: vacuolar amino acid transporter 1-like [Populus euphratica]
Length=554

 Score =   265 bits (678),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 153/411 (37%), Positives = 244/411 (59%), Gaps = 6/411 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD + S    E      SSF  AV+N + +L G+G LSTPYA ++GGW+   +L+   V+
Sbjct  147   KDEKLSRVSHELPMSRQSSFGQAVLNGLNVLCGVGILSTPYAAKEGGWLGLSILLIFAVL  206

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +P    Y DIGQ AFGT GR++ +  +Y+E++   V Y I   DNL
Sbjct  207   SFYTGMLLRYCLDSEPGLGTYPDIGQAAFGTAGRVVISIILYVELYACCVEYIILESDNL  266

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             +++F   ++ L G +L +     +M  L  LP++W RDLS +S++S+ G++ S+L+ + +
Sbjct  267   SSLFPNANISLGGFELDSPHFFALMTTLAVLPTVWLRDLSVLSYISAGGVIASVLVVLCL  326

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  +     L+L  +P   GLY + Y+GH VFPNIYT+M  PS+F  V +  
Sbjct  327   FWIGLVDNVGIHSEGTVLNLGTLPVAIGLYGYCYSGHAVFPNIYTSMAQPSRFPAVLLAC  386

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F + T+LY  +A+MG  MFG    SQ TL++P+ +V +KVA+W TV+ P TKYAL  +P 
Sbjct  387   FGICTLLYAGVAYMGYTMFGEKTESQFTLNLPQDLVASKVAVWTTVVNPFTKYALTMSPV  446

Query  1092  AIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGIS  1265
             A+ L+  +P + MK H+  I IR    + L++  L +AL +P+F  V+SL GSL+++ ++
Sbjct  447   AMSLEELIPSNHMKSHMYAICIR----TALVISTLLVALSIPFFGLVMSLIGSLLTMLVT  502

Query  1266  IVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             ++LPC  +  I   K +R  +   +++I  G + +V GT SS   ++ +L 
Sbjct  503   LILPCACFLSILRAKATRFQIAVCIIIIAVGVVSSVFGTRSSLSQIIENLN  553



>ref|XP_011031689.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Populus euphratica]
 ref|XP_011031690.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Populus euphratica]
 ref|XP_011031691.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Populus euphratica]
 ref|XP_011031692.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Populus euphratica]
 ref|XP_011031693.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Populus euphratica]
Length=554

 Score =   265 bits (677),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 149/410 (36%), Positives = 247/410 (60%), Gaps = 6/410 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             K+ ++S+   E      SSF  AV+N + +L G+G LSTPYA ++GGW+   +L    V+
Sbjct  147   KNEKASQVSHELPMSRQSSFGQAVLNGVNVLCGVGILSTPYAAKEGGWLGLIILFVFAVL  206

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +P  + Y DIGQ AFGT GR + +  +Y+E++   V Y I   DNL
Sbjct  207   SFYTGMLLRSCLDSEPGLETYPDIGQAAFGTTGRFVISIILYVELYACCVEYIILESDNL  266

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             +++F   H+ + G ++ +  L  +M  L  LP++W RDLS +S++S+ G++ S+L+ +++
Sbjct  267   SSLFPNAHISMGGFEMDSHHLFALMTTLAVLPTVWLRDLSVLSYISAGGVVASVLVVLSL  326

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  + +   L+L  +P   GLY + Y+GH VFPNIYT+M  PS+F KV +  
Sbjct  327   FWVGLVDNVGIHSKGTVLNLGTLPVAIGLYGYCYSGHAVFPNIYTSMAQPSRFPKVLLAC  386

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             FS+ T++Y  +A+MG  MFG    +Q TL++P+ +V +KVA+W TV+ P TKYAL  +P 
Sbjct  387   FSICTLMYAGVAYMGYTMFGESTETQFTLNLPQDLVVSKVAVWTTVVNPFTKYALTMSPV  446

Query  1092  AIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGIS  1265
             A+ L+  +P + MK H+  I IR    + L+   L + L +P+F  V+SL GSL+++ ++
Sbjct  447   AMSLEELIPSNHMKSHMYAICIR----TALVFSTLLVGLAIPFFGLVMSLIGSLLTMLVT  502

Query  1266  IVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             ++LPC  +  I   K +R   +  +++I  G + +  GT S+   ++ +L
Sbjct  503   LILPCACFLSIVRGKATRFQGVVCIIIIAVGIVSSAFGTHSALSKIIENL  552



>ref|XP_006480871.1| PREDICTED: vacuolar amino acid transporter 1-like [Citrus sinensis]
Length=551

 Score =   265 bits (677),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 154/388 (40%), Positives = 229/388 (59%), Gaps = 12/388 (3%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             S   + +N I +L G+G L+TPYA+++GGW S  LL   G+I  +T  LL +CL   P  
Sbjct  164   SLAQSCLNGINVLCGVGLLATPYAIKEGGWSSLSLLFIFGIIAFYTGILLQECLDSAPGL  223

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y D+GQ AFG  GR++ A  +YLE+F A + Y I + DNLA++F  T +   G+ L  
Sbjct  224   TTYPDVGQAAFGITGRLIVAIVLYLELFAASIEYLIMMSDNLASLFPHTSMNFGGLHLDC  283

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIP--  779
              ++ ++ A LV LP++W RDL+ +S++S  G++ +    V V C    G+V+     P  
Sbjct  284   HKIFSITATLVVLPTVWLRDLTLLSYISVGGVITT---GVVVLCLLWIGLVDAVGFHPYG  340

Query  780   -PLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMG  956
               L L N+P   GLY F+YAGH VFPNIY++M++P KF  V ++SF   ++L   +   G
Sbjct  341   TALDLSNLPVTIGLYGFAYAGHSVFPNIYSSMQEPKKFPFVLMISFVFCSLLNAGVGICG  400

Query  957   AKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS--MK  1130
               MFG  + SQ TL+ P+  V +KVA+W TVL PM+KYA+   P A+ L+  +P      
Sbjct  401   YLMFGDSIQSQFTLNFPKEFVASKVAIWTTVLIPMSKYAMTLTPIALSLEELMPSKELQS  460

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
             + +  IIR    +IL +  L +AL +PYF  V+SL GSL+++ I+++ PC FY KI   K
Sbjct  461   YSVSVIIR----TILAISTLVVALTLPYFGIVMSLIGSLLAMLITLIFPCVFYLKILQGK  516

Query  1311  ISRPLLIFNVVLIVFGTLLAVSGTVSSF  1394
             IS+  + F +   V G   A  GT S+ 
Sbjct  517   ISKLKIAFCIFNAVLGVFCACIGTYSAL  544



>ref|XP_010464576.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=527

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/397 (37%), Positives = 233/397 (59%), Gaps = 11/397 (3%)
 Frame = +3

Query  228   AEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCL  407
             AE +  SF  +V+N I +L G+  L+ PY +++GGW+  F+L   G+I   T  LL +CL
Sbjct  134   AEPDLCSFPQSVLNGINILCGIALLTMPYGVKEGGWLGLFILFFFGIITCNTCILLKRCL  193

Query  408   GKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLT  587
                P  + Y DIGQ AFG+ GR++ +  +Y+E++   V Y I + DNL+ +F    L + 
Sbjct  194   ESSPGLRTYPDIGQAAFGSTGRLIISILLYMELYAGCVEYIIMMSDNLSRIFPNMSLNIV  253

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
             G+ L +SQ+  + A L+ LP++W RDLS +S+LS+ G+  S+++ +   C    G V+  
Sbjct  254   GLSLDSSQIFAISATLIVLPTVWLRDLSLLSYLSAGGVFSSIMMAL---CLYWVGTVDGV  310

Query  768   HRIP---PLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYT  938
                P    L L N+P   G+Y F ++GH VFPNIY++MKDPSKF  V ++SF     LY 
Sbjct  311   GFRPGGQALDLANLPVAIGIYGFGFSGHAVFPNIYSSMKDPSKFPLVVVISFGFCVFLYI  370

Query  939   ALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLP  1118
              +A  G  MFG  + S+ TL+MP+    +K+A+W   +TPMTKYAL   P  + L+  +P
Sbjct  371   VVAICGYSMFGEAIQSEFTLNMPQQFTSSKIAVWIAAITPMTKYALAITPIVLSLEELMP  430

Query  1119  PSMKHH-IKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTK  1295
              S + + +   +R    +IL+L  L +AL +P+F  + +L GS +++ ++ ++PC  Y  
Sbjct  431   SSQRSYGVSMFLR----TILVLSTLVVALTLPFFAIMGALMGSFLAMLVAAIIPCLCYLS  486

Query  1296  IFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             I   K+S+  +   V +I+FG +    GT S+   LV
Sbjct  487   ILKGKLSKTQIGICVFIIIFGVVSGCCGTYSAIGKLV  523



>ref|XP_001781020.1| predicted protein [Physcomitrella patens]
 gb|EDQ54129.1| predicted protein [Physcomitrella patens]
Length=519

 Score =   264 bits (674),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 149/418 (36%), Positives = 243/418 (58%), Gaps = 10/418 (2%)
 Frame = +3

Query  168   RFEDQTAVKDLESSEECVEQ--AEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWIS  341
             R E+Q+     ES  E  E    +   SS +  + N + +L G+G L+TP+AL++ GWI 
Sbjct  107   RLENQSV--KTESVYELSEYHGIKPQGSSLLQGLFNGMNVLAGVGILTTPFALKEAGWIG  164

Query  342   AFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALV  521
                LI L +IC FT  LL +CL   P    Y DIGQ AFG  GRI+ +  +Y E++   V
Sbjct  165   MLYLILLSIICFFTGILLRRCLESGPGLATYPDIGQAAFGYTGRIIISIILYTELYACCV  224

Query  522   SYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGI  701
              + I   DNL+++F G HL + G+ L    + +++  +  LP++W RDLS ++++S+ G+
Sbjct  225   EFLILEGDNLSSLFPGAHLSIAGLHLEGKSMFSLLTAIFVLPTVWLRDLSYLAYVSAGGV  284

Query  702   LMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDP  881
             + S ++ ++V        V  +   P   L ++P   GLY F Y+GH VFPNIY+++++ 
Sbjct  285   VASFVVGISVFWVGAVDGVGFHETGPLFKLSSLPVSIGLYGFCYSGHAVFPNIYSSLRNR  344

Query  882   SKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPM  1061
             + + KV  +SF + T+LY+ +A MG  MFG   +SQITL++P+  + + +A+W TV+ P 
Sbjct  345   NAYNKVLGISFILCTLLYSGMAVMGFTMFGEDTASQITLNLPKQFLASNIAVWTTVVNPF  404

Query  1062  TKYALEFAPFAIELDHSL---PPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
             TK+AL   P A+ L+  L   P SMKH   +I+     + L++  + +AL VP+F  V++
Sbjct  405   TKFALSMTPVALSLEELLPHNPDSMKHRSSSIL---IRTALVISTIGVALLVPFFGFVMA  461

Query  1233  LTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
               GS +S+ +S++LPC  Y  IF  K+    +I   ++I+ G +  V G+ SS   +V
Sbjct  462   FIGSFLSMNVSLILPCACYLAIFGKKLPAYQVILCAMVILVGFICLVLGSYSSLSSIV  519



>ref|XP_010543282.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Tarenaya hassleriana]
Length=545

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/392 (37%), Positives = 234/392 (60%), Gaps = 4/392 (1%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
             +N  SF  +V+N + +L GL  L+ PYAL++GGWI  F+L+  G+I  +T  LL +C   
Sbjct  153   ENRCSFSQSVLNGVNVLCGLALLTMPYALKEGGWIGLFVLLLFGIITCYTGILLKRCAES  212

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGI  593
              P    Y DIG  AFG  GR++ +  +YLE++ + V Y I + DNL+ +F  T L+++G+
Sbjct  213   SPGLTTYPDIGHAAFGMTGRVIISILLYLELYASCVEYIIMMSDNLSGLFPNTSLRISGL  272

Query  594   QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHR  773
              L +SQ+  V   ++ LP++W RDLS +S+LS  G+L S+L+ + +        V  +  
Sbjct  273   SLDSSQIFAVATTVIVLPTVWLRDLSLLSYLSVGGVLSSILLALCLLWNGSVDGVGFHLT  332

Query  774   IPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFM  953
                L L N+P   G++   +AGH VFPN+Y++MK+PSKF  V ++ F   T LY  +A  
Sbjct  333   GQALDLTNLPVSVGIFGLGFAGHSVFPNLYSSMKEPSKFPLVLVICFGFCTFLYIGVAIC  392

Query  954   GAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-MK  1130
             G  MFG  + SQ TL+MP+  + +++A+W  V+TPMTKYAL   P  + L+  +P S MK
Sbjct  393   GYTMFGDAIQSQFTLNMPKQFLTSRIAVWTAVVTPMTKYALTITPVVLSLEELMPSSKMK  452

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
              +  +I+     +IL++  L +AL VP+F  V +L GS +++ ++++ PC  Y  I   +
Sbjct  453   PYGSSIL---LRTILVISTLVVALAVPFFAIVGALMGSFLAVLVALIFPCMCYLSILKGR  509

Query  1311  ISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             +S   +   +++I+FG +    GT S+   L+
Sbjct  510   LSNTQVGICILIIIFGLVAGCCGTYSAVARLI  541



>ref|XP_011084300.1| PREDICTED: vacuolar amino acid transporter 1 isoform X1 [Sesamum 
indicum]
Length=576

 Score =   265 bits (677),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/397 (37%), Positives = 241/397 (61%), Gaps = 10/397 (3%)
 Frame = +3

Query  237   NNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKD  416
              +SS+  AV+N + +L G+G LSTPYA+++GGW+   +L+   V+  +T  LL  CL   
Sbjct  185   RHSSYGQAVLNGMNVLCGVGILSTPYAVKEGGWLGLSILLTFAVLSYYTGILLRSCLDSQ  244

Query  417   PKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQ  596
             P  + Y DIGQ AFGT GR+  +  +Y+E++   V Y I   DNL+++F   HL     +
Sbjct  245   PGLETYPDIGQAAFGTTGRVAISIILYVELYACCVEYIILESDNLSSLFPNAHLNFGAFE  304

Query  597   LSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNP---N  767
             L++  L  VM  L  LP++W RD+S +S++S+ G++ S+L+   VAC    G+V+     
Sbjct  305   LNSHHLFAVMTALAVLPTVWLRDMSVLSYISAGGVIASILV---VACLFWVGLVDQVGFQ  361

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
              +   L+L  +P   GLY + Y+GH +FPNIYT+M  PS++  V + SF++ T++Y A+A
Sbjct  362   TKGTTLNLSTLPVAIGLYGYCYSGHAIFPNIYTSMAKPSQYPAVLLTSFAICTVMYAAVA  421

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-  1124
              +G  MFG    SQ TL+MP+ +V +K+ALW TV+ P TKYAL  +P A+ L+  +P S 
Sbjct  422   VLGYMMFGESTQSQFTLNMPQDLVASKIALWTTVVNPFTKYALTMSPVAMSLEELIPSSH  481

Query  1125  MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFW  1304
              K ++ +I+     + L++  L + L +P+F  V++L GSL+++ ++++LPC  Y  I  
Sbjct  482   AKSYMYSIL---IRTALVISTLLVGLSIPFFGLVMALIGSLLTMLVTLILPCACYLSILR  538

Query  1305  PKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
              KI+       +++I  G + +  GT S+   +V SL
Sbjct  539   GKINALQGSMCILVIGVGVVSSAFGTYSALSKIVQSL  575



>ref|XP_011084301.1| PREDICTED: vacuolar amino acid transporter 1 isoform X2 [Sesamum 
indicum]
 ref|XP_011084302.1| PREDICTED: vacuolar amino acid transporter 1 isoform X2 [Sesamum 
indicum]
 ref|XP_011084303.1| PREDICTED: vacuolar amino acid transporter 1 isoform X2 [Sesamum 
indicum]
 ref|XP_011084304.1| PREDICTED: vacuolar amino acid transporter 1 isoform X2 [Sesamum 
indicum]
 ref|XP_011084305.1| PREDICTED: vacuolar amino acid transporter 1 isoform X2 [Sesamum 
indicum]
Length=556

 Score =   265 bits (676),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 148/397 (37%), Positives = 241/397 (61%), Gaps = 10/397 (3%)
 Frame = +3

Query  237   NNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKD  416
              +SS+  AV+N + +L G+G LSTPYA+++GGW+   +L+   V+  +T  LL  CL   
Sbjct  165   RHSSYGQAVLNGMNVLCGVGILSTPYAVKEGGWLGLSILLTFAVLSYYTGILLRSCLDSQ  224

Query  417   PKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQ  596
             P  + Y DIGQ AFGT GR+  +  +Y+E++   V Y I   DNL+++F   HL     +
Sbjct  225   PGLETYPDIGQAAFGTTGRVAISIILYVELYACCVEYIILESDNLSSLFPNAHLNFGAFE  284

Query  597   LSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNP---N  767
             L++  L  VM  L  LP++W RD+S +S++S+ G++ S+L+   VAC    G+V+     
Sbjct  285   LNSHHLFAVMTALAVLPTVWLRDMSVLSYISAGGVIASILV---VACLFWVGLVDQVGFQ  341

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
              +   L+L  +P   GLY + Y+GH +FPNIYT+M  PS++  V + SF++ T++Y A+A
Sbjct  342   TKGTTLNLSTLPVAIGLYGYCYSGHAIFPNIYTSMAKPSQYPAVLLTSFAICTVMYAAVA  401

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-  1124
              +G  MFG    SQ TL+MP+ +V +K+ALW TV+ P TKYAL  +P A+ L+  +P S 
Sbjct  402   VLGYMMFGESTQSQFTLNMPQDLVASKIALWTTVVNPFTKYALTMSPVAMSLEELIPSSH  461

Query  1125  MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFW  1304
              K ++ +I+     + L++  L + L +P+F  V++L GSL+++ ++++LPC  Y  I  
Sbjct  462   AKSYMYSIL---IRTALVISTLLVGLSIPFFGLVMALIGSLLTMLVTLILPCACYLSILR  518

Query  1305  PKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
              KI+       +++I  G + +  GT S+   +V SL
Sbjct  519   GKINALQGSMCILVIGVGVVSSAFGTYSALSKIVQSL  555



>ref|XP_007207639.1| hypothetical protein PRUPE_ppa020769mg [Prunus persica]
 gb|EMJ08838.1| hypothetical protein PRUPE_ppa020769mg [Prunus persica]
Length=533

 Score =   264 bits (674),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 147/389 (38%), Positives = 232/389 (60%), Gaps = 14/389 (4%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             ++   SF  AV+N   +L G+G L+TPYA+++GGW+S  LL   GVIC +T  LL +CL 
Sbjct  149   KERCCSFSQAVLNGTNVLCGIGLLTTPYAIKEGGWLSLILLALYGVICCYTGILLKRCLE  208

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG  590
               P  + Y DIGQ AFG+ GR   +         A V +   + DNLA+VF  T + L G
Sbjct  209   SCPGLRTYPDIGQAAFGSTGRFFLSG--------ACVEFLTMMSDNLASVFPDTQMTLGG  260

Query  591   IQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNH  770
             I L +  +  + A LV LP++W ++LS +S+LS  G+L S+L+ + +    V   V  +H
Sbjct  261   IHLDSHHIFGITATLVILPTVWLQNLSLLSYLSVGGVLASILVALCLLWVGVVNQVGFHH  320

Query  771   RIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAF  950
             R P L+L +I    G+Y F +AGH VFPNIYT+MK+PS+F+ V I S +    +YT +A 
Sbjct  321   RGPALNLSDISVTIGIYGFGFAGHSVFPNIYTSMKEPSQFSAVLITSVTFCFFIYTGVAV  380

Query  951   MGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSM-  1127
              G  MFG  + SQ TL+MP H V +K+A+W T++ PMTKYAL   P A+ ++   P +  
Sbjct  381   FGFLMFGDSIHSQFTLNMPTHFVASKIAVWTTIVNPMTKYALTMTPVALSVEELFPEAWT  440

Query  1128  -KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFW  1304
               H +   +R    ++L+   L +A+  P+F  V++L GSLV++ +++V PC  Y  +  
Sbjct  441   GSHCVSIFVR----TLLVSSTLGVAMSFPFFGSVMALIGSLVAMLVAVVFPCVCYLILLR  496

Query  1305  PKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
              ++++  +   +++I+ G + ++ GT S+
Sbjct  497   GRLTKLQIATCILIIIVGVVCSIIGTYSA  525



>ref|XP_006411137.1| hypothetical protein EUTSA_v10016467mg [Eutrema salsugineum]
 ref|XP_006411138.1| hypothetical protein EUTSA_v10016467mg [Eutrema salsugineum]
 gb|ESQ52590.1| hypothetical protein EUTSA_v10016467mg [Eutrema salsugineum]
 gb|ESQ52591.1| hypothetical protein EUTSA_v10016467mg [Eutrema salsugineum]
Length=553

 Score =   264 bits (675),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 149/428 (35%), Positives = 245/428 (57%), Gaps = 9/428 (2%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P    R    +  KD +++    E    +NSS+  AV+N + +L G+G LSTPYA
Sbjct  131   HGLLSPVPSRR---SSMRKDEKATMVSHEIPLSSNSSYGQAVLNGLNVLCGVGILSTPYA  187

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
              ++GGW+   +L   G++  +T  LL  CL  +   + Y DIGQ AFGT GRI  +  +Y
Sbjct  188   AKEGGWLGLMILFIYGLLSFYTGILLRYCLDSESDLETYPDIGQAAFGTTGRIFVSIVLY  247

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             LE++   V Y I   DNL+++F    L + G+ L    L  ++  L  LP++W RDLS +
Sbjct  248   LELYACCVEYIILESDNLSSLFPNAALSIGGLDLDARHLFALLTTLAVLPTVWLRDLSVL  307

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+L+ + +    +   V  + R   L+L  +P   GLY + Y+GH VFPN
Sbjct  308   SYISAGGVIASVLVVLCLFWIGLVDEVGIHSRGTTLNLSTLPVAIGLYGYCYSGHAVFPN  367

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT+M  P+++  V +  F + T++Y  +A MG  MFG    SQ TL++P+ +V TK+A+
Sbjct  368   IYTSMAKPTQYPAVLVTCFGICTLMYAGVAVMGYTMFGESTQSQFTLNLPQDLVATKIAV  427

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPP--SMKHHIKTIIRGGTGSililiilalalCVP  1211
             W TV+ P TKYAL  +P A+ L+  +P   +  H     IR    + L+   L + L +P
Sbjct  428   WTTVVNPFTKYALTISPVALSLEELIPSRHNKSHWYAIAIR----TALVFSTLLVGLSIP  483

Query  1212  YFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             +F  V+SL GSL+++ ++++LP   +  I   K++R  ++  V++I+ G + +V G+ S+
Sbjct  484   FFGLVMSLIGSLLTMLVTLILPPACFLSILRRKVTRTQMMLCVLIIIVGAISSVIGSYSA  543

Query  1392  FKLLVISL  1415
                +V  L
Sbjct  544   LSKIVEKL  551



>ref|XP_001781900.1| predicted protein [Physcomitrella patens]
 gb|EDQ53265.1| predicted protein [Physcomitrella patens]
Length=389

 Score =   259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/387 (37%), Positives = 232/387 (60%), Gaps = 8/387 (2%)
 Frame = +3

Query  273   IGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQ  452
             + +L G+G L+TPYAL++ GW++   L  L + C +T  LL +CL  +P    Y DIGQ 
Sbjct  1     MNVLAGVGVLTTPYALKEAGWVAVVYLCLLSLFCFYTGILLRRCLESEPGLATYPDIGQA  60

Query  453   AFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAV  632
             AFG  GRI+ +  +Y E++   V + I   DNL+ +F G HL + G+   +  + +V+  
Sbjct  61    AFGNTGRIIISIILYTELYACCVEFLILEGDNLSALFPGAHLSVAGVHFDSKTVFSVLTA  120

Query  633   LVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVS  812
             L  LP++W RDLS +S++S+ G++ S+++  +V        V      P   L  +P   
Sbjct  121   LFVLPTVWLRDLSYLSYVSAGGVIASMVVAFSVVGVGAIDGVGFYETGPLFKLSGLPVSI  180

Query  813   GLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQI  992
             GL+ F Y+GH VFPNIY+++++ + + KV  VSF + T+LY  +A +G KMFG   +SQI
Sbjct  181   GLFGFCYSGHAVFPNIYSSLRNRNDYNKVLGVSFILCTLLYAGMAVLGFKMFGADTASQI  240

Query  993   TLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSL---PPSMKHHIKTI-IRGG  1160
             TL++P+  + +K+A+W TV+ P TK+AL   P A+ L+  L   P S+KH   +I IR  
Sbjct  241   TLNLPKQFLASKIAVWTTVVNPFTKFALTMTPVALSLEELLPHSPDSLKHRSSSIFIR--  298

Query  1161  TGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNV  1340
               + L++  + +A+ VP+F +V++  GS +S+ +S++LPC  +  IF  KIS   + F V
Sbjct  299   --TALVVSTIGVAVLVPFFGYVMAFIGSFLSMTVSLILPCACFLAIFGKKISMIQIFFCV  356

Query  1341  VLIVFGTLLAVSGTVSSFKLLVISLQR  1421
             ++++ G +  V GT SS   +V S  +
Sbjct  357   MVMLIGFICLVLGTYSSISGIVASYSQ  383



>ref|XP_010517249.1| PREDICTED: vacuolar amino acid transporter 1 [Camelina sativa]
 ref|XP_010517250.1| PREDICTED: vacuolar amino acid transporter 1 [Camelina sativa]
 ref|XP_010517251.1| PREDICTED: vacuolar amino acid transporter 1 [Camelina sativa]
Length=551

 Score =   264 bits (675),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 147/409 (36%), Positives = 241/409 (59%), Gaps = 4/409 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD +SS    E     NSS+  AV+N + +L G+G LSTPYA ++GGW+   +L   G++
Sbjct  144   KDEKSSMISHEIPMSRNSSYGQAVLNGLNVLCGVGILSTPYAAKEGGWLGLMILFIYGLL  203

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +   + Y DIGQ AFGT GRI  +  +YLE++   V Y I   DNL
Sbjct  204   SFYTGILLRYCLDSESDLETYPDIGQAAFGTTGRIFVSIVLYLELYACCVEYIILESDNL  263

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             ++++    L + G QL    L  ++  L  LP++W RDLS +S++S+ G++ S+L+ + +
Sbjct  264   SSLYPNAALSIGGFQLDARHLFALLTTLAVLPTVWLRDLSVLSYISAGGVIASVLVVLCL  323

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  + +   L+L  +P   GLY + Y+GH VFPNIYT+M  PS++  V +  
Sbjct  324   FWIGLVDEVGIHSKGTTLNLSTLPVAIGLYGYCYSGHAVFPNIYTSMAKPSQYPAVLLTC  383

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F++ T++Y  +A MG  MFG    SQ TL++P+ +V TK+A+W TV+ P TKYAL  +P 
Sbjct  384   FTICTLMYAGVAVMGYTMFGESTESQFTLNLPQDLVATKIAVWTTVVNPFTKYALTISPV  443

Query  1092  AIELDHSLPPSMKHHIKTIIRG-GTGSililiilalalCVPYFEHVLSLTGSLVSIGISI  1268
             A+ L+  +P     HI++     G  + L+   L + L +P+F  V+SL GSL+++ +++
Sbjct  444   AMSLEELIP---SRHIRSHWYAIGIRTALVFSTLLVGLSIPFFGLVMSLIGSLLTMLVTL  500

Query  1269  VLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             +LP   +  I   K++   ++  V++I+ GT+ +V G+ S+   ++  L
Sbjct  501   ILPPACFLSIVRRKVTPTQMMLCVLIIIVGTISSVIGSYSALSKIIEKL  549



>ref|XP_010933084.1| PREDICTED: vacuolar amino acid transporter 1 [Elaeis guineensis]
Length=564

 Score =   264 bits (675),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 151/400 (38%), Positives = 239/400 (60%), Gaps = 11/400 (3%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E    +  S+  AV+N I +L G+G LSTPYA+++GGWI   +L+   V+  +T  LL  
Sbjct  168   ELPVSHQCSYGQAVLNGINVLCGVGILSTPYAVKEGGWIGLSILLIFAVLAWYTGILLRY  227

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL  +P  + Y DIGQ AFGT GR   +  +YLE++   V Y I   DNL+++F   HL 
Sbjct  228   CLDSEPGLQTYPDIGQAAFGTTGRFAVSIILYLELYGCCVEYIILESDNLSSLFPNAHLD  287

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             + G+ L++  L  +MA  + LP+ W +DLS +S++S+ G++ SLL+  ++    +   V+
Sbjct  288   IGGLHLNSHLLFAIMAAAIVLPTTWLQDLSILSYISAGGVIASLLVVFSLFWVGLVDQVD  347

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
               +    L+L  IP   GLY + Y+GH VFPNIY+++K P+++  V   SF++ T+++  
Sbjct  348   FQNGGTSLNLSGIPIAIGLYGYCYSGHAVFPNIYSSLKKPNQYPSVLFTSFAICTVMFAG  407

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
              A MG  MFG    SQ TL+MP  +V ++VA+W TV+ P+TKYAL   P A+ L+  +P 
Sbjct  408   AAVMGYIMFGDSTLSQFTLNMPHDLVMSRVAVWTTVVNPLTKYALTLTPMALSLEELIPA  467

Query  1122  S-MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYT--  1292
             + +K H+  II   T   L++  L +AL VP+F  V+SL GSL+++ ++++LPC  +   
Sbjct  468   NHVKSHMYAIIIRTT---LVVSTLLVALSVPFFGLVMSLIGSLLTMLVTLILPCACFLSI  524

Query  1293  ---KIFWPKISRPL--LIFNVVLIVFGTLLAVSGTVSSFK  1397
                K+ W ++S  +  +I  VV   FGT  A+S  + S  
Sbjct  525   LRGKVAWTQVSLCMFIIIVGVVSCAFGTFSAISKIIQSLS  564



>ref|XP_010509069.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
 ref|XP_010509070.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=551

 Score =   264 bits (674),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 147/409 (36%), Positives = 241/409 (59%), Gaps = 4/409 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD +SS    E     NSS+  AV+N + +L G+G LSTPYA ++GGW+   +L   G++
Sbjct  144   KDEKSSMISHEVPMSRNSSYGQAVLNGLNVLCGVGILSTPYAAKEGGWLGLIILFIYGLL  203

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +   + Y DIGQ AFGT GRI  +  +YLE++   V Y I   DNL
Sbjct  204   SFYTGILLRYCLDSESDLETYPDIGQAAFGTTGRIFVSIVLYLELYACCVEYIILESDNL  263

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             ++++    L + G QL    L  ++  L  LP++W RDLS +S++S+ G++ S+L+ + +
Sbjct  264   SSLYPNAALSIGGFQLDARHLFALLTTLAVLPTVWLRDLSVLSYISAGGVIASVLVVLCL  323

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  + +   L+L  +P   GLY + Y+GH VFPNIYT+M  PS++  V +  
Sbjct  324   FWIGLVDEVGIHSKGTTLNLSTLPVAIGLYGYCYSGHAVFPNIYTSMAKPSQYPAVLLTC  383

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F++ T++Y  +A MG  MFG    SQ TL++P+ +V TK+A+W TV+ P TKYAL  +P 
Sbjct  384   FTICTLMYAGVAVMGYTMFGESTESQFTLNLPQDLVATKIAVWTTVVNPFTKYALTISPV  443

Query  1092  AIELDHSLPPSMKHHIKTIIRG-GTGSililiilalalCVPYFEHVLSLTGSLVSIGISI  1268
             A+ L+  +P     HI++     G  + L+   L + L +P+F  V+SL GSL+++ +++
Sbjct  444   AMSLEELIP---SRHIRSHWYAIGIRTALVFSTLLVGLSIPFFGLVMSLIGSLLTMLVTL  500

Query  1269  VLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             +LP   +  I   K++   ++  V++I+ GT+ +V G+ S+   ++  L
Sbjct  501   ILPPACFLSIVRGKVTPTQMMLCVLIIIVGTISSVIGSYSALSKIIEKL  549



>ref|XP_010505578.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
 ref|XP_010505579.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
 ref|XP_010505581.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=551

 Score =   263 bits (673),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 146/409 (36%), Positives = 241/409 (59%), Gaps = 4/409 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD +SS    E     NSS+  AV+N + +L G+G LSTPYA ++GGW+   +L   G++
Sbjct  144   KDEKSSMISHEIPMSRNSSYGQAVLNGLNVLCGVGILSTPYAAKEGGWLGLMILFIYGLL  203

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +   + Y DIGQ AFGT GRI  +  +YLE++   V Y I   DNL
Sbjct  204   SFYTGILLRYCLDSESDLETYPDIGQAAFGTTGRIFVSIVLYLELYACCVEYIILESDNL  263

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             ++++    L + G QL    L  ++  L  LP++W RDLS +S++S+ G++ S+L+ + +
Sbjct  264   SSLYPNAALSIGGFQLDARHLFALLTTLAVLPTVWLRDLSVLSYISAGGVIASVLVVLCL  323

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  + +   L+L  +P   GLY + Y+GH VFPNIYT+M  PS++  V +  
Sbjct  324   FWIGLVDEVGIHSKGTTLNLSTLPVAIGLYGYCYSGHAVFPNIYTSMAKPSQYPAVLLTC  383

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F++ T++Y  +A MG  MFG    SQ TL++P+ +V TK+A+W TV+ P TKYAL  +P 
Sbjct  384   FTICTLMYAGVAVMGYTMFGESTESQFTLNLPQDLVATKIAVWTTVVNPFTKYALTISPV  443

Query  1092  AIELDHSLPPSMKHHIKTIIRG-GTGSililiilalalCVPYFEHVLSLTGSLVSIGISI  1268
             A+ L+  +P     HI++     G  + L+   L + L +P+F  V+SL GSL+++ +++
Sbjct  444   AMSLEELIP---SRHIRSHWYAIGIRTALVFSTLLVGLSIPFFGLVMSLIGSLLTMLVTL  500

Query  1269  VLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             +LP   +  I   K++   ++  +++I+ GT+ +V G+ S+   ++  L
Sbjct  501   ILPPACFLSIVRNKVTPTQMMLCILIIIVGTISSVIGSYSALSKIIEKL  549



>gb|AES62112.2| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=548

 Score =   263 bits (672),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 160/417 (38%), Positives = 242/417 (58%), Gaps = 18/417 (4%)
 Frame = +3

Query  198   LESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICA  377
             L+   +   +    + SF  AV+N I +L G+G LSTPYA ++GGW+   +L   G++  
Sbjct  137   LKKESKVSHEVPSRHCSFGQAVLNGINVLCGVGILSTPYAAKEGGWLGLSILFIFGILSF  196

Query  378   FTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLAT  557
             +T  LL  CL  +P  + Y DIGQ AFGT GRI  +  +Y+E++   + Y I   DNLA+
Sbjct  197   YTGLLLRSCLDSEPGLETYPDIGQAAFGTAGRIAISIVLYVELYGCCIEYIILEGDNLAS  256

Query  558   VFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVAC  737
             +F   +L L GI+L+   L  V+A L  LP++W RDLS +S++S+ G++ S+L+   V C
Sbjct  257   LFPNAYLNLGGIELNPQTLFAVVAALAVLPTVWLRDLSVLSYISAGGVIASVLV---VLC  313

Query  738   TAVFGV--VNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 G+  V        L+L  +P   GLY + Y+GH VFPNIYT+M  P++F  V +  
Sbjct  314   LLWIGIEDVGFQRSGTTLNLGTLPVAIGLYGYCYSGHAVFPNIYTSMAKPNQFPAVLVAC  373

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTK-------Y  1070
             F V T+LY   A MG KMFG    SQ TL++P+ +V TK+A+W TV+ P TK       Y
Sbjct  374   FGVCTLLYAGGAVMGYKMFGEDTLSQFTLNLPQDLVATKIAVWTTVVNPFTKYPLYAITY  433

Query  1071  ALEFAPFAIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGS  1244
             AL  +P A+ L+  +P +  K ++ +I IR G    L+   L + L VP+F  V+SL GS
Sbjct  434   ALTISPVAMSLEELIPANHAKSYLFSIFIRTG----LVFSTLVIGLSVPFFGLVMSLIGS  489

Query  1245  LVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             L+++ ++++LPC  Y +I   K++R      + +IV G   +  GT S+   +V SL
Sbjct  490   LLTMLVTLILPCVCYLRILRGKVTRIQAGLCITIIVVGVACSSVGTYSALAEIVKSL  546



>ref|XP_002987847.1| hypothetical protein SELMODRAFT_42776, partial [Selaginella moellendorffii]
 gb|EFJ11150.1| hypothetical protein SELMODRAFT_42776, partial [Selaginella moellendorffii]
Length=546

 Score =   263 bits (672),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 154/424 (36%), Positives = 244/424 (58%), Gaps = 10/424 (2%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVE----QAEKNNSSFMHAVINMIGMLIGLGQLS  305
               H+   S E    +T+   +  S +  +    Q  K   +F  A +N I +L G+G LS
Sbjct  122   QSHIVTVSSETRLRKTSSTRISPSSDAQDYHHLQLPKQGCTFFQATLNGINVLAGVGVLS  181

Query  306   TPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAA  485
             TPYAL++GGWI A +L+   V+C +T  LL KCL  +P    Y DIGQ AFG  GR++ +
Sbjct  182   TPYALKQGGWIGAIILLLFAVVCCYTGILLRKCLESEPGLVTYPDIGQAAFGRIGRLVIS  241

Query  486   SFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRD  665
               +Y+E++   V + I   DNLA++F   H    G ++ + ++ +++A L  LP++W RD
Sbjct  242   IILYVELYACCVEFLILEGDNLASLFPNAHFSFNGRKMESQKVFSMIAALFILPTVWLRD  301

Query  666   LSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHI  845
             LS +S++S+ G++ S+++ V+V        V   +    ++  N+P   GL  F ++GH 
Sbjct  302   LSLLSYISAGGVVTSIIVVVSVWWVGAVDGVGFRNTGSFINFGNLPVSIGLIGFCFSGHA  361

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPNIY++MKD ++F +V  + F +  ++Y  +A MG KMFG    SQ+TL++P+  V +
Sbjct  362   VFPNIYSSMKDRAQFNRVLQLCFLLCILMYGGVAIMGFKMFGAETQSQVTLNLPKQFVAS  421

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPP--SMKHHIKTIIRGGTGSililiilala  1199
             K+ALW TV+TP+TKYAL   P A+ L+  LP   S  H    +IR    + L+   L +A
Sbjct  422   KIALWTTVITPLTKYALTITPVALSLEELLPTQVSKNHFASVLIR----TSLVTSTLFVA  477

Query  1200  lCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSG  1379
             L +P+F  V++  GS +S+  S++LP   Y  I   +I +   I  VV I  G + A++G
Sbjct  478   LMIPFFGFVMAFIGSFLSLTGSLILPSACYLSISGRRIPKTQAIICVVTIFIGVIAAIAG  537

Query  1380  TVSS  1391
             T SS
Sbjct  538   TYSS  541



>ref|XP_002881631.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57890.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=549

 Score =   263 bits (672),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 147/409 (36%), Positives = 239/409 (58%), Gaps = 4/409 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD +SS    E     NSS+  AV+N + +L G+G LSTPYA ++GGW+   +L   G++
Sbjct  142   KDEKSSMVSHEIPMSRNSSYGQAVLNGLNVLCGVGILSTPYAAKEGGWLGLMILFVYGLL  201

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +   + Y DIGQ AFGT GRI  +  +YLE++   V Y I   DNL
Sbjct  202   SFYTGILLRYCLDSESDLETYPDIGQAAFGTTGRIFVSIVLYLELYACCVEYIILESDNL  261

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             ++++    L + G QL    L  ++  L  LP++W RDLS +S++S+ G++ S+L+ + +
Sbjct  262   SSLYPNAALSIGGFQLDARHLFALLTTLAVLPTVWLRDLSVLSYISAGGVIASVLVVLCL  321

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  + +   L+L  +P   GLY + Y+GH VFPNIYT+M  PS++  V +  
Sbjct  322   FWIGLVDEVGIHSKGTTLNLSTLPVAIGLYGYCYSGHAVFPNIYTSMAKPSQYPAVLLTC  381

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F + T++Y  +A MG  MFG    SQ TL++P+ +V TK+A+W TV+ P TKYAL  +P 
Sbjct  382   FGICTLMYAGVAVMGYTMFGESTQSQFTLNLPQDLVATKIAVWTTVVNPFTKYALTISPV  441

Query  1092  AIELDHSLPPSMKHHIKTIIRG-GTGSililiilalalCVPYFEHVLSLTGSLVSIGISI  1268
             A+ L+  +P     HI++     G  + L+   L + L +P+F  V+SL GSL+++ +++
Sbjct  442   AMSLEELIP---SRHIRSHWYAIGIRTALVFSTLLVGLAIPFFGLVMSLIGSLLTMLVTL  498

Query  1269  VLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             +LP   +  I   K++   ++  V++I+ G + +V G+ S+   +V  L
Sbjct  499   ILPPACFLSIVRRKVTPTQMMLCVLIIIVGAISSVIGSYSALSKIVEKL  547



>ref|XP_002311078.2| amino acid transporter family protein [Populus trichocarpa]
 gb|EEE88445.2| amino acid transporter family protein [Populus trichocarpa]
Length=554

 Score =   263 bits (671),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 151/410 (37%), Positives = 245/410 (60%), Gaps = 6/410 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD + S+   E      SSF  AVIN + +L G+G LSTPYA ++GGW+   +L+   V+
Sbjct  147   KDEKPSQVSHELPMSRQSSFGQAVINGLNVLCGVGILSTPYAAKEGGWLGLIILLVFAVL  206

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +P  + Y DIGQ AFGT GR + +  +Y+E++   V Y I   DNL
Sbjct  207   SFYTGMLLRYCLDSEPGLETYPDIGQAAFGTTGRFVISIILYVELYACCVEYIILEGDNL  266

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             +++F   H+ L G ++ +  L  +M  L  LP++W RDLS +S++S+ G++ S+L+ +++
Sbjct  267   SSLFPNAHISLGGFEMDSHHLFALMTTLAVLPTVWLRDLSVLSYISAGGVVASVLVVLSL  326

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  + +   L+L  +P   GLY + Y+GH VFPNIYT+M  PS+F  V +  
Sbjct  327   FWVGLVDNVGIHSKGTVLNLGTLPVAIGLYGYCYSGHAVFPNIYTSMAQPSRFPTVLLAC  386

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             FS+ T +Y  +A+MG  MFG    +Q TL++P+ +V +KVA+W TV+ P TKYAL  +P 
Sbjct  387   FSICTSMYAGVAYMGYTMFGESTETQFTLNLPQDLVVSKVAVWTTVVNPFTKYALTMSPV  446

Query  1092  AIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGIS  1265
             A+ L+  +P + MK H+  I IR    + L+   L + L +P+F  V+SL GSL+++ ++
Sbjct  447   AMSLEELIPSNHMKSHMYAICIR----TALVFSTLLVGLAIPFFGLVMSLIGSLLTMLVT  502

Query  1266  IVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             ++LPC  +  I   K +R   +  +++I  G + +  GT S+   ++ +L
Sbjct  503   LILPCACFLSIVRGKATRFQGVVCIIIIAVGIVSSAFGTHSALSKIIENL  552



>ref|XP_009588888.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Nicotiana tomentosiformis]
Length=552

 Score =   263 bits (671),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 151/406 (37%), Positives = 235/406 (58%), Gaps = 4/406 (1%)
 Frame = +3

Query  201   ESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAF  380
             E S++         SS+  AV+N + +L G+G LSTPYA+++GGW    +L   GV+  +
Sbjct  149   EPSKDAHGLTMSRQSSYGQAVVNGMNVLCGVGILSTPYAMKEGGWSGLSILFIFGVLSFY  208

Query  381   TTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATV  560
             T  LL  CL   P  + Y DIGQ AFGT GRI  +  +Y+E++ + + Y I   DNL+ +
Sbjct  209   TGILLRSCLDSQPGLETYPDIGQAAFGTPGRIFISIILYVELYFSCIEYIILEGDNLSAI  268

Query  561   FLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACT  740
             F   HL L   +L    L   +A L  LP++W RDLS +S++S  G++ S+L+ + +   
Sbjct  269   FPNAHLSLGSFELDARHLFVFIATLAVLPTVWLRDLSVLSYISVGGVVASVLVVLCLYWA  328

Query  741   AVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSV  920
              +   V    +   L+L  +P   GLY F Y+GH VFPNIYT++ D ++F  V +  F +
Sbjct  329   GLVDHVGFESKGTVLNLSTLPVAIGLYGFCYSGHAVFPNIYTSLADRNQFPAVLLTCFGM  388

Query  921   VTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIE  1100
             VT+LY   A MG  MFG    SQ TL++P+ ++ +KVA+W TV+ P TKYAL  +P A+ 
Sbjct  389   VTLLYGGTAVMGYLMFGDSADSQFTLNLPKGLIASKVAVWTTVVNPFTKYALTLSPVAMS  448

Query  1101  LDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLP  1277
             L+  LP    K H+  I+     + L    L + L +P+F  V++L GSL+++ ++++LP
Sbjct  449   LEELLPSKHAKSHVYPIL---IRTALAFSTLVVGLSIPFFGLVMALIGSLLTMLVTLILP  505

Query  1278  CGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             C  + +I   K SR  +   V++I  GT+ AV G+ S+   ++ SL
Sbjct  506   CVCFLRILKGKTSRLQVSVCVLIITVGTISAVIGSYSAVSNIIQSL  551



>emb|CDY07919.1| BnaC03g36040D [Brassica napus]
Length=528

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 149/420 (35%), Positives = 234/420 (56%), Gaps = 14/420 (3%)
 Frame = +3

Query  174   EDQTAVKDLESSE-----ECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWI  338
             +D  +VK   SS+       +   E+N  SF  +V+N I +L G+  L+ PYA+++GGW+
Sbjct  110   KDDVSVKSYVSSQLKLSITDLSYEEQNLCSFPQSVLNGINILCGVSLLTMPYAVKEGGWL  169

Query  339   SAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMAL  518
                +L   G+I  +T  LL +CL   P    Y DIGQ AFG  GR++ +  +Y+E++   
Sbjct  170   GLIILFFFGIITCYTGILLKRCLESSPDIHTYPDIGQAAFGFSGRLIVSILLYMELYACC  229

Query  519   VSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAG  698
             V Y I + DNL+  F    L + G+ + +SQ+  +   L+ LP++W RDLS +S+LS+ G
Sbjct  230   VEYIIMMSDNLSRFFPSVSLNVAGVSIDSSQIFAIATALIVLPTVWLRDLSLLSYLSAGG  289

Query  699   ILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKD  878
             +  S+L+ + +        +  +     L L N+P   G++ F ++GH VFPNIY++MKD
Sbjct  290   VFSSILLALCLFWVGSVDGIGFHSGGQALDLSNLPVAIGIFGFGFSGHAVFPNIYSSMKD  349

Query  879   PSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTP  1058
             PSKF  V I+SF    + Y A+A  G  MFG  + SQ TLSMP+    +K+A+W  V+TP
Sbjct  350   PSKFPLVLIISFGFCVVFYIAVAVCGYSMFGEAIQSQFTLSMPQQFTSSKIAVWTAVITP  409

Query  1059  MTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCV----PYFEHV  1226
             MTKYAL   P  + L+  +P S K     +I  G    L  I++   L V    P+F  +
Sbjct  410   MTKYALTLTPIVLSLEELMPSSEK-----MISNGVSMFLRTILVLSTLVVALEFPFFAIM  464

Query  1227  LSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
              +L GS +S+ ++ +LPC  Y  I   ++S+  +   V++I+ G +    GT S+   LV
Sbjct  465   GALMGSFLSMLLAFILPCLCYLSILRGRLSKIQMGVCVLIIIAGIVSGCCGTYSAIGKLV  524



>ref|NP_850312.1| transmembrane amino acid transporter [Arabidopsis thaliana]
 gb|AEC09638.1| transmembrane amino acid transporter [Arabidopsis thaliana]
Length=550

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/409 (36%), Positives = 240/409 (59%), Gaps = 4/409 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD +SS    E     NSS+  AV+N + +L G+G LSTPYA ++GGW+   +L   G++
Sbjct  143   KDEKSSMVSHEIPMSRNSSYGQAVLNGLNVLCGVGILSTPYAAKEGGWLGLMILFVYGLL  202

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +   + Y DIGQ AFGT GRI  +  +YLE++   V Y I   DNL
Sbjct  203   SFYTGILLRYCLDSESDLETYPDIGQAAFGTTGRIFVSIVLYLELYACCVEYIILESDNL  262

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             ++++    L + G QL    L  ++  L  LP++W RDLS +S++S+ G++ S+L+ + +
Sbjct  263   SSLYPNAALSIGGFQLDARHLFALLTTLAVLPTVWLRDLSVLSYISAGGVIASVLVVLCL  322

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  + +   L+L  +P   GLY + Y+GH VFPNIYT+M  PS++  V +  
Sbjct  323   FWIGLVDEVGIHSKGTTLNLSTLPVAIGLYGYCYSGHAVFPNIYTSMAKPSQYPAVLLTC  382

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F + T++Y  +A MG  MFG    SQ TL++P+ ++ TK+A+W TV+ P TKYAL  +P 
Sbjct  383   FGICTLMYAGVAVMGYTMFGESTQSQFTLNLPQDLIATKIAVWTTVVNPFTKYALTISPV  442

Query  1092  AIELDHSLPPSMKHHIKTIIRG-GTGSililiilalalCVPYFEHVLSLTGSLVSIGISI  1268
             A+ L+  +P     HI++     G  ++L+   L + L +P+F  V+SL GSL+++ +++
Sbjct  443   AMSLEELIP---SRHIRSHWYAIGIRTLLVFSTLLVGLAIPFFGLVMSLIGSLLTMLVTL  499

Query  1269  VLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             +LP   +  I   K++   ++  V++I+ G + +V G+ S+   +V  L
Sbjct  500   ILPPACFLSIVRRKVTPTQMMLCVLIIIVGAISSVIGSYSALSKIVEKL  548



>ref|XP_003591861.1| Amino acid transporter [Medicago truncatula]
Length=550

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 160/419 (38%), Positives = 242/419 (58%), Gaps = 20/419 (5%)
 Frame = +3

Query  198   LESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICA  377
             L+   +   +    + SF  AV+N I +L G+G LSTPYA ++GGW+   +L   G++  
Sbjct  137   LKKESKVSHEVPSRHCSFGQAVLNGINVLCGVGILSTPYAAKEGGWLGLSILFIFGILSF  196

Query  378   FTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLAT  557
             +T  LL  CL  +P  + Y DIGQ AFGT GRI  +  +Y+E++   + Y I   DNLA+
Sbjct  197   YTGLLLRSCLDSEPGLETYPDIGQAAFGTAGRIAISIVLYVELYGCCIEYIILEGDNLAS  256

Query  558   VFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVAC  737
             +F   +L L GI+L+   L  V+A L  LP++W RDLS +S++S+ G++ S+L+   V C
Sbjct  257   LFPNAYLNLGGIELNPQTLFAVVAALAVLPTVWLRDLSVLSYISAGGVIASVLV---VLC  313

Query  738   TAVFGV--VNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 G+  V        L+L  +P   GLY + Y+GH VFPNIYT+M  P++F  V +  
Sbjct  314   LLWIGIEDVGFQRSGTTLNLGTLPVAIGLYGYCYSGHAVFPNIYTSMAKPNQFPAVLVAC  373

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTK--------  1067
             F V T+LY   A MG KMFG    SQ TL++P+ +V TK+A+W TV+ P TK        
Sbjct  374   FGVCTLLYAGGAVMGYKMFGEDTLSQFTLNLPQDLVATKIAVWTTVVNPFTKYPLYACII  433

Query  1068  -YALEFAPFAIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLT  1238
              YAL  +P A+ L+  +P +  K ++ +I IR G    L+   L + L VP+F  V+SL 
Sbjct  434   TYALTISPVAMSLEELIPANHAKSYLFSIFIRTG----LVFSTLVIGLSVPFFGLVMSLI  489

Query  1239  GSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             GSL+++ ++++LPC  Y +I   K++R      + +IV G   +  GT S+   +V SL
Sbjct  490   GSLLTMLVTLILPCVCYLRILRGKVTRIQAGLCITIIVVGVACSSVGTYSALAEIVKSL  548



>ref|XP_010490633.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=523

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/392 (37%), Positives = 231/392 (59%), Gaps = 3/392 (1%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E  + +F  +V+N I +L G+  L+ PYA+++GGW+  F+L   GVI  +T  LL  CL 
Sbjct  131   ETGSCTFSQSVLNGINVLCGVALLTMPYAVKEGGWLGLFILFSFGVITFYTGILLKICLE  190

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG  590
               P    Y DIGQ  FG  GRI+ +  +Y+E++ + V Y I + DNL+ +F  T L +TG
Sbjct  191   NSPGIHTYPDIGQAVFGITGRIIVSILLYVELYASCVEYIIMMSDNLSGMFPNTSLYITG  250

Query  591   IQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNH  770
             + L + Q+  +   LV LP++W +DLS +S+LS+ G++ S+L+ + +  T     V  N 
Sbjct  251   LSLDSHQIFAITTTLVVLPTVWLKDLSLLSYLSAGGVVSSILLALCLFWTGSVDGVGFNL  310

Query  771   RIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAF  950
                 L L NIP   G+Y F + GH VFPNIY++MK+PSKF  V ++SF   T+ Y A+A 
Sbjct  311   SGKALDLTNIPVAIGIYGFGFVGHSVFPNIYSSMKEPSKFPMVLLISFGFCTLFYIAVAV  370

Query  951   MGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMK  1130
              G  MFG  + SQ TL+MP+    +K+A+W  V+TPM KYAL   P  + L+  +P S++
Sbjct  371   CGYTMFGDAIQSQFTLNMPQQFTSSKIAVWTAVVTPMAKYALTITPVMLGLEELIPSSLR  430

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
                 +I+     +I++L  L +AL VP+F  V +L GS +++ I+++ PC  Y  +   +
Sbjct  431   SKGFSILF---RTIVVLSTLVVALTVPFFATVAALMGSFIAMLIALIFPCLCYISVMKGR  487

Query  1311  ISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             ++   +   +++I+ G +    GT S+   L+
Sbjct  488   LTNFQMGVCILIIIIGVVSGCCGTYSAIARLI  519



>ref|XP_010253961.1| PREDICTED: vacuolar amino acid transporter 1-like [Nelumbo nucifera]
Length=555

 Score =   262 bits (670),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 248/427 (58%), Gaps = 4/427 (1%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P   ++   +    D +  +   E +     S+  +V+N I +L G+G LSTPYA
Sbjct  131   HSLLPPIPTKKPSAKKITPDQKPHKVSHETSAPRQCSYGQSVLNGINVLCGVGILSTPYA  190

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
              ++GGW+   +L  + ++  +T  LL KCL  +P  + Y DIGQ AFGT GR+  +  +Y
Sbjct  191   AKEGGWLGLSILFIIAMLSWYTGILLRKCLDSEPGLETYPDIGQAAFGTVGRLFISIVLY  250

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   V Y I   DNL++ F   HL   G+QL +  L  ++ +L  LP++W RDLS +
Sbjct  251   VELYACCVEYVILESDNLSSFFPNAHLSFGGLQLDSHHLFALIFILAVLPTVWLRDLSVL  310

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+L+ + +    +   V  +++   L+L  +P   GLY + Y+GH VFPN
Sbjct  311   SYISAGGVIASILVVLCLFWIGLVDQVGFHNKGTTLNLTTLPVAIGLYGYCYSGHAVFPN  370

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT+M  PS++  V + +F++ T+LY   A +G  MFG    SQ TL+MP  +V +K+A+
Sbjct  371   IYTSMAKPSQYPSVLLTTFTICTLLYAGAALIGYTMFGETTESQFTLNMPHDLVASKIAV  430

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPP-SMKHHIKTIIRGGTGSililiilalalCVPY  1214
             W TV+ P TKYAL   P A+ L+  +P   +K H+  I+     + L++  L +AL VP+
Sbjct  431   WTTVVNPFTKYALTMMPVALSLEELIPSVHLKSHMYAIL---IRTALVISTLLVALSVPF  487

Query  1215  FEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSF  1394
             F  V++L GSL ++ +S++LPC  + +I   K++       +++I+ G + +  GT S+ 
Sbjct  488   FGFVMALVGSLFTMLVSLILPCACFLRILRGKVTMFQGSMCILIIIVGVICSGYGTFSAL  547

Query  1395  KLLVISL  1415
               ++ +L
Sbjct  548   SKIIENL  554



>gb|KFK24700.1| hypothetical protein AALP_AA8G013400 [Arabis alpina]
Length=529

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/363 (38%), Positives = 216/363 (60%), Gaps = 0/363 (0%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E  + +F  +V+N I +L G+  L+ PYAL++GGW+  FLL   GVI  +T  LL +C+ 
Sbjct  134   ENRSCTFSQSVLNGINVLCGVSLLAMPYALKQGGWLGLFLLFSFGVITFYTGLLLKRCME  193

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG  590
               P    Y DIGQ AFGT GRIL +  +Y+E++ + V Y I + DNL+ +F  T L +T 
Sbjct  194   NSPGIHTYPDIGQAAFGTTGRILVSILLYVELYASCVEYIIMMSDNLSGIFPNTSLYITE  253

Query  591   IQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNH  770
             + L  SQ+  + + L+ LP++W RDLS +S+LS+ G+  S+L+ + +        V  + 
Sbjct  254   VSLDASQVFAITSTLIVLPTVWLRDLSLLSYLSAGGVFSSILLALCLFWVGSVDKVGFHL  313

Query  771   RIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAF  950
                 L L N+P   G+Y F +  H VFPNIY++MK+PSKF  V ++SF+  T+ Y A+A 
Sbjct  314   SGKALDLANLPVAIGIYGFGFGSHSVFPNIYSSMKEPSKFPMVLLISFAFCTVFYIAVAV  373

Query  951   MGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMK  1130
              G  MFG  + SQ TL+MP+H   +K+A+W  V+TPMTKYAL   P  + L+  +P S +
Sbjct  374   CGYTMFGDAIQSQFTLNMPQHFTSSKIAVWTAVVTPMTKYALTITPVVLSLEELIPTSSR  433

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
                         ++L+L  L +AL +P+F  V +L GS +++ I+++ PC  Y  I   +
Sbjct  434   KMRSKGFSMLFRTVLVLSTLVVALTIPFFATVGALIGSFIAMLIALIFPCLCYLSIMKGR  493

Query  1311  ISR  1319
             ++ 
Sbjct  494   LTN  496



>ref|XP_009135985.1| PREDICTED: vacuolar amino acid transporter 1-like [Brassica rapa]
Length=528

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/419 (36%), Positives = 238/419 (57%), Gaps = 12/419 (3%)
 Frame = +3

Query  174   EDQTAVKDLESSE-----ECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWI  338
             +D  +VK   SS+       +   E+N  SF  +V+N I +L G+  L+ PYA+++GGW+
Sbjct  110   KDDVSVKSYVSSQLKLSITDLSYEEQNLCSFPQSVLNGINILCGVSLLTMPYAVKEGGWL  169

Query  339   SAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMAL  518
                +L   G+I  +T  LL +CL   P    Y DIGQ AFG  GR++ +  +Y+E++   
Sbjct  170   GLIILFFFGIITCYTGILLKRCLESSPDIHTYPDIGQAAFGFTGRLIISILLYMELYACC  229

Query  519   VSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAG  698
             V Y I + DNL+  F    L + G+ + +SQ+  +   L+ LP++W RDLS +S+LS+ G
Sbjct  230   VEYIIMMSDNLSRFFPHVSLNVAGVSIDSSQIFAIATALIVLPTVWLRDLSLLSYLSAGG  289

Query  699   ILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKD  878
             +  S+L+ + +        V  +     L L N+P   G++ F ++GH VFPNIY++MKD
Sbjct  290   VFSSILLALCLFWVGSVDGVGFHSGGQALDLSNLPVAIGIFGFGFSGHAVFPNIYSSMKD  349

Query  879   PSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTP  1058
             PSKF  V I+SF    + Y A+A  G  MFG  + SQ TLSMP+    +K+A+W  V+TP
Sbjct  350   PSKFPLVLIISFGFCVVFYIAVAVCGYSMFGEAIQSQFTLSMPQQFTSSKIAVWTAVITP  409

Query  1059  MTKYALEFAPFAIELDHSLPPSMK---HHIKTIIRGGTGSililiilalalCVPYFEHVL  1229
             MTKYAL   P  + L+  +P S K   + +   +R    +IL+L  L +AL  P+F  + 
Sbjct  410   MTKYALTLTPIVLSLEELMPSSEKMRSNGVSMFLR----TILVLSTLVVALAFPFFAIMG  465

Query  1230  SLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             +L GS +S+ ++ +LPC  Y  I   ++S+  +   V++I+ G +    GT S+   LV
Sbjct  466   ALMGSFLSMLLAFILPCLCYLSILRGRLSKIQMGVCVLIIIAGIVSGCCGTYSAIGKLV  524



>ref|XP_002316384.2| hypothetical protein POPTR_0010s23280g [Populus trichocarpa]
 ref|XP_006378775.1| hypothetical protein POPTR_0010s23280g [Populus trichocarpa]
 ref|XP_006378776.1| hypothetical protein POPTR_0010s23280g [Populus trichocarpa]
 gb|EEF02555.2| hypothetical protein POPTR_0010s23280g [Populus trichocarpa]
 gb|ERP56572.1| hypothetical protein POPTR_0010s23280g [Populus trichocarpa]
 gb|ERP56573.1| hypothetical protein POPTR_0010s23280g [Populus trichocarpa]
Length=554

 Score =   262 bits (669),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 150/410 (37%), Positives = 244/410 (60%), Gaps = 6/410 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD + S    E      SSF  A++N + +L G+G LSTPYA ++GGW+   +L+   V+
Sbjct  147   KDEKLSRVSHELPMSRQSSFGQALLNGLNVLCGVGILSTPYAAKEGGWLGLSILLIFAVL  206

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +P    Y DIGQ AFGT GR++ +  +Y+E++   V Y I   DNL
Sbjct  207   SFYTGMLLRDCLDSEPGLGTYPDIGQAAFGTAGRVVISIILYVELYACCVEYIILESDNL  266

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             +++F   ++ L G +L +     +M  L  LP++W RDLS +S++S+ G++ S+L+ + +
Sbjct  267   SSLFPNANISLGGFELDSHHFFALMTTLAVLPTVWLRDLSVLSYISAGGVIASVLVVLCL  326

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  +     L+L  +P   GLY + Y+GH VFPNIYT+M  P++F  V +  
Sbjct  327   FWIGLIDNVGIHSEGTVLNLGTLPVAIGLYGYCYSGHAVFPNIYTSMAQPNRFPAVLLAC  386

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F + T++Y  +A+MG  MFG    SQ TL++P+ +V +KVA+W TV+ P TKYAL  +P 
Sbjct  387   FGLCTLMYAGVAYMGYTMFGEKTESQFTLNLPQDLVASKVAVWTTVVNPFTKYALTMSPV  446

Query  1092  AIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGIS  1265
             A+ L+  +P + MK H+  I IR    + L++  L +AL +P+F  V+SL GSL+++ ++
Sbjct  447   AMSLEELIPSNHMKSHMYAICIR----TALVISTLLVALSIPFFGLVMSLIGSLLTMLVT  502

Query  1266  IVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             ++LPC  +  I   K +R  +   +++I  G + +V GT SS   ++ +L
Sbjct  503   LILPCACFLSILRGKATRFQIAVCIIIIAVGVVSSVFGTRSSLSRIIENL  552



>ref|XP_006429127.1| hypothetical protein CICLE_v10011256mg [Citrus clementina]
 gb|ESR42367.1| hypothetical protein CICLE_v10011256mg [Citrus clementina]
Length=650

 Score =   264 bits (675),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 154/388 (40%), Positives = 229/388 (59%), Gaps = 12/388 (3%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             S   + +N I +L G+G L+TPYA+++GGW S  LL   G+I  +T  LL +CL   P  
Sbjct  164   SLAQSCLNGINVLCGVGLLATPYAIKEGGWSSLSLLFIFGIIAFYTGILLQECLDSAPGL  223

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y D+GQ AFG  GR++ A  +YLE+F A + Y I + DNLA++F  T +   G+ L  
Sbjct  224   TTYPDVGQAAFGITGRLIVAIVLYLELFAASIEYLIMMSDNLASLFPHTSMNFGGLHLDC  283

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIP--  779
              ++ ++ A LV LP++W RDL+ +S++S  G++ +    V V C    G+V+     P  
Sbjct  284   HKIFSITATLVVLPTVWLRDLTLLSYISVGGVITT---GVVVLCLLWIGLVDAVGFHPYG  340

Query  780   -PLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMG  956
               L L N+P   GLY F+YAGH VFPNIY++M++P KF  V ++SF   ++L   +   G
Sbjct  341   TALDLSNLPVTIGLYGFAYAGHSVFPNIYSSMQEPKKFPFVLMISFVFCSLLNAGVGICG  400

Query  957   AKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS--MK  1130
               MFG  + SQ TL+ P+  V +KVA+W TVL PM+KYA+   P A+ L+  +P      
Sbjct  401   YLMFGDSIQSQFTLNFPKEFVASKVAIWTTVLIPMSKYAMTLTPIALSLEELMPSKELQS  460

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
             + +  IIR    +IL +  L +AL +PYF  V+SL GSL+++ I+++ PC FY KI   K
Sbjct  461   YSVSVIIR----TILAISTLVVALTLPYFGIVMSLIGSLLAMLITLIFPCVFYLKILQGK  516

Query  1311  ISRPLLIFNVVLIVFGTLLAVSGTVSSF  1394
             IS+  + F +   V G   A  GT S+ 
Sbjct  517   ISKLKIAFCIFNAVLGVFCACIGTYSAL  544



>gb|AAK92736.1| unknown protein [Arabidopsis thaliana]
Length=550

 Score =   261 bits (668),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/409 (36%), Positives = 240/409 (59%), Gaps = 4/409 (1%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD +SS    E     NSS+  AV+N + +L G+G LSTPYA ++GGW+   +L   G++
Sbjct  143   KDEKSSMVSHEIPMSRNSSYGQAVLNGLNVLCGVGILSTPYAAKEGGWLGLMILFVYGLL  202

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +   + Y DIGQ AFGT GRI  +  +YLE++   V Y I   DNL
Sbjct  203   SFYTGILLRYCLDSESDLETYPDIGQAAFGTTGRIFVSIVLYLELYACCVEYIILEIDNL  262

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             ++++    L + G QL    L  ++  L  LP++W RDLS +S++S+ G++ S+L+ + +
Sbjct  263   SSLYPNAALSIGGFQLDARHLFALLTTLAVLPTVWLRDLSVLSYISAGGVIASVLVVLCL  322

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  + +   L+L  +P   GLY + Y+GH VFPNIYT+M  PS++  V +  
Sbjct  323   FWIGLVDEVGIHSKGTTLNLSTLPVAIGLYGYCYSGHAVFPNIYTSMAKPSQYPAVLLTC  382

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F + T++Y  +A MG  MFG    SQ TL++P+ ++ TK+A+W TV+ P TKYAL  +P 
Sbjct  383   FGICTLMYAGVAVMGYTMFGESTQSQFTLNLPQDLIATKIAVWTTVVNPFTKYALTISPV  442

Query  1092  AIELDHSLPPSMKHHIKTIIRG-GTGSililiilalalCVPYFEHVLSLTGSLVSIGISI  1268
             A+ L+  +P     HI++     G  ++L+   L + L +P+F  V+SL GSL+++ +++
Sbjct  443   AMSLEELIP---SRHIRSHWYAIGIRTLLVFSTLLVGLAIPFFGLVMSLIGSLLTMLVTL  499

Query  1269  VLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             +LP   +  I   K++   ++  V++I+ G + +V G+ S+   +V  L
Sbjct  500   ILPPACFLSIVRRKVTPTQMMLCVLIIIVGAISSVIGSYSALSKIVEKL  548



>ref|XP_009141789.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Brassica rapa]
Length=550

 Score =   261 bits (668),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 144/438 (33%), Positives = 247/438 (56%), Gaps = 14/438 (3%)
 Frame = +3

Query  132   DGHKHVEPASGERFEDQTAVKDLESSEECVEQAEK--------NNSSFMHAVINMIGMLI  287
             +  +   P    R      +  + S    + + E+         NSS+  AV+N + +L 
Sbjct  115   EAEEQAPPPPKHRLSSHGLLPPVPSRRSSMRKDERVSHEVPMSRNSSYGQAVMNGLNVLC  174

Query  288   GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTK  467
             G+G LSTPYA ++GGW+   +L   G++  +T  LL  CL  +   + Y DIGQ AFGT 
Sbjct  175   GVGILSTPYAAKEGGWLGLGILFIYGLLSFYTGILLRYCLDSESDLETYPDIGQAAFGTT  234

Query  468   GRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALP  647
             GRI  +  +YLE++   V Y I   DNL++++    L + G +L    L  ++  +  LP
Sbjct  235   GRIFVSIVLYLELYACCVEYIILESDNLSSLYPNAGLSIGGFELDARHLFALLTTIAVLP  294

Query  648   SLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAF  827
             ++W RDLS +S++S+ G++ S+L+ +++    +   V  + +   L+L  +P   GLY +
Sbjct  295   TVWLRDLSLLSYISAGGVIASVLVVLSLFWIGLVDDVGIHSKGTTLNLSTLPVAIGLYGY  354

Query  828   SYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMP  1007
              Y+GH VFPNIYT+M +P+++    +  F++ T++Y  +AFMG  MFG    SQ TL++P
Sbjct  355   CYSGHAVFPNIYTSMANPNQYPSALLTCFTICTLMYAGVAFMGYTMFGEATESQFTLNLP  414

Query  1008  RHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP--SMKHHIKTIIRGGTGSilil  1181
             + +V TK+A+W TV+ P TKYAL  +P A+ L+  +P   +  H     IR    + L+ 
Sbjct  415   QDLVATKIAVWTTVVNPFTKYALTLSPVALSLEELIPSRHNKSHWYAIAIR----TALVF  470

Query  1182  iilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGT  1361
               L + L +P+F  V+SL GSL+++ ++++LP   +  I   K++R  ++  V++IV G 
Sbjct  471   STLLVGLAIPFFGLVMSLIGSLLTMLVTLILPPACFLSIVRRKVTRTQMMLCVLIIVVGA  530

Query  1362  LLAVSGTVSSFKLLVISL  1415
             + +V G+ S+   ++  L
Sbjct  531   ISSVIGSYSALSQIIEKL  548



>gb|EYU39626.1| hypothetical protein MIMGU_mgv1a003970mg [Erythranthe guttata]
Length=552

 Score =   261 bits (668),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 156/425 (37%), Positives = 248/425 (58%), Gaps = 27/425 (6%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             ++ + P    +   + AV D  +S    E +    S+F  AVIN + +L G+G LSTPYA
Sbjct  129   YQLLSPTLSRKSSLRKAVLDKRASV-ANEISTTRQSTFGQAVINGMNVLCGVGILSTPYA  187

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
             + +GGW    +L+   V+  +T  LL +CL   P  + Y DIGQ AFGT GRI  +  +Y
Sbjct  188   VREGGWFGLSVLLIFAVLSFYTGILLRRCLDSQPGLETYPDIGQAAFGTTGRICISIILY  247

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   V Y I   DNLA++F   HL L  I+L +  L  ++  +  LP++W RDLS +
Sbjct  248   VELYACCVEYIILEGDNLASLFPNAHLNLGVIELDSHHLFALIITIAVLPTVWLRDLSIL  307

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNP---NHRIPPLHLPNIPSVSGLYAFSYAGHIV  848
             S++S+ G++ S+L+   VAC    G+V+    + +   L+L  +P   GLY F Y+GH V
Sbjct  308   SYISAGGVIASILV---VACLFWIGLVDEVGIHSKGTTLNLSTLPVAIGLYGFCYSGHAV  364

Query  849   FPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTK  1028
             FPNIY++M++PS++  V + SF + T++Y + A MG  MFG    SQ TL+MP+++V +K
Sbjct  365   FPNIYSSMEEPSQYPSVLLASFGICTVMYASAATMGYTMFGESTQSQFTLNMPQNLVASK  424

Query  1029  VALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT-----IIRGGTGSililiila  1193
             +A+W TV+ P TKYAL  +P A+ L+  +P     H K+     +IR    + L++  L 
Sbjct  425   IAVWTTVVNPFTKYALTISPVAMSLEELIP---SRHAKSRTYSILIR----TALVISTLV  477

Query  1194  lalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKIS---RPLLIFNVVLIVFGTL  1364
             + L +P+F  V +L GSL+++ ++++LPC  Y  I   K++   R + +F     V G  
Sbjct  478   VGLSIPFFGLVSALIGSLLTMLVTLILPCACYLSILGEKLNSLQRAMCVF-----VIGVG  532

Query  1365  LAVSG  1379
             +A SG
Sbjct  533   VAASG  537



>ref|XP_006293964.1| hypothetical protein CARUB_v10022954mg [Capsella rubella]
 gb|EOA26862.1| hypothetical protein CARUB_v10022954mg [Capsella rubella]
Length=538

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 148/391 (38%), Positives = 219/391 (56%), Gaps = 2/391 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   + N I ++ G+G LSTPY +++ GW S  +L+   VIC +T  L+ +C       
Sbjct  150   SFTQTIFNAINVMAGVGLLSTPYTVKEAGWASMVILLLFAVICCYTATLMKECFENKTGI  209

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT L   GI + +
Sbjct  210   ITYPDIGEAAFGIYGRILICVLLYTELYSYCVEFIILEGDNLTGLFPGTSLDWLGIHIDS  269

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  +   LV LP++W +DL  IS+LS+ G++ ++LI V+V      G +  +H    +
Sbjct  270   KHLFGIFTALVVLPTVWLKDLRIISYLSAGGVIATVLIAVSVFLLGTTGGIGFHHTGQAV  329

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
              L  IP   G+Y F Y+GH VFPNIY +M D +KF K  I  F +  +LY  +A MG  M
Sbjct  330   KLKGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITVFILCVLLYGGVAVMGYLM  389

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP++  F+KVA W TV++P TKYAL   P A  ++  LPPSM  +I  
Sbjct  390   FGEATLSQITLNMPQNQFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPPSMSENIWC  449

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  V++L GSL+SI ++IV+P   + KI   K +R  
Sbjct  450   FLLLRTA--LVASSVCSAFLIPFFGLVMALIGSLLSILVAIVMPALCFMKIMGNKATRTQ  507

Query  1326  LIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             +I +  ++  G +    GT SS   ++ + Q
Sbjct  508   MILSSTIVAIGVVSGTLGTYSSVAKIIRNYQ  538



>ref|XP_009132202.1| PREDICTED: vacuolar amino acid transporter 1-like, partial [Brassica 
rapa]
Length=387

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/382 (37%), Positives = 224/382 (59%), Gaps = 0/382 (0%)
 Frame = +3

Query  261   VINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKD  440
             V+  I +L G+  L+ PYA+++GGW+  F+L   GVI  +T  LL +CL   P    Y D
Sbjct  2     VVVGINVLCGVALLTMPYAVKEGGWLGLFILFSFGVITFYTGILLKRCLENSPGIHTYPD  61

Query  441   IGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLT  620
             IGQ AFGT GRIL +  +Y+E++ + V Y I + DNL+ +F  T L ++G+ L + Q+  
Sbjct  62    IGQAAFGTTGRILVSILLYVELYASCVEYIIMMSDNLSGMFPNTSLYISGLSLDSKQVFA  121

Query  621   VMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNI  800
             +   ++ LP++W RDLS +S+LS+ G+  S+L+ + +      G V  +     L + N+
Sbjct  122   ITTTIIVLPTVWLRDLSLLSYLSAGGVFSSILLALCLFWAGSVGGVGFHLTGKALDIANL  181

Query  801   PSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGV  980
             P   G+Y F +  H VFPNIY++MK+PSKF  V ++SF+  T+ Y A+A  G  MFG  +
Sbjct  182   PVAIGIYGFGFGSHSVFPNIYSSMKEPSKFPLVLLISFAFCTLFYIAVAVCGYTMFGDAI  241

Query  981   SSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGG  1160
              SQ TL++P+H   +K+A W  V+TPMTKYAL   P  + L+  +P S +      +   
Sbjct  242   QSQFTLNIPQHFTSSKIAAWTAVVTPMTKYALTITPVVLSLEELIPSSSRKMKSKGVSML  301

Query  1161  TGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNV  1340
               S+L+L  L +AL VP+F  V +L GS +++ I+++ PC  Y  I   ++S   +   +
Sbjct  302   FRSVLVLSTLVVALTVPFFATVAALIGSFIAMLIALIFPCLCYMSIMKGRLSNSQMGICI  361

Query  1341  VLIVFGTLLAVSGTVSSFKLLV  1406
              +++ G +    GT S+   L+
Sbjct  362   FIVIIGVVSGCCGTYSAIARLI  383



>ref|XP_010032152.1| PREDICTED: vacuolar amino acid transporter 1 [Eucalyptus grandis]
 gb|KCW51557.1| hypothetical protein EUGRSUZ_J01066 [Eucalyptus grandis]
Length=563

 Score =   261 bits (668),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 156/420 (37%), Positives = 243/420 (58%), Gaps = 20/420 (5%)
 Frame = +3

Query  192   KDLESSEECV-EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGV  368
             KD + S+    E      SS+  AV+N + +L G+G LSTPYA ++GGW    +LI   V
Sbjct  151   KDEKPSKGAAHELPTSRQSSYGQAVVNGMNVLCGVGILSTPYAAKEGGWAGISILIVFAV  210

Query  369   ICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDN  548
             +  +T  LL  CL   P  + Y DIGQ AFGT GRI  +  +Y+E++   V Y I   DN
Sbjct  211   LSYYTGILLRYCLDSQPGLETYPDIGQAAFGTLGRIAISIVLYVELYACCVEYIILESDN  270

Query  549   LATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVT  728
             L++ F   HL L G  L +  L  +M  L  LP++W RDLS +S++S+ G++ S+L+   
Sbjct  271   LSSQFPHAHLSLGGYNLDSHHLFALMTALAVLPTVWLRDLSVLSYISAGGVVASILV---  327

Query  729   VACTAVFGVVNP----NHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTK  896
             V C    G+V+           L+L  +P   GLY + Y+GH VFPNIYT+M  PS++  
Sbjct  328   VLCLFWAGLVDKVGFHAKSTTTLNLSTLPVAIGLYGYCYSGHAVFPNIYTSMAKPSQYPS  387

Query  897   VSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYAL  1076
             V + SF++ T++Y  +A +G  MFG    SQ TL+MP+  V +K+A+W TV+ P TKYAL
Sbjct  388   VLLTSFAICTVMYAGVAILGYLMFGEQTQSQFTLNMPQDSVASKIAVWTTVVNPFTKYAL  447

Query  1077  EFAPFAIELDHSLPPSMKHHIKT-----IIRGGTGSililiilalalCVPYFEHVLSLTG  1241
               +P A+ L+  +P S   H+K+     +IR    + L++  L +AL +P+F  V+SL G
Sbjct  448   TMSPVAMSLEELIPSS---HVKSYAYAILIR----TALVISTLIVALSIPFFGLVMSLIG  500

Query  1242  SLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQR  1421
             SL+++ ++++LPC  +  I   K++R    F  ++I+ G + +  GT S+   ++  L +
Sbjct  501   SLLTMLVTLILPCACFLSIMKGKVTRFQAAFCGLIIIVGVISSAFGTYSALSKIIEELGK  560



>ref|XP_009390333.1| PREDICTED: vacuolar amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=564

 Score =   261 bits (667),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 144/412 (35%), Positives = 243/412 (59%), Gaps = 6/412 (1%)
 Frame = +3

Query  195   DLESSEECV--EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGV  368
              LE  +E V  E     + S+  AV+N + +L G+G LSTPYA+++GGW+   +L+   V
Sbjct  156   SLEKIQEKVSHELPVSRSCSYGQAVLNGMNVLCGVGILSTPYAVKEGGWLGLSILLTFAV  215

Query  369   ICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDN  548
             +  +T  LL  CL  +   + Y DIGQ AFGT GR   +  +Y+E++   V Y I   DN
Sbjct  216   LAWYTGILLRYCLDSEEGLETYPDIGQAAFGTTGRFAISIILYMELYACCVEYIILERDN  275

Query  549   LATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVT  728
             L+++F    L + GI L +  L  ++  ++ LP+ W RDLS +S++S  G++ S+++ ++
Sbjct  276   LSSLFPNAQLNIGGIHLDSRLLFAILTTILVLPTTWLRDLSVLSYISVGGVIASVMVVLS  335

Query  729   VACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIV  908
             +        V   ++   L+L  IP   G+Y + Y+GH VFPNIY+++K P+++  V   
Sbjct  336   LFWVGTVDKVGFQNKGTSLNLSGIPIAIGIYGYCYSGHAVFPNIYSSLKKPNQYPSVLFT  395

Query  909   SFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAP  1088
             SF++ T+++  +A MG  MFG    SQ TL+MP ++V ++V +W TV+ P+TKYAL   P
Sbjct  396   SFAICTVMFAGVAVMGYTMFGESTQSQFTLNMPHNLVASRVTVWTTVVNPITKYALTLTP  455

Query  1089  FAIELDHSLPPSM-KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGIS  1265
              A+ L+  +P +  K H+  I+   T   L+L  L +AL VP+F  V++  GSL+++ ++
Sbjct  456   LALSLEELIPSNQSKSHLYAIMIRTT---LVLSTLLVALSVPFFGLVMAFIGSLLTMLVT  512

Query  1266  IVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQR  1421
             ++ PC  +  I   K++R   +F +++I  G + ++ GTVSS   +V  L +
Sbjct  513   LIFPCACFLSILRHKVTRIQGLFCIIIITIGVVSSIVGTVSSISKIVDKLSQ  564



>ref|XP_001758436.1| predicted protein [Physcomitrella patens]
 gb|EDQ76838.1| predicted protein [Physcomitrella patens]
Length=488

 Score =   259 bits (661),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 149/440 (34%), Positives = 250/440 (57%), Gaps = 12/440 (3%)
 Frame = +3

Query  132   DGHKHVEPASGERFEDQTAVK-DLESSEECVEQA---------EKNNSSFMHAVINMIGM  281
             D +   EP   +    Q+  K  ++S+EE +  +          +  SSF  ++ N + +
Sbjct  37    DSNGIREPLLKKSESYQSENKYGVQSTEEAIHLSCYSGNFRPRNEQGSSFFQSLFNGMNV  96

Query  282   LIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFG  461
             L G+G LSTPYA  KGGW+S  LL+   +IC +T  LL +CL  DP    Y D+G+ +FG
Sbjct  97    LAGVGILSTPYAAAKGGWLSLVLLLAFALICCYTAILLRRCLDSDPYIHSYPDVGEASFG  156

Query  462   TKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVA  641
               GR + +  +YLE++   + + I   DNLA +F    +    I L  +++  +M+ +  
Sbjct  157   KWGRWIISIMLYLELYAVAIEFLILEGDNLAHLFPSAGISFGRIILRPNEIFIIMSAVCM  216

Query  642   LPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLY  821
             LP++W R+LS +S++S+ G++ S LI +TV    +   V  +++   LHL  +P   GLY
Sbjct  217   LPTVWLRELSVLSYISATGVVASFLIVLTVGWIGILDGVGFHNQGSLLHLDGLPVAVGLY  276

Query  822   AFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLS  1001
             +F Y GH VFP+IY +M++ ++F+ V ++ F++ T +Y  +A MG  MFG  + SQITL+
Sbjct  277   SFCYCGHAVFPSIYGSMRNRAQFSHVLVLCFTLCTFMYGGIAVMGYSMFGDELQSQITLN  336

Query  1002  MPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGT--GSil  1175
             +P+ V  +  A+W T++ P  KYA+   P A+ L+  L  SM    K I   GT   ++L
Sbjct  337   LPQEVPASHFAIWVTLVNPFAKYAITLTPVAVALEEFLSHSMADSTKDIRFWGTILRTLL  396

Query  1176  iliilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVF  1355
             ++  + +AL VP+F  +++  GS +S  +SI+LPC  Y KIF  ++S P +     L+  
Sbjct  397   VISTVIVALSVPFFGLLMAFIGSFLSATVSIILPCLCYLKIFHQRLSFPEVSVVGALLCL  456

Query  1356  GTLLAVSGTVSSFKLLVISL  1415
             G ++ + G+  S K ++ +L
Sbjct  457   GFIVGIGGSYFSVKAIIDNL  476



>emb|CDX78269.1| BnaA09g34640D [Brassica napus]
Length=530

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 148/423 (35%), Positives = 232/423 (55%), Gaps = 5/423 (1%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKG  329
             E A+  +    + +    SS    E    N+SSF  AV+N + +L G+G LSTPYA+++G
Sbjct  112   EEAAKRKRSSHSLLPSKASSRVSHEMGISNDSSFGQAVLNGVNVLCGVGILSTPYAVKEG  171

Query  330   GWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIF  509
             GW+   +L   GV+C +T  LL  CL   P  + Y DIG  AFGT GRIL +  +YLE++
Sbjct  172   GWLGLLILFAFGVLCFYTGLLLRYCLDSHPDLQTYPDIGHAAFGTTGRILVSVILYLELY  231

Query  510   MALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLS  689
                V Y I   DNL+++F    L + G  L    L  ++  +  LP++W RDLS +S++S
Sbjct  232   AMSVEYIILESDNLSSLFPNAALSIGGFHLDAPHLFALLTTIAVLPTVWLRDLSILSYIS  291

Query  690   SAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTA  869
             + G++ S+L+ + +    +   V  + +  PL+L  +P   GLY + Y+GH VFPNIYT+
Sbjct  292   AGGVIASVLVVLCLFWVGLIDEVGIHSKGTPLNLATLPVSVGLYGYCYSGHGVFPNIYTS  351

Query  870   MKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATV  1049
             M  PS+F  V +  F + T++Y  +A MG  MFG    SQ TL++P+ +V +K+ALW TV
Sbjct  352   MAKPSQFPAVLVTCFGICTLMYAGVAVMGYSMFGESTESQFTLNLPQDLVASKIALWTTV  411

Query  1050  LTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVL  1229
                   YAL  +P A+ L+  LP    H           S L    L + L +P+F  V+
Sbjct  412   ---KITYALTLSPVAMSLEELLPS--NHGKSRFYAIAIRSALAFSTLLVGLAIPFFGLVM  466

Query  1230  SLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVI  1409
             SL GS +++ I+++LP   +  I   K++   +   +V+I  G + +  GT S+   ++ 
Sbjct  467   SLIGSFLTMLITLILPPACFLSILRTKVTPTQVALCIVIITVGAVCSAMGTYSALSKIIE  526

Query  1410  SLQ  1418
              L 
Sbjct  527   KLS  529



>ref|XP_002870959.1| amino acid transporter family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47218.1| amino acid transporter family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   260 bits (665),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 150/399 (38%), Positives = 235/399 (59%), Gaps = 17/399 (4%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E N  SF  +++N   +L GLG ++ PYA+++ GW+   +L+  GVI  +T  L+ +CL 
Sbjct  149   EPNLCSFSQSILNGTNVLCGLGLITMPYAIKESGWLGLVILLFFGVITCYTGVLMKRCLE  208

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL-T  587
               P  + Y DIGQ AFG  GR + +  +Y+E++ A V Y I + DNL+ +F    L + +
Sbjct  209   SSPGLQTYPDIGQAAFGITGRFIISILLYVELYAACVEYIIMMSDNLSGLFPNVSLSIAS  268

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN--  761
             GI L + Q+  ++  L+ LP++W +DLS +S+LS  G+L S+L+ +   C    G+V+  
Sbjct  269   GISLDSPQIFAILTTLLVLPTVWLKDLSLLSYLSVGGVLASILLGL---CLFWVGLVDGI  325

Query  762   ---PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTIL  932
                   R+    L N+P   G++ F Y+GH VFPNIY++MKDPS+F  V ++ FS  T+L
Sbjct  326   GFHATGRV--FDLSNLPVTIGIFGFGYSGHSVFPNIYSSMKDPSRFPLVLVICFSFCTVL  383

Query  933   YTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHS  1112
             Y A+A  G  MFG  V SQ TL+MP+H   +KVA+W  V+TPMTKYAL   P  + L+  
Sbjct  384   YIAVAVCGYTMFGEAVESQFTLNMPKHFFPSKVAVWTAVITPMTKYALTITPIVMSLEEL  443

Query  1113  LPPS-MKHH-IKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGF  1286
             +P + MK H +  + R    + L+   L +AL VP+F  V +L GS +++ ++++ PC  
Sbjct  444   IPTAKMKSHGVSILFR----TALVTSTLVVALSVPFFAIVAALIGSFLAMLVALIFPCLC  499

Query  1287  YTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
             Y  I   K+S   +   + +I+FG +    GT S+   L
Sbjct  500   YLSILKGKLSNTQIGLCIFIILFGLVSGCCGTYSAISRL  538



>ref|XP_002270908.1| PREDICTED: vacuolar amino acid transporter 1 [Vitis vinifera]
 ref|XP_010658377.1| PREDICTED: vacuolar amino acid transporter 1 [Vitis vinifera]
 ref|XP_010658378.1| PREDICTED: vacuolar amino acid transporter 1 [Vitis vinifera]
Length=551

 Score =   260 bits (665),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 150/428 (35%), Positives = 243/428 (57%), Gaps = 6/428 (1%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P    R   + A  D +  +   E      SS+  AV+N + +L G+G LSTPYA
Sbjct  127   HSLLPPIPSRRSYIKKAGLDQKPHKVSHEVPISRQSSYGQAVLNGMNILCGVGILSTPYA  186

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
             +++GGW+   +L+   ++  +T  LL  CL   P  + Y DIGQ AFGT GR   +  +Y
Sbjct  187   VKEGGWVGLSILLIFALLSFYTGILLRYCLDSAPGLETYPDIGQAAFGTTGRFAISIILY  246

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   V Y I   DNL+++F   HL      L +  L  +M  L  LP++W RDLS +
Sbjct  247   VELYACCVEYIILESDNLSSLFPNAHLNFGVFHLGSHHLFALMTALAVLPTVWLRDLSVL  306

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+L+ + +    +   V        L+L N+P   GLY + Y+GH VFPN
Sbjct  307   SYISAGGVVASILVVLCLFWVGLVDQVGFQSEGTVLNLTNLPVAIGLYGYCYSGHAVFPN  366

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT+M  PS++  V ++SF++ T+LY  +A +G +MFG    SQ TL+MP+ +V +K+A+
Sbjct  367   IYTSMAKPSQYPSVLLISFAICTLLYAGVAVLGYQMFGESTLSQFTLNMPQDLVASKIAV  426

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLP--PSMKHHIKTIIRGGTGSililiilalalCVP  1211
             W TV+ P TKYAL  +P A+ L+  +P   S  H    +IR    + L++  L + L VP
Sbjct  427   WTTVVNPFTKYALTMSPVAMSLEELIPSNQSKSHMYAILIR----TALVISTLLVGLTVP  482

Query  1212  YFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             +F  V++L GSL+++ ++++LPC  +  I   KI+R      +++I  G + +  GT S+
Sbjct  483   FFGLVMALIGSLLTMLVTLILPCACFLSILRGKITRFQGSLCILIIAVGVVSSAFGTYSA  542

Query  1392  FKLLVISL  1415
                ++  L
Sbjct  543   LAKIIEKL  550



>ref|XP_010505884.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=530

 Score =   259 bits (663),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 145/391 (37%), Positives = 220/391 (56%), Gaps = 2/391 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   + N I ++ G+G LSTP+ +++ GW S  +L+   VIC +T  L+ +C       
Sbjct  142   SFTQTIFNAINVMAGVGLLSTPFTVKEAGWASMVILLLFAVICCYTATLMKECFENKTGI  201

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT L   GI + +
Sbjct  202   ITYPDIGEAAFGIYGRILICMLLYTELYSYCVEFIILEGDNLTGLFPGTSLDWLGINIDS  261

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  ++  L+ LP++W +DL  IS+LS+ G++ ++LI V+V      G +  +H    +
Sbjct  262   KHLFGILTALIVLPTVWLKDLRIISYLSAGGVIATVLIAVSVFFLGTTGGIGFHHTGQAV  321

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
              L  IP   G+Y F Y+GH VFPNIY +M D +KF K  I +F +  +LY  +A MG  M
Sbjct  322   KLNGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITTFILCVLLYGGVAVMGYLM  381

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+   F+KVA W TV++P TKYAL   P A  ++  LPP M  +I  
Sbjct  382   FGEATLSQITLNMPQDQFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPPRMSENIWC  441

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  V++L GSL+SI ++IV+P   + KI   K +R  
Sbjct  442   FLLLRTA--LVASSVCSAFLIPFFGLVMALIGSLLSILVAIVMPALCFIKIMGNKATRTQ  499

Query  1326  LIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             +I + +++  G +    GT SS   ++ + Q
Sbjct  500   MILSSIIVAIGVVSGTLGTYSSVAKIIRNYQ  530



>ref|NP_001052989.1| Os04g0460300 [Oryza sativa Japonica Group]
 emb|CAD40982.2| OSJNBa0072F16.7 [Oryza sativa Japonica Group]
 dbj|BAF14903.1| Os04g0460300 [Oryza sativa Japonica Group]
 dbj|BAG97637.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77404.1| hypothetical protein OsI_16168 [Oryza sativa Indica Group]
Length=455

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/416 (34%), Positives = 250/416 (60%), Gaps = 10/416 (2%)
 Frame = +3

Query  153   PASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGG  332
             PA G++   +   +D E+  +C  +A+ + ++F+    N +  L G+G LS PYAL +GG
Sbjct  43    PARGKQ---EPVERDHEA--QCSPEADGDGATFVRTCFNGLNALSGVGLLSIPYALSEGG  97

Query  333   WISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFM  512
             W+S  LL+ + ++C +T  LL +C+   P  + Y DIG  AFG KGR+  ++F+Y E+++
Sbjct  98    WLSLVLLLAVAMVCCYTGLLLRRCMAASPAVRGYPDIGALAFGAKGRLAVSAFLYAELYL  157

Query  513   ALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSS  692
               + + I   DNL  +F GT L + G+ +S  QL  V+  +V LP+ W R L+ ++++S+
Sbjct  158   VAIGFLILEGDNLDKLFPGTSLAVGGLVVSGKQLFVVVVAVVILPTTWLRSLAVLAYVSA  217

Query  693   AGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAM  872
             +G+L S+++   V   AVF  V  + +   L++  +P+  GLY F Y GH +FP +  +M
Sbjct  218   SGVLASVVVVFCVLWAAVFDGVGFHGKGRMLNVSGLPTALGLYTFCYCGHAIFPTLCNSM  277

Query  873   KDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVL  1052
             ++  KF++V ++ F   T+ Y ++A +G  M+G  V SQ+TL++P   + +K+A++ T++
Sbjct  278   QEKDKFSRVLVICFVACTVNYGSMAILGYLMYGDDVKSQVTLNLPEGKISSKLAIYTTLI  337

Query  1053  TPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
              P +KYAL   P A  ++  L    K  +  +IR    +++++  + +AL VP+F H+++
Sbjct  338   NPFSKYALMVTPVATAIEEKLLAGNKRSVNVLIR----TLIVVSTVVIALTVPFFGHLMA  393

Query  1233  LTGSLVSIGISIVLPCGFYTKIF-WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFK  1397
             L GSL+S+  S++LPC  Y KIF   +  R   +    +IV G+L+A +GT SS K
Sbjct  394   LVGSLLSVMASMLLPCICYLKIFGLTRCGRGETLLIAAIIVLGSLVAATGTYSSLK  449



>ref|NP_195838.2| transmembrane amino acid transporter family protein [Arabidopsis 
thaliana]
 dbj|BAC42086.1| unknown protein [Arabidopsis thaliana]
 gb|AED90441.1| transmembrane amino acid transporter family protein [Arabidopsis 
thaliana]
Length=550

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 155/433 (36%), Positives = 245/433 (57%), Gaps = 25/433 (6%)
 Frame = +3

Query  129   PDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLST  308
             PD  + + P + +  + + +V DL          E N  SF  +V+N   +L GLG ++ 
Sbjct  129   PDKEETILPVNPQS-QLKLSVTDLP-------LPEPNLCSFSQSVLNGTNVLCGLGLITM  180

Query  309   PYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAAS  488
             PYA+++ GW+   +L+  GVI  +T  L+ +CL   P  + Y DIGQ AFG  GR + + 
Sbjct  181   PYAIKESGWLGLPILLFFGVITCYTGVLMKRCLESSPGIQTYPDIGQAAFGITGRFIISI  240

Query  489   FIYLEIFMALVSYTISLHDNLATVFLGTHLKL-TGIQLSTSQLLTVMAVLVALPSLWFRD  665
              +Y+E++ A V Y I + DNL+ +F    L + +GI L + Q+  ++  L+ LP++W +D
Sbjct  241   LLYVELYAACVEYIIMMSDNLSGLFPNVSLSIASGISLDSPQIFAILTTLLVLPTVWLKD  300

Query  666   LSSISFLSSAGILMSLLIFVTVACTAVFGVVN-----PNHRIPPLHLPNIPSVSGLYAFS  830
             LS +S+LS  G+L S+L+ +   C    G V+        R+    L N+P   G++ F 
Sbjct  301   LSLLSYLSVGGVLASILLGI---CLFWVGAVDGIGFHATGRV--FDLSNLPVTIGIFGFG  355

Query  831   YAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPR  1010
             Y+GH VFPNIY++MKDPS+F  V ++ FS  T+LY A+A  G  MFG  V SQ TL+MP+
Sbjct  356   YSGHSVFPNIYSSMKDPSRFPLVLVICFSFCTVLYIAVAVCGYTMFGEAVESQFTLNMPK  415

Query  1011  HVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS--MKHHIKTIIRGGTGSilili  1184
             H   +KVA+W  V+TPMTKYAL   P  + L+  +P +      +  + R    ++L+  
Sbjct  416   HFFPSKVAVWTAVITPMTKYALTITPIVMSLEELIPTAKMRSRGVSILFR----TMLVTS  471

Query  1185  ilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTL  1364
              L +AL VP+F  V +L GS +++ ++++ PC  Y  I   K+S   +   + +IVFG +
Sbjct  472   TLVVALSVPFFAIVAALIGSFLAMLVALIFPCLCYLSILKGKLSNTQIGLCIFIIVFGVV  531

Query  1365  LAVSGTVSSFKLL  1403
                 GT S+   L
Sbjct  532   SGCCGTYSAISRL  544



>ref|XP_006648197.1| PREDICTED: vacuolar amino acid transporter 1-like [Oryza brachyantha]
Length=561

 Score =   259 bits (663),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/393 (36%), Positives = 228/393 (58%), Gaps = 3/393 (1%)
 Frame = +3

Query  228   AEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCL  407
             A +   S+  AV+N I +L G+G LSTPYA+++GGW+   +L    V+  +T  LL +CL
Sbjct  168   AYQQQCSYTQAVMNGINVLCGVGILSTPYAIKQGGWLGLVILCLFAVLAWYTGVLLRRCL  227

Query  408   GKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLT  587
                   + Y DIG  AFGT GRI  +  +Y+E++   + Y I   DNL+ +F   HL + 
Sbjct  228   DSKEGLETYPDIGHAAFGTTGRIAISIILYVELYACCIEYLILESDNLSKLFPNAHLTIG  287

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
              + L++     ++  L+ +P+ W RDLS +S+LS+ G++ S+L+ V ++   V   V   
Sbjct  288   SMTLNSHVFFAILTTLIVMPTTWLRDLSCLSYLSAGGVIASILVVVCLSWVGVVDHVGFE  347

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
             ++   L+LP IP   GLY + Y+GH VFPNIY+++K+ ++F  +      + +IL+   A
Sbjct  348   NKGTALNLPGIPIAIGLYGYCYSGHGVFPNIYSSLKNRNQFPSILFTCIGLSSILFAGAA  407

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSM  1127
              MG KMFG    SQ TL++P ++V +KVA+W TV  P+TKYAL   P A+ L+  LPP+ 
Sbjct  408   VMGYKMFGESTESQFTLNLPENLVVSKVAVWTTVANPITKYALTITPLAMSLEELLPPNQ  467

Query  1128  KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
             + +   I+     S L++  L +AL VP+F  V++L GSL+++ ++ +LPC  +  I   
Sbjct  468   QKYANIIM---LRSSLVVSTLLIALSVPFFGLVMALVGSLLTMLVTYILPCACFLAILKG  524

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             K+    +     +IV G   A  GT SS   +V
Sbjct  525   KVPWHQIAACSFIIVVGVCCACVGTYSSLSKIV  557



>emb|CAH67082.1| OSIGBa0097P08.12 [Oryza sativa Indica Group]
 emb|CAH67450.1| H0219H12.7 [Oryza sativa Indica Group]
Length=455

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/416 (34%), Positives = 249/416 (60%), Gaps = 10/416 (2%)
 Frame = +3

Query  153   PASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGG  332
             PA G++   +   +D E+  +C  +A+ + ++F+    N +  L G+G LS PYAL +GG
Sbjct  43    PARGKQ---EPVERDHEA--QCSPEADGDGATFVRTCFNGLNALSGVGLLSIPYALSEGG  97

Query  333   WISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFM  512
             W+S  LL+ + ++C +T  LL +C+   P  + Y DIG  AFG KGR+  ++F+Y E+++
Sbjct  98    WLSLVLLLAVAMVCCYTGLLLRRCMAASPAVRGYPDIGALAFGAKGRLAVSAFLYAELYL  157

Query  513   ALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSS  692
               + + I   DNL  +F GT L + G+ +S  QL  V+  +V LP+ W R L+ ++++S+
Sbjct  158   VAIGFLILEGDNLDKLFPGTSLAVGGLVVSGKQLFVVVVAVVILPTTWLRSLAVLAYVSA  217

Query  693   AGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAM  872
              G+L S+++   V   AVF  V  + +   L++  +P+  GLY F Y GH +FP +  +M
Sbjct  218   NGVLASVVVVFCVLWAAVFDGVGFHGKGRMLNVSGLPTALGLYTFCYCGHAIFPTLCNSM  277

Query  873   KDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVL  1052
             ++  KF++V ++ F   T+ Y ++A +G  M+G  V SQ+TL++P   + +K+A++ T++
Sbjct  278   QEKDKFSRVLVICFVACTVNYGSMAILGYLMYGDDVKSQVTLNLPEGKISSKLAIYTTLI  337

Query  1053  TPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
              P +KYAL   P A  ++  L    K  +  +IR    +++++  + +AL VP+F H+++
Sbjct  338   NPFSKYALMVTPVATAIEEKLLAGNKRSVNVLIR----TLIVVSTVVIALTVPFFGHLMA  393

Query  1233  LTGSLVSIGISIVLPCGFYTKIF-WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFK  1397
             L GSL+S+  S++LPC  Y KIF   +  R   +    +IV G+L+A +GT SS K
Sbjct  394   LVGSLLSVMASMLLPCICYLKIFGLTRCGRGETLLIAAIIVLGSLVAATGTYSSLK  449



>gb|KDO52345.1| hypothetical protein CISIN_1g044089mg, partial [Citrus sinensis]
Length=521

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 219/363 (60%), Gaps = 12/363 (3%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             S   + +N I +L G+G L+TPYA+++GGW S  LL   G+I  +T  LL +CL   P  
Sbjct  164   SLAQSCLNGINVLCGVGLLATPYAIKEGGWSSLSLLFIFGIIAFYTGILLQECLDSAPGL  223

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y D+GQ AFG  GR++ A  +YLE+F A + Y I + DNLA++F  T +   G+ L  
Sbjct  224   TTYPDVGQAAFGITGRLIVAIVLYLELFAASIEYLIMMSDNLASLFPHTSMNFGGLHLDC  283

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIP--  779
              ++ ++ A LV LP++W RDL+ +S++S  G++ +    V V C    G+V+     P  
Sbjct  284   HKIFSITATLVVLPTVWLRDLTLLSYISVGGVITT---GVVVLCLLWIGLVDAVGFHPYG  340

Query  780   -PLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMG  956
               L L N+P   GLY F+YAGH VFPNIY++M++P KF  V ++SF   ++L   +   G
Sbjct  341   TALDLSNLPVTIGLYGFAYAGHSVFPNIYSSMQEPKKFPFVLMISFVFCSLLNAGVGICG  400

Query  957   AKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS--MK  1130
               MFG  + SQ TL+ P+  V +KVA+W TVL PM+KYA+   P A+ L+  +P      
Sbjct  401   YLMFGDSIQSQFTLNFPKEFVASKVAIWTTVLIPMSKYAMTLTPIALSLEELMPSKELQS  460

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
             + +  IIR    +IL +  L +AL +PYF  V+SL GSL+++ I+++ PC FY KI   K
Sbjct  461   YSVSVIIR----TILAISTLVVALTLPYFGIVMSLIGSLLAMLITLIFPCVFYLKILQGK  516

Query  1311  ISR  1319
             IS+
Sbjct  517   ISK  519



>ref|XP_006339019.1| PREDICTED: vacuolar amino acid transporter 1-like [Solanum tuberosum]
Length=529

 Score =   258 bits (660),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 156/409 (38%), Positives = 238/409 (58%), Gaps = 21/409 (5%)
 Frame = +3

Query  195   DLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVIC  374
             +L  S++C         S+  +V+N I  L G+G LS PYAL++GGW S FLL   G+I 
Sbjct  137   ELPPSQQC---------SYTQSVLNAINALCGIGILSIPYALKEGGWCSLFLLFLFGIIT  187

Query  375   AFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLA  554
              +T  LL KCL   P  + Y DIGQ AFG  GRI  A  +Y E++ + + Y I + DNL 
Sbjct  188   YYTGTLLKKCLESSPGIETYPDIGQAAFGLSGRIFIAIALYAELYSSCIEYLIMMSDNLG  247

Query  555   TVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVA  734
              +F   H++  G+ L++ Q+  +++ LV LP++W R+LS +S +S+ G++    + V V 
Sbjct  248   ALFPNIHMEFAGLHLNSYQICAIISTLVILPTVWLRNLSLLSIVSAGGVIA---LTVVVI  304

Query  735   CTAVFGVVNPNHRIP---PLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSI  905
             C    GVV+     P    +++  IP   GLY+F Y  H VFPNIY++MK+PS+F  V +
Sbjct  305   CLLWVGVVDDVGFHPSGTAINIAKIPVTIGLYSFCYGSHSVFPNIYSSMKEPSRFPSVLL  364

Query  906   VSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFA  1085
             +SFS     Y  +A  G  MFG   + Q TL++P  +V +KVA W  V+TP+TKYA+   
Sbjct  365   ISFSTAFFSYLGVAICGFLMFGENTNPQFTLNLPTKLVTSKVAAWTVVITPLTKYAITLT  424

Query  1086  PFAIELDHSLP-PSMK-HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIG  1259
             P A  ++  LP P ++ + +  +IR    ++L+   L +AL VPYF  V+SL GS + + 
Sbjct  425   PVAFGIEEFLPSPQLRTYAVSLLIR----TLLVFSTLVIALAVPYFGSVMSLIGSSLVML  480

Query  1260  ISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             +S++LPC  Y ++   +I+R  L     +IV G + AV GT S+   +V
Sbjct  481   VSLILPCVCYIQLRKDQITRFQLAACSSIIVVGLISAVVGTYSALTNMV  529



>ref|XP_002870958.1| amino acid transporter family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47217.1| amino acid transporter family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/363 (38%), Positives = 216/363 (60%), Gaps = 0/363 (0%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E  + +F  +V+N I +L G+  L+ PYAL++GGW+  F+L   G+I  +T  LL +CL 
Sbjct  130   ENRSCTFSQSVLNGINVLCGVALLTMPYALKEGGWLGLFILFSFGIITFYTGILLKRCLE  189

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG  590
               P    Y DIGQ AFGT GRIL +  +Y+E++ + V Y I + DNL+ +F  T L + G
Sbjct  190   NSPGIHTYPDIGQAAFGTTGRILVSILLYVELYASCVEYIIMMSDNLSRMFPNTSLYING  249

Query  591   IQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNH  770
               L ++Q+  +    + LP++W +DLS +S+LS+ G+  S+L+ +++        V  + 
Sbjct  250   CSLDSNQVFAITTTFIVLPTVWLKDLSLLSYLSAGGVFSSILLALSLFWAGSVDGVGFHI  309

Query  771   RIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAF  950
                 L + NIP   G+Y F +  H VFPNIY++MK+PSKF  V ++SF+  T+ Y A+A 
Sbjct  310   SGQALDITNIPVAIGIYGFGFGSHSVFPNIYSSMKEPSKFPMVLLISFAFCTLFYIAVAV  369

Query  951   MGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMK  1130
              G  MFG  + SQ TL+MP+H   +K+A+W  V+TPMTKYAL   P  + L+  +P S +
Sbjct  370   CGYTMFGEAIQSQFTLNMPQHFTSSKIAVWTAVVTPMTKYALTITPVMLSLEELIPSSSR  429

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
                   +     +IL+L  L +AL VP+F  V +L GS +++ I+++ PC  Y  I   +
Sbjct  430   KMRSKGVSMLFRTILVLSTLVVALTVPFFATVAALIGSFIAMLIALIFPCLCYLSIMKGR  489

Query  1311  ISR  1319
             ++ 
Sbjct  490   LTN  492



>ref|XP_009381415.1| PREDICTED: vacuolar amino acid transporter 1 [Musa acuminata 
subsp. malaccensis]
Length=440

 Score =   255 bits (651),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 140/395 (35%), Positives = 246/395 (62%), Gaps = 10/395 (3%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             +++ +  ++F+    N +  L G+G +S PYAL  GGW+S  +L  L  IC +T  LL +
Sbjct  47    QESPQAGATFVRTCFNGLNALSGVGIVSIPYALSSGGWLSLVVLFMLAAICCYTGLLLQR  106

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             C+ + P  K Y DIG+ AFG KGR+  + F+YLE+++  + + I   DNL  +F G  ++
Sbjct  107   CMQRSPDIKTYPDIGEFAFGHKGRVAVSVFMYLELYLVAIGFLILQGDNLENLFPGASIR  166

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             +  + ++  QL  ++A LV LP+ W R +  ++++S+ G+L+S+++  +V   A    V 
Sbjct  167   IAMLNIAAKQLFVILAALVVLPTTWMRSMGLLAYVSAGGVLVSVIMVCSVLSAATVE-VG  225

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              + R   ++L  +P+  GLYAF Y GH VFP + T+MKD +KF+KV IV F + TI Y +
Sbjct  226   FHERGRLVNLSGLPTALGLYAFCYCGHAVFPTLCTSMKDSTKFSKVLIVCFVLCTINYGS  285

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
             +A +G  M+G  + SQ+TL++P   + +K+A++ TV+ P+TKYAL   P A  ++  L  
Sbjct  286   MAIIGYLMYGDNLKSQVTLNLPIGNISSKIAIYTTVVNPLTKYALMVTPIANAIEERLA-  344

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
               ++H K++    T ++L+L ++ +AL +P+F ++++  GSL+ + +SI+LPC  Y KIF
Sbjct  345   --EYH-KSLEPCLTRTLLMLSMVTVALAIPFFGYLMAFIGSLLGVVVSILLPCLCYLKIF  401

Query  1302  WP---KISRPLLIFNVVLIVFGTLLAVSGTVSSFK  1397
              P    +   ++IF ++++  G ++AV+GT +S +
Sbjct  402   KPHCIHVVELVIIFCILMM--GCVMAVTGTYTSLR  434



>ref|XP_002993770.1| hypothetical protein SELMODRAFT_42771, partial [Selaginella moellendorffii]
 gb|EFJ05189.1| hypothetical protein SELMODRAFT_42771, partial [Selaginella moellendorffii]
Length=546

 Score =   258 bits (659),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 152/424 (36%), Positives = 243/424 (57%), Gaps = 10/424 (2%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVE----QAEKNNSSFMHAVINMIGMLIGLGQLS  305
               H+   S E    +T+   +  S +  +    Q  K   +F  A +N I +L G+G LS
Sbjct  122   QSHIVTVSSETRLRKTSSTRISPSSDAQDYHHLQLPKQGCTFFQATLNGINVLAGVGVLS  181

Query  306   TPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAA  485
             TPYAL++GGWI A +L+   V+C +T  LL KCL  +P    Y DIGQ AFG  GR++ +
Sbjct  182   TPYALKQGGWIGAIILLLFAVVCCYTGILLRKCLESEPGLVTYPDIGQAAFGRIGRLVIS  241

Query  486   SFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRD  665
               +Y+E++   V + I   DNLA++F        G ++ + ++ +++A L  LP++W RD
Sbjct  242   IILYVELYACCVEFLILEGDNLASLFPNARFSYNGHKMESQKVFSMIAALFILPTVWLRD  301

Query  666   LSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHI  845
             LS +S++S+ G++ S+++ V+V        V   +    ++  N+P   GL  F ++GH 
Sbjct  302   LSLLSYISAGGVVTSIIVVVSVWWVGAVDGVGFRNTGSFINFGNLPVSIGLIGFCFSGHA  361

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPNIY++MKD ++F +V  + F +  ++Y  +A MG KMFG    SQ+TL++P+  V +
Sbjct  362   VFPNIYSSMKDRAQFNRVLQLCFLLCILMYGGVAIMGFKMFGAETQSQVTLNLPKQFVAS  421

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPP--SMKHHIKTIIRGGTGSililiilala  1199
             K+ALW TV+TP+TKYAL   P A+ L+  LP   S  H    +IR    + L+   L +A
Sbjct  422   KIALWTTVITPLTKYALTITPVALSLEELLPTQVSKNHFASVLIR----TSLVTSTLFVA  477

Query  1200  lCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSG  1379
             L +P+F  V++  GS +S+  S++LP   Y  I   +I +   I  V+ I  G + A++G
Sbjct  478   LMIPFFGFVMAFIGSFLSLTGSLILPSACYLSISGRRIPKTQAIICVMTIFIGVIAAIAG  537

Query  1380  TVSS  1391
             T SS
Sbjct  538   TYSS  541



>ref|XP_004249816.1| PREDICTED: vacuolar amino acid transporter 1-like [Solanum lycopersicum]
Length=529

 Score =   258 bits (658),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 153/413 (37%), Positives = 239/413 (58%), Gaps = 19/413 (5%)
 Frame = +3

Query  180   QTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIG  359
             + +  +L  S++C         S+  +V+N I  L G+G LS PYAL++GGW S FLL  
Sbjct  132   RYSAPELPPSQQC---------SYAQSVLNAINALCGIGILSVPYALKEGGWCSLFLLFL  182

Query  360   LGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISL  539
              G+I  +T  LL KCL   P  + Y DIGQ AFG  GRI  A  +Y E++ + + Y I +
Sbjct  183   FGIITFYTGTLLKKCLESSPGIETYPDIGQAAFGLSGRIFIAIALYAELYSSCIEYLIMM  242

Query  540   HDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLI  719
              DNL  +F  +H++  GI L++ Q+  +++ L+ LP++W R+L  +S +S+ G++    +
Sbjct  243   SDNLGALFPNSHMEFAGIHLNSYQICAIISTLIILPTVWLRNLRLLSIVSAGGVIA---L  299

Query  720   FVTVACTAVFGVVNPNHRIP---PLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKF  890
              V V C    GVV+     P    +++  +P   GLY+F Y  H VFPNIY++MK+PSKF
Sbjct  300   IVVVICLLWVGVVDDVGFHPSGTAINIARLPVTIGLYSFCYGSHSVFPNIYSSMKEPSKF  359

Query  891   TKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKY  1070
               V ++SFSV    Y   A  G  MFG   + Q TL++P  +V +KVA W  V+ P+TKY
Sbjct  360   PSVLLISFSVAFFSYLGAAVCGFLMFGENTNPQFTLNLPTELVTSKVAAWTVVIAPLTKY  419

Query  1071  ALEFAPFAIELDHSLP-PSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSL  1247
             A+   P A  ++  LP P ++ ++ +++     ++L+   L +AL VPYF  V+SL GS 
Sbjct  420   AITLTPVAFGIEEFLPSPQLRTYVVSLL---IRTLLVFSTLVIALAVPYFGSVMSLIGSS  476

Query  1248  VSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             + + +S++LPC  Y ++   +I+R  L     +IV G + AV GT S+   +V
Sbjct  477   LVMLVSLILPCVCYIQLSKDQITRFQLAACSFIIVVGLISAVFGTYSALTNMV  529



>ref|NP_001045585.1| Os02g0101000 [Oryza sativa Japonica Group]
 dbj|BAD08181.1| putative amino acid transport protein [Oryza sativa Japonica 
Group]
 dbj|BAF07499.1| Os02g0101000 [Oryza sativa Japonica Group]
 dbj|BAG93768.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72284.1| hypothetical protein OsI_05452 [Oryza sativa Indica Group]
 gb|EEE56120.1| hypothetical protein OsJ_04987 [Oryza sativa Japonica Group]
Length=571

 Score =   258 bits (660),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 146/422 (35%), Positives = 240/422 (57%), Gaps = 15/422 (4%)
 Frame = +3

Query  150   EPASGERFEDQTAV---KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYAL  320
             +P+  +  EDQ  +    ++ + ++C         S+  AV+N I +L G+G LSTPYA+
Sbjct  158   KPSLQQIPEDQKPLVPAHEVPAYQQC---------SYTQAVMNGINVLCGVGILSTPYAI  208

Query  321   EKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYL  500
             ++GGW+   +L    V+  +T  LL +CL      + Y DIG  AFGT GRI  +  +Y+
Sbjct  209   KQGGWLGLVILCLFAVLAWYTGVLLRRCLDSKEGLETYPDIGHAAFGTTGRIAISIILYI  268

Query  501   EIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSIS  680
             E++   + Y I   DNL+ +F   HL +  + L++     ++  L+ +P+ W RDLS +S
Sbjct  269   ELYACCIEYLILESDNLSKLFPNAHLTIGSMTLNSHVFFAILTTLIVMPTTWLRDLSCLS  328

Query  681   FLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNI  860
             +LS+ G++ S+L+ V +    V   V   ++   L+LP IP   GLY + Y+GH VFPNI
Sbjct  329   YLSAGGVIASILVVVCLCWVGVVDHVGFENKGTALNLPGIPIAIGLYGYCYSGHGVFPNI  388

Query  861   YTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALW  1040
             Y+++K+ ++F  +      + +IL+   A MG KMFG    SQ TL++P ++V +KVA+W
Sbjct  389   YSSLKNRNQFPSILFTCIGLSSILFAGAAVMGYKMFGESTESQFTLNLPENLVVSKVAVW  448

Query  1041  ATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFE  1220
              TV  P+TKYAL   P A+ L+  LPP+ + +   I+     S L++  L +AL VP+F 
Sbjct  449   TTVANPITKYALTITPLAMSLEELLPPNQQKYANIIM---LRSSLVVSTLLIALSVPFFG  505

Query  1221  HVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKL  1400
              V++L GSL+++ ++ +LPC  +  I   K++   +     +IV G   A  GT SS   
Sbjct  506   LVMALVGSLLTMLVTYILPCACFLAILKRKVTWHQIAACSFIIVVGVCCACVGTYSSLSK  565

Query  1401  LV  1406
             ++
Sbjct  566   II  567



>ref|XP_010452048.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=526

 Score =   257 bits (657),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/392 (36%), Positives = 228/392 (58%), Gaps = 0/392 (0%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E  + +F  +V+N I +L G+  L+ PYA+++GGW+  F+L   GVI  +T  LL +CL 
Sbjct  131   ETGSCTFSQSVLNGINVLCGVALLTMPYAVKEGGWLGLFILFSFGVITFYTGILLKRCLE  190

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG  590
               P    Y DIGQ AFG  GRI+ +  +Y+E++ + V Y I + DNL+ +F  T L +TG
Sbjct  191   NSPGIHTYPDIGQAAFGITGRIIVSILLYVELYASCVEYIIMMSDNLSGMFPNTSLYITG  250

Query  591   IQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNH  770
             + L + Q+  +   LV LP++W +DLS +S+LS+ G++ S+L+ + +        V  + 
Sbjct  251   LSLDSHQIFAITTTLVVLPTVWLKDLSLLSYLSAGGVVSSILLALCLFWAGSVDGVGFHL  310

Query  771   RIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAF  950
                 L L NIP   G+Y F +  H VFPNIY++MK+PSKF  V ++SF   T+ Y A+A 
Sbjct  311   SGKALDLTNIPVAIGIYGFGFGSHSVFPNIYSSMKEPSKFPMVLLISFGFCTLFYIAVAV  370

Query  951   MGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMK  1130
              G  MFG  + SQ TL+MP+    +K+A+W  V+TPMTKYAL   P  + L+  +P S +
Sbjct  371   CGYTMFGDAIQSQFTLNMPQQFTSSKIAVWTAVVTPMTKYALTITPVMLGLEELIPSSSR  430

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
                         +I++L  L +AL VP+F  V +L GS +++ I+++ PC  Y  +   +
Sbjct  431   KLRSKGFSILFRTIVVLSTLVVALTVPFFATVAALIGSFIAMLIALIFPCLCYISVMKGR  490

Query  1311  ISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             ++   +   +++I+ G +    GT S+   L+
Sbjct  491   LTNFQMGVCILIIIIGVVSGCCGTYSAIARLI  522



>ref|XP_010453840.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=202

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 151/200 (76%), Gaps = 1/200 (1%)
 Frame = +3

Query  309  PYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAAS  488
            PYA+E GGWIS FLLI  G++  +T+H+LG CL ++PKSK Y D+G  AFG  GR++A+ 
Sbjct  2    PYAVESGGWISIFLLISFGILTTYTSHILGNCLRRNPKSKSYSDVGHSAFGRHGRLIASL  61

Query  489  FIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDL  668
            FIYLEIFMALVSYTISLHDN++  F  T    +      ++L T +AV +ALPSLW RDL
Sbjct  62   FIYLEIFMALVSYTISLHDNISAAFPATFSHHSNGHFPAAKL-TAVAVAIALPSLWIRDL  120

Query  669  SSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIV  848
            SSISFLSS GILMS +IF +V  TAVFG V  + RIP L L NIP+VSG+Y F + GHIV
Sbjct  121  SSISFLSSGGILMSAIIFGSVVYTAVFGGVIDDGRIPALRLGNIPTVSGIYLFGFGGHIV  180

Query  849  FPNIYTAMKDPSKFTKVSIV  908
            FPN+YT+MKDPSKFTKV ++
Sbjct  181  FPNLYTSMKDPSKFTKVRLI  200



>ref|XP_010471703.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=521

 Score =   257 bits (656),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 145/424 (34%), Positives = 237/424 (56%), Gaps = 21/424 (5%)
 Frame = +3

Query  174   EDQTAVK--DLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAF  347
             +D  +VK   ++ S   +  AE +  SF  +V+N I +L G+  L+ PY +++GGW+  F
Sbjct  108   DDDDSVKSSQVKLSITDISYAEPDLCSFPQSVLNGINILCGVALLTMPYGVKEGGWLGLF  167

Query  348   LLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSY  527
             +L   G+I  +T  LL +CL   P   +Y DIGQ AFG  GR++ +  +Y+E++   V Y
Sbjct  168   ILFFFGIITCYTCILLKRCLESSPGLHNYPDIGQAAFGFTGRLIISILLYMELYTGCVEY  227

Query  528   TISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILM  707
              I + DNL+ +F    L + G+ L +SQ+  +   L+ LP++W RDLS +S++S+ G+  
Sbjct  228   IIMMSDNLSRIFPNISLNIIGLSLDSSQIFAISTTLIVLPTVWLRDLSLLSYISAGGVFS  287

Query  708   SLLIFVTVACTAVFGVVNPNHRIP---PLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKD  878
             S+++     C    G V+     P    L L N+P   G+Y F ++GH VFP+IY++MK+
Sbjct  288   SIMM---ALCLYWVGTVDGVGFRPGGQALDLANLPVAIGIYGFGFSGHAVFPSIYSSMKE  344

Query  879   PSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTP  1058
             PSKF  V ++SF     LY  +A  G  MFG  + S+ TL+MP+    +K+A+W   +TP
Sbjct  345   PSKFPLVVVISFGFCVFLYIVVAICGYSMFGEAIQSEFTLNMPQQFTSSKIAVWIAAITP  404

Query  1059  MTKYALEFAPFAIELDHSLPPSMKHH-----IKTIIRGGTGSililiilalalCVPYFEH  1223
             M KYAL   P  + L+  +P S + +     ++TI+   T        L +AL  P+F  
Sbjct  405   MAKYALSITPIVLSLEELMPSSQRSYGVSMFLRTILALST--------LVVALTFPFFAI  456

Query  1224  VLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
             + +L GS +++ ++ ++PC  Y  I   K+S+  +   V +I+FG +    GT S+   L
Sbjct  457   MGALMGSFLAMLVAFIIPCLCYLSILKGKLSKTQIGICVFIIIFGIVSGCCGTYSAIGRL  516

Query  1404  VISL  1415
             V  L
Sbjct  517   VREL  520



>ref|XP_010906599.1| PREDICTED: vacuolar amino acid transporter 1-like [Elaeis guineensis]
Length=474

 Score =   256 bits (653),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 149/405 (37%), Positives = 237/405 (59%), Gaps = 20/405 (5%)
 Frame = +3

Query  195   DLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVIC  374
             DL  S +C         S   A++N I +L G+G L+TPYA+++GGW+   +L GLG I 
Sbjct  78    DLPPSPQC---------STAQAILNGINVLCGVGILTTPYAIKEGGWLGMLVLFGLGAIS  128

Query  375   AFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLA  554
              +T  LL +CL   P+ + Y DIGQ AFG  GR+  +  +YLE++ + V Y I + ++L+
Sbjct  129   CYTGVLLKRCLDSSPELQTYPDIGQAAFGMTGRLWISIVLYLELYASCVEYIILVGNSLS  188

Query  555   TVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVA  734
             ++F   H+   G+ LS+ QL  V   ++ LP++W R LS +S+LS+ G++ ++L    V 
Sbjct  189   SLFPDAHVNFMGVDLSSQQLFAVTTAIMVLPTVWLRKLSLLSYLSAGGVIATIL---AVI  245

Query  735   CTAVFGVVNPNHRIPP---LHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSI  905
             C    GVV+     P    L L N+P   GLY F Y+GH VFPNIY++MK  ++F  V I
Sbjct  246   CLLWVGVVDRVGFHPAGTALDLANLPVAVGLYGFCYSGHSVFPNIYSSMKIQAQFPAVLI  305

Query  906   VSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFA  1085
               F + TILY  +A  G  MFG  + SQ TL+MP+  + +K+A+W TV+ P++KYAL   
Sbjct  306   FCFILCTILYAGVAVAGFLMFGESIKSQFTLNMPQQYLSSKIAVWTTVVNPLSKYALTMT  365

Query  1086  PFAIELDHSLPPSMKHH-IKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGI  1262
             P A+ L+  LP + + H +  +IR     +L+   L +AL VP+F  V++L GS+ ++ +
Sbjct  366   PVALSLEELLPSTEQSHLVAVLIR----MVLVFSTLFVALLVPFFGFVMALLGSVFTMLV  421

Query  1263  SIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFK  1397
             +++LPC  Y  I    ++   +   + +I+ G + +  G+  S K
Sbjct  422   ALILPCACYLSIQRRSVNFIQVFVCISIIMVGIVCSCFGSYHSIK  466



>ref|XP_009621097.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X3 
[Nicotiana tomentosiformis]
Length=462

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 153/396 (39%), Positives = 229/396 (58%), Gaps = 12/396 (3%)
 Frame = +3

Query  219   VEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLG  398
             +E       S+  +V+N I  L G+G LSTPYAL++GGW S FLL+  G+I  +T  LL 
Sbjct  68    LELPPSQQCSYTQSVLNAINALCGIGILSTPYALKEGGWCSLFLLLLFGIITFYTGILLK  127

Query  399   KCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHL  578
             KCL   P  + Y DIGQ AFG  GRI  A  +Y E++ + + Y I + DNL  +F    +
Sbjct  128   KCLDSSPGIETYPDIGQAAFGMLGRIFIAVALYAELYSSCIEYLIMMSDNLGAIFPSARM  187

Query  579   KLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVV  758
                GI L + Q+  +++ LV LP++W R+LS +S++S+ G++    + V V C    G +
Sbjct  188   VFAGIHLDSYQMCAIISTLVILPTVWLRNLSLLSYISAGGVIA---LIVVVLCLLWVGAI  244

Query  759   NP---NHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTI  929
             N    +     L++  +P   GLY+F Y  H VFPNIY++MK+PS+F  V ++SFS+   
Sbjct  245   NEVGFHSGGTALNIAKLPVTIGLYSFCYGSHSVFPNIYSSMKEPSRFPSVLLISFSIAFF  304

Query  930   LYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDH  1109
              Y  +A  G  MFG   S Q TL++P  ++ +KVA W  VLTP+TKYA+   P A  ++ 
Sbjct  305   SYLGVAVCGFLMFGENTSPQFTLNLPAKLITSKVAAWTVVLTPVTKYAITITPVAFGIEE  364

Query  1110  SLPPSM--KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCG  1283
              LP      + +  +IR    +IL+   L ++L VPYF  V+SL GS + + +S++LPC 
Sbjct  365   FLPSRQLRTYGVSILIR----TILVFSTLVISLTVPYFGSVMSLIGSSLVMLVSLILPCA  420

Query  1284  FYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
              Y K+   +I+R  L     +IV G + AV GT S+
Sbjct  421   CYIKLSKDRITRFQLAACTSIIVVGVVSAVIGTYSA  456



>ref|XP_008446844.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Cucumis melo]
Length=563

 Score =   258 bits (659),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 150/415 (36%), Positives = 243/415 (59%), Gaps = 14/415 (3%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD + S+   E      SSF  A++N   +L G+G L+TPYA ++GGW+   +L+   V+
Sbjct  154   KDDKPSKVPHEFPTARRSSFSQAMLNGGNVLCGVGILTTPYAAKEGGWLGLSILLIFAVV  213

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
             C +T  LL  C+   P+   Y DIGQ AFGT GRI+ +  +Y+E++ + + Y I   DNL
Sbjct  214   CYYTGLLLRDCMESRPELDTYPDIGQAAFGTTGRIVISIILYMELYASCIEYIILESDNL  273

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             +++F   HL + G +L+   L  +M  +  LP+++ RDLS +S++S+ G++ S+L+   V
Sbjct  274   SSLFPNAHLNVGGYELNAHLLFALMTTIAVLPTVYLRDLSVLSYISAGGVIASILV---V  330

Query  732   ACTAVFGVVN-----PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTK  896
              C    G+V+            L+   +P   GLY + Y+GH VFPNIY++M  PS++  
Sbjct  331   LCLFWIGLVDGVGFQGKETTTLLNPGTLPIAIGLYGYCYSGHAVFPNIYSSMSKPSQYPS  390

Query  897   VSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYAL  1076
             V +  F V T++Y  +AF+G  MFG    SQ TL++P ++V +K+A+W TV+ P TKYAL
Sbjct  391   VLLTCFVVCTLMYAGVAFVGYSMFGESTMSQFTLNLPTNLVASKIAVWTTVVNPFTKYAL  450

Query  1077  EFAPFAIELDHSLPPSMKH--HIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLV  1250
                P A+ L+  +P +      +  +IR    + L++  L + L +P+F  +LSL GSL+
Sbjct  451   TLTPIALSLEELIPSNHPQFLMLSILIR----TALVVSTLLVGLGIPFFGLILSLVGSLL  506

Query  1251  SIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             ++ IS++LPC  +  I   K++R   I  V+++V G + A  GT SS   +V +L
Sbjct  507   TMFISLILPCACFLSILKGKVTRLQGIVCVIIMVIGLIAAAFGTYSSVLKIVQNL  561



>ref|NP_195837.2| transmembrane amino acid transporter family protein [Arabidopsis 
thaliana]
 gb|AAM26683.1| AT5g02170/T7H20_220 [Arabidopsis thaliana]
 gb|AAO64748.1| At5g02170/T7H20_220 [Arabidopsis thaliana]
 gb|AED90439.1| transmembrane amino acid transporter family protein [Arabidopsis 
thaliana]
Length=526

 Score =   257 bits (656),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 137/363 (38%), Positives = 216/363 (60%), Gaps = 0/363 (0%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E  + +F  +V+N I +L G+  L+ PYA+++GGW+  F+L   G+I  +T  LL +CL 
Sbjct  131   ENRSCTFSQSVLNGINVLCGVALLTMPYAVKEGGWLGLFILFSFGIITFYTGILLKRCLE  190

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG  590
               P    Y DIGQ AFGT GRIL +  +Y+E++ + V Y I + DNL+ +F  T L + G
Sbjct  191   NSPGIHTYPDIGQAAFGTTGRILVSILLYVELYASCVEYIIMMSDNLSRMFPNTSLYING  250

Query  591   IQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNH  770
               L ++Q+  +   L+ LP++W +DLS +S+LS+ G++ S+L+ + +        V  + 
Sbjct  251   FSLDSTQVFAITTTLIVLPTVWLKDLSLLSYLSAGGVISSILLALCLFWAGSVDGVGFHI  310

Query  771   RIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAF  950
                 L + NIP   G+Y F +  H VFPNIY++MK+PSKF  V ++SF+  T+ Y A+A 
Sbjct  311   SGQALDITNIPVAIGIYGFGFGSHSVFPNIYSSMKEPSKFPTVLLISFAFCTLFYIAVAV  370

Query  951   MGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMK  1130
              G  MFG  + SQ TL+MP H   +K+A+W  V+TPMTKYAL   P  + L+  +P S +
Sbjct  371   CGFTMFGDAIQSQFTLNMPPHFTSSKIAVWTAVVTPMTKYALTITPVMLSLEELIPSSSR  430

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
                   +     +IL+L  L +AL VP+F  V +L GS +++ I+++ PC  Y  I   +
Sbjct  431   KMRSKGVSMLFRTILVLSTLVVALTVPFFATVAALIGSFIAMLIALIFPCLCYISIMKGR  490

Query  1311  ISR  1319
             ++ 
Sbjct  491   LTN  493



>gb|EEE61126.1| hypothetical protein OsJ_15055 [Oryza sativa Japonica Group]
Length=455

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/416 (34%), Positives = 250/416 (60%), Gaps = 10/416 (2%)
 Frame = +3

Query  153   PASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGG  332
             PA G++   +   +D E+  +C  +A+ + ++F+    N +  L G+G LS PYAL +GG
Sbjct  43    PARGKQ---EPVERDHEA--QCSPEADGDGATFVRTCFNGLNALSGVGLLSIPYALSEGG  97

Query  333   WISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFM  512
             W+S  LL+ + ++C +T  LL +C+   P  + Y DIG  AFG KGR+  ++F+Y E+++
Sbjct  98    WLSLVLLLAVAMVCCYTGLLLRRCMAASPAVRGYPDIGALAFGAKGRLAVSAFLYAELYL  157

Query  513   ALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSS  692
               + + I   DNL  +F GT L + G+ +S  QL  V+  +V LP+ W R L+ ++++S+
Sbjct  158   VAIGFLILEGDNLDKLFPGTSLAVGGLVVSGKQLFVVVVAVVILPTTWLRSLAVLAYVSA  217

Query  693   AGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAM  872
             +G+L S+++   V   AVF  V  + +   L++  +P+  GLY F Y GH +FP +  +M
Sbjct  218   SGVLASVVVVFCVLWAAVFDGVGFHGKGRMLNVSGLPTALGLYTFCYCGHAIFPTLCNSM  277

Query  873   KDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVL  1052
             ++  KF++V ++ F   T+ Y ++A +G  M+G  V SQ+TL++P   + +K+A++ T++
Sbjct  278   QEKDKFSRVLVICFVACTVNYGSMAILGYLMYGDDVKSQVTLNLPEGKISSKLAIYTTLI  337

Query  1053  TPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
              P +KYAL   P A  ++  L    K  +  +IR    +++++  + +AL VP+F ++++
Sbjct  338   NPFSKYALMVTPVATAIEEKLLAGNKRSVNVLIR----TLIVVSTVVIALTVPFFGNLMA  393

Query  1233  LTGSLVSIGISIVLPCGFYTKIF-WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFK  1397
             L GSL+S+  S++LPC  Y KIF   +  R   +    +IV G+L+A +GT SS K
Sbjct  394   LVGSLLSVMASMLLPCICYLKIFGLTRCGRGETLLIAAIIVLGSLVAATGTYSSLK  449



>ref|XP_010543284.1| PREDICTED: vacuolar amino acid transporter 1-like [Tarenaya hassleriana]
Length=540

 Score =   257 bits (656),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 146/391 (37%), Positives = 230/391 (59%), Gaps = 6/391 (2%)
 Frame = +3

Query  237   NNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKD  416
             N  SF  +V+N I +L G+G L+ PYA+++GGW+  F+L+  G+I  +T  LL +CL   
Sbjct  149   NLCSFSQSVLNGINVLCGVGLLTMPYAVKEGGWLGMFILLFFGIITCYTGILLKRCLESS  208

Query  417   PKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQ  596
             P    Y DIGQ AFG  GR + ++ +Y+E++ A V Y I + DNL+ +F  T   + G+ 
Sbjct  209   PGLHTYPDIGQAAFGIAGRFIISTLLYVELYAACVEYIIMMSDNLSGLFPDTSFTILGVF  268

Query  597   LSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRI  776
             L + Q+  V+  L+ LP++W RDLS +S+LS  G+L S+L+ + +    V   V  +   
Sbjct  269   LDSKQIFAVLTTLIVLPTVWLRDLSLLSYLSVGGVLSSILLALCLVWVGVVDGVGFHTGG  328

Query  777   PPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMG  956
               L+L N+P   G++ F ++GH V PNIY++M++ SKF  V + SF+  T LY A+A  G
Sbjct  329   EALNLGNLPVAIGIFGFGFSGHSVLPNIYSSMRETSKFPLVLVTSFTFCTFLYIAVAICG  388

Query  957   AKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLP-PSMKH  1133
               MFG  + SQ TL+MP   V +K+A+W  V+TPMTKYAL   P  + L+  +P   M+ 
Sbjct  389   YSMFGEAIQSQFTLNMPSQFVSSKLAVWTAVITPMTKYALTITPIVLSLEELMPLARMRS  448

Query  1134  H-IKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
               +  + R    + L++  L +AL VP+F  V +L GS +++ ++I+ PC  Y  I   +
Sbjct  449   DGVSMLFR----TTLVVSTLVVALTVPFFAIVAALVGSFLAMLVAIIFPCLCYLSILKHR  504

Query  1311  ISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
             +S   +   + +IVFG +    GT S+   L
Sbjct  505   LSNAQIGICISIIVFGLVSGCCGTYSALARL  535



>ref|XP_008446843.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Cucumis melo]
Length=583

 Score =   258 bits (658),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 150/415 (36%), Positives = 243/415 (59%), Gaps = 14/415 (3%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             KD + S+   E      SSF  A++N   +L G+G L+TPYA ++GGW+   +L+   V+
Sbjct  174   KDDKPSKVPHEFPTARRSSFSQAMLNGGNVLCGVGILTTPYAAKEGGWLGLSILLIFAVV  233

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
             C +T  LL  C+   P+   Y DIGQ AFGT GRI+ +  +Y+E++ + + Y I   DNL
Sbjct  234   CYYTGLLLRDCMESRPELDTYPDIGQAAFGTTGRIVISIILYMELYASCIEYIILESDNL  293

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             +++F   HL + G +L+   L  +M  +  LP+++ RDLS +S++S+ G++ S+L+   V
Sbjct  294   SSLFPNAHLNVGGYELNAHLLFALMTTIAVLPTVYLRDLSVLSYISAGGVIASILV---V  350

Query  732   ACTAVFGVVN-----PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTK  896
              C    G+V+            L+   +P   GLY + Y+GH VFPNIY++M  PS++  
Sbjct  351   LCLFWIGLVDGVGFQGKETTTLLNPGTLPIAIGLYGYCYSGHAVFPNIYSSMSKPSQYPS  410

Query  897   VSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYAL  1076
             V +  F V T++Y  +AF+G  MFG    SQ TL++P ++V +K+A+W TV+ P TKYAL
Sbjct  411   VLLTCFVVCTLMYAGVAFVGYSMFGESTMSQFTLNLPTNLVASKIAVWTTVVNPFTKYAL  470

Query  1077  EFAPFAIELDHSLPPSMKH--HIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLV  1250
                P A+ L+  +P +      +  +IR    + L++  L + L +P+F  +LSL GSL+
Sbjct  471   TLTPIALSLEELIPSNHPQFLMLSILIR----TALVVSTLLVGLGIPFFGLILSLVGSLL  526

Query  1251  SIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             ++ IS++LPC  +  I   K++R   I  V+++V G + A  GT SS   +V +L
Sbjct  527   TMFISLILPCACFLSILKGKVTRLQGIVCVIIMVIGLIAAAFGTYSSVLKIVQNL  581



>emb|CDX73443.1| BnaC08g25600D [Brassica napus]
Length=537

 Score =   256 bits (655),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 146/425 (34%), Positives = 230/425 (54%), Gaps = 2/425 (0%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKG  329
             E A+  +    + +    SS    E    N+SSF  AV+N + +L G+G LSTPYA+++G
Sbjct  112   EEAAKRKRSSHSLLPSKASSRVSHEMGISNDSSFGQAVLNGVNVLCGVGILSTPYAVKEG  171

Query  330   GWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIF  509
             GW+   +L   GV+C +T  LL  CL   P  + Y DIG  AFGT GRIL +  +YLE++
Sbjct  172   GWLGLLILFAFGVLCFYTGLLLRYCLDSHPDLQTYPDIGHAAFGTTGRILVSVILYLELY  231

Query  510   MALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLS  689
                V Y I   DNL+++F    L + G  L    L  ++  +  LP++W RDLS +S++S
Sbjct  232   AMSVEYIILESDNLSSLFPNAALSIGGFHLDAPHLFALLTTIAVLPTVWLRDLSILSYIS  291

Query  690   SAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTA  869
             + G++ S+L+ + +    +   V  + +  PL+L  +P   GLY + Y+GH VFPNIYT+
Sbjct  292   AGGVIASVLVVLCLFWVGLIDEVGIHSKGTPLNLATLPVSVGLYGYCYSGHGVFPNIYTS  351

Query  870   MKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATV  1049
             M  PS+F  V +  F + T++Y  +A MG  MFG    SQ TL++P+ +V +K+ALW TV
Sbjct  352   MAKPSQFPAVLVTCFGICTLMYAGVAVMGYSMFGESTESQFTLNLPQDLVASKIALWTTV  411

Query  1050  LTPMTKYA--LEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEH  1223
             ++P TKY   + F+               H           S L    L + L +P+F  
Sbjct  412   VSPFTKYPFLMIFSETLSLFLLEELLPSNHGKSRFYAIAIRSALAFSTLLVGLAIPFFGL  471

Query  1224  VLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
             V+SL GS +++ I+++LP   +  I   K++   +   VV+I  G + +  GT S+   +
Sbjct  472   VMSLIGSFLTMLITLILPPACFLSILRTKVTPTQVALCVVIITVGAVCSAMGTYSALSKI  531

Query  1404  VISLQ  1418
             +  L 
Sbjct  532   IEKLN  536



>ref|XP_011094890.1| PREDICTED: vacuolar amino acid transporter 1-like [Sesamum indicum]
Length=533

 Score =   256 bits (654),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/392 (35%), Positives = 229/392 (58%), Gaps = 6/392 (2%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E    +  S+  +++N I  L G+G LSTPYAL++GGW S  +L  LG I  +T  LL +
Sbjct  139   ELPPTDQCSYTQSLLNAINALCGIGILSTPYALKEGGWFSILILCTLGTITCYTGILLKR  198

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL   P  + Y DIGQ AFG +GRI  A+ +Y+E++ + V + I + DNLA  F    + 
Sbjct  199   CLESSPHLQTYPDIGQAAFGLRGRICIAAILYVELYSSCVEFLIMMSDNLAASFPNVQMD  258

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             + GI L + Q+  + + LV LP++W R+LS +SF+S+ G++   L+ + +    V   V 
Sbjct  259   VAGIHLDSYQVCAIASTLVILPTVWLRNLSLLSFISAGGVVTLALVVLCLLWVGVATDVG  318

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              +     L    +P   G+Y+F Y  H VFPNIY++MK+PS+F  V ++SF V  +LY  
Sbjct  319   FHPSGKALDYTKLPITIGIYSFCYGSHSVFPNIYSSMKEPSRFPSVLVISFLVAALLYAG  378

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
             +A  G  MFG   + Q TL++P + V + +A W+ VL P+TK+ L   P A+ ++  LP 
Sbjct  379   VAVCGFLMFGEATNPQFTLNLPTNFVASDIAGWSVVLAPLTKFGLSITPVALGIEELLPA  438

Query  1122  SM--KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTK  1295
             +    H +  ++R    + L++  L +AL VPYF  +++L GSL+ + +S++LPC  Y +
Sbjct  439   AQLRSHTMSVLVR----TCLVVSTLVVALAVPYFGSLMALIGSLLVMLVSVILPCACYMR  494

Query  1296  IFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             I   ++++  +    +++  G + A+ GT S+
Sbjct  495   IDKGRLTKVQITGCYLIMTVGVICAIVGTYSA  526



>ref|XP_009588885.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009588886.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009588887.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Nicotiana tomentosiformis]
Length=567

 Score =   257 bits (656),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 154/421 (37%), Positives = 238/421 (57%), Gaps = 19/421 (5%)
 Frame = +3

Query  201   ESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAF  380
             E S++         SS+  AV+N + +L G+G LSTPYA+++GGW    +L   GV+  +
Sbjct  149   EPSKDAHGLTMSRQSSYGQAVVNGMNVLCGVGILSTPYAMKEGGWSGLSILFIFGVLSFY  208

Query  381   TTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATV  560
             T  LL  CL   P  + Y DIGQ AFGT GRI  +  +Y+E++ + + Y I   DNL+ +
Sbjct  209   TGILLRSCLDSQPGLETYPDIGQAAFGTPGRIFISIILYVELYFSCIEYIILEGDNLSAI  268

Query  561   FLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLI-------  719
             F   HL L   +L    L   +A L  LP++W RDLS +S++S  G++ S+L+       
Sbjct  269   FPNAHLSLGSFELDARHLFVFIATLAVLPTVWLRDLSVLSYISVGGVVASVLVVLCLYWA  328

Query  720   -----FVTVACTAVFGVVNP---NHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMK  875
                   + V C    G+V+      +   L+L  +P   GLY F Y+GH VFPNIYT++ 
Sbjct  329   GXVASVLVVLCLYWAGLVDHVGFESKGTVLNLSTLPVAIGLYGFCYSGHAVFPNIYTSLA  388

Query  876   DPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLT  1055
             D ++F  V +  F +VT+LY   A MG  MFG    SQ TL++P+ ++ +KVA+W TV+ 
Sbjct  389   DRNQFPAVLLTCFGMVTLLYGGTAVMGYLMFGDSADSQFTLNLPKGLIASKVAVWTTVVN  448

Query  1056  PMTKYALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPYFEHVLS  1232
             P TKYAL  +P A+ L+  LP    K H+  I+     + L    L + L +P+F  V++
Sbjct  449   PFTKYALTLSPVAMSLEELLPSKHAKSHVYPIL---IRTALAFSTLVVGLSIPFFGLVMA  505

Query  1233  LTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVIS  1412
             L GSL+++ ++++LPC  + +I   K SR  +   V++I  GT+ AV G+ S+   ++ S
Sbjct  506   LIGSLLTMLVTLILPCVCFLRILKGKTSRLQVSVCVLIITVGTISAVIGSYSAVSNIIQS  565

Query  1413  L  1415
             L
Sbjct  566   L  566



>ref|XP_006665080.1| PREDICTED: vacuolar amino acid transporter 1-like [Oryza brachyantha]
Length=451

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/436 (34%), Positives = 254/436 (58%), Gaps = 13/436 (3%)
 Frame = +3

Query  111   ECSSCCPDGHK---HVEPASGERFEDQTAVKDLESSEECVEQAEKNN---SSFMHAVINM  272
             E S+  PD  +       A   R + + A +D E+  +C  QA+ ++   ++F+    N 
Sbjct  16    EGSTAQPDFEEPLLQAHAAVPARGKQEPAERDHEA--QCSPQADVDDDGGATFVRTCFNG  73

Query  273   IGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQ  452
             +  L G+G LS PYAL +GGW+S  LL+ + ++C +T  LL +C+   P    Y DIG  
Sbjct  74    LNALSGVGLLSIPYALSEGGWLSLVLLLAVAMVCFYTGLLLRRCMAASPTVLGYPDIGAL  133

Query  453   AFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAV  632
             AFG KGR+  ++F+Y E+++  + + I   DNL  +F GT L + G+ +S  QL  V+  
Sbjct  134   AFGAKGRLAVSAFLYAELYLVAIGFLILEGDNLDKLFPGTSLSVGGLVVSGKQLFVVLVA  193

Query  633   LVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVS  812
             +V LP+ W R L+ ++++S++G+L S+++   V   AV   V  + +   L++  +P+  
Sbjct  194   VVILPTTWLRSLAVLAYVSASGVLASVVVVFCVLWVAVVDGVGFHGKGRMLNVSGLPTAL  253

Query  813   GLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQI  992
             GLY F Y GH +FP +  +MK+  KF+KV ++ F   T+ Y ++A +G  M+G  V SQ+
Sbjct  254   GLYTFCYCGHAIFPTLCNSMKEKDKFSKVLVICFVACTLNYGSMAILGYLMYGDDVKSQV  313

Query  993   TLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSi  1172
             TL++P   + +K+A++ T++ P +KYAL   P A  ++  L    K  +  +IR    ++
Sbjct  314   TLNLPEGKISSKLAIYTTLINPFSKYALMVTPVATAIEERLLAGNKRSVNVLIR----TL  369

Query  1173  liliilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF-WPKISRPLLIFNVVLI  1349
             +++  + +AL VP+F H+++L GSL+S+  S++LPC  Y KIF   +  R   +    +I
Sbjct  370   IVVSTVVIALTVPFFGHLMALVGSLLSVMASMLLPCICYLKIFGLTRCGRAETLLIATII  429

Query  1350  VFGTLLAVSGTVSSFK  1397
             V G+L+A +GT SS K
Sbjct  430   VLGSLVAATGTYSSLK  445



>ref|XP_008807703.1| PREDICTED: vacuolar amino acid transporter 1-like, partial [Phoenix 
dactylifera]
Length=524

 Score =   256 bits (653),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/424 (35%), Positives = 240/424 (57%), Gaps = 6/424 (1%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKG  329
              P    R   +   +D E  +   E       S+  AV+N + +L G+G LS PYA+ +G
Sbjct  104   RPIPTRRLPAKKIKEDHEPHKVSNELPISQQCSYGQAVLNGMNVLCGVGILSMPYAVMEG  163

Query  330   GWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIF  509
             GWI   +L    V+  +T  LL  CL   P  + Y DIGQ AFGT GR   +  +YLE++
Sbjct  164   GWIGLSVLFIFSVLAFYTGILLRHCLDSKPGLETYPDIGQAAFGTVGRFAVSVILYLELY  223

Query  510   MALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLS  689
                V + I   DNL+++F   HL + G+ L+   L  ++A L  LP+ W RDLS +S++S
Sbjct  224   ACCVEFIILESDNLSSLFPNAHLNIGGLHLNCHVLFAIVATLGVLPTTWLRDLSLLSYIS  283

Query  690   SAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTA  869
             + G++ S+L+  ++    +   V        L+L  IP   GLY + ++GH VFPNIY++
Sbjct  284   AGGVIASVLVVCSLFWVGLVDQVGFQTGGTSLNLSGIPIAIGLYGYCFSGHAVFPNIYSS  343

Query  870   MKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATV  1049
             +K PS++  V   SF++ T ++  +A MG  MFG  + SQ TL+MP ++V +K+A+W TV
Sbjct  344   LKKPSQYPSVLFTSFAISTAMFAGVAVMGYLMFGESLVSQFTLNMPHNLVASKLAVWTTV  403

Query  1050  LTPMTKYALEFAPFAIELDHSLPPSMK--HHIKTIIRGGTGSililiilalalCVPYFEH  1223
             + P++KYAL   P A+ L+  +P + +  H    IIR    + L++  L +AL +P+F  
Sbjct  404   VNPLSKYALTLTPLALSLEELIPANRRESHAYAIIIR----TALVVSTLFVALSIPFFGL  459

Query  1224  VLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
             V+SL GSL+S+ ++++LPC  Y  I   K++   +    ++I  G + + SGT S+   +
Sbjct  460   VMSLIGSLLSMLVTLILPCACYLSILRGKVTWTQVSLCTLIITVGVVSSTSGTYSALSKI  519

Query  1404  VISL  1415
             + +L
Sbjct  520   IQNL  523



>ref|XP_010423892.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Camelina sativa]
Length=475

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 155/427 (36%), Positives = 242/427 (57%), Gaps = 13/427 (3%)
 Frame = +3

Query  129   PDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLST  308
             PD  + + P +    + + +V DL          E N  SF  +V+N   +L GLG ++ 
Sbjct  55    PDKDETISPFNPSS-QLKLSVTDLP-------VPETNLCSFSQSVLNGTNVLCGLGLITM  106

Query  309   PYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAAS  488
             PYA+++ GW+   +L+  GVI  +T  L+ +CL   P  + Y DIGQ AFG  GR + + 
Sbjct  107   PYAIKESGWLGLLILLFFGVITCYTGVLMKRCLESSPGLQTYPDIGQAAFGITGRFIISI  166

Query  489   FIYLEIFMALVSYTISLHDNLATVFLGTHLKL-TGIQLSTSQLLTVMAVLVALPSLWFRD  665
              +Y+E++ A V Y I + DNL+ +F    L + +GI L +SQ+  ++  ++ LP++W +D
Sbjct  167   LLYVELYAACVEYIIMMSDNLSGLFPNISLSIASGISLDSSQIFAILTTILVLPTVWLKD  226

Query  666   LSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHI  845
             LS +S+LS  G+L S+L+ + +    V   +  +         N+P   G++ F Y+GH 
Sbjct  227   LSLLSYLSVGGVLASILLGLCLFWIGVVDGIGFHATGKVFDFNNLPVAIGIFGFGYSGHS  286

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPNIY++MKDPSKF  V ++ FS  T LY A+A  G  MFG  V SQ TL+MP+    +
Sbjct  287   VFPNIYSSMKDPSKFPLVLVICFSFCTFLYIAVAICGYTMFGEAVESQFTLNMPKQFFPS  346

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalal  1202
             KVA+W  V+TPMTKYAL   P  + L+  +P S M+ H  +I+   T   L+   L +AL
Sbjct  347   KVAVWTAVITPMTKYALTITPIVMSLEELIPMSKMRSHGVSILFRTT---LVTSTLVVAL  403

Query  1203  CVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGT  1382
              VP+F  V +L GS +++ ++++ PC  Y  I   K+S   +   V +I+FG +    GT
Sbjct  404   SVPFFAIVAALIGSFLAMLVALIFPCLCYLSILKGKLSNTQIGLCVFIILFGLVSGCCGT  463

Query  1383  VSSFKLL  1403
              S+   L
Sbjct  464   YSAISRL  470



>ref|XP_010471796.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=529

 Score =   256 bits (653),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 152/430 (35%), Positives = 245/430 (57%), Gaps = 18/430 (4%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLESSE-----ECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPY  314
             +P   ++ +D + VK   SS+       +  A+ +  SF  +V+N I +L G+G L+ PY
Sbjct  103   QPLLTQKDDDDSVVKSFLSSQLKLSITDLSYAKPDLCSFPQSVLNAINILCGVGLLTMPY  162

Query  315   ALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFI  494
              +++GGW+  F+L   G+I  +T  LL +CL   P    Y DIGQ AFG  GR++ +  +
Sbjct  163   GVKEGGWLGIFILFFFGIITCYTCILLKRCLESSPGLHTYPDIGQAAFGFTGRVIISILL  222

Query  495   YLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSS  674
             Y+E++   V Y I + DNL+ +F    L + G+ L +SQ+  + A L+ LP++W RDLS 
Sbjct  223   YMELYAGCVEYIIMMSDNLSRMFPNMSLNIVGLSLDSSQIFAISATLIVLPTVWLRDLSL  282

Query  675   ISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIP---PLHLPNIPSVSGLYAFSYAGHI  845
             +S+LS+ G+  S+++     C    G V+     P    L L NIP   G+Y F ++GH 
Sbjct  283   LSYLSAGGVFSSIMM---ALCLFWVGTVDEVGFRPGGQALDLANIPVAIGIYGFGFSGHA  339

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPNIY++MK+PSKF  V ++SF     LY  +A  G  MFG  + SQ TL+MP+    +
Sbjct  340   VFPNIYSSMKEPSKFPLVVVISFGFCVFLYIVVAICGYSMFGEAIQSQFTLNMPQQFTSS  399

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPPSMK---HHIKTIIRGGTGSililiilal  1196
             K+A+W  V+TPMTKYAL   P  + L+  +P S K   + +   +R    +IL+L  L +
Sbjct  400   KIAVWLAVITPMTKYALSITPIVLSLEELMPSSRKMRSYGVSIFLR----TILVLSTLVV  455

Query  1197  alCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVS  1376
             AL +P+F  + +L GS +++ ++ +LPC  Y  I   ++S+  +   + +I+ G +    
Sbjct  456   ALTLPFFAIMGALMGSFLAMLVAFILPCLCYLSILKSRLSQTQIGLCIFIIIVGVVSGCC  515

Query  1377  GTVSSFKLLV  1406
             GT S+   L+
Sbjct  516   GTYSAIVRLI  525



>ref|XP_010517607.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=530

 Score =   256 bits (653),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 144/393 (37%), Positives = 221/393 (56%), Gaps = 6/393 (2%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   + N I ++ G+G LSTP+ +++ GW S  +L+   VIC +T  L+ +C       
Sbjct  142   SFTQTIFNAINVMAGVGLLSTPFTVKEAGWASMVILLLFAVICCYTATLMKECFENKTGI  201

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT L   GI + +
Sbjct  202   ITYPDIGEAAFGIYGRILICMLLYTELYSYCVEFIILEGDNLTGLFPGTSLDWLGINIDS  261

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  ++  L+ LP++W +DL  IS+LS+ G++ ++LI V+V      G +  +H    +
Sbjct  262   KHLFGILTALIVLPTVWLKDLRIISYLSAGGVIATVLIAVSVFFLGTTGGIGFHHTGKAV  321

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
              L  IP   G+Y F Y+GH VFPNIY +M D +KF K  I +F +  ++Y  +A MG  M
Sbjct  322   KLNGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITTFILCVLIYGGVAVMGYLM  381

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+   F+KVA W TV++P TKYAL   P A  ++  LP  M  +I  
Sbjct  382   FGEATLSQITLNMPQDQFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPLRMSENIWC  441

Query  1146  --IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISR  1319
               I+R    + L+   +  A  +P+F  V++L GSL+SI ++IV+P   + KI   K +R
Sbjct  442   FLILR----TALVASSVCSAFLIPFFGLVMALIGSLLSILVAIVMPALCFIKIMGNKATR  497

Query  1320  PLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
               +I + +++  G +    GT SS   ++ + Q
Sbjct  498   TQMILSSIIVAIGVISGTLGTYSSVAKIIRNYQ  530



>gb|AAN31931.1| unknown protein [Arabidopsis thaliana]
Length=407

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 142/391 (36%), Positives = 216/391 (55%), Gaps = 2/391 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             S +  + N I ++ G+G LSTPY +++ GW S  +L+   VIC +T  L+  C       
Sbjct  19    SVIQTIFNAINVMAGVGLLSTPYTVKEAGWASMVILLLFAVICCYTATLMKDCFENKTGI  78

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT L L G +L +
Sbjct  79    ITYPDIGEAAFGKYGRILICMLLYTELYSYCVEFIILEGDNLTGLFPGTSLDLLGFRLDS  138

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  ++  L+ LP++W +DL  IS+LS+ G++ + LI V+V      G +  +H    +
Sbjct  139   KHLFGILTALIVLPTVWLKDLRIISYLSAGGVIATALIAVSVFFLGTTGGIGFHHTGQAV  198

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 IP   G+Y F Y+GH VFPNIY +M D +KF K  I  F +  +LY  +A MG  M
Sbjct  199   KWNGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITCFIICVLLYGGVAIMGYLM  258

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+   F+KVA W TV++P TKYAL   P A  ++  LP  M  +I  
Sbjct  259   FGEATLSQITLNMPQDQFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPERMSENIWC  318

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  +++L GSL+SI ++I++P   + KI   K +R  
Sbjct  319   FLLLRTA--LVASSVCSAFLIPFFGLMMALIGSLLSILVAIIMPALCFIKIMGNKATRTQ  376

Query  1326  LIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             +I + +++  G +    GT SS   ++ + Q
Sbjct  377   MILSSIIVAIGVVSGTLGTYSSVAKIIRNYQ  407



>ref|XP_010508748.1| PREDICTED: vacuolar amino acid transporter 1-like [Camelina sativa]
Length=530

 Score =   255 bits (652),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 143/391 (37%), Positives = 219/391 (56%), Gaps = 2/391 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   + N I ++ G+G LSTP+ +++ GW S  +L+   VIC +T  L+ +C       
Sbjct  142   SFTQTIFNAINVMAGVGLLSTPFTVKEAGWASMVILLLFAVICCYTATLMKECFENKTGI  201

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT L   GI + +
Sbjct  202   ITYPDIGEAAFGIYGRILICMLLYTELYSYCVEFIILEGDNLTGLFPGTSLDWLGINIDS  261

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  +   L+ LP++W +DL  IS+LS+ G++ ++LI V+V      G +  +H    +
Sbjct  262   KHLFGIFTALIVLPTVWLKDLRIISYLSAGGVISTVLIAVSVFFLGTTGGIGFHHTGQAV  321

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
              L  IP   G+Y F Y+GH VFPNIY +M D +KF K  I +F +  +LY  +A MG  M
Sbjct  322   KLNGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITTFILCVLLYGGVAVMGYLM  381

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+   F+KVA W TV++P TKYAL   P A  ++  LP  M+ +I  
Sbjct  382   FGEATLSQITLNMPKDQFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPLRMQENIWC  441

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  V++L GSL+SI ++IV+P   + KI   K +R  
Sbjct  442   FLLLRTA--LVASSVCSAFLIPFFGLVMALIGSLLSILVAIVMPALCFIKIMGNKATRTQ  499

Query  1326  LIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             ++ + +++  G +    GT SS   ++ + Q
Sbjct  500   MVLSSIIVAIGVVSGTLGTYSSVAKIIRNYQ  530



>ref|XP_009143338.1| PREDICTED: vacuolar amino acid transporter 1-like [Brassica rapa]
 ref|XP_009143339.1| PREDICTED: vacuolar amino acid transporter 1-like [Brassica rapa]
Length=552

 Score =   256 bits (653),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 146/428 (34%), Positives = 240/428 (56%), Gaps = 9/428 (2%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + PA   R   +   K    S E        NSS+  AV+N + +L G+G LSTPYA
Sbjct  130   HGLLSPAPSRRGSMRKDEKVFMVSHEI---PMSRNSSYGQAVLNGLNVLCGVGILSTPYA  186

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
              ++GGW+   +L   G++  +T  LL  CL  +   + Y DIGQ AFGT GRI  +  +Y
Sbjct  187   AKEGGWLGLMILFIYGLLSFYTGILLRYCLDSESDLETYPDIGQAAFGTTGRIFVSIVLY  246

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             LE++   V Y I   DNL+++F      + G +L    L  ++  L  LP++W RDLS +
Sbjct  247   LELYACCVEYIILESDNLSSLFPNAAFGIGGFELDARHLFAILTTLAVLPTVWLRDLSVL  306

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+L+ + +    +   V  + +   L+L  +P   GLY + Y+GH VFPN
Sbjct  307   SYISAGGVIASVLVVLCLFWIGLVDEVGIHSKGTTLNLSTLPVAIGLYGYCYSGHAVFPN  366

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT+M  P+++  V +  F + T++Y  +A MG  MFG    SQ TL++P+ +V TK+A+
Sbjct  367   IYTSMAKPTQYPAVLLTCFGICTLMYAGVAVMGYTMFGEATESQFTLNLPQELVATKIAV  426

Query  1038  WATVLTPMTKYALEFAPFAIELDHSLPP--SMKHHIKTIIRGGTGSililiilalalCVP  1211
             W TV+ P TKYAL  +P A+ L+  +P   +  H     IR    + L+   L + L +P
Sbjct  427   WTTVVNPFTKYALTISPVALSLEELIPERHNKSHWYAIAIR----TALVFSTLLVGLSIP  482

Query  1212  YFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             +F  V+SL GSL+++ ++++LP   +  I   K++   ++  V++I+ G + +V G+ S+
Sbjct  483   FFGLVMSLIGSLLTMLVTLILPPVCFLSIVRGKVTSTQMMLCVLIIIIGAISSVIGSYSA  542

Query  1392  FKLLVISL  1415
                ++  L
Sbjct  543   LSKIIQKL  550



>gb|KHN00860.1| Vacuolar amino acid transporter 1 [Glycine soja]
Length=570

 Score =   256 bits (653),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 154/429 (36%), Positives = 244/429 (57%), Gaps = 37/429 (9%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
              +    + SF  AV+N I +L G+G LSTPYA + GGW+   +L+   +I  +T  LL  
Sbjct  148   HEVPSGHCSFGQAVLNGINVLCGVGILSTPYAAKVGGWLGLSILVIFAIISFYTGLLLRS  207

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL  +P+ + Y DIGQ AFGT GRI  +  +Y+E++   + Y I   DNL+++F   HL 
Sbjct  208   CLDSEPELETYPDIGQAAFGTTGRIAISIVLYVELYACCIEYIILEGDNLSSLFPSAHLN  267

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGV--  755
             L GI+L++  L  V+  L  LP++W RDLS +S++S+ G++ S+L+   V C    G+  
Sbjct  268   LGGIELNSHTLFAVITTLAVLPTVWLRDLSILSYISAGGVVASILV---VLCLLWVGIED  324

Query  756   VNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILY  935
             V  + +   L+L  +P   GLY + Y+GH VFPNIYT+M +P++F  V +  F + T+LY
Sbjct  325   VGFHSKGTTLNLATLPVAVGLYGYCYSGHAVFPNIYTSMANPNQFPVVLLACFGICTLLY  384

Query  936   TALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKY---------------  1070
                A +G  MFG  + SQ TL+MP+ +V TK+A+W TV+ P TKY               
Sbjct  385   AGAAVLGYTMFGEAILSQFTLNMPKELVATKIAVWTTVVNPFTKYPLYVPYINTYEHASK  444

Query  1071  -----------ALEFAPFAIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalalCVP  1211
                        AL  +P A+ L+  +P +  K ++ +I IR G    L+L  L + L VP
Sbjct  445   KDVFYLISFTYALTISPVAMSLEELIPSNHAKSYLYSIFIRTG----LVLSTLVIGLSVP  500

Query  1212  YFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             +F  V+SL GSL+++ ++++LPC  + +I   K++R      + +I  G + +  G+ S+
Sbjct  501   FFGLVMSLIGSLLTMLVTLILPCACFLRILRGKVTRTQAALCITIITVGVVCSAFGSYSA  560

Query  1392  FKLLVISLQ  1418
                +V SL+
Sbjct  561   LAEIVKSLR  569



>ref|XP_009621094.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Nicotiana tomentosiformis]
Length=533

 Score =   255 bits (651),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 153/396 (39%), Positives = 229/396 (58%), Gaps = 12/396 (3%)
 Frame = +3

Query  219   VEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLG  398
             +E       S+  +V+N I  L G+G LSTPYAL++GGW S FLL+  G+I  +T  LL 
Sbjct  139   LELPPSQQCSYTQSVLNAINALCGIGILSTPYALKEGGWCSLFLLLLFGIITFYTGILLK  198

Query  399   KCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHL  578
             KCL   P  + Y DIGQ AFG  GRI  A  +Y E++ + + Y I + DNL  +F    +
Sbjct  199   KCLDSSPGIETYPDIGQAAFGMLGRIFIAVALYAELYSSCIEYLIMMSDNLGAIFPSARM  258

Query  579   KLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVV  758
                GI L + Q+  +++ LV LP++W R+LS +S++S+ G++    + V V C    G +
Sbjct  259   VFAGIHLDSYQMCAIISTLVILPTVWLRNLSLLSYISAGGVIA---LIVVVLCLLWVGAI  315

Query  759   NP---NHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTI  929
             N    +     L++  +P   GLY+F Y  H VFPNIY++MK+PS+F  V ++SFS+   
Sbjct  316   NEVGFHSGGTALNIAKLPVTIGLYSFCYGSHSVFPNIYSSMKEPSRFPSVLLISFSIAFF  375

Query  930   LYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDH  1109
              Y  +A  G  MFG   S Q TL++P  ++ +KVA W  VLTP+TKYA+   P A  ++ 
Sbjct  376   SYLGVAVCGFLMFGENTSPQFTLNLPAKLITSKVAAWTVVLTPVTKYAITITPVAFGIEE  435

Query  1110  SLPPSM--KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCG  1283
              LP      + +  +IR    +IL+   L ++L VPYF  V+SL GS + + +S++LPC 
Sbjct  436   FLPSRQLRTYGVSILIR----TILVFSTLVISLTVPYFGSVMSLIGSSLVMLVSLILPCA  491

Query  1284  FYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
              Y K+   +I+R  L     +IV G + AV GT S+
Sbjct  492   CYIKLSKDRITRFQLAACTSIIVVGVVSAVIGTYSA  527



>ref|XP_006287324.1| hypothetical protein CARUB_v10000525mg, partial [Capsella rubella]
 gb|EOA20222.1| hypothetical protein CARUB_v10000525mg, partial [Capsella rubella]
Length=596

 Score =   256 bits (655),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 146/394 (37%), Positives = 229/394 (58%), Gaps = 7/394 (2%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E N  SF  +V+N   +L GLG ++ PYA+++ GW+   +L+  GVI  +T  L+ +CL 
Sbjct  202   ETNLCSFSQSVLNGTNVLCGLGLITMPYAIKESGWLGLIILLFFGVITCYTGVLMKRCLE  261

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL-T  587
               P  + Y DIGQ AFG  GR++ +  +Y+E++ A V Y I + DNL+ +F      + +
Sbjct  262   SSPGLQTYPDIGQAAFGITGRLIISILLYVELYAACVEYIIMMSDNLSGLFPNISFSIAS  321

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
             GI L + Q+  ++  L+ LP++W +DLS +S+LS  G+L S+L+ + +        +  +
Sbjct  322   GISLDSPQVFAILTTLLVLPTVWLKDLSLLSYLSVGGVLASILLGLCLFWVGAVDGIGFH  381

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
                      N+P V G++ F Y+GH VFPNIY++MKDPSKF  V ++ FS  T LY A+A
Sbjct  382   ATGKVFDFSNLPVVIGIFGFGYSGHSVFPNIYSSMKDPSKFPLVLVICFSFCTSLYIAVA  441

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-  1124
               G  MFG  V SQ TL+MP+H   +KVA+W  V+TPMTKYAL   P  + L+  +P + 
Sbjct  442   VCGYTMFGEAVESQFTLNMPKHFFPSKVAVWTAVITPMTKYALTITPIVMSLEELIPTAK  501

Query  1125  -MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
                H +  + R    +IL+   L +AL VP+F  V +L GS +++ ++++ PC  Y  I 
Sbjct  502   MRSHGVSILFR----TILVTSTLVVALSVPFFAIVAALIGSFLAMLVALIFPCLCYLSIL  557

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
               K+S   +   + +I+FG +    GT S+   L
Sbjct  558   KGKLSNTQIGLCMFIILFGLVSGCCGTYSAISRL  591



>ref|XP_004149900.1| PREDICTED: vacuolar amino acid transporter 1-like [Cucumis sativus]
Length=554

 Score =   255 bits (652),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 142/397 (36%), Positives = 239/397 (60%), Gaps = 6/397 (2%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
               +S+F  AV+N I +L G+G LSTPYA+++GGW+   +L+   V+  +T  LL  CL  
Sbjct  161   SRHSTFGQAVVNGINVLCGVGILSTPYAMKEGGWMGLSILMIFAVLSFYTGILLRACLDS  220

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGI  593
              P  + Y DIGQ AFG  GR+  +  +Y+E++ + + Y I   DNL+++F   H+   G+
Sbjct  221   RPGLETYPDIGQAAFGAMGRVAISIVLYVELYASCIEYVILESDNLSSLFPRAHISFGGL  280

Query  594   QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHR  773
             +++   L  +   L  LP+++ RDLS +S++S+ G++ S+++ + +    +   V  + +
Sbjct  281   EINAHLLFAIATALAVLPTVYLRDLSILSYISAGGVVASIVVVLCLFWVGLVDDVGFHGK  340

Query  774   IPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFM  953
             + PL+L ++P   GLY F Y+GH VFPNIY++M + S+F  V +  F + T++Y  +A M
Sbjct  341   VTPLNLSSLPVALGLYGFCYSGHAVFPNIYSSMGNQSQFPAVLLTCFGICTLMYAGVAVM  400

Query  954   GAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSM-K  1130
             G  MFG    SQ TL++P+ +V +K+A+W TV+ P TKYAL  +P A+ L+  +PP+  K
Sbjct  401   GYLMFGESTLSQYTLNLPQDLVASKIAVWTTVVNPFTKYALTISPVAMSLEEFIPPNHPK  460

Query  1131  HHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
              HI +I IR G    L+   L + L VP+F  ++SL GSL+++ ++++LPC  Y  I   
Sbjct  461   SHIYSILIRTG----LVFSTLLVGLSVPFFGLMMSLIGSLLTMLVTLILPCVCYLSILRG  516

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             K++        ++I  G + +  G+ S+ K +V  L 
Sbjct  517   KVTILQRALCCIVIAVGVVASAFGSFSALKKIVEELS  553



>ref|XP_009368911.1| PREDICTED: vacuolar amino acid transporter 1-like [Pyrus x bretschneideri]
Length=552

 Score =   255 bits (652),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 145/415 (35%), Positives = 240/415 (58%), Gaps = 6/415 (1%)
 Frame = +3

Query  180   QTAVKDLESSEECVEQAE--KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLL  353
             +T+V+  E +            +SSF  AV N I +L G+G LSTPYA+++GGW+  F+L
Sbjct  139   RTSVRKDEKASRVTHDHHPMSRHSSFTQAVFNGINVLCGVGILSTPYAIKEGGWLGLFVL  198

Query  354   IGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTI  533
             +   V+  +T  LL  CL   P  + Y DIGQ AFG  GRI  +  +Y+E++   + Y I
Sbjct  199   LIFAVLSFYTGLLLRYCLDSQPGLETYPDIGQAAFGIGGRIGISIVLYVELYACCIEYII  258

Query  534   SLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSL  713
                DNL+++F    L L G  L    L  +   L  LP++W RDLS +S++S+ G++ S+
Sbjct  259   LESDNLSSLFPNAQLSLGGFVLDAHLLFAIATTLAVLPTVWLRDLSVLSYISAGGVIASI  318

Query  714   LIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFT  893
             L+ + +    +   V   ++  PL+L  +P   GLY + Y+GH VFPNIYT+++  +++ 
Sbjct  319   LVSLCLFWVGLVDGVGFENKGTPLNLATLPVAMGLYGYCYSGHAVFPNIYTSLEKRNQYP  378

Query  894   KVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYA  1073
              + +  F + T LY  +A +G  MFG  + SQ TL+MP ++V +K+ALW TV+ P TKYA
Sbjct  379   AIILTCFCICTFLYAGVAAVGYTMFGESIQSQFTLNMPHNLVASKIALWTTVVNPFTKYA  438

Query  1074  LEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVS  1253
             L  +P A+ L+  +P +  +    +IR    + L++  L + LC+P+F  V+SL GSL +
Sbjct  439   LTMSPVAMSLEELVPANKSYIYSVLIR----TALVVSTLVVGLCIPFFGLVMSLIGSLFT  494

Query  1254  IGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             + ++++LPC  +  I   +I+R      +++I  G + +  GT S+   +V +L+
Sbjct  495   MLVTLILPCACFLSILRGRITRFQGTLCIIIIAVGVVSSAFGTFSAISKIVENLR  549



>ref|XP_011077256.1| PREDICTED: vacuolar amino acid transporter 1-like [Sesamum indicum]
 ref|XP_011077257.1| PREDICTED: vacuolar amino acid transporter 1-like [Sesamum indicum]
Length=545

 Score =   255 bits (651),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 145/399 (36%), Positives = 234/399 (59%), Gaps = 4/399 (1%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E    + SS+  AV+N + +L G+G LSTPYA+++GGW+   +L+    +  +T  LL  
Sbjct  149   ELPVSHQSSYGQAVLNGVNVLCGVGILSTPYAVKEGGWVGLSILLIFAALSFYTGILLRY  208

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL   P  + Y DIGQ AFGT GR+  +  +Y+E++   V Y I   DNL+++F   H+ 
Sbjct  209   CLDSQPGLETYPDIGQAAFGTAGRVFISIILYVELYACCVEYIILETDNLSSLFPNAHIN  268

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             +    L++  L  +M  LV LP++W RDLS +S+LS+ G++ S+L+   +  T +   V 
Sbjct  269   IGEFDLNSHHLFALMTTLVILPTVWLRDLSVLSYLSAGGVVASILVVACLFWTGLVDHVG  328

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
              + +   L+L  +P   GLY F Y+GH VFPNIY++MK PS++  V + SF + T+LY  
Sbjct  329   VHTKGTALNLSTLPVAIGLYGFCYSGHAVFPNIYSSMKMPSQYPSVLLTSFGICTVLYAG  388

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
              A +G  MFG    SQ TL++P+ +V +K+A+W TV+ P TKYAL  +P A+ L+  +P 
Sbjct  389   AAALGYTMFGETTQSQFTLNLPKDLVASKIAVWTTVVNPFTKYALTMSPVAMSLEELIP-  447

Query  1122  SMKHHIKTIIRG-GTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKI  1298
                 H K+ I      + L++  L + L +P+F  V++L GSL+++ ++++LPC  Y  I
Sbjct  448   --SRHAKSFIYSILIRTALVISTLLVGLTIPFFGLVMALIGSLLTMLVTLILPCACYLSI  505

Query  1299  FWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
                KI+       +++I  G + +  GT S+   +V  L
Sbjct  506   LRGKINLFQTGLCILVIGVGVVSSGLGTYSALSQIVNQL  544



>ref|XP_008456512.1| PREDICTED: vacuolar amino acid transporter 1-like [Cucumis melo]
Length=554

 Score =   255 bits (651),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 139/397 (35%), Positives = 237/397 (60%), Gaps = 6/397 (2%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
               +S+F  AV+N I +L G+G LSTPYA+++GGW+   +L+   V+  +T  LL  CL  
Sbjct  161   SRHSTFGQAVVNGINVLCGVGILSTPYAMKEGGWLGLSILMIFAVLSFYTGILLRACLDS  220

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGI  593
              P  + Y DIGQ AFG  GR++ +  +Y+E++ + + Y I   DNL+++F   H+   G+
Sbjct  221   RPGLETYPDIGQAAFGAMGRVIISIVLYVELYASCIEYVILESDNLSSLFPRAHISFGGL  280

Query  594   QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHR  773
             +++   L  +   L  LP+++ RDLS +S++S+ G++ S+++ + +    +   V  +  
Sbjct  281   EINAHLLFAIATALAVLPTVYLRDLSILSYISAGGVVASIVVVLCLFWVGLVDDVGFHGN  340

Query  774   IPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFM  953
             + PL+L ++P   GLY F Y+GH VFPNIY++M   S+F  V +  F + T+LY  +A M
Sbjct  341   VTPLNLSSLPVALGLYGFCYSGHAVFPNIYSSMGKQSQFPAVLLTCFGICTLLYAGVAVM  400

Query  954   GAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS--M  1127
             G  MFG    SQ TL++P+ +V +K+A+W TV+ P TKYAL  +P A+ L+  +PP+   
Sbjct  401   GYLMFGESTLSQYTLNLPQDLVASKIAVWTTVVNPFTKYALTISPVAMSLEEFIPPNHPK  460

Query  1128  KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
              H    +IR G    L++  L + L VP+F  ++SL GSL+++ ++++LPC  Y  I   
Sbjct  461   SHFYSILIRTG----LVISTLLVGLSVPFFGLMMSLIGSLLTMLVALILPCVCYLSILRG  516

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             K++    +   ++I  G + +  G+ S+ K ++  L 
Sbjct  517   KVTFLQRVLCCIVIAVGVVASAIGSFSAIKKIIEELS  553



>ref|XP_004305195.1| PREDICTED: vacuolar amino acid transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=661

 Score =   257 bits (657),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/388 (36%), Positives = 229/388 (59%), Gaps = 4/388 (1%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             ++++ SF  AV+N I +L G+G L+TPYA+++GGW+S  +L    VIC +T  LL +CL 
Sbjct  157   KEHSCSFSQAVLNGINLLCGMGLLTTPYAIKEGGWLSLIVLALFSVICCYTGILLMRCLE  216

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG  590
               P  + Y DIGQ AFG  GR+  +  +YLE++ A V +   + DN+A +F   H+   G
Sbjct  217   SYPGLRTYPDIGQAAFGYTGRLFLSIILYLELYGACVEFLTLMGDNIAALFPNAHMAFAG  276

Query  591   IQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNH  770
             I L + ++  + A LV LP++W R+LS +S+LS  G+  ++ + + +        V  +H
Sbjct  277   IHLDSHEIFVITATLVVLPTVWLRNLSLLSYLSVGGVATTIFVAILMVWVGAVNQVGFHH  336

Query  771   RIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAF  950
             R   L+L  +P   G+Y F YAGH VFPNIYT+M++PS+F    + S +    +YT +A 
Sbjct  337   RGSALNLSGLPVTVGIYGFCYAGHSVFPNIYTSMRNPSQFPAALMASMAFCLFMYTTVAI  396

Query  951   MGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-M  1127
              G  MFG  + SQ TL+MP   V +K+A+W TVL  MTK+A+   P A+ ++   P + M
Sbjct  397   CGYLMFGDSIKSQFTLNMPEEFVASKIAIWTTVLNTMTKFAITITPVALSVEELFPKALM  456

Query  1128  KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
               H   I+   T ++L+   L +AL  P+F  V++L GSL+++ ++I+ PC     +   
Sbjct  457   GSHFACIL---TRTVLVASTLVVALSFPFFGSVMALMGSLLAMLVAIIFPCICNLILHKG  513

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             +++   +   +++I+ G   ++ GT SS
Sbjct  514   RLTNWQITSCILIIMVGVTCSIIGTYSS  541



>ref|XP_004136638.1| PREDICTED: vacuolar amino acid transporter 1-like [Cucumis sativus]
Length=539

 Score =   254 bits (649),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 150/428 (35%), Positives = 233/428 (54%), Gaps = 19/428 (4%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLES--SEECVEQAEKNNS-------SFMHAVINMIGMLIGLGQL  302
             +P   ++ ED   +  L+S  SE      +           SF   + N I +L G+G L
Sbjct  111   DPGGDDQNEDFYNISRLQSLRSERTTISKQMTGELPIGRGCSFTQTIFNGINVLAGVGLL  170

Query  303   STPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILA  482
             STP+ +++ GW S  +L+   ++C +T  L+  C  K      Y DIG+ A+G  GR+  
Sbjct  171   STPFTVKEAGWASLGVLVLFAIVCCYTATLMRYCFEKREGVITYPDIGEAAYGKFGRLFV  230

Query  483   ASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFR  662
             +  +YLE++   V + I   DNL ++F G  L L  IQL +  L  ++  L+ LP++W R
Sbjct  231   SIILYLELYCYCVEFIILEGDNLTSLFPGASLSLGSIQLDSMHLFGILTALIVLPTVWLR  290

Query  663   DLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGH  842
             DL  IS+LS+ G++ ++LI + +     FG V  +     ++   +P   G+Y F Y+GH
Sbjct  291   DLRVISYLSAGGVIATILIGLCLIFLGTFGGVGFHQTGEVVNWKGVPFAIGVYGFCYSGH  350

Query  843   IVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVF  1022
              VFPNIY +M D +KFTK  IV F +  ++Y  +A MG  MFG    SQITL+MP+H V 
Sbjct  351   TVFPNIYQSMADKTKFTKALIVCFILCVLIYGGVAIMGFLMFGQNTLSQITLNMPKHAVT  410

Query  1023  TKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalal  1202
             +KVA W TV+ P TKYAL   P A  ++  LPP +       I      +L   ++A ++
Sbjct  411   SKVAGWTTVINPFTKYALLMNPLARSIEELLPPRISASYGCFI------LLRTALVASSV  464

Query  1203  CV----PYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLA  1370
             CV    P+F  V+SL GSL+SI +S+++P   Y KI     ++  +  ++V++  G + A
Sbjct  465   CVAFILPFFGLVMSLIGSLLSILVSVIVPTMCYLKIMGSDATKIQITSSIVVVGLGIVSA  524

Query  1371  VSGTVSSF  1394
             + GT SS 
Sbjct  525   IMGTYSSL  532



>ref|NP_001147785.1| amino acid permease [Zea mays]
 gb|ACG28709.1| amino acid permease [Zea mays]
Length=569

 Score =   255 bits (651),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 150/430 (35%), Positives = 238/430 (55%), Gaps = 10/430 (2%)
 Frame = +3

Query  141   KHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYAL  320
              H  P S +    Q   +D        E       S+   V+N + +L G+G LSTPYA+
Sbjct  146   SHYLPPSRKASSLQRIPEDQRPMVGGHEVGPHRQCSYSQGVMNGVNVLCGVGILSTPYAV  205

Query  321   EKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYL  500
             ++GGW+   +L  LG +  +T  LL +CL      + Y DIG  AFGT GRI+ +  +Y+
Sbjct  206   KQGGWLGLVILAVLGALAWYTGILLRRCLDSKDGLETYPDIGHAAFGTAGRIIISIILYM  265

Query  501   EIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSIS  680
             E++   + Y I   DNL+ +F   HL +  + L +  L  ++  LV +P+ W RDLS +S
Sbjct  266   ELYACCIEYLILESDNLSKLFPNAHLTMGNLTLDSHMLFAILTALVVMPTTWLRDLSCLS  325

Query  681   FLSSAGILMSLLIFVTVACTAVFGVVNPNHRIP----PLHLPNIPSVSGLYAFSYAGHIV  848
             F+S+ G++ S++I   V+C    G+V+    +      L+LP IP   GLY + Y+GH V
Sbjct  326   FISAGGVIASIVI---VSCLFWVGLVDHVGTVESEGTALNLPGIPIAIGLYGYCYSGHGV  382

Query  849   FPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTK  1028
             FPNIY+++K  ++F  V     ++ T+L+ A A MG  MFG    SQ TL++P ++V +K
Sbjct  383   FPNIYSSLKKSNQFPAVLFTCIALSTVLFAAAAIMGYIMFGESTESQFTLNLPPNLVASK  442

Query  1029  VALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCV  1208
             +A+W TV  P+TKYAL   P A+ L+  LPP+ + +   +I     S L++  L +AL V
Sbjct  443   IAVWTTVTNPITKYALTMTPLALSLEELLPPNKQTYPNIMI---LRSALVVSSLIIALSV  499

Query  1209  PYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVS  1388
             P+F  V+SL GS +++ ++ +LPC  +  I   K++   ++  V +IV G      GT S
Sbjct  500   PFFGLVMSLVGSFLTMFVAYILPCACFLSILRSKVTWYQVVLCVFIIVVGLCCVGVGTYS  559

Query  1389  SFKLLVISLQ  1418
             S   ++   Q
Sbjct  560   SLSKIIQKYQ  569



>ref|XP_007026971.1| Transmembrane amino acid transporter family protein, putative 
[Theobroma cacao]
 gb|EOY07473.1| Transmembrane amino acid transporter family protein, putative 
[Theobroma cacao]
Length=535

 Score =   254 bits (649),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 151/429 (35%), Positives = 239/429 (56%), Gaps = 14/429 (3%)
 Frame = +3

Query  132   DGHKHVEPASGER-FEDQTAVKDLESSEECVEQAE----KNNSSFMHAVINMIGMLIGLG  296
             D   H +P   ER F+++     L +S++ +   E    +   SF  ++IN I +L G+G
Sbjct  103   DESSHKKPLISERSFDEEVPTSTLLASQQRIFANESTPSQRQCSFTQSLINGINVLCGIG  162

Query  297   QLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRI  476
              L+TPYA+++GGW+S  LLI  G+I  +T  LL +CL   P  + Y DIGQ AFG  GR+
Sbjct  163   LLTTPYAVKEGGWLSLSLLIIFGIIACYTGILLKRCLESSPGLQTYPDIGQAAFGVAGRL  222

Query  477   LAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLW  656
             + +  +Y E++ A V Y I + DNL+T+F    +   GI L + Q+ +++  L  LP++W
Sbjct  223   MISVILYAELYAACVEYVIMMSDNLSTIFPNASIDFAGIYLDSHQVFSIVGALTVLPTVW  282

Query  657   FRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYA  836
              RDLS +S+LS  G+  S+L+ + +        V  +     L+L N+P   G+Y+F YA
Sbjct  283   LRDLSLLSYLSVGGVGASILVVLCLLWVGAVDQVGFHGSGTALNLANLPISVGIYSFCYA  342

Query  837   GHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHV  1016
             GH V PNIY++MK+PS F  V + SF       T  A  G  +FG    SQ TL+MP   
Sbjct  343   GHSVLPNIYSSMKEPSLFPLVLVASFIFCWFACTGAAISGFLIFGDSAESQFTLNMPIKF  402

Query  1017  VFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSM----KHHIKTIIRGGTGSilili  1184
               +K+A W  V+  ++KYAL   P A+ ++  L PSM     + +  IIR    + L++ 
Sbjct  403   TASKIAAWTVVIITVSKYALTLTPIALSVEE-LVPSMTQFRSYGVSIIIR----TALVIS  457

Query  1185  ilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTL  1364
              L +A+ VP+F  V++L GSL+++ + I+ PC  Y  I    +++      + + V G +
Sbjct  458   TLVVAMTVPFFAFVMALAGSLLAMLLCIIFPCACYLSILRASLTKLQKAVCIGIAVLGLV  517

Query  1365  LAVSGTVSS  1391
             +A  GT S+
Sbjct  518   IACFGTYSA  526



>ref|XP_006289906.1| hypothetical protein CARUB_v10003527mg [Capsella rubella]
 gb|EOA22804.1| hypothetical protein CARUB_v10003527mg [Capsella rubella]
Length=526

 Score =   254 bits (648),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/363 (37%), Positives = 214/363 (59%), Gaps = 0/363 (0%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E    +F  +V+N I +L G+  L+ PYA+++GGW+  F+L   G+I  +T  LL +CL 
Sbjct  131   ETGTCTFSQSVLNGINVLCGVALLTMPYAVKEGGWLGLFILFSFGIITFYTGILLKRCLE  190

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTG  590
               P    Y DIGQ AFGT GRIL +  +Y+E++ + V Y I + DNL+ +F  T + +TG
Sbjct  191   NSPGIHTYPDIGQAAFGTTGRILVSILLYVELYASCVEYIIMMSDNLSGMFPNTSIYITG  250

Query  591   IQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNH  770
             + L + Q+  +   L+ LP++W +DLS +S+LS+ G+  S+L+ + +        V  + 
Sbjct  251   LSLDSHQIFAITTTLIVLPTVWLKDLSLLSYLSAGGVFSSILLALCLFWAGSVDGVGFHL  310

Query  771   RIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAF  950
                 L L N+P   G+Y F +  H VFPNIY++MK+PSKF  V ++SF+  T+ Y A+A 
Sbjct  311   TGKALDLTNMPVAIGIYGFGFGSHSVFPNIYSSMKEPSKFPMVLLISFAFCTLFYIAVAV  370

Query  951   MGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMK  1130
              G  MFG  + SQ TL+MP+    +K+A+W  V+TPMTKYAL   P  + L+  +P S +
Sbjct  371   CGYTMFGDAIQSQFTLNMPQQFTSSKIAVWTAVVTPMTKYALTITPVMLSLEELIPSSSR  430

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
                         +IL+L  L +AL VP+F  V +L GS +++ I+++ PC  Y  I   +
Sbjct  431   KMRSKGFSMLFRTILVLSTLVVALTVPFFATVAALIGSFIAMLIALIFPCLCYLSIMKDR  490

Query  1311  ISR  1319
             ++ 
Sbjct  491   LTN  493



>ref|XP_002453115.1| hypothetical protein SORBIDRAFT_04g000290 [Sorghum bicolor]
 gb|EES06091.1| hypothetical protein SORBIDRAFT_04g000290 [Sorghum bicolor]
Length=576

 Score =   255 bits (651),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/437 (33%), Positives = 242/437 (55%), Gaps = 14/437 (3%)
 Frame = +3

Query  129   PDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEK-----------NNSSFMHAVINMI  275
             P     ++    ER   Q  +   + S + + + +K           +  S+  AV+N I
Sbjct  139   PTTSDDLQQQHEERKSSQYLLPSRKPSLQQIPEDQKPVPVAHEVSPYHKCSYTQAVVNGI  198

Query  276   GMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQA  455
              +L G+G LSTPYA+++GGW+   +L    ++  +T  LL +CL      + Y DIG  A
Sbjct  199   NVLCGVGILSTPYAIKQGGWLGLVILCLFAILAWYTGVLLRRCLDSKEGLETYPDIGHAA  258

Query  456   FGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVL  635
             FGT GRI  +  +Y+E++   + Y I   DNL+ +F   HL +  + +++  L  ++  +
Sbjct  259   FGTTGRIAISIILYVELYACCIEYLILEGDNLSKLFPNAHLTIGSLTVNSHVLFAILTTI  318

Query  636   VALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSG  815
             + +P+ W RDLS +S+LS+ G++ S+L  + +    V   V+  ++   L+LP IP   G
Sbjct  319   IVMPTTWLRDLSCLSYLSAGGVIASILGVICLFWVGVVDNVDFENKGTALNLPGIPIAIG  378

Query  816   LYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQIT  995
             LY + Y+GH VFPNIY+++K+ ++F  +      + TIL+   A MG KMFG    SQ T
Sbjct  379   LYGYCYSGHGVFPNIYSSLKNRNQFPSILFTCIGLSTILFAGAAVMGYKMFGEATQSQFT  438

Query  996   LSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSil  1175
             L++P ++V +K+A+W TV  P+TKYAL   P A+ L+  LPP+ + +   ++     S L
Sbjct  439   LNLPENLVVSKIAVWTTVANPITKYALTITPLAMSLEELLPPNQQKYSNIVM---LRSAL  495

Query  1176  iliilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVF  1355
             ++  L +AL VP+F  V++L GSL+++ ++ +LPC  +  I   K+S   +     +I+ 
Sbjct  496   VVSTLLIALSVPFFGLVMALVGSLLTMLVTYILPCACFLAILRRKVSWHQVAACSFIIMV  555

Query  1356  GTLLAVSGTVSSFKLLV  1406
             G   A  GT SS   ++
Sbjct  556   GVCCACVGTYSSLSKII  572



>ref|XP_006846281.1| hypothetical protein AMTR_s00012p00249520 [Amborella trichopoda]
 gb|ERN07956.1| hypothetical protein AMTR_s00012p00249520 [Amborella trichopoda]
Length=573

 Score =   254 bits (650),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 232/399 (58%), Gaps = 17/399 (4%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
                 S+  AVIN I +L G+G LSTPYA+++GGW+   +L+   +I  +T  LL +CL  
Sbjct  145   SQQCSYSQAVINGINVLCGVGVLSTPYAVKEGGWLGLLVLLSFALISCYTGVLLKRCLES  204

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGI  593
              P    Y DIGQ AFG  GR+  +  +Y E++   V Y I   DNL ++F   HL L G 
Sbjct  205   KPGLHTYPDIGQAAFGKVGRLGISIILYAELYACCVEYVILESDNLNSLFPNAHLNLAGY  264

Query  594   QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHR  773
             QLS+ QL  ++  L  LP++W RDLS +S++S+ G++ SLL+ + +    V   V  +H 
Sbjct  265   QLSSHQLFAIITTLAVLPTVWLRDLSVLSYISAGGVIASLLVVICLIWVGVVDGVGFHHG  324

Query  774   IPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFM  953
                L+L  +P   GLY F Y+GH V+PNIY++MK+PS+F  V + S    TILY  +A M
Sbjct  325   GTSLNLSGLPVAIGLYGFCYSGHAVYPNIYSSMKNPSQFPAVLLTSSVACTILYAGVAIM  384

Query  954   GAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-MK  1130
             G  MFG  ++SQ TL+MP+    +KV +W TV+ P TKYAL   P A+ L+  LP S +K
Sbjct  385   GYMMFGESINSQFTLNMPQQFFASKVGVWTTVVNPFTKYALTITPVALSLEELLPASHLK  444

Query  1131  HHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
             +H  +I IR G    L+L  L +AL VP+F  V++  GS++++ ++++LPC  Y  I   
Sbjct  445   YHFFSIVIRTG----LVLSTLIVALAVPFFGFVMAFIGSVLTMLVALILPCACYLSILGS  500

Query  1308  KIS-----------RPLLIFNVVLIVFGTLLAVSGTVSS  1391
              ++            P     +++IV G + A  G+ S+
Sbjct  501   NVTLLQSAEFCSCFLPQRFICMLVIVVGVVCACIGSYSA  539



>gb|EPS65238.1| amino acid transporter, partial [Genlisea aurea]
Length=467

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/389 (37%), Positives = 227/389 (58%), Gaps = 6/389 (2%)
 Frame = +3

Query  237   NNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKD  416
                S+  +++N + +L G+G LSTPYAL++GGW+S  LL  LGVI  +T  LL +CL   
Sbjct  83    QRCSYAQSILNAVNVLCGIGILSTPYALKEGGWLSLILLFVLGVITCYTGILLKRCLESS  142

Query  417   PKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQ  596
              + + Y DIG  AFGTKGRI  A+ +Y+E++ + V Y I + D L+      H+ + GI 
Sbjct  143   SQLQTYPDIGSAAFGTKGRICIAAILYVELYSSCVEYLIMMTDALSAYIPTAHVDVAGIH  202

Query  597   LSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRI  776
             L++ Q+  V + L+ LP++W R+LS +S++S  G++   LI + +    V   +  +   
Sbjct  203   LNSYQICAVTSTLIILPTVWLRNLSLLSYISVGGVVTLALIVICLIWVGVVSEIGFHPSG  262

Query  777   PPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMG  956
               L+L  +P   G+Y+F Y  H VFPNIY++M++PS+F  V I+SF +  +LY  +A   
Sbjct  263   NALNLTKVPIAIGIYSFCYGSHSVFPNIYSSMEEPSQFPSVLIISFLISGLLYGGVAVCA  322

Query  957   AKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS--MK  1130
               MFG   +SQ TL+MP + V + VA W+ VL P+TK+ L   P A+ ++   P +    
Sbjct  323   FLMFGEATNSQFTLNMPSNSVASNVAGWSVVLAPLTKFGLSMTPVALAIEELFPATHVQS  382

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
             H +  +IR    ++L    LA+AL  PYF  +++L GS + + + I+LPC  Y  I   K
Sbjct  383   HTLPILIR----TLLTFSTLAVALAFPYFGSMMALIGSFLEMVVCIILPCACYLMIQDGK  438

Query  1311  ISRPLLIFNVVLIVFGTLLAVSGTVSSFK  1397
             +S+  +     +I+ G L A+SGT S+  
Sbjct  439   LSKVEIGSCCTMIMVGVLCAISGTYSAIS  467



>ref|XP_009782945.1| PREDICTED: vacuolar amino acid transporter 1-like [Nicotiana 
sylvestris]
 ref|XP_009782946.1| PREDICTED: vacuolar amino acid transporter 1-like [Nicotiana 
sylvestris]
Length=554

 Score =   254 bits (649),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 147/402 (37%), Positives = 229/402 (57%), Gaps = 17/402 (4%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLESSEECVEQ--AEKN---------NSSFMHAVINMIGMLIGLG  296
             E A  ER    T +  L S    +++   EK+          SS+   V+N I +L G+G
Sbjct  124   EQAPHERRSSHTLLPPLPSRRSAIKKFPDEKSVAHEFPVSRQSSYGQGVLNGINVLCGVG  183

Query  297   QLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRI  476
              LSTPYA+++GGW    +L   GV+  +T  LL  CL   P  + Y DIGQ AFGT GRI
Sbjct  184   ILSTPYAVKEGGWAGLSILFIFGVLSYYTGILLRYCLDSQPGLETYPDIGQAAFGTVGRI  243

Query  477   LAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLW  656
             + +  +Y+E++   V Y I   DNL+ +F   HL L G QL    L  ++  L  LP++W
Sbjct  244   IISIILYVELYSCCVEYIILEGDNLSALFPNAHLNLGGFQLDARHLFALITTLAVLPTVW  303

Query  657   FRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYA  836
              RDL+ +S++S+ G++ S+++ + +    +   V        L++ ++P   GLY + Y+
Sbjct  304   LRDLTVLSYISAGGVIASVMVVICLYWLGLVDHVGSQSEHTVLNVSSLPVAIGLYGYCYS  363

Query  837   GHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHV  1016
             GH VFPNIYT+++  S+F  V + SF +VT+LY   A MG  MFG    SQ TL++P ++
Sbjct  364   GHAVFPNIYTSLEKRSQFPAVLLTSFGIVTVLYAGAAVMGYMMFGDSAESQFTLNLPTNL  423

Query  1017  VFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS--MKHHIKTIIRGGTGSililiil  1190
             V +K+A W T++ P TKYAL  AP A+ L+  +P +    H    +IR    + L++  L
Sbjct  424   VASKIAFWTTIVNPFTKYALTMAPVAMSLEELIPSNHAKSHMYGVLIR----TALVISTL  479

Query  1191  alalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKIS  1316
              +AL VP+F  V++L GSL ++ ++++LPC  + +I   K S
Sbjct  480   LVALKVPFFGFVMALIGSLFTMLVTLILPCACFLRILKGKTS  521



>ref|XP_008813473.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Phoenix dactylifera]
Length=632

 Score =   256 bits (654),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 151/424 (36%), Positives = 237/424 (56%), Gaps = 34/424 (8%)
 Frame = +3

Query  237   NNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKD  416
                S+  AV+N I +L G+G LSTPYA+++GGW+   +L+  GV+  +T  LL  CL  +
Sbjct  211   RQCSYGQAVLNGINVLCGVGILSTPYAMKEGGWMGLSILLIFGVLAWYTGILLRYCLDSE  270

Query  417   PKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQ  596
             P  + + DIGQ AFGT GR   +  +YLE++   V Y I   DNL+++F   HL + G+ 
Sbjct  271   PGLETFPDIGQAAFGTTGRFAVSIILYLELYACCVEYIILESDNLSSLFPNAHLNIGGLH  330

Query  597   LSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRI  776
             LS+  L  +MA LV LP+ W RDLS +S++S+ G++ SLL+  ++    +   V   H  
Sbjct  331   LSSHPLFAIMATLVVLPTTWLRDLSLLSYISAGGVIASLLVVFSLFWVGLVDQVGFRHGG  390

Query  777   PPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMG  956
               L+L  IP   GLY + Y+GH VFPNIY+++K P+++  V   SF++ T+++  +A MG
Sbjct  391   TSLNLSGIPIAVGLYGYCYSGHAVFPNIYSSLKKPNQYPSVLFTSFAICTVMFAGVAVMG  450

Query  957   AKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKY----------------------  1070
               MFG    SQ TL+MP ++V +KVA+W TV+ P+TKY                      
Sbjct  451   YIMFGDSTLSQFTLNMPHNLVVSKVAVWTTVVNPLTKYPLFDCFICPSWGEDCQSNLQYY  510

Query  1071  --------ALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPYFEH  1223
                     AL   P A+ L+  +P + +K H+  II     + L+   L +AL VP+F  
Sbjct  511   TPILMITYALTLTPMALSLEELIPANHLKSHMYAII---IRTALVFSTLFVALSVPFFGL  567

Query  1224  VLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
             V+SL GS+++  ++++LPC  +  I   K++   +   + +I  G L    GT S+   +
Sbjct  568   VMSLIGSMLTTLVTMILPCACFLGILRGKVTWTQVSLCIFIITVGVLSCTFGTFSALSKI  627

Query  1404  VISL  1415
             + SL
Sbjct  628   IQSL  631



>ref|XP_004250060.1| PREDICTED: vacuolar amino acid transporter 1 [Solanum lycopersicum]
Length=555

 Score =   254 bits (648),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/385 (37%), Positives = 224/385 (58%), Gaps = 12/385 (3%)
 Frame = +3

Query  165   ERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISA  344
             ++F D+ +V          E      SS+   V+N I +L G+G LSTPYA+++GGW   
Sbjct  149   KKFPDEKSVAH--------ELPVSRQSSYGQGVLNGINVLCGVGILSTPYAVKEGGWAGL  200

Query  345   FLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVS  524
              +L   GV+  +T  LL  CL   P  + Y DIGQ AFGT GRI+ +  +Y+E++   V 
Sbjct  201   SILFIFGVLSYYTGILLRYCLDSQPGLETYPDIGQAAFGTVGRIIISIILYVELYSCCVE  260

Query  525   YTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGIL  704
             Y I   DNL+ +F   HL L G QL    L  ++  L  LP++W RDL+ +S++S+ G++
Sbjct  261   YIILEGDNLSALFPNAHLNLGGCQLDARHLFALITSLAVLPTVWLRDLTVLSYISAGGVI  320

Query  705   MSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPS  884
              S+++ + +    +   V        L+L ++P   GLY + Y+GH VFPNIYT+++  S
Sbjct  321   ASVMVVICLYWLGLVDHVGTQSTETVLNLSSLPVAIGLYGYCYSGHAVFPNIYTSLEKRS  380

Query  885   KFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMT  1064
             +F  V   SF++VT+LY   A MG  MFG    SQ TL++P  +V +K+A W T++ P T
Sbjct  381   QFPAVLFTSFAIVTVLYAGAAVMGYMMFGDSAQSQFTLNLPTDLVASKIAFWTTIVNPFT  440

Query  1065  KYALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTG  1241
             KYAL  AP A+ L+  +P +  K H+ +I+     + L++  L +AL +P+F  V++L G
Sbjct  441   KYALTMAPVAMSLEELIPSNHTKSHMYSIL---IRTALVMSTLFVALKIPFFAFVMALIG  497

Query  1242  SLVSIGISIVLPCGFYTKIFWPKIS  1316
             S  ++ ++++LPC  + +I   KIS
Sbjct  498   SFFTMLVTLILPCACFLRILKGKIS  522



>gb|EMT05140.1| hypothetical protein F775_07363 [Aegilops tauschii]
Length=440

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 149/430 (35%), Positives = 247/430 (57%), Gaps = 12/430 (3%)
 Frame = +3

Query  129   PDGHKHVEPASG--ERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQL  302
             PD  K +  A G  +  +D  A  D E+  +C    E   ++ +    N +  L G+G L
Sbjct  16    PDFEKPLLHAHGGLQAGKDPAAAHDHEA--QC--SPEAGGATSLRTCFNGLNALSGVGLL  71

Query  303   STPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILA  482
             S PYAL +GGW+S  LL+ + ++C +T  LL  C+G  P  + Y DIG  AFG KGR   
Sbjct  72    SIPYALAEGGWLSLVLLLLVAIVCCYTGQLLRTCMGASPDVRGYPDIGALAFGAKGRFAV  131

Query  483   ASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQ-LSTSQLLTVMAVLVALPSLWF  659
             ++F+Y E+++  + + I   DNL  +F GT L L G+  LS   L  V+  +  LP+ W 
Sbjct  132   SAFMYAELYLVAIGFLILEGDNLDKLFPGTSLSLGGVLVLSGKHLFIVLVSIFILPTTWL  191

Query  660   RDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAG  839
             R+L  ++++S++G+L S+++   V   AV   V    +   L++  +P+  GLY F Y G
Sbjct  192   RNLGVLAYVSASGVLASVVLVFCVLWAAVVDGVGFQGKGTMLNVSGLPTALGLYTFCYCG  251

Query  840   HIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVV  1019
             H +FP +  +MK+  KF+KV ++ F   T+ Y ++A +G  M+G  V SQ+TL++P   +
Sbjct  252   HAIFPTLCNSMKEKDKFSKVLVICFVACTLNYGSMAILGYLMYGDDVESQVTLNLPEGKL  311

Query  1020  FTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilala  1199
              +K+A++  ++ P +KYAL   P A  ++  L    K  +  +IR    + +++  + +A
Sbjct  312   SSKLAIYTALINPFSKYALMVTPVATAVEEKLLAGNKRSLNMLIR----TFIVISTVIVA  367

Query  1200  lCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFW-PKISRPLLIFNVVLIVFGTLLAVS  1376
             L VP+F H+++L GSL+S+  S++LPC  Y KIF   + SR  +   V++IV G+L+A S
Sbjct  368   LTVPFFGHLMALVGSLLSVMASMLLPCICYLKIFGTARCSRAEVALIVMIIVLGSLVAAS  427

Query  1377  GTVSSFKLLV  1406
             GT SS + ++
Sbjct  428   GTYSSLQKII  437



>gb|ACN34366.1| unknown [Zea mays]
 tpg|DAA38552.1| TPA: amino acid permease [Zea mays]
Length=570

 Score =   254 bits (649),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 149/429 (35%), Positives = 238/429 (55%), Gaps = 10/429 (2%)
 Frame = +3

Query  144   HVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALE  323
             H  P S +    Q   +D        E       S+   V+N + +L G+G LSTPYA++
Sbjct  148   HYLPPSRKASSLQRIPEDQRPMVGGHEVGPYRQCSYTQGVMNGVNVLCGVGILSTPYAVK  207

Query  324   KGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLE  503
             +GGW+   +L  LG +  +T  LL +CL      + Y DIG  AFGT GRI+ +  +Y+E
Sbjct  208   QGGWLGLVILAVLGALAWYTGILLRRCLDSKDGLETYPDIGHAAFGTAGRIIISIILYME  267

Query  504   IFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISF  683
             ++   + Y I   DNL+ +F   HL +  + L +  L  ++  LV +P+ W RDLS +SF
Sbjct  268   LYACCIEYLILESDNLSKLFPNAHLTMGNLTLDSHMLFAILTALVVMPTTWLRDLSCLSF  327

Query  684   LSSAGILMSLLIFVTVACTAVFGVVNPNHRIP----PLHLPNIPSVSGLYAFSYAGHIVF  851
             +S+ G++ S++I   V+C    G+V+    +      L+LP IP   GLY + Y+GH VF
Sbjct  328   ISAGGVIASIVI---VSCLFWVGLVDHVGTVESEGTALNLPGIPIAIGLYGYCYSGHGVF  384

Query  852   PNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKV  1031
             PNIY+++K  ++F  V     ++ T+L+ A A MG  MFG    SQ TL++P ++V +K+
Sbjct  385   PNIYSSLKKSNQFPAVLFTCIALSTVLFAAAAIMGYIMFGESTESQFTLNLPPNLVASKI  444

Query  1032  ALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVP  1211
             A+W TV  P+TKYAL   P A+ L+  LPP+ + +   ++     S L++  L +AL VP
Sbjct  445   AVWTTVTNPITKYALTMTPLALSLEELLPPNKQTYPNIMM---LRSALVVSSLIIALSVP  501

Query  1212  YFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             +F  V+SL GS +++ ++ +LPC  +  I   K++   ++  V +IV G      GT SS
Sbjct  502   FFGLVMSLVGSFLTMFVAYILPCACFLSILRSKVTWYQVVLCVFIIVVGLCCVGVGTYSS  561

Query  1392  FKLLVISLQ  1418
                ++   Q
Sbjct  562   LSKIIQKYQ  570



>ref|XP_009141972.1| PREDICTED: vacuolar amino acid transporter 1-like [Brassica rapa]
Length=534

 Score =   253 bits (646),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 141/382 (37%), Positives = 213/382 (56%), Gaps = 2/382 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   + N I ++ G+G LSTP+ +++ GW S  +L+   VIC +T  L+  C       
Sbjct  147   SFTQTIFNAINVMAGVGLLSTPFTVKEAGWASMVILLLFAVICCYTATLMKDCFEAKTGI  206

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT +   GI++ +
Sbjct  207   ITYPDIGEAAFGKYGRILICVILYTELYSYCVEFIILEGDNLTGLFPGTSIDWLGIRIDS  266

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  +   LV LP++W +DL  IS+LS+ G++ ++LI V+       G +  NH  P +
Sbjct  267   KHLFGIFTALVVLPTVWLKDLRIISYLSAGGVIATVLIAVSTFFLGTTGGIGFNHTGPAV  326

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 IP   G+Y F Y+GH VFPNIY +M D +KF K  I +F +  +LY  +A MG  M
Sbjct  327   KWNGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITTFILCVLLYGGVAIMGYCM  386

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+ + F+KVA W TV++P TKYAL   P A  ++  LP  +  +I  
Sbjct  387   FGEATLSQITLNMPKGLFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPERISENIWC  446

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  V++L GS +SI ++IV+P   + +I   K +R  
Sbjct  447   FLLLRTA--LVASSVCSAFLIPFFGLVMALIGSFLSILVAIVMPALCFIRIMGNKATRTQ  504

Query  1326  LIFNVVLIVFGTLLAVSGTVSS  1391
             +I +  ++V G +    GT SS
Sbjct  505   MILSSTIVVIGLVSGALGTYSS  526



>ref|XP_003581074.2| PREDICTED: vacuolar amino acid transporter 1-like [Brachypodium 
distachyon]
Length=568

 Score =   254 bits (648),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 156/452 (35%), Positives = 243/452 (54%), Gaps = 28/452 (6%)
 Frame = +3

Query  129   PDGHKHVEPASGERFEDQTAV---KDLESSEECVEQAEKNN---------------SSFM  254
             PD H + E   G R      +   +   S  +  E  +K N                S+ 
Sbjct  123   PDDHYNDEEEGGVRKSSHQHLPPPRKASSLFKIPEDQQKKNPLPGGAGHEVGPYRQCSYT  182

Query  255   HAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDY  434
               V+N + +L G+G LSTPYA+ +GGW+   +L  L V+  +T  LL +CL      + Y
Sbjct  183   QGVLNGVNVLCGVGILSTPYAVRQGGWLGLVILAVLAVLAWYTGVLLRRCLDSKEGLETY  242

Query  435   KDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQL  614
              DIG  AFGT GRI+ +  +Y+E++   V Y I   DNL+ +F   HL + G  L +  L
Sbjct  243   PDIGHAAFGTPGRIIISIILYMELYACCVEYLILESDNLSKLFPNAHLTIGGFTLDSHVL  302

Query  615   LTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN----PNHRIPP  782
               ++  L+ +P+ W RDLS +SF+S+ G++ S++I   V+C    G+V+           
Sbjct  303   FAILTALIVMPTTWLRDLSCLSFISAGGVIASIVI---VSCLFWAGLVDHVGIDKSEGTA  359

Query  783   LHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAK  962
             L+LP IP   GLY + Y+GH VFPNIY+++K  ++F  V     ++ TIL+   A MG  
Sbjct  360   LNLPGIPIAIGLYGYCYSGHGVFPNIYSSLKKSNQFNAVVFTCITLSTILFAGAAIMGYI  419

Query  963   MFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIK  1142
             MFG    SQ TL++P ++V +K+A+W TV  P+TKYAL   P A+ L+  LP + + ++ 
Sbjct  420   MFGESAESQFTLNLPPNLVSSKIAVWTTVTNPITKYALTMTPLALSLEELLPSNRQTYLN  479

Query  1143  TIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRP  1322
              I+     S L+L  L +AL VP+F  V+SL GSL+++ ++ +LPC  +  I    ++  
Sbjct  480   IIL---LRSALVLSSLVVALSVPFFGLVMSLVGSLLTMFVAYILPCACFLAILRSTVTWY  536

Query  1323  LLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
              ++  V +I  G   A  GT SS   ++ S Q
Sbjct  537   QVVLCVFIIAVGLCCAGIGTYSSLSKIIQSYQ  568



>gb|AFW89943.1| hypothetical protein ZEAMMB73_168665 [Zea mays]
Length=491

 Score =   252 bits (643),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 142/419 (34%), Positives = 234/419 (56%), Gaps = 9/419 (2%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKG  329
             +P+  +  EDQ  V          E +  +  ++  AV+N I +L G+G LSTPYA+++G
Sbjct  78    KPSLQQIPEDQKPVPVAH------EVSPYHKCTYTQAVVNGINVLCGVGILSTPYAIKQG  131

Query  330   GWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIF  509
             GW+   +L    ++  +T  LL +CL      + Y DIG  AFG  GRI  +  +Y+E++
Sbjct  132   GWLGLVILCLFAILAWYTGVLLRRCLDSKEGLETYPDIGHAAFGATGRIAISIILYVELY  191

Query  510   MALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLS  689
                + Y I   DNL+ +F   HL +  + +++  L T++  ++ +P+ W RDLS +S+LS
Sbjct  192   ACCIEYLILEGDNLSKLFPNAHLSVGSLTMNSHVLFTILTTIIVMPTTWLRDLSCLSYLS  251

Query  690   SAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTA  869
             + G+  S+L  + +    V   V   ++   L+LP IP   GLY + Y+GH VFPNIY++
Sbjct  252   AGGVFASILGVICLFWVGVVDNVGFENKGTALNLPGIPIAIGLYGYCYSGHGVFPNIYSS  311

Query  870   MKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATV  1049
             +K  ++F  +      + TIL+   A MG KMFG    SQ TL++P ++V +K+A+W TV
Sbjct  312   LKKRNQFPSILFTCIGLSTILFAGAAVMGYKMFGEATQSQFTLNLPENLVVSKIAVWTTV  371

Query  1050  LTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVL  1229
               P+TKYAL   P  + L+  LPP+ + +   ++     S L++  L +AL VP+F  V+
Sbjct  372   ANPITKYALTITPLTMSLEELLPPNQQKYSNIVM---LRSALVVSTLLIALSVPFFGLVM  428

Query  1230  SLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             +L GSL+++ ++ +LPC  +  I   K+S   +     +IV G   A  GT SS   ++
Sbjct  429   ALVGSLLTMLVTYILPCACFLAILRRKVSWHQVAVCSFIIVVGVCCACVGTYSSLSKII  487



>ref|NP_030664.1| transmembrane amino acid transporter family protein [Arabidopsis 
thaliana]
 gb|AAK64155.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85095.1| unknown protein [Arabidopsis thaliana]
 gb|AAD11993.2| expressed protein [Arabidopsis thaliana]
 gb|AEC09942.1| transmembrane amino acid transporter family protein [Arabidopsis 
thaliana]
Length=536

 Score =   253 bits (646),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 142/391 (36%), Positives = 216/391 (55%), Gaps = 2/391 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             S +  + N I ++ G+G LSTPY +++ GW S  +L+   VIC +T  L+  C       
Sbjct  148   SVIQTIFNAINVMAGVGLLSTPYTVKEAGWASMVILLLFAVICCYTATLMKDCFENKTGI  207

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT L L G +L +
Sbjct  208   ITYPDIGEAAFGKYGRILICMLLYTELYSYCVEFIILEGDNLTGLFPGTSLDLLGFRLDS  267

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  ++  L+ LP++W +DL  IS+LS+ G++ + LI V+V      G +  +H    +
Sbjct  268   KHLFGILTALIVLPTVWLKDLRIISYLSAGGVIATALIAVSVFFLGTTGGIGFHHTGQAV  327

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 IP   G+Y F Y+GH VFPNIY +M D +KF K  I  F +  +LY  +A MG  M
Sbjct  328   KWNGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITCFIICVLLYGGVAIMGYLM  387

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+   F+KVA W TV++P TKYAL   P A  ++  LP  M  +I  
Sbjct  388   FGEATLSQITLNMPQDQFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPERMSENIWC  447

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  +++L GSL+SI ++I++P   + KI   K +R  
Sbjct  448   FLLLRTA--LVASSVCSAFLIPFFGLMMALIGSLLSILVAIIMPALCFIKIMGNKATRTQ  505

Query  1326  LIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             +I + +++  G +    GT SS   ++ + Q
Sbjct  506   MILSSIIVAIGVVSGTLGTYSSVAKIIRNYQ  536



>ref|XP_010452051.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Camelina sativa]
Length=476

 Score =   251 bits (642),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 152/428 (36%), Positives = 239/428 (56%), Gaps = 15/428 (4%)
 Frame = +3

Query  129   PDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLST  308
             PD  + + P +    + + +V DL S        E N  SF  +V+N   +L GLG ++ 
Sbjct  56    PDKDETISPFNPSS-QLKLSVTDLPS-------PETNLCSFSQSVLNGTNVLCGLGLITM  107

Query  309   PYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAAS  488
             PYA+++ GW+   +L+  GVI  +T  L+ +CL   P  + Y DIGQ AFG  GR + + 
Sbjct  108   PYAIKESGWLGLLILLFFGVITCYTGVLMKRCLESSPGLQTYPDIGQAAFGITGRFIISI  167

Query  489   FIYLEIFMALVSYTISLHDNLATVFLGTHLKL-TGIQLSTSQLLTVMAVLVALPSLWFRD  665
              +Y+E++ A V Y I + DNL+ +F    L + +GI L +SQ+  ++  ++ LP++W +D
Sbjct  168   LLYVELYAACVEYIIMMSDNLSGLFPNISLSIASGISLDSSQIFAILTTILVLPTVWLKD  227

Query  666   LSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHI  845
             LS +S+LS  G+L S+L+ + +    V   +  +         N+P   G++ F Y+GH 
Sbjct  228   LSLLSYLSVGGVLASILLGLCLFWIGVVDGIGFHATGKVFDFYNLPVAIGIFGFGYSGHS  287

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPNIY++MKDPSKF  V ++ FS  T LY A+A     MFG  V SQ TL+MP+    +
Sbjct  288   VFPNIYSSMKDPSKFPLVLVICFSFCTFLYIAVAICCYTMFGEAVESQFTLNMPKQFFPS  347

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPPS--MKHHIKTIIRGGTGSililiilala  1199
             KVA+W  V+TPMTKYAL   P  + L+  +P +    H +  + R      L+   L +A
Sbjct  348   KVAVWTAVITPMTKYALTITPIVMSLEELIPTAKMRSHGVSILFRAA----LVTSTLVVA  403

Query  1200  lCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSG  1379
             L VP+F  V +L GS +++ ++++ PC  Y  I   K+S   +   V +I+FG +    G
Sbjct  404   LSVPFFAIVAALIGSFLAMLVALIFPCLCYLSILKGKLSNTQIGLCVFIILFGLVSGCCG  463

Query  1380  TVSSFKLL  1403
             T S+   L
Sbjct  464   TYSAISRL  471



>ref|XP_010423891.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Camelina sativa]
Length=552

 Score =   253 bits (647),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 149/393 (38%), Positives = 230/393 (59%), Gaps = 5/393 (1%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E N  SF  +V+N   +L GLG ++ PYA+++ GW+   +L+  GVI  +T  L+ +CL 
Sbjct  158   ETNLCSFSQSVLNGTNVLCGLGLITMPYAIKESGWLGLLILLFFGVITCYTGVLMKRCLE  217

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL-T  587
               P  + Y DIGQ AFG  GR + +  +Y+E++ A V Y I + DNL+ +F    L + +
Sbjct  218   SSPGLQTYPDIGQAAFGITGRFIISILLYVELYAACVEYIIMMSDNLSGLFPNISLSIAS  277

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
             GI L +SQ+  ++  ++ LP++W +DLS +S+LS  G+L S+L+ + +    V   +  +
Sbjct  278   GISLDSSQIFAILTTILVLPTVWLKDLSLLSYLSVGGVLASILLGLCLFWIGVVDGIGFH  337

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
                      N+P   G++ F Y+GH VFPNIY++MKDPSKF  V ++ FS  T LY A+A
Sbjct  338   ATGKVFDFNNLPVAIGIFGFGYSGHSVFPNIYSSMKDPSKFPLVLVICFSFCTFLYIAVA  397

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-  1124
               G  MFG  V SQ TL+MP+    +KVA+W  V+TPMTKYAL   P  + L+  +P S 
Sbjct  398   ICGYTMFGEAVESQFTLNMPKQFFPSKVAVWTAVITPMTKYALTITPIVMSLEELIPMSK  457

Query  1125  MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFW  1304
             M+ H  +I+   T   L+   L +AL VP+F  V +L GS +++ ++++ PC  Y  I  
Sbjct  458   MRSHGVSILFRTT---LVTSTLVVALSVPFFAIVAALIGSFLAMLVALIFPCLCYLSILK  514

Query  1305  PKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
              K+S   +   V +I+FG +    GT S+   L
Sbjct  515   GKLSNTQIGLCVFIILFGLVSGCCGTYSAISRL  547



>dbj|BAJ96557.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92983.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   254 bits (648),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/395 (36%), Positives = 225/395 (57%), Gaps = 3/395 (1%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E +     S+    +N I +L G+G LSTPYA+++GGW+   +L+   ++  +T  LL +
Sbjct  172   EVSPYQQCSYTQGAMNGINVLCGVGILSTPYAIKQGGWLGLVILLVFALLAWYTGVLLRR  231

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL      + Y DIG  AFGT GRI  +  +Y+E++   + Y I   DNL+ +F   HL 
Sbjct  232   CLDSKEGLQTYPDIGHAAFGTTGRIAISIILYVELYACCIEYLILESDNLSKLFPNVHLN  291

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             + G+ +++     ++  LV +P+ W RDL+ +S++S+ G++ S+L+ + +    V   V 
Sbjct  292   IWGLAINSHVFFAILTTLVVMPTTWLRDLTCLSYISAGGVVASILVVICLCWIGVVDHVG  351

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
               ++   L+LP IP   GLY + Y+GH VFPNIY+++K+ ++F  +        TIL+TA
Sbjct  352   FENKGTALNLPGIPIAIGLYGYCYSGHGVFPNIYSSLKNRNQFPSILFTCIGFSTILFTA  411

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
              A MG KMFG    SQ TL++P ++V +K+A+WATV  P+TKYAL   P A+ L+  LP 
Sbjct  412   AAVMGYKMFGESTESQFTLNLPENLVVSKIAVWATVANPITKYALTITPLAMSLEELLPR  471

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
             S + +   II     S L++  L +AL VP+F  V++L GSL ++ ++ +LPC  +  I 
Sbjct  472   SQQKYSNIII---LRSALVVSTLIIALSVPFFALVMALIGSLFAMLVTYILPCACFLAIL  528

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
               K +         +I  G   A  GT SS   +V
Sbjct  529   KAKATWYQTATCSFIIAVGVTCACVGTYSSLSGIV  563



>ref|XP_009774062.1| PREDICTED: vacuolar amino acid transporter 1-like [Nicotiana 
sylvestris]
Length=532

 Score =   253 bits (645),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 154/396 (39%), Positives = 231/396 (58%), Gaps = 12/396 (3%)
 Frame = +3

Query  219   VEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLG  398
             +E       S+  +V+N I  L G+G LSTPYAL++GGW S FLL+  G+I  +T  LL 
Sbjct  138   LELPPSQQCSYTQSVLNAINALCGIGILSTPYALKEGGWCSLFLLLLFGIITFYTGILLK  197

Query  399   KCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHL  578
             KCL   P  + Y DIGQ AFG  GRI  A  +Y E++ + + Y I + DNL  +F    +
Sbjct  198   KCLDSSPGIETYPDIGQAAFGMLGRIFIAVALYAELYSSCIEYLIMMSDNLGAIFPSARM  257

Query  579   KLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVV  758
                GI L + Q+  +++ LV LP++W R+LS +S++S+ G++    + V V C    G +
Sbjct  258   VFAGIHLDSYQMCAIISTLVILPTVWLRNLSLLSYISAGGVVA---LIVVVLCLLWVGAI  314

Query  759   NP---NHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTI  929
             N    +     L++  +P   GLY+F Y  H VFPNIY++MK+PS+F  V ++SFS+   
Sbjct  315   NEVGFHSGGTALNIAKLPVTIGLYSFCYGSHSVFPNIYSSMKEPSRFPSVLLISFSIAFF  374

Query  930   LYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDH  1109
              Y  +A  G  MFG   S Q TL++P  +V +KVA W  VLTP+TKYA+   P A  ++ 
Sbjct  375   SYFGVAVCGFLMFGENTSPQFTLNLPAKLVTSKVAAWTVVLTPVTKYAITITPVAFGIEE  434

Query  1110  SLP-PSMKHH-IKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCG  1283
              LP P ++ + +  +IR    +IL+   L ++L VPYF  V+SL GS + + +S++LPC 
Sbjct  435   FLPSPQLRTYGVSILIR----TILVFSTLVISLTVPYFGSVMSLIGSSLVMLVSLILPCA  490

Query  1284  FYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
              Y K+    I+R  L     +I+ G + AV GT S+
Sbjct  491   CYIKLSKDGITRFQLAACTSIIMVGVVSAVIGTYSA  526



>ref|XP_006575238.1| PREDICTED: vacuolar amino acid transporter 1-like [Glycine max]
Length=534

 Score =   253 bits (645),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 144/382 (38%), Positives = 211/382 (55%), Gaps = 2/382 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   + N I ++ G+G LSTPY + + GW+S  +++   V+C +T  LL  C     + 
Sbjct  147   SFTQTIFNGINVMAGVGLLSTPYTVNQAGWMSMAVMLLFAVMCCYTATLLRYCFENREEI  206

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRI  +  +Y E++   V +     DNL ++F GT L L G QL +
Sbjct  207   ITYPDIGEAAFGRYGRIAVSIILYTELYSYCVEFITLEGDNLTSLFPGTSLDLGGFQLDS  266

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  V+  L+ LP++W +DL  IS+LS+ G++ ++LI + V C      V  +H    +
Sbjct  267   MHLFGVLTALIILPTVWLKDLRIISYLSAGGVIATVLIIICVFCVGTIDGVGFHHTGQLV  326

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 IP   G+Y F +AGH VFPNIY +M D  +FTK  I+ F +  ++Y   A MG  M
Sbjct  327   KWNGIPFAIGVYGFCFAGHSVFPNIYQSMADKKQFTKALIICFVLCVLIYGGTAIMGYLM  386

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG G  SQITL+MP     +KVALW TV+ P+TKYAL   P A  L+  LP  +      
Sbjct  387   FGDGTLSQITLNMPPGTFASKVALWTTVINPLTKYALLMNPLARSLEELLPDRISSSYWC  446

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              I   T   L+   + +A  VP+F  V++L GSL SI +S ++P   + KI   K +R  
Sbjct  447   FILLRT--TLVASTVCVAFLVPFFGLVMALIGSLFSILVSAIMPSLCFLKIIGKKATRTQ  504

Query  1326  LIFNVVLIVFGTLLAVSGTVSS  1391
             ++ +V +  FG +  + GT SS
Sbjct  505   VVLSVAIAAFGVICGILGTYSS  526



>emb|CDY22507.1| BnaC03g23170D [Brassica napus]
Length=520

 Score =   252 bits (644),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 141/382 (37%), Positives = 215/382 (56%), Gaps = 2/382 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             S    + N I ++ G+G LSTPY +++ GW S  +L+   VIC +T  L+  C    P  
Sbjct  133   SVTQTIFNGINVMAGVGLLSTPYTVKEAGWASMVILLMFAVICCYTATLMKDCFENKPGI  192

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT +   GI++ +
Sbjct  193   ITYPDIGEAAFGKYGRILICVLLYTELYSYCVEFIILEGDNLTGLFPGTSIDWLGIKIDS  252

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  ++  L+ LP++W +DLS IS+LS+ G++ ++LI V+       G +  NH    +
Sbjct  253   IHLFGIITALIILPTVWLKDLSIISYLSAGGVIATVLIAVSSFFLGTTGGIGFNHTGYAV  312

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 IP   G+Y F Y+GH VFPNIY +M D SKF K  I  F +  ++Y  +A MG  M
Sbjct  313   KWNGIPFAIGIYGFCYSGHSVFPNIYQSMADKSKFNKAVITCFILCVLIYGGVAIMGYLM  372

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG   SSQITL+MP+  +F+KVA W TV++P TKYAL   P A  ++  LP  +  +I  
Sbjct  373   FGEATSSQITLNMPKGSLFSKVAQWTTVVSPFTKYALLMNPLARGIEELLPERISENIWC  432

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  V++L GSL+SI ++I++P   + +I   K +R  
Sbjct  433   FLLLRTA--LVASSVCSAFLIPFFGLVMALIGSLLSILVAIIMPALCFMRIMGNKATRTQ  490

Query  1326  LIFNVVLIVFGTLLAVSGTVSS  1391
             +I +  ++  G +  + GT SS
Sbjct  491   MILSSAIVAIGLVSGILGTYSS  512



>ref|XP_008443262.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Cucumis melo]
 ref|XP_008443263.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Cucumis melo]
Length=539

 Score =   253 bits (645),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 150/445 (34%), Positives = 237/445 (53%), Gaps = 16/445 (4%)
 Frame = +3

Query  108   IECSSCCPDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEK------NNSSFMHAVIN  269
             +E  +  P    H      E F + + ++ L S    + +            SF   + N
Sbjct  100   LEMDAKAPLISDHGGADQNEDFYNISRLQSLRSGRTTISKQLTGELPIGRGCSFTQTIFN  159

Query  270   MIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQ  449
              I +L G+G LSTP+ +++ GW S  +L+   ++C +T  L+  C  K      Y DIG+
Sbjct  160   GINVLAGVGLLSTPFTVKEAGWASLGVLVLFAIVCCYTATLMRYCFEKREGVITYPDIGE  219

Query  450   QAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMA  629
              A+G  GR+  +  +YLE++   V + I   DNL ++F G  L L  IQL +  L  ++ 
Sbjct  220   AAYGKFGRLFVSIILYLELYCYCVEFIILEGDNLTSLFPGASLSLGSIQLDSMHLFGILT  279

Query  630   VLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSV  809
              L+ LP++W RDL  IS+LS+ G++ ++LI + +     FG V  +     ++   +P  
Sbjct  280   ALIVLPTVWLRDLRVISYLSAGGVIATILIGLCLIFLGTFGGVGFHQTGEVVNWKGVPFA  339

Query  810   SGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQ  989
              G+Y F Y+GH VFPNIY +M D +KFTK  IV F +  ++Y  +A MG  MFG    SQ
Sbjct  340   IGVYGFCYSGHTVFPNIYQSMADKTKFTKALIVCFILCVLIYGGVAIMGFLMFGQNTLSQ  399

Query  990   ITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGS  1169
             ITL+MP+H V +KVA+W TV+ P TKYAL   P A  ++  LPP +       I      
Sbjct  400   ITLNMPKHAVTSKVAVWTTVINPFTKYALLMNPLARSIEELLPPRISASYGCFI------  453

Query  1170  ililiilalalCV----PYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFN  1337
             +L   ++A ++CV    P+F  V+SL GSL+SI +S+++P   Y KI     ++  +  +
Sbjct  454   LLRTALVASSVCVAFLLPFFGLVMSLIGSLLSILVSVIVPTICYLKIMGSDATKIHITSS  513

Query  1338  VVLIVFGTLLAVSGTVSSFKLLVIS  1412
             + ++  G + A+ GT SS   +  S
Sbjct  514   IFVVGIGIVSAIMGTYSSLSRIAKS  538



>ref|XP_010241839.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Nelumbo nucifera]
Length=554

 Score =   253 bits (645),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 139/391 (36%), Positives = 232/391 (59%), Gaps = 4/391 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             S+   V+N I +L G+G LSTPYA ++GGW+   +L+   ++  +T  LL  CL  +P  
Sbjct  166   SYGQTVLNGINVLCGVGILSTPYAAKEGGWLGFSILLIFAILSWYTGILLRNCLDSEPGL  225

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
             + Y DIGQ AFGT GR+  +  +Y+E++   V Y I   DNL+++F   HL   G+ L +
Sbjct  226   ETYPDIGQAAFGTAGRLAISIILYVELYACCVEYIILESDNLSSLFPNAHLSFGGMVLDS  285

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  +MA L  LP++W RDLS +S++S+ G++ S+L+ + +    +   V   ++   L
Sbjct  286   HHLFALMATLAVLPTVWLRDLSILSYISAGGVIASILVVLCLFWIGLVDQVGFQNKGTTL  345

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
             +L  +P   GLY + Y+GH VFPNIYT+M  PS++    +  F + T +Y  +A MG  M
Sbjct  346   NLTTLPVAIGLYGYCYSGHAVFPNIYTSMAKPSQYPSALLTIFIICTSMYAGVALMGYTM  405

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-MKHHIK  1142
             FG    SQ TL+MP+ +V +K+A+W TV+ P TKYAL   P A+ L+  +P + +K H+ 
Sbjct  406   FGEKTESQFTLNMPQDLVASKIAVWTTVVNPFTKYALTMTPVAMSLEELIPSNHLKSHMY  465

Query  1143  TIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRP  1322
              I+     + L++  L + L VP+F  V++L GSL+++ ++++LPC  +  I   K++  
Sbjct  466   AIL---IRTALVISTLLVGLSVPFFGLVMALIGSLLTMLVTLILPCACFLSILRGKVTLF  522

Query  1323  LLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
                  +++I+ G + +  GT S+   ++ +L
Sbjct  523   QGTMCILIIIVGVISSGFGTFSALSKIIENL  553



>ref|XP_006573771.1| PREDICTED: vesicular inhibitory amino acid transporter-like isoform 
X1 [Glycine max]
Length=534

 Score =   252 bits (643),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 144/392 (37%), Positives = 214/392 (55%), Gaps = 2/392 (1%)
 Frame = +3

Query  237   NNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKD  416
                SF+  V N   ++ G+G LSTPY L++ GW+S  L++   VIC +T  L+  C    
Sbjct  144   RECSFLQTVFNATNVMAGVGILSTPYTLKEAGWMSMVLMVLFAVICCYTATLMRYCFESR  203

Query  417   PKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQ  596
                  Y DIG+ AFG  GRI+ +  +Y E++   V +     DNL  +F GT L L   +
Sbjct  204   EGITSYPDIGEAAFGKYGRIIVSIILYTELYSCCVEFITLEGDNLTGLFPGTSLDLGSFR  263

Query  597   LSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRI  776
             L +  L  ++A L+ +P++W +DL  IS LS+ G+  +LLI V V C      V  +H  
Sbjct  264   LDSVHLFGILAALIIIPTVWLKDLRIISILSAGGVFATLLIVVCVFCVGTINGVGFHHTG  323

Query  777   PPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMG  956
               ++   IP   G++ F +AGH VFPNIY +M D  +FTK  I+ F +   +Y  +A MG
Sbjct  324   QLVNWSGIPLAIGIHGFCFAGHSVFPNIYQSMADKRQFTKALIICFVLSITIYGGVAIMG  383

Query  957   AKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHH  1136
               MFG    SQITL+MPR    +KVALW TV+ P TKYAL   P A  L+  LP  +   
Sbjct  384   FLMFGGETLSQITLNMPRDAFASKVALWTTVINPFTKYALLMNPLARSLEELLPDRISST  443

Query  1137  IKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKIS  1316
              +  I   T   L++  +  A  +P+F  V++L GSL S+ +S+++P   + KI   K +
Sbjct  444   YRCFILLRTA--LVVSTVCAAFLIPFFGFVMALIGSLFSVLVSVIMPSLCFMKIVGKKAT  501

Query  1317  RPLLIFNVVLIVFGTLLAVSGTVSSFKLLVIS  1412
                +  +VV+  FG +  + GT SS + +V S
Sbjct  502   ATQVALSVVITTFGVICGILGTYSSVQNIVNS  533



>ref|XP_011031694.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Populus euphratica]
Length=546

 Score =   252 bits (644),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 148/410 (36%), Positives = 241/410 (59%), Gaps = 14/410 (3%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             K+ ++S+   E      SSF  AV+N + +L G+G LSTPYA ++GGW+   +L    V+
Sbjct  147   KNEKASQVSHELPMSRQSSFGQAVLNGVNVLCGVGILSTPYAAKEGGWLGLIILFVFAVL  206

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL  CL  +P  + Y DIGQ AFGT GR +        I    V Y I   DNL
Sbjct  207   SFYTGMLLRSCLDSEPGLETYPDIGQAAFGTTGRFV--------ISACCVEYIILESDNL  258

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             +++F   H+ + G ++ +  L  +M  L  LP++W RDLS +S++S+ G++ S+L+ +++
Sbjct  259   SSLFPNAHISMGGFEMDSHHLFALMTTLAVLPTVWLRDLSVLSYISAGGVVASVLVVLSL  318

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                 +   V  + +   L+L  +P   GLY + Y+GH VFPNIYT+M  PS+F KV +  
Sbjct  319   FWVGLVDNVGIHSKGTVLNLGTLPVAIGLYGYCYSGHAVFPNIYTSMAQPSRFPKVLLAC  378

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             FS+ T++Y  +A+MG  MFG    +Q TL++P+ +V +KVA+W TV+ P TKYAL  +P 
Sbjct  379   FSICTLMYAGVAYMGYTMFGESTETQFTLNLPQDLVVSKVAVWTTVVNPFTKYALTMSPV  438

Query  1092  AIELDHSLPPS-MKHHIKTI-IRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGIS  1265
             A+ L+  +P + MK H+  I IR    + L+   L + L +P+F  V+SL GSL+++ ++
Sbjct  439   AMSLEELIPSNHMKSHMYAICIR----TALVFSTLLVGLAIPFFGLVMSLIGSLLTMLVT  494

Query  1266  IVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
             ++LPC  +  I   K +R   +  +++I  G + +  GT S+   ++ +L
Sbjct  495   LILPCACFLSIVRGKATRFQGVVCIIIIAVGIVSSAFGTHSALSKIIENL  544



>ref|XP_003535879.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Glycine max]
 ref|XP_006588943.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Glycine max]
 ref|XP_006588944.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X3 
[Glycine max]
Length=542

 Score =   252 bits (643),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 148/401 (37%), Positives = 236/401 (59%), Gaps = 16/401 (4%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             +F  AV+N I  L G+G LSTPYA ++GGWI   +L+   V   +T  LL  CL   P  
Sbjct  150   TFGQAVLNGINALCGIGILSTPYAAKEGGWIGLSILLLYAVFSFYTGLLLRYCLDSAPGL  209

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
             + Y DIGQ AFGT GR++ +  +Y+E++   + Y I   DNL+T+F   H+ L G++L+ 
Sbjct  210   ETYPDIGQAAFGTTGRVIISIILYMELYACCIEYIIVESDNLSTLFPNAHISLGGVELNA  269

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRI---  776
               L  ++  +  LP++W RDL  +S++S+ G++ ++L+   V C    G+++ N  I   
Sbjct  270   HILFAILTAVALLPTVWLRDLRILSYISACGVIATILV---VLCLFWVGLLD-NADIHTQ  325

Query  777   ---PPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
                   +L   P   GLY + YAGH VFPNIYTAM + ++F  V +V F++ T +Y A+A
Sbjct  326   GTTKTFNLATFPVAIGLYGYCYAGHAVFPNIYTAMANRNQFPGVLLVCFAICTSMYCAVA  385

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSM  1127
              MG   FG    SQ TL+MP+H+V TK+A+W TV+ P TKYAL  +P A+ L+  +P + 
Sbjct  386   IMGYTAFGKATLSQYTLNMPQHLVATKIAVWTTVVNPFTKYALSLSPVAMCLEELIPANS  445

Query  1128  KHHI--KTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
              +      +IR    + L++  L + L VP+F  V+SLTGSL+++ +S++LP   +  I 
Sbjct  446   PNFFIYSKLIR----TALVVSTLLVGLSVPFFGLVMSLTGSLLTMFVSLILPAACFLSIR  501

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRA  1424
               +I+R  +   V +IV G + +  G+ S+   ++  L ++
Sbjct  502   GGRITRFQVSICVTIIVVGIVSSCLGSYSALSEIIQELFKS  542



>ref|XP_011007142.1| PREDICTED: vacuolar amino acid transporter 1-like [Populus euphratica]
Length=532

 Score =   251 bits (642),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/388 (37%), Positives = 222/388 (57%), Gaps = 14/388 (4%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
                +S   +++N   +L G+G L+ PYA+++GGW+S  +L   GVIC +T  LL  CL  
Sbjct  148   DQKASLAQSILNGTNVLCGIGLLTMPYAIKEGGWLSLIILSLFGVICCYTGMLLKNCLES  207

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGI  593
              P  + Y DIGQ AFG +GR++        I  + V Y I + DNL+T+F   ++   GI
Sbjct  208   SPGLQTYPDIGQAAFGVRGRLV--------ISASCVEYVIMMSDNLSTLFPNMYMNFAGI  259

Query  594   QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHR  773
              L   Q+ ++ A L+ LP++W RDLS +S+LS  G+  S+++ + +  T V   +  +  
Sbjct  260   HLDCHQIFSITATLIVLPTVWLRDLSLLSYLSVGGVGASIIVALCLLWTGVIDKIGFHPT  319

Query  774   IPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFM  953
                L L N+P   G+Y F ++GH VFPNIY++MK+PS+F  V I SF    ++YT  A  
Sbjct  320   GTALDLANLPVAIGIYGFGFSGHSVFPNIYSSMKEPSRFPTVLITSFIFCWLMYTGAAIC  379

Query  954   GAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP--SM  1127
             G  MFG  + SQ TL+MP   V +KVA+W  V+ PMTKYAL   P A+ L+   P   S 
Sbjct  380   GFLMFGHSIESQYTLNMPAQFVSSKVAVWTAVVNPMTKYALVMMPVALSLEELAPSGRSS  439

Query  1128  KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
              + +  IIR    + L+   LA+AL VP+F  V++L GSL+++ ++++ PC  Y  I   
Sbjct  440   SYGVSLIIR----TFLVTSTLAVALAVPFFGFVMALIGSLLAMLVAVIFPCACYLSILHE  495

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             ++++  +   +  I  G L    GT S+
Sbjct  496   RLTKLQIAACLFTIGVGVLFGCVGTYSA  523



>ref|XP_010490635.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Camelina sativa]
Length=475

 Score =   250 bits (638),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 152/428 (36%), Positives = 241/428 (56%), Gaps = 15/428 (4%)
 Frame = +3

Query  129   PDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLST  308
             PD  + + P +    + + +V DL          E N  SF  +V+N   +L GLG ++ 
Sbjct  55    PDKDETISPFNPSS-QLKLSVTDLP-------VPETNLCSFSQSVLNGTNVLCGLGLITM  106

Query  309   PYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAAS  488
             PYA+++ GW+   +L+  GVI  +T  L+ +CL   P  + Y DIGQ AFG  GR + + 
Sbjct  107   PYAIKESGWLGLLILLFFGVITCYTGVLMKRCLESSPGLQTYPDIGQAAFGITGRFIISI  166

Query  489   FIYLEIFMALVSYTISLHDNLATVFLGTHLKL-TGIQLSTSQLLTVMAVLVALPSLWFRD  665
              +Y+E++ A V Y I + DNL+ +F    L + +GI L +SQ+  ++  ++ LP++W +D
Sbjct  167   LLYVELYAACVEYIIMMSDNLSGLFPNISLSIASGISLDSSQIFAILTTILVLPTVWLKD  226

Query  666   LSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHI  845
             LS +S+LS  G+L S+L+ + +    V   +  +         N+P   G++ F Y+ H 
Sbjct  227   LSLLSYLSVGGVLASILLGLCLFWIGVVDGIGFHATGKVFDFSNLPVAIGIFGFGYSRHS  286

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPNIY++MKDPSKF  V ++ F+  T LY A+A  G  MFG  V SQ TL+MP+    +
Sbjct  287   VFPNIYSSMKDPSKFPLVLVICFTFCTFLYIAVATCGYTMFGEAVESQFTLNMPKQFFAS  346

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLP-PSMKHH-IKTIIRGGTGSililiilala  1199
             KVA+W  V+TPMTKYAL   P  + L+  +P   M+ H +  I R    ++L+   L +A
Sbjct  347   KVAVWTAVITPMTKYALTITPIVMSLEELIPMAKMRSHGVSIIFR----TVLVTSTLVVA  402

Query  1200  lCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSG  1379
             L VP+F  V +L GS +++ ++++ PC  Y  I   K+S   +   V +I+FG +    G
Sbjct  403   LSVPFFAIVAALIGSFLAMLVALIFPCLCYLSILKGKLSNTQIGLCVFIILFGVVSGCCG  462

Query  1380  TVSSFKLL  1403
             T S+   L
Sbjct  463   TYSAISRL  470



>ref|XP_006398682.1| hypothetical protein EUTSA_v10013167mg [Eutrema salsugineum]
 gb|ESQ40135.1| hypothetical protein EUTSA_v10013167mg [Eutrema salsugineum]
Length=549

 Score =   252 bits (643),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/398 (37%), Positives = 233/398 (59%), Gaps = 15/398 (4%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E    SF  +V+N   +L GLG ++ PYA+++ GW+   +L+  GVI  +T  L+ +CL 
Sbjct  155   ESKLCSFSQSVLNGTNVLCGLGLITMPYAIKESGWLGLLILLFFGVITCYTGVLMKRCLE  214

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLT-  587
               P  + Y DIGQ AFG  GR + +  +Y+E++ A V Y I + DNL+ +F    L +  
Sbjct  215   SSPGLQTYPDIGQAAFGITGRFIISILLYVELYAACVEYIIMMSDNLSGLFPDISLNIAP  274

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN--  761
             GI L ++Q   ++  L+ LP++W +DLS +S+LS  G+L S+L+ +   C    GVV+  
Sbjct  275   GISLDSAQSFAILTTLLVLPTVWLKDLSLLSYLSVGGVLASVLLGL---CLFRVGVVDGI  331

Query  762   ---PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTIL  932
                   R+  L L N+P   G++ F Y+GH VFPNIY++MKDPSKF  V ++ F   T L
Sbjct  332   GFHATGRV--LDLSNLPVTIGIFGFGYSGHSVFPNIYSSMKDPSKFPLVLVICFCFCTAL  389

Query  933   YTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHS  1112
             Y A+A  G  MFG  + SQ TL+MP+  + +K+A+W  V+TPMTKYAL   P  + L+  
Sbjct  390   YVAVAICGYTMFGEAIESQFTLNMPKQFIPSKIAVWTAVVTPMTKYALTITPIVLSLEEL  449

Query  1113  LPPS-MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFY  1289
             +P + M+ H  +I      ++L+   L +AL VP+F  V +L GS +++ ++++ PC  Y
Sbjct  450   IPKAKMRSHCVSIC---FRTVLVTSTLVVALSVPFFAIVAALIGSFLAMLVALIFPCICY  506

Query  1290  TKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
               IF  K++   +   +V+I FG +    GT S+   L
Sbjct  507   LSIFKGKLTNTQIGLCMVIITFGLVSGCCGTYSAISRL  544



>gb|AGV28592.1| transmembrane amino acid transporter [Oryza sativa Indica Group]
Length=571

 Score =   252 bits (644),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/422 (34%), Positives = 240/422 (57%), Gaps = 19/422 (5%)
 Frame = +3

Query  150   EPASGERFEDQTAV---KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYAL  320
             +P+  +  EDQ  +    ++ + ++C         S+  AV+N I +L G+G LSTPYA+
Sbjct  162   KPSLQQIPEDQKPLVPAHEVPAYQQC---------SYTQAVMNGINVLCGVGILSTPYAI  212

Query  321   EKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYL  500
             ++GGW+   +L    V+  +T  LL +CL      + Y DIG  AFGT GRI  +  +Y+
Sbjct  213   KQGGWLGLVILCLFAVLAWYTGVLLRRCLDSKEGLETYPDIGHAAFGTTGRIAISIILYI  272

Query  501   EIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSIS  680
             E++   + Y I   DNL+ +F   HL +  + L++     ++  L+ +P+ W RDLS +S
Sbjct  273   ELYACCIEYLILESDNLSKLFPNAHLTIGSMTLNSHVFFAILTTLIVMPTTWLRDLSCLS  332

Query  681   FLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNI  860
             +LS+ G++ S+L+ V +    V   V   ++   L+LP IP   GLY + Y+GH VFPNI
Sbjct  333   YLSAGGVIASILVVVCLCWVGVVDHVGFENKGTALNLPGIPIAIGLYGYCYSGHGVFPNI  392

Query  861   YTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALW  1040
             Y+++K+ ++F+    + F+ + +     A MG KMFG    SQ TL++P ++V +KVA+W
Sbjct  393   YSSLKNRNQFS----ILFTCIGLSSICAAMMGYKMFGESTESQFTLNLPENLVVSKVAVW  448

Query  1041  ATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFE  1220
              TV  P+TKYAL   P A+ L+  LPP+ + +   I+     S L++  L +AL VP+F 
Sbjct  449   TTVANPITKYALTITPLAMSLEELLPPNQQKYANIIM---LRSSLVVSTLLIALSVPFFG  505

Query  1221  HVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKL  1400
              V++L GSL+++ ++ +LPC  +  I   K++   +     +IV G   A  GT SS   
Sbjct  506   IVMALVGSLLTMLVTYILPCACFLAILKRKVTWHQIAACSFIIVVGVCCACVGTYSSLSK  565

Query  1401  LV  1406
             ++
Sbjct  566   II  567



>ref|XP_008778079.1| PREDICTED: vacuolar amino acid transporter 1-like [Phoenix dactylifera]
Length=547

 Score =   251 bits (642),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/403 (35%), Positives = 233/403 (58%), Gaps = 14/403 (3%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             +DL  S +C         S   A++N I +L G+G L+TPYA+++GGW+   +L  LG I
Sbjct  150   RDLPPSPQC---------STAQAIVNGINVLCGVGILTTPYAVKEGGWLGMLVLFALGAI  200

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
               +T  LL +CL   P+ + Y DIGQ AFG  GR+  +  +YLE++ + V Y   + D+L
Sbjct  201   SCYTGVLLKRCLDSSPELQTYPDIGQAAFGMTGRLWISIVLYLELYASCVEYITLVGDSL  260

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             +++F   H+   G+ LS+ QL      ++ LP++W R+L  +S+LS+ G++ ++L+ + +
Sbjct  261   SSLFPHAHVNFMGVDLSSHQLFAGTTAIMVLPTVWLRNLGLLSYLSAGGVIATILVVICL  320

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                     V  +     L L N+P   GLY F Y+GH VFPNIY++M   ++F  V I  
Sbjct  321   LWVGAVDRVGFHPGGTALDLANLPVAVGLYGFCYSGHSVFPNIYSSMNIQAQFPAVLIFC  380

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F++ TILY  +A  G  MFG  + SQ TL+MP   + +K+A+W TV+ P++KYAL   P 
Sbjct  381   FALCTILYAGVAVAGFLMFGESIKSQFTLNMPHQYLSSKIAVWTTVVNPLSKYALTMTPV  440

Query  1092  AIELDHSLPPSMKHH-IKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISI  1268
             A+ L+  LP + + H +  +IR    ++L+   L +AL  P+F  V++L GS+ ++ +++
Sbjct  441   ALSLEELLPSTEQSHLVAVLIR----TVLVFSTLFVALLFPFFGFVMALLGSVFTMLVAL  496

Query  1269  VLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFK  1397
             +LPC  Y  I    ++   +   + +I+ G + +  G+ SS K
Sbjct  497   ILPCACYLSIQRRSVNFTQVFVCISIIMVGVVCSCFGSYSSIK  539



>ref|XP_004514396.1| PREDICTED: vacuolar amino acid transporter 1-like [Cicer arietinum]
Length=541

 Score =   251 bits (641),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 145/392 (37%), Positives = 239/392 (61%), Gaps = 14/392 (4%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
             +   SF  +VIN   +L G+G ++ PYA+++GGW+S  LL+    IC +T  LL +CL  
Sbjct  148   QRQCSFAQSVINGTNILCGIGMMTIPYAIKEGGWLSFLLLLMFAAICCYTGILLLRCLQS  207

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGI  593
              P    Y DIGQ AFG  GR+  +  +Y+E+F + V + I + DNL ++F  T + L G 
Sbjct  208   HPGVNSYPDIGQAAFGIAGRLGISIILYMELFASCVEFLILVSDNLTSLFPNTSMTLAGT  267

Query  594   QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVV-----  758
             QLS+ Q+  + A L+ LP++W ++LS +S++S  GI  +LL+ +   C    G V     
Sbjct  268   QLSSHQVFAITAALLVLPTVWLKNLSLLSYISVGGIFATLLVAL---CLFWVGAVDQIGF  324

Query  759   NPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYT  938
             NP  +I  L + N+    GL+ F +AGH VFPN+Y++MK+PSKF  V  +SF+   ++Y 
Sbjct  325   NPGGKI--LDIENLSVSIGLFGFGFAGHAVFPNVYSSMKEPSKFPLVLYISFAFCLVMYV  382

Query  939   ALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLP  1118
             ++   G  +FG  V SQ TL+MP+ +  +K+A W TV+TP+ K+AL   P +  ++  +P
Sbjct  383   SVGTYGYLLFGDSVGSQFTLNMPKTLYASKIAKWTTVVTPLAKFALTLLPISSSIEELVP  442

Query  1119  -PSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTK  1295
              P ++ +  +I+     +IL+++ L +ALCVPYF  V++L GS +S+ ++++ PC  Y K
Sbjct  443   SPRLRCYAMSIL---IRTILVILSLIVALCVPYFGSVMALIGSFMSMLVALIYPCACYLK  499

Query  1296  IFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             +   K+S   +I  +++I+ G + A+ GT S+
Sbjct  500   LHRGKLSNIEIINCILIIIVGLVSAMVGTYSA  531



>ref|XP_004975175.1| PREDICTED: vacuolar amino acid transporter 1-like [Setaria italica]
Length=571

 Score =   252 bits (643),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 146/408 (36%), Positives = 234/408 (57%), Gaps = 17/408 (4%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E       S++  V+N + +L G+G LSTPYA+++GGW+   +L  LG +  +T  LL +
Sbjct  175   EVGPYRQCSYIQGVMNGVNVLCGVGILSTPYAVKQGGWLGLVILAVLGALAWYTGILLRR  234

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL      + Y DIG  AFGT GRI+ +  +Y+E++   + Y I   DNL+ +F   HL 
Sbjct  235   CLDSKEGLETYPDIGHAAFGTAGRIIISIILYMELYACCIEYLILESDNLSKLFPNAHLT  294

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             +  + L +  L  ++  L+ +P+ W RDLS +SF+S+ G++ S++I   V+C    G+V 
Sbjct  295   IGSLTLDSHVLFAILTALIVMPTTWLRDLSCLSFVSAGGVIASIVI---VSCLFWVGLV-  350

Query  762   PNHRIP------PLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVV  923
              +H  P       L+LP IP   GLY + Y+GH VFPNIY+++K  ++F  V     ++ 
Sbjct  351   -DHVGPVKSEGTALNLPGIPIAIGLYGYCYSGHGVFPNIYSSLKKRNQFPAVLFTCIALS  409

Query  924   TILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIEL  1103
             T+L+   A MG  MFG    SQ TL++P ++V +K+A+W TV  P+TKYAL   P A+ L
Sbjct  410   TVLFAGAAIMGYIMFGESTESQFTLNLPPNLVASKIAVWTTVTNPITKYALTMTPLALSL  469

Query  1104  DHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCG  1283
             +  LPP+ + +   ++     S L++  L +AL VP+F  V+SL GS +++ ++ +LPC 
Sbjct  470   EELLPPNQQTYPNIVM---LRSALVVSSLIVALSVPFFGLVMSLVGSFLTMFVAYILPCA  526

Query  1284  FYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISLQRAH  1427
              +  I   K+S   ++  V +I  G   A  GT SS   ++   Q+ H
Sbjct  527   CFLAILRNKVSWYQVVLCVFIIAVGLCCAGVGTYSSLSKII---QQYH  571



>ref|XP_009630820.1| PREDICTED: vacuolar amino acid transporter 1-like [Nicotiana 
tomentosiformis]
Length=556

 Score =   251 bits (642),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/382 (36%), Positives = 223/382 (58%), Gaps = 7/382 (2%)
 Frame = +3

Query  180   QTAVKDLESSEECVEQ-AEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLI  356
             ++A+K     +    +      SS+   V+N I +L G+G LSTPYA+++GGW    +L 
Sbjct  146   RSAIKKFPDEKSVAHEFPASRQSSYGQGVLNGINVLCGVGILSTPYAVKEGGWAGLSILF  205

Query  357   GLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTIS  536
               GV+  +T  LL  CL   P  + Y DIGQ AFGT GRI+ +  +Y+E++   V Y I 
Sbjct  206   IFGVLSYYTGILLRYCLDSQPGLETYPDIGQAAFGTVGRIIISIILYVELYSCCVEYIIL  265

Query  537   LHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLL  716
               DNL+ +F   HL L G QL    L  ++  L  LP++W RDL+ +S++S+ G++ S++
Sbjct  266   EGDNLSALFPNAHLSLGGYQLDARHLFALITTLAVLPTVWLRDLTVLSYISAGGVIASVM  325

Query  717   IFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTK  896
             + V +    +   V+       L++ ++P   GLY + Y+GH VFPNIYT+++  S+F  
Sbjct  326   VVVCLYWLGLVDHVSSQSEQTVLNVSSLPVAIGLYGYCYSGHAVFPNIYTSLEKRSQFPA  385

Query  897   VSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYAL  1076
             V + SF++VT+LY   A MG  MFG    SQ TL++P  +V +K+A W T++ P TKYAL
Sbjct  386   VLLTSFAIVTVLYAGAAVMGYMMFGDSAESQFTLNLPTDLVASKIAFWTTIVNPFTKYAL  445

Query  1077  EFAPFAIELDHSLPPS--MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLV  1250
               +P A+ ++  +P +    H    +IR    + L++  L +AL VP+F  V++L GSL 
Sbjct  446   TMSPVAMSMEELIPSNHAKSHMYGVLIR----TALVISTLLVALKVPFFGFVMALIGSLF  501

Query  1251  SIGISIVLPCGFYTKIFWPKIS  1316
             ++ ++++LPC  + +I   K S
Sbjct  502   TMLVTLILPCACFLRILKGKTS  523



>ref|NP_001136459.1| hypothetical protein [Zea mays]
 gb|ACF81977.1| unknown [Zea mays]
 gb|AFW89941.1| hypothetical protein ZEAMMB73_168665 [Zea mays]
Length=567

 Score =   251 bits (642),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/419 (34%), Positives = 234/419 (56%), Gaps = 9/419 (2%)
 Frame = +3

Query  150   EPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKG  329
             +P+  +  EDQ  V          E +  +  ++  AV+N I +L G+G LSTPYA+++G
Sbjct  154   KPSLQQIPEDQKPVPVAH------EVSPYHKCTYTQAVVNGINVLCGVGILSTPYAIKQG  207

Query  330   GWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIF  509
             GW+   +L    ++  +T  LL +CL      + Y DIG  AFG  GRI  +  +Y+E++
Sbjct  208   GWLGLVILCLFAILAWYTGVLLRRCLDSKEGLETYPDIGHAAFGATGRIAISIILYVELY  267

Query  510   MALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLS  689
                + Y I   DNL+ +F   HL +  + +++  L T++  ++ +P+ W RDLS +S+LS
Sbjct  268   ACCIEYLILEGDNLSKLFPNAHLSVGSLTMNSHVLFTILTTIIVMPTTWLRDLSCLSYLS  327

Query  690   SAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTA  869
             + G+  S+L  + +    V   V   ++   L+LP IP   GLY + Y+GH VFPNIY++
Sbjct  328   AGGVFASILGVICLFWVGVVDNVGFENKGTALNLPGIPIAIGLYGYCYSGHGVFPNIYSS  387

Query  870   MKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATV  1049
             +K  ++F  +      + TIL+   A MG KMFG    SQ TL++P ++V +K+A+W TV
Sbjct  388   LKKRNQFPSILFTCIGLSTILFAGAAVMGYKMFGEATQSQFTLNLPENLVVSKIAVWTTV  447

Query  1050  LTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVL  1229
               P+TKYAL   P  + L+  LPP+ + +   ++     S L++  L +AL VP+F  V+
Sbjct  448   ANPITKYALTITPLTMSLEELLPPNQQKYSNIVM---LRSALVVSTLLIALSVPFFGLVM  504

Query  1230  SLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             +L GSL+++ ++ +LPC  +  I   K+S   +     +IV G   A  GT SS   ++
Sbjct  505   ALVGSLLTMLVTYILPCACFLAILRRKVSWHQVAVCSFIIVVGVCCACVGTYSSLSKII  563



>ref|XP_006361676.1| PREDICTED: vacuolar amino acid transporter 1-like [Solanum tuberosum]
Length=556

 Score =   251 bits (641),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/385 (37%), Positives = 223/385 (58%), Gaps = 12/385 (3%)
 Frame = +3

Query  165   ERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISA  344
             ++F D+ +V          E      SS+   V+N I +L G+G LSTPYA+++GGW   
Sbjct  150   KKFPDEKSVAH--------ELPVSRQSSYGQGVLNGINVLCGVGILSTPYAVKEGGWAGL  201

Query  345   FLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVS  524
              LL   G++  +T  LL  CL   P  + Y DIGQ AFGT GRI+ +  +Y+E++   V 
Sbjct  202   SLLFIFGLLSYYTGILLRYCLDSQPGLETYPDIGQAAFGTVGRIIISIILYVELYSCCVE  261

Query  525   YTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGIL  704
             Y I   DNL+ +F   HL L G QL    L  ++  L  LP++W RDL+ +S++S+ G++
Sbjct  262   YIILEGDNLSALFPNAHLNLGGYQLDARHLFALVTTLAVLPTVWLRDLTVLSYISAGGVI  321

Query  705   MSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPS  884
              S+++ + +    +   V    +   L+L ++P   GLY + Y+GH VFPNIYT+++  S
Sbjct  322   ASVMVVICLYWLGLVDHVGTQSKETVLNLSSLPVAIGLYGYCYSGHAVFPNIYTSLEKRS  381

Query  885   KFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMT  1064
             +F  V   SF++VT LY   A MG  MFG    SQ TL++P  +V +K+A W T++ P T
Sbjct  382   QFPAVLFTSFAIVTALYAGAAVMGYMMFGDSAESQFTLNLPTDLVASKIAFWTTIVNPFT  441

Query  1065  KYALEFAPFAIELDHSLPPS-MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTG  1241
             KYAL  AP A+ L+  +P +  K H+ +I+     + L++  L +AL +P+F  V++L G
Sbjct  442   KYALTMAPVAMSLEELIPSNHTKSHMYSIL---IRTALVMSTLFVALKIPFFGFVMALIG  498

Query  1242  SLVSIGISIVLPCGFYTKIFWPKIS  1316
             S  ++ ++++LPC  + +I   K S
Sbjct  499   SFFTMLVTLILPCACFLRILKGKTS  523



>ref|XP_010683901.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=546

 Score =   251 bits (640),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 143/395 (36%), Positives = 234/395 (59%), Gaps = 4/395 (1%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
                S+F  A++N I +L G+G LSTPYA+++GGW+S  +L+   V+  +T  LL  CL  
Sbjct  154   SQGSTFGQALLNGINVLCGVGILSTPYAVKEGGWLSLAILLMFAVLSFYTGLLLRYCLDS  213

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGI  593
              P  + Y DIGQ +FG  GRI+ +  +Y+E++   V Y I   DNL+++F   HL L G 
Sbjct  214   APGLETYPDIGQASFGKLGRIVISIILYVELYACCVEYIILESDNLSSLFPNAHLTLLGY  273

Query  594   QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHR  773
             +L +  L  + A LV LP+ W RDLS +S++S  G++ S+L+F+ +    +   V    +
Sbjct  274   ELDSYHLFALAATLVELPTCWVRDLSILSYVSVGGVIASVLVFLCLFWVGLVDQVGFVGQ  333

Query  774   IPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFM  953
                LHL  +P   GLY + Y+GH V+PNIYT+M + S++  V + SF++ T +    A +
Sbjct  334   GTTLHLSTLPVTIGLYGYCYSGHAVYPNIYTSMANRSQYPAVLLTSFAICTFMCAGAAVL  393

Query  954   GAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP-SMK  1130
             G  MFG    SQ TL+MP+++V +KVA+W TV+ P TKYAL  +P A+ L+  +P   +K
Sbjct  394   GYLMFGESTQSQFTLNMPQNLVASKVAVWTTVVNPFTKYALIISPVAMSLEELIPSYYLK  453

Query  1131  HHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPK  1310
              H+  I+     + L++  L + L +P+F  V++L GSL+++ ++++LPC  Y  I   K
Sbjct  454   SHMYPIL---IRTALVISTLLVGLNIPFFGLVMALIGSLLTMLVTLILPCACYLSILRKK  510

Query  1311  ISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVISL  1415
              +   +   +  +  G + + SGT S+   ++ +L
Sbjct  511   ATYLQISACLFTMTVGVISSASGTYSAVSQIIENL  545



>emb|CDY06942.1| BnaA04g23730D [Brassica napus]
Length=534

 Score =   250 bits (639),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/382 (37%), Positives = 213/382 (56%), Gaps = 2/382 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   + N I ++ G+G LSTP+ +++ GW S  +L+   VIC +T  L+  C       
Sbjct  147   SFTQTIFNAINVMAGVGLLSTPFTVKEAGWASMVILLLFAVICCYTATLMKDCFEAKTGI  206

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT +   GI++ +
Sbjct  207   ITYPDIGEAAFGKYGRILICVILYTELYSYCVEFIILEGDNLTGLFPGTSIDWLGIRIDS  266

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  +   LV LP++W +DL  IS+LS+ G++ ++LI V+       G +  +H  P +
Sbjct  267   KHLFGIFTALVVLPTVWLKDLRIISYLSAGGVIATVLIAVSTFFLGTTGGIGFHHTGPAV  326

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 IP   G+Y F Y+GH VFPNIY +M D +KF K  I +F +  +LY  +A MG  M
Sbjct  327   KWNGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITTFILCVLLYGGVAIMGYCM  386

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+ + F+KVA W TV++P TKYAL   P A  ++  LP  +  +I  
Sbjct  387   FGEATLSQITLNMPKGLFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPERISENIWC  446

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  V++L GS +SI ++IV+P   + +I   K +R  
Sbjct  447   FLLLRTA--LVASSVCSAFLIPFFGLVMALIGSFLSILVAIVMPALCFIRIMGNKATRTQ  504

Query  1326  LIFNVVLIVFGTLLAVSGTVSS  1391
             +I +  ++V G +    GT SS
Sbjct  505   MILSSTIVVIGLVSGALGTYSS  526



>ref|XP_009141790.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X2 
[Brassica rapa]
Length=518

 Score =   250 bits (638),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 136/406 (33%), Positives = 229/406 (56%), Gaps = 14/406 (3%)
 Frame = +3

Query  132   DGHKHVEPASGERFEDQTAVKDLESSEECVEQAEK--------NNSSFMHAVINMIGMLI  287
             +  +   P    R      +  + S    + + E+         NSS+  AV+N + +L 
Sbjct  115   EAEEQAPPPPKHRLSSHGLLPPVPSRRSSMRKDERVSHEVPMSRNSSYGQAVMNGLNVLC  174

Query  288   GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTK  467
             G+G LSTPYA ++GGW+   +L   G++  +T  LL  CL  +   + Y DIGQ AFGT 
Sbjct  175   GVGILSTPYAAKEGGWLGLGILFIYGLLSFYTGILLRYCLDSESDLETYPDIGQAAFGTT  234

Query  468   GRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALP  647
             GRI  +  +YLE++   V Y I   DNL++++    L + G +L    L  ++  +  LP
Sbjct  235   GRIFVSIVLYLELYACCVEYIILESDNLSSLYPNAGLSIGGFELDARHLFALLTTIAVLP  294

Query  648   SLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAF  827
             ++W RDLS +S++S+ G++ S+L+ +++    +   V  + +   L+L  +P   GLY +
Sbjct  295   TVWLRDLSLLSYISAGGVIASVLVVLSLFWIGLVDDVGIHSKGTTLNLSTLPVAIGLYGY  354

Query  828   SYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMP  1007
              Y+GH VFPNIYT+M +P+++    +  F++ T++Y  +AFMG  MFG    SQ TL++P
Sbjct  355   CYSGHAVFPNIYTSMANPNQYPSALLTCFTICTLMYAGVAFMGYTMFGEATESQFTLNLP  414

Query  1008  RHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP--SMKHHIKTIIRGGTGSilil  1181
             + +V TK+A+W TV+ P TKYAL  +P A+ L+  +P   +  H     IR    + L+ 
Sbjct  415   QDLVATKIAVWTTVVNPFTKYALTLSPVALSLEELIPSRHNKSHWYAIAIR----TALVF  470

Query  1182  iilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISR  1319
               L + L +P+F  V+SL GSL+++ ++++LP   +  I   K++R
Sbjct  471   STLLVGLAIPFFGLVMSLIGSLLTMLVTLILPPACFLSIVRRKVTR  516



>ref|XP_002881760.1| amino acid transporter family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58019.1| amino acid transporter family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   250 bits (639),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/391 (37%), Positives = 214/391 (55%), Gaps = 2/391 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             S    + N I ++ G+G LSTPY +++ GW S  +L+   VIC +T  L+  C       
Sbjct  146   SVTQTIFNAINVMAGVGLLSTPYTVKEAGWASMVILLLFAVICCYTATLMKDCFENKTGI  205

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT L L G +L +
Sbjct  206   ITYPDIGEAAFGKYGRILICMLLYTELYSYCVEFIILEGDNLTGLFPGTSLDLLGFRLDS  265

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  ++  L+ LP++W +DL  IS+LS+ G++ + LI V+V      G +  +H    +
Sbjct  266   KHLFGILTALIVLPTVWLKDLRIISYLSAGGVIATGLIAVSVFFLGTTGGIGFHHTGQAV  325

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 IP   G+Y F Y+GH VFPNIY +M D +KF K  I  F +  +LY  +A MG  M
Sbjct  326   KWNGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITCFILCVLLYGGVAIMGYLM  385

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP++  F+KVA W TV+ P TKYAL   P A  ++  LP  M  +I  
Sbjct  386   FGEATLSQITLNMPQNQFFSKVAQWTTVVNPFTKYALLMNPLARSIEELLPDRMSENIWC  445

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  +++L GSL+SI ++IV+P   + KI   K +R  
Sbjct  446   FLLLRTA--LVASSVCSAFLIPFFGLMMALIGSLLSILVAIVMPALCFIKIMGNKATRTQ  503

Query  1326  LIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             +I +  ++  G +    GT SS   ++ + Q
Sbjct  504   MILSSTIVAIGLVSGTLGTYSSVAKIIRNYQ  534



>gb|KFK24702.1| hypothetical protein AALP_AA8G013600 [Arabis alpina]
Length=748

 Score =   255 bits (651),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 146/393 (37%), Positives = 234/393 (60%), Gaps = 5/393 (1%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
               N  SF  +V+N   +L GLG ++ PYA+++ GW+   +L+  GVI  +T  L+ +CL 
Sbjct  354   RTNLCSFSQSVLNGTNVLCGLGLITMPYAIKESGWLGLLILLLFGVITCYTGVLMKRCLE  413

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL-T  587
               P    Y DIGQ AFG  GR + +  +Y+E++ A V Y I + DNL+ +F    L + +
Sbjct  414   SSPGLHTYPDIGQAAFGITGRFIISILLYVELYAACVEYIIMMSDNLSGLFPNISLSIAS  473

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
             GI L ++Q+  ++  L+ LP++W +DLS +S+LS  G+L S+L+ + +    +   +  +
Sbjct  474   GISLDSAQIFAILTTLLVLPTVWLKDLSLLSYLSVGGVLASILLGLCLFWVGLVDGIGFH  533

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
                    L N+P   G++ F Y+GH VFPNIY++MKDPSKF  V ++ FS  T+LY A+A
Sbjct  534   ATGRVFDLANLPVTIGIFGFGYSGHSVFPNIYSSMKDPSKFPLVLVICFSFCTVLYIAVA  593

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPS-  1124
               G  MFG  + SQ TL+MP+H + +K+A+W  V+TPMTKYAL   P  + L+  +P + 
Sbjct  594   VCGYTMFGEAIESQFTLNMPKHFISSKIAVWTAVVTPMTKYALTITPIVLSLEELIPKAK  653

Query  1125  MKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFW  1304
             MK H  +II     +IL+   L +AL VP+F  V +L GS +++ ++++ PC  Y  I  
Sbjct  654   MKSHGVSII---FRTILVASTLVVALSVPFFAIVATLIGSFLAMLVALIFPCLCYLSILK  710

Query  1305  PKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
              K+++  +   + +I+FG +    GT S+   L
Sbjct  711   GKLTKTQIGLCMFIILFGLVSGCCGTYSAISRL  743



>ref|XP_009122801.1| PREDICTED: vacuolar amino acid transporter 1 [Brassica rapa]
Length=547

 Score =   250 bits (639),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 142/394 (36%), Positives = 230/394 (58%), Gaps = 7/394 (2%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             + N  S   +++N   +L GLG ++ PYA+++ GW+   +L   GVI  +T  LL +CL 
Sbjct  153   QSNLCSVSQSILNGTNVLCGLGLITMPYAIKESGWLGLLILSFFGVITCYTGILLKRCLE  212

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLT-  587
               P  + Y DIGQ AFG  GR + +  +Y+E++ A V Y I + DNL+ +F    L +T 
Sbjct  213   SSPGLQTYPDIGQAAFGITGRCIISILLYIELYAACVEYIIMMSDNLSGLFPNVSLGITP  272

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
             G+ L ++Q   V+  ++ LP++W +DLS +S+LS  G+L S+L+ + +        +  +
Sbjct  273   GLSLDSAQTFAVLTTILVLPTVWLKDLSLLSYLSVGGVLASVLLGLCLLWVGAVDGIGFH  332

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
                  +   N+P   G++ F Y+GH VFPNIY++MKDPSKF  V ++ F   T+LY A+A
Sbjct  333   ATGKLMDFGNLPVAIGIFGFGYSGHSVFPNIYSSMKDPSKFPLVLVICFGFCTVLYIAIA  392

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLP-PS  1124
               G  MFG  + SQ TL+MP+H + +K+A+W  V+TPMTKYAL   P  + L+  +P   
Sbjct  393   VCGYTMFGEALQSQFTLNMPKHFLPSKIAVWTAVVTPMTKYALTITPIVLSLEELIPMAK  452

Query  1125  MKHH-IKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
             M+ H +  + R    +IL++  L +AL VP+F  V +L GS +++ ++++ PC  Y  I 
Sbjct  453   MRSHGVSILFR----TILVISTLVVALSVPFFAIVAALIGSFLAMLVALIFPCLCYLSIL  508

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
               K++   +   + +IVFG +    GT S+   L
Sbjct  509   KGKLTNTQIGLCMFIIVFGLVSGCCGTYSAISRL  542



>ref|XP_003572249.1| PREDICTED: vacuolar amino acid transporter 1-like [Brachypodium 
distachyon]
Length=565

 Score =   251 bits (640),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 137/398 (34%), Positives = 230/398 (58%), Gaps = 10/398 (3%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E +     S+    +N I +L G+G LSTPYA+++GGW+   +L+   ++  +T  LL +
Sbjct  170   EVSPYQQCSYTQGAMNGINVLCGVGILSTPYAIKQGGWLGLVILVLFALLAWYTGVLLRR  229

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL      + Y DIG  AFGT GRI  +  +Y+E++   + Y I   DNL+ +F   HL 
Sbjct  230   CLDSKEGLQTYPDIGHAAFGTTGRIAISVILYIELYACCIEYLILESDNLSKLFPNVHLT  289

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             +  + L++     ++  ++ +P+ W RDL+ +S++S  G++ S+L+ + +    V   V 
Sbjct  290   IGSLTLNSHVFFAILTTIIVMPTTWLRDLTCLSYISVGGVIASILVVICLFWIGVVDHVG  349

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
               ++   L+LP IP   GLY + Y+GH VFPNIY+++K+ ++F  +     +  TIL+ A
Sbjct  350   FENKGATLNLPGIPIAIGLYGYCYSGHGVFPNIYSSLKNRNQFPSILFTCIAFSTILFAA  409

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
              A MG KMFG    SQ TL++P +++ +K+A+WATV  P+TKYAL   P A+ L+  LP 
Sbjct  410   AAVMGYKMFGESTESQFTLNLPENLLVSKIAVWATVANPITKYALTITPLAMSLEELLPR  469

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFY----  1289
             S + +   I+     S L+   L +AL VP+F  V+SL GSL+++ ++ +LPC  +    
Sbjct  470   SQQKYSNIIM---LRSALVASTLLIALSVPFFALVMSLIGSLLAMLVTYILPCACFLAIL  526

Query  1290  -TKIFWPKISRP--LLIFNVVLIVFGTLLAVSGTVSSF  1394
              TK+ W +I+    ++I  V     GT  ++SG + ++
Sbjct  527   KTKVTWYQITACSFIIIVGVSCACVGTYSSLSGIIQNY  564



>ref|XP_010554769.1| PREDICTED: vacuolar amino acid transporter 1 [Tarenaya hassleriana]
Length=523

 Score =   249 bits (636),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 139/382 (36%), Positives = 213/382 (56%), Gaps = 2/382 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   + N + ++ G+G LSTP+ +++ GW S F+L+   VIC +T  L+  C       
Sbjct  136   SFTQTIFNGVNVMAGVGLLSTPFTVKEAGWASMFILVLFAVICCYTASLMRDCFESKSGI  195

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNLA +F GT L   GI L +
Sbjct  196   VTYPDIGEAAFGKYGRILICVLLYTELYSYCVEFIILEGDNLAGLFPGTSLNWIGIHLDS  255

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
             + L  ++  L+ LPS+W RDL  IS+LS+ G+  +LLI ++       G +  +H    +
Sbjct  256   THLFGILTALIVLPSVWLRDLRIISYLSAGGVFATLLIALSTFFLGTTGGIGFHHTGELV  315

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 +P   G+Y F Y+GH VFPNIY +M D ++FTK  I  F +  ++Y  +A MG  M
Sbjct  316   KWSGLPFAIGVYGFCYSGHSVFPNIYQSMADKTQFTKALITCFLLCVVIYGGVAVMGYLM  375

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+    ++VA W TV+ P TKYAL   P A  ++  LP  +   I  
Sbjct  376   FGEATLSQITLNMPKDAFASQVAQWTTVINPFTKYALLMNPLARSIEELLPARISDSIWC  435

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   + +A  +P+F  V++L GSL+SI ++IV+P   + KI   + +R  
Sbjct  436   FVLLRTA--LVASSVCVAFLLPFFGLVMALIGSLLSILVAIVMPALCFMKIVGNRATRTQ  493

Query  1326  LIFNVVLIVFGTLLAVSGTVSS  1391
             ++ +  ++  G + A+ GT SS
Sbjct  494   IVLSSAIVAIGVVSAILGTYSS  515



>ref|XP_009133472.1| PREDICTED: vacuolar amino acid transporter 1-like [Brassica rapa]
 emb|CDY35425.1| BnaA03g19350D [Brassica napus]
Length=520

 Score =   249 bits (636),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 139/382 (36%), Positives = 214/382 (56%), Gaps = 2/382 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             S    + N I ++ G+G LSTPY +++ GW S  +L+   VIC +T  L+  C    P  
Sbjct  133   SVTQTIFNGINVMAGVGLLSTPYTVKEAGWASMVILLMFAVICCYTATLMKDCFENKPGI  192

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT +   GI++ +
Sbjct  193   ITYPDIGEAAFGKYGRILICVLLYTELYSYCVEFIILEGDNLTGLFPGTSIDWLGIKIDS  252

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  ++  L+ LP++W +DLS IS+LS+ G++ ++LI V+       G +  NH    +
Sbjct  253   IHLFGIITALIILPTVWLKDLSIISYLSAGGVIATVLIAVSTFFLGTTGGIGFNHTGHAV  312

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 IP   G+Y F Y+GH VFPNIY +M D +KF K  I  F +  ++Y  +A MG  M
Sbjct  313   KWNGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITCFILCVLIYGGVAIMGYLM  372

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+  +F+KVA W TV++P TKYAL   P A  ++  LP  +  +I  
Sbjct  373   FGEATLSQITLNMPKGSLFSKVAQWTTVVSPFTKYALLMNPLARGIEELLPERISENIWC  432

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  V++L GSL+SI ++I++P   + +I   K +R  
Sbjct  433   FLLLRTA--LVASSVCSAFLIPFFGLVMALIGSLLSILVAIIMPALCFMRIMGNKATRTQ  490

Query  1326  LIFNVVLIVFGTLLAVSGTVSS  1391
             +I +  ++  G +  + GT SS
Sbjct  491   MILSSTIVAIGLVSGILGTYSS  512



>ref|XP_002438439.1| hypothetical protein SORBIDRAFT_10g019640 [Sorghum bicolor]
 gb|EER89806.1| hypothetical protein SORBIDRAFT_10g019640 [Sorghum bicolor]
Length=571

 Score =   251 bits (640),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 141/398 (35%), Positives = 224/398 (56%), Gaps = 9/398 (2%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E +   N S+   V+N I +L G+G LSTPYA+++GGWI   +L    ++  +T  LL  
Sbjct  176   EASRNRNCSYTQGVMNGINVLCGVGILSTPYAIKQGGWIGLVILCLFALLAWYTGVLLRH  235

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL      + Y DIG  AFG+ GRI+ +  +Y+E++   + Y I   DNL  +F   HL 
Sbjct  236   CLDSKEGLETYPDIGHAAFGSTGRIVISIILYVELYACCIEYLILESDNLTKLFPTAHLT  295

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             +  + L++     ++  ++ +P+ W RDLS +S++S+ G++ S+L+   V C  + GVVN
Sbjct  296   IGSLTLNSHVFFAILTTIIVMPTTWLRDLSCLSYISAGGVIASILV---VICLFLVGVVN  352

Query  762   P---NHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTIL  932
                  +    L+LP IP   GLY + Y+GH VFPNIY+++K+ ++F  +      + T L
Sbjct  353   DVGFENEGTALNLPGIPIAIGLYGYCYSGHGVFPNIYSSLKNRNQFPSILFTCIGLSTFL  412

Query  933   YTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHS  1112
             Y   A MG KMFG    SQ TL++P + + +KVA+W TV  P+TKYAL   P A+ L+  
Sbjct  413   YAGAAVMGYKMFGEATESQFTLNLPDNSLISKVAVWTTVANPITKYALTIIPLAMSLEEL  472

Query  1113  LPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYT  1292
             LPP+ + +   I+     S L++  L +AL VP+F  V++L GSL ++ ++ +LPC  + 
Sbjct  473   LPPNQQKYSTIIM---LRSSLVMSTLLIALSVPFFGLVMALVGSLFAMLVTYILPCACFL  529

Query  1293  KIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
              I   K+    +     +I  G   A  GT SS   ++
Sbjct  530   AILKTKVGWHQIAACSFIIAVGVCCACVGTYSSLSKII  567



>ref|XP_002323513.1| amino acid transporter family protein [Populus trichocarpa]
 gb|EEF05274.1| amino acid transporter family protein [Populus trichocarpa]
Length=532

 Score =   249 bits (637),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 143/388 (37%), Positives = 224/388 (58%), Gaps = 14/388 (4%)
 Frame = +3

Query  234   KNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGK  413
                +S   +++N   +L G+G L+ PYA+++GGW+S  +L   GVIC +T  LL  CL  
Sbjct  148   DQKASLAQSILNGTNVLCGIGLLTMPYAIKEGGWLSLIILSLFGVICCYTGILLKNCLES  207

Query  414   DPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGI  593
              P  + Y DIGQ AFG  GR++ ++        + V Y I + DNL+T+F   ++   GI
Sbjct  208   SPGLQTYPDIGQAAFGVGGRLVISA--------SCVEYVIMMSDNLSTLFPNMYMDFAGI  259

Query  594   QLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHR  773
              L   Q+ ++ A L+ LP++W RDLS +S+LS  G++ S+++ + +  T V   +  +  
Sbjct  260   HLDCHQIFSITATLIVLPTVWLRDLSLLSYLSVGGVVASIIVALCLLWTGVIDKIGFHPT  319

Query  774   IPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFM  953
                L L N+P   G+Y F ++GH VFPNIY++MK+PS+F  V I SF    ++YT  A  
Sbjct  320   GTALDLANLPVAIGIYGFGFSGHSVFPNIYSSMKEPSRFPTVLITSFIFCWLMYTGAAIC  379

Query  954   GAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSM--  1127
             G  MFG  + SQ TL+MP   V +KVA+W  V+ PMTKYAL   P A+ L+  +P     
Sbjct  380   GFLMFGNSIESQYTLNMPAQFVSSKVAVWTAVVNPMTKYALVMMPVALSLEELVPSGRFS  439

Query  1128  KHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWP  1307
              + +  IIR    +IL+   LA+AL VP+F  V++L GSL+++ ++++ PC  Y  I   
Sbjct  440   SYGVSLIIR----TILVTSTLAVALAVPFFGFVMALIGSLLAMLVAVIFPCVCYLSILHE  495

Query  1308  KISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             ++++  +   +     G L A  GT S+
Sbjct  496   RLTKLQIAACLFTTGVGVLFACVGTYSA  523



>emb|CDY18351.1| BnaA04g22360D, partial [Brassica napus]
Length=509

 Score =   249 bits (635),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 142/445 (32%), Positives = 245/445 (55%), Gaps = 21/445 (5%)
 Frame = +3

Query  132   DGHKHVEPASGERFEDQTAVKDLESSEECVEQAEK--------NNSSFMHAVINMIGMLI  287
             +  +   P    R      +  + S    + + E+         NSS+  AV+N + +L 
Sbjct  67    EAEEQAPPPPKHRLSSHGLLPPVPSRRSSMRKDERVSHEVPMSRNSSYGQAVMNGLNVLC  126

Query  288   GLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTK  467
             G+G LSTPYA ++GGW+   +L   G++  +T  LL  CL  +   + Y DIGQ AFGT 
Sbjct  127   GVGILSTPYAAKEGGWLGLGILFIYGLLSFYTGILLRYCLDSESDLETYPDIGQAAFGTT  186

Query  468   GRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALP  647
             GRI  +  +YLE++   V Y I   DNL++++    L + G +L    L  ++  +  LP
Sbjct  187   GRIFVSIVLYLELYACCVEYIILESDNLSSLYPNAGLSIGGFELDARHLFALLTTIAVLP  246

Query  648   SLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAF  827
             ++W RDLS +S++S+ G++ S+L+ +++    +   V  + +   L+L  +P   GLY +
Sbjct  247   TVWLRDLSLLSYISAGGVIASVLVVLSLFWIGLVDDVGIHSKGTTLNLSTLPVAIGLYGY  306

Query  828   SYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMP  1007
              Y+GH VFPNIYT+M +P+++    +  F++ T++Y  +AFMG  MFG    SQ TL++P
Sbjct  307   CYSGHAVFPNIYTSMANPNQYPSALLTCFTICTLMYAGVAFMGYTMFGEATESQFTLNLP  366

Query  1008  RHVVFTKVALWATVLTPMTKY-------ALEFAPFAIELDHSLPP--SMKHHIKTIIRGG  1160
             + +V TK+A+W TV+ P TKY       A+     A+ L+  +P   +  H     IR  
Sbjct  367   QDLVATKIAVWTTVVNPFTKYPFQENYSAIILFYLALSLEELIPSRHNKSHWYAIAIR--  424

Query  1161  TGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNV  1340
               + L+   L + L +P+F  V+SL GSL+++ ++++LP   +  I   K++R  ++  V
Sbjct  425   --TALVFSTLLVGLAIPFFGLVMSLIGSLLTMLVTLILPPACFLSIVRRKVTRTQMMLCV  482

Query  1341  VLIVFGTLLAVSGTVSSFKLLVISL  1415
             ++IV G + +V G+ S+   ++  L
Sbjct  483   LIIVVGAISSVIGSYSALSQIIEKL  507



>emb|CBI31429.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   250 bits (639),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 150/443 (34%), Positives = 243/443 (55%), Gaps = 21/443 (5%)
 Frame = +3

Query  138   HKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYA  317
             H  + P    R   + A  D +  +   E      SS+  AV+N + +L G+G LSTPYA
Sbjct  127   HSLLPPIPSRRSYIKKAGLDQKPHKVSHEVPISRQSSYGQAVLNGMNILCGVGILSTPYA  186

Query  318   LEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIY  497
             +++GGW+   +L+   ++  +T  LL  CL   P  + Y DIGQ AFGT GR   +  +Y
Sbjct  187   VKEGGWVGLSILLIFALLSFYTGILLRYCLDSAPGLETYPDIGQAAFGTTGRFAISIILY  246

Query  498   LEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSI  677
             +E++   V Y I   DNL+++F   HL      L +  L  +M  L  LP++W RDLS +
Sbjct  247   VELYACCVEYIILESDNLSSLFPNAHLNFGVFHLGSHHLFALMTALAVLPTVWLRDLSVL  306

Query  678   SFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPN  857
             S++S+ G++ S+L+ + +    +   V        L+L N+P   GLY + Y+GH VFPN
Sbjct  307   SYISAGGVVASILVVLCLFWVGLVDQVGFQSEGTVLNLTNLPVAIGLYGYCYSGHAVFPN  366

Query  858   IYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVAL  1037
             IYT+M  PS++  V ++SF++ T+LY  +A +G +MFG    SQ TL+MP+ +V +K+A+
Sbjct  367   IYTSMAKPSQYPSVLLISFAICTLLYAGVAVLGYQMFGESTLSQFTLNMPQDLVASKIAV  426

Query  1038  WATVLTPMTK---------------YALEFAPFAIELDHSLP--PSMKHHIKTIIRGGTG  1166
             W TV+ P TK               YAL  +P A+ L+  +P   S  H    +IR    
Sbjct  427   WTTVVNPFTKYPFSNIIRFSDEEATYALTMSPVAMSLEELIPSNQSKSHMYAILIR----  482

Query  1167  SililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVL  1346
             + L++  L + L VP+F  V++L GSL+++ ++++LPC  +  I   KI+R      +++
Sbjct  483   TALVISTLLVGLTVPFFGLVMALIGSLLTMLVTLILPCACFLSILRGKITRFQGSLCILI  542

Query  1347  IVFGTLLAVSGTVSSFKLLVISL  1415
             I  G + +  GT S+   ++  L
Sbjct  543   IAVGVVSSAFGTYSALAKIIEKL  565



>emb|CDY55126.1| BnaA03g55030D [Brassica napus]
Length=514

 Score =   249 bits (635),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 140/404 (35%), Positives = 225/404 (56%), Gaps = 13/404 (3%)
 Frame = +3

Query  195   DLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVIC  374
             +L + E+     E  + +F  +V+N I +L G+  L+ PYA+++GGW+  F+L   GVI 
Sbjct  120   NLSAPEDLSFPQETRSCTFSQSVLNGINVLCGVALLTMPYAVKEGGWLGLFILFSFGVIT  179

Query  375   AFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLA  554
              +T  LL +CL   P    Y DIGQ AFGT GRIL +  +Y+E++ + V Y I + DNL+
Sbjct  180   FYTGILLKRCLENSPGIHTYPDIGQAAFGTTGRILVSILLYVELYASCVEYIIMMSDNLS  239

Query  555   TVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVA  734
              +F  T L ++G+ L + Q+  +   ++ LP++W RDLS +S+LS+ G+  S+L+ + + 
Sbjct  240   GMFPNTSLYISGLSLDSKQVFAITTTIIVLPTVWLRDLSLLSYLSAGGVFSSILLALCLF  299

Query  735   CTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSF  914
                  G V  +     L + N+P   G+Y F +  H VFPNIY++MK+PSKF        
Sbjct  300   WAGSVGGVGFHLTGKALDIANLPVAIGIYGFGFGSHSVFPNIYSSMKEPSKFP-------  352

Query  915   SVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFA  1094
                      LA  G  MFG  + SQ TL++P+H   +K+A W  V+TPMTKYAL   P  
Sbjct  353   ------LKPLAVCGYTMFGDAIQSQFTLNIPQHFTSSKIAAWTAVVTPMTKYALTITPVV  406

Query  1095  IELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVL  1274
             + L+  +P S +      +     S+L+L  L +AL VP+F  V +L GS +++ I+++ 
Sbjct  407   LSLEELIPSSSRKMKSKGVSMLFRSVLVLSTLVVALTVPFFATVAALIGSFIAMLIALIF  466

Query  1275  PCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
             PC  Y  I   ++S   +   + +++ G +    GT S+   L+
Sbjct  467   PCLCYMSIMKGRLSNSQMGICIFIVIIGVVSGCCGTYSAIARLI  510



>ref|XP_002994629.1| hypothetical protein SELMODRAFT_432534 [Selaginella moellendorffii]
 gb|EFJ04307.1| hypothetical protein SELMODRAFT_432534 [Selaginella moellendorffii]
Length=415

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 134/404 (33%), Positives = 239/404 (59%), Gaps = 13/404 (3%)
 Frame = +3

Query  192   KDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVI  371
             + L+ +++   Q +   SSF+HA  N +  ++G+  L+TPYALE+GGW+   +L    VI
Sbjct  11    QSLDQNDQ--SQNKLQRSSFLHATFNSVSAILGISFLTTPYALEQGGWLGLSILFAFSVI  68

Query  372   CAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNL  551
             C +T ++LG+CL  +     Y  I + AFG++ R+     +  E+   LV YTIS+ DNL
Sbjct  69    CCYTAYVLGRCLTPN---GSYNTIAETAFGSRARLPFTLLVQFEMIAVLVGYTISMGDNL  125

Query  552   ATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTV  731
             A +F    L+++ +++  S++L  +A LV LP++W R+L+ IS+LS  GI+  ++I VT+
Sbjct  126   ARLFPHATLRISALEIGPSKVLLFIAFLVVLPTVWLRNLAWISYLSLFGIVTYMIITVTM  185

Query  732   ACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVS  911
                     +  +H +P L   N+ +++G+YA+ +A H   P++YT++K+PS + KV ++S
Sbjct  186   IYAGAGLGIGFHHSVPHLRPENLLNIAGIYAYCFAAHCALPSVYTSLKNPSNYAKVLVLS  245

Query  912   FSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPF  1091
             F + T++Y   AF+G  MFG     Q++L++P H+V  K+ LW  VL P +KY+L  AP 
Sbjct  246   FMIATMIYIGFAFLGGTMFGDYTLPQVSLNIPTHLVAAKLVLWMVVLLPFSKYSLCLAPI  305

Query  1092  AIELDHSLP-PSMKHHI---KTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIG  1259
             A++++   P P+          ++R G    L++ +  LA+  PYFE +++  GS   + 
Sbjct  306   ALDIESKFPWPNTSRSFVASSLLLRTG----LLIFVFLLAMVFPYFETMVAFIGSASGML  361

Query  1260  ISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             +++ LP  FY +I+   + +     N  ++  GT + ++GT++S
Sbjct  362   VAVTLPSLFYLRIYRNVMPKWEAGVNYAILAVGTAVGMAGTIAS  405



>emb|CDY40336.1| BnaA10g27320D [Brassica napus]
Length=547

 Score =   249 bits (637),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 141/394 (36%), Positives = 230/394 (58%), Gaps = 7/394 (2%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             + N  S   +++N   +L GLG ++ PYA+++ GW+   +L   GVI  +T  LL +CL 
Sbjct  153   QSNLCSVSQSILNGTNVLCGLGLITMPYAIKESGWLGLLILSFFGVITCYTGILLKRCLE  212

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLT-  587
               P  + Y DIGQ AFG  GR + +  +Y+E++ A V Y I + DNL+ +F    L +T 
Sbjct  213   SSPGLQTYPDIGQAAFGITGRCIISILLYIELYAACVEYIIMMSDNLSGLFPNVSLGITP  272

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
             G+ L ++Q   V+  ++ LP++W +DLS +S+LS  G+L S+L+ + +        +  +
Sbjct  273   GLSLDSAQTFAVLTTILVLPTVWLKDLSLLSYLSVGGVLASVLLGLCLFWVGAVDGIGFH  332

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
                  +   N+P   G++ F Y+GH VFPNIY++MKDPSKF  V ++ F   T+LY A+A
Sbjct  333   ATGKLMDFGNLPVAIGIFGFGYSGHSVFPNIYSSMKDPSKFPLVLVICFGFCTVLYIAIA  392

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLP-PS  1124
               G  MFG  + SQ TL+MP+H + +K+A+W  V+TPMTKYAL   P  + L+  +P   
Sbjct  393   VCGYTMFGEALQSQFTLNMPKHFLPSKIAVWTAVVTPMTKYALTITPIVLSLEELIPMAK  452

Query  1125  MKHH-IKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
             M+ H +  + R    +IL++  L +AL VP+F  V +L GS +++ ++++ PC  Y  I 
Sbjct  453   MRSHGVSILFR----TILVISTLVVALSVPFFAIVAALIGSFLAMLVALIFPCLCYLSIL  508

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
               K++   +   + +I+FG +    GT S+   L
Sbjct  509   KGKLTNTQIGLCMFIIIFGLVSGCCGTYSAISRL  542



>gb|ACN33733.1| unknown [Zea mays]
 gb|AFW76712.1| amino acid permease [Zea mays]
Length=555

 Score =   249 bits (637),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 147/429 (34%), Positives = 234/429 (55%), Gaps = 20/429 (5%)
 Frame = +3

Query  162   GERFEDQTAVKDLESSEECVEQAEK-----------NNSSFMHAVINMIGMLIGLGQLST  308
             G R   +  V    SS + + + +K            N S+   V+N I +L G+G LST
Sbjct  129   GTRKSSEYLVPSRRSSLQQIPEDQKPPVGGHGASHDQNCSYTQGVMNGINVLCGVGILST  188

Query  309   PYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAAS  488
             PYA+++GGWI   +L    ++  +T  LL  CL      K Y DIG  AFG+ GRI+ + 
Sbjct  189   PYAIKQGGWIGLAILCTFALLAWYTGVLLRHCLDSKEGLKTYPDIGHAAFGSTGRIVISI  248

Query  489   FIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDL  668
              +Y+E++   + Y I   DNL+ +F   HL +  + L++     ++  ++ +P+ W RDL
Sbjct  249   ILYVELYACCIEYLILEGDNLSKLFPNAHLTIGSMTLNSHVFFAILTTIIVMPTTWLRDL  308

Query  669   SSISFLSSAGILMSLLIFVTVACTAVFGVVNP---NHRIPPLHLPNIPSVSGLYAFSYAG  839
             S +S++S+ G++ S+L+   V C  + GVVN     +    L+ P IP   GLY + Y+G
Sbjct  309   SWLSYISAGGVIASILV---VICLFLVGVVNDFGFENEGTALNAPGIPIAIGLYGYCYSG  365

Query  840   HIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVV  1019
             H VFPNIY+++K+ ++F  +      + T LY   A MG KMFG    SQ TL++P + V
Sbjct  366   HGVFPNIYSSLKNRNQFPSILFTCIGLSTFLYAGAAVMGYKMFGEATESQFTLNLPDNSV  425

Query  1020  FTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilala  1199
              +K+A+W TV  P+TKYAL   P A+ L+  LPP+ + +   I+     S L++  L +A
Sbjct  426   ISKIAVWTTVANPITKYALTIIPLAMSLEELLPPNQQKYSTIIM---LRSSLVISTLLIA  482

Query  1200  lCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSG  1379
             L VP+F  V++L GSL ++ ++ +LPC  +  I   K+    +     +IV G   A  G
Sbjct  483   LSVPFFGLVMALVGSLFAMLVTYILPCACFLAILKTKVGWHQIAACSFIIVVGVCCAYVG  542

Query  1380  TVSSFKLLV  1406
             T SS   ++
Sbjct  543   TYSSLSKII  551



>ref|XP_010452050.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Camelina sativa]
Length=553

 Score =   249 bits (637),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 152/428 (36%), Positives = 239/428 (56%), Gaps = 15/428 (4%)
 Frame = +3

Query  129   PDGHKHVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLST  308
             PD  + + P +    + + +V DL S        E N  SF  +V+N   +L GLG ++ 
Sbjct  133   PDKDETISPFNPSS-QLKLSVTDLPS-------PETNLCSFSQSVLNGTNVLCGLGLITM  184

Query  309   PYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAAS  488
             PYA+++ GW+   +L+  GVI  +T  L+ +CL   P  + Y DIGQ AFG  GR + + 
Sbjct  185   PYAIKESGWLGLLILLFFGVITCYTGVLMKRCLESSPGLQTYPDIGQAAFGITGRFIISI  244

Query  489   FIYLEIFMALVSYTISLHDNLATVFLGTHLKL-TGIQLSTSQLLTVMAVLVALPSLWFRD  665
              +Y+E++ A V Y I + DNL+ +F    L + +GI L +SQ+  ++  ++ LP++W +D
Sbjct  245   LLYVELYAACVEYIIMMSDNLSGLFPNISLSIASGISLDSSQIFAILTTILVLPTVWLKD  304

Query  666   LSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHI  845
             LS +S+LS  G+L S+L+ + +    V   +  +         N+P   G++ F Y+GH 
Sbjct  305   LSLLSYLSVGGVLASILLGLCLFWIGVVDGIGFHATGKVFDFYNLPVAIGIFGFGYSGHS  364

Query  846   VFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFT  1025
             VFPNIY++MKDPSKF  V ++ FS  T LY A+A     MFG  V SQ TL+MP+    +
Sbjct  365   VFPNIYSSMKDPSKFPLVLVICFSFCTFLYIAVAICCYTMFGEAVESQFTLNMPKQFFPS  424

Query  1026  KVALWATVLTPMTKYALEFAPFAIELDHSLPPS--MKHHIKTIIRGGTGSililiilala  1199
             KVA+W  V+TPMTKYAL   P  + L+  +P +    H +  + R      L+   L +A
Sbjct  425   KVAVWTAVITPMTKYALTITPIVMSLEELIPTAKMRSHGVSILFRAA----LVTSTLVVA  480

Query  1200  lCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSG  1379
             L VP+F  V +L GS +++ ++++ PC  Y  I   K+S   +   V +I+FG +    G
Sbjct  481   LSVPFFAIVAALIGSFLAMLVALIFPCLCYLSILKGKLSNTQIGLCVFIILFGLVSGCCG  540

Query  1380  TVSSFKLL  1403
             T S+   L
Sbjct  541   TYSAISRL  548



>ref|XP_009348276.1| PREDICTED: vacuolar amino acid transporter 1 [Pyrus x bretschneideri]
Length=534

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 146/422 (35%), Positives = 234/422 (55%), Gaps = 5/422 (1%)
 Frame = +3

Query  150   EPASGERFE-DQTAVKDLESSEECV--EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYAL  320
             +    ERF  +Q+ + +  +  + +  E    +  SF   V N I ++ G+G LSTP  L
Sbjct  112   QKGDSERFSVNQSLLSERSTLHKHLTGEIPVGHGCSFTQTVFNGINVMAGVGLLSTPSTL  171

Query  321   EKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYL  500
             ++ GW    +L+   V+C +T  L+  C       K Y D+G+ AFG  GR+  +  +Y 
Sbjct  172   KEAGWAGIVVLLLFAVVCCYTAILMRYCFESKEGIKTYPDLGEAAFGRYGRLFISIILYA  231

Query  501   EIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSIS  680
             E++   V + I   DNL+ +F GT L   G QL +  L  ++  L+ LPS+W +DL  IS
Sbjct  232   ELYSYCVEFIILEGDNLSRLFPGTSLNWAGFQLDSMHLFGIVTALIVLPSVWLKDLRLIS  291

Query  681   FLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNI  860
             FLS+ G+++++LI + V      G V  +H  P +H   IP V G+Y F +AGH VFPNI
Sbjct  292   FLSAGGVIVTVLIVLCVILLGTAGGVGFHHTPPAVHWNGIPLVIGVYGFCFAGHTVFPNI  351

Query  861   YTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALW  1040
             Y +M D  +F+K  I+ F +  +LY ++A MG  MFG    SQITL+MP H   ++VALW
Sbjct  352   YQSMADRRQFSKALIICFILCVLLYGSVAVMGYLMFGERTLSQITLNMPPHAFLSQVALW  411

Query  1041  ATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFE  1220
              TV+ P++KYAL   P A  ++  LP ++ +     I   T   L++  +  A  +P+F 
Sbjct  412   TTVINPLSKYALLMNPLARSIEELLPVTISNSSWCFILLRTA--LVISTVVSAFLIPFFG  469

Query  1221  HVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKL  1400
              V++L GSL+SI +S+++P   + +I   K +R  ++ ++ +   G + A  GT S+   
Sbjct  470   LVMALIGSLLSILVSVIVPSLCFLRIAGRKATRTQVVSSITISTLGIIAAALGTYSALSK  529

Query  1401  LV  1406
             +V
Sbjct  530   IV  531



>ref|XP_009407617.1| PREDICTED: vacuolar amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=539

 Score =   249 bits (636),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/364 (39%), Positives = 219/364 (60%), Gaps = 13/364 (4%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E    +  S   AV+N I +L G+G LSTPYA+++GGW+   LL  L  I  +T  LL +
Sbjct  146   ELPPPHQCSAAQAVVNGINVLCGVGLLSTPYAVKEGGWLGMLLLFCLASISFYTGILLKR  205

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL   P  K Y DIG  AFG  GRI  +  +YLE++   V Y I + D+L  +F    + 
Sbjct  206   CLDSFPGLKTYPDIGHAAFGLSGRIFISIVLYLELYGCCVEYIILVSDSLTFIFPDASIS  265

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
               G+ LS  QL  +   +  LP++W ++LS +S+LS+AG++ ++L+ +   C    GVV+
Sbjct  266   FLGLDLSPHQLFALTTAIAVLPTVWLKNLSVLSYLSAAGVVATILVII---CLLWGGVVD  322

Query  762   -----PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVT  926
                  P  R   L+L ++P   GLY F Y+GH VFPNIY++MK PS+F  V I+ F + T
Sbjct  323   QIGFHPGGR--ALNLVDLPVALGLYGFGYSGHSVFPNIYSSMKRPSQFPTVLIICFVLCT  380

Query  927   ILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELD  1106
             I+Y+A+A  G  MFG  + SQ TL+MPR  + +KVA+W TV+ P++KYAL   P A+ L+
Sbjct  381   IMYSAVAVAGYLMFGDSLKSQFTLNMPRQYLASKVAVWTTVINPLSKYALTMTPVALSLE  440

Query  1107  HSLPPSMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGF  1286
               LP + + +I  +      + L+L  L +AL +P+F +V++L GS+ ++ ++++LPC  
Sbjct  441   ELLPSTSQSNIVML---SLRTFLVLSTLVVALTLPFFGYVMALLGSVFTMLVALILPCSC  497

Query  1287  YTKI  1298
             Y  I
Sbjct  498   YLSI  501



>ref|XP_008667918.1| PREDICTED: amino acid permease isoform X1 [Zea mays]
 tpg|DAA38553.1| TPA: hypothetical protein ZEAMMB73_614746 [Zea mays]
Length=573

 Score =   250 bits (638),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 149/432 (34%), Positives = 238/432 (55%), Gaps = 13/432 (3%)
 Frame = +3

Query  144   HVEPASGERFEDQTAVKDLESSEECVEQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALE  323
             H  P S +    Q   +D        E       S+   V+N + +L G+G LSTPYA++
Sbjct  148   HYLPPSRKASSLQRIPEDQRPMVGGHEVGPYRQCSYTQGVMNGVNVLCGVGILSTPYAVK  207

Query  324   KGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLE  503
             +GGW+   +L  LG +  +T  LL +CL      + Y DIG  AFGT GRI+ +  +Y+E
Sbjct  208   QGGWLGLVILAVLGALAWYTGILLRRCLDSKDGLETYPDIGHAAFGTAGRIIISIILYME  267

Query  504   IFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISF  683
             ++   + Y I   DNL+ +F   HL +  + L +  L  ++  LV +P+ W RDLS +SF
Sbjct  268   LYACCIEYLILESDNLSKLFPNAHLTMGNLTLDSHMLFAILTALVVMPTTWLRDLSCLSF  327

Query  684   LSSAGILMSLLIFVTVACTAVFGVVNPNHRIP----PLHLPNIPSVSGLYAFSYAGHIVF  851
             +S+ G++ S++I   V+C    G+V+    +      L+LP IP   GLY + Y+GH VF
Sbjct  328   ISAGGVIASIVI---VSCLFWVGLVDHVGTVESEGTALNLPGIPIAIGLYGYCYSGHGVF  384

Query  852   PNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITLSMPRHVVFTKV  1031
             PNIY+++K  ++F  V     ++ T+L+ A A MG  MFG    SQ TL++P ++V +K+
Sbjct  385   PNIYSSLKKSNQFPAVLFTCIALSTVLFAAAAIMGYIMFGESTESQFTLNLPPNLVASKI  444

Query  1032  ALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKTIIRGGTGSililiilalalCVP  1211
             A+W TV  P+TKYAL   P A+ L+  LPP+ + +   ++     S L++  L +AL VP
Sbjct  445   AVWTTVTNPITKYALTMTPLALSLEELLPPNKQTYPNIMM---LRSALVVSSLIIALSVP  501

Query  1212  YFEH---VLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPLLIFNVVLIVFGTLLAVSGT  1382
             +F     V+SL GS +++ ++ +LPC  +  I   K++   ++  V +IV G      GT
Sbjct  502   FFAFSGLVMSLVGSFLTMFVAYILPCACFLSILRSKVTWYQVVLCVFIIVVGLCCVGVGT  561

Query  1383  VSSFKLLVISLQ  1418
              SS   ++   Q
Sbjct  562   YSSLSKIIQKYQ  573



>gb|KFK36966.1| hypothetical protein AALP_AA4G195600 [Arabis alpina]
Length=529

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/391 (36%), Positives = 216/391 (55%), Gaps = 2/391 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   + N I ++ G+G LSTPY +++ GW S  +L+   VIC +T  L+ +C       
Sbjct  141   SFTQTIFNAINVMAGVGLLSTPYTVKEAGWASMVILLLFAVICCYTATLMKECFENKSGI  200

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F  T L   GI+L +
Sbjct  201   ITYPDIGEAAFGKYGRILICVLLYTELYSYCVEFIILEGDNLTGLFPRTSLDWLGIRLDS  260

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  ++  L+ LP++W +DL  IS+LS+ G++ ++LI V+       G +  +H    +
Sbjct  261   KHLFGILTALIVLPTVWLKDLRIISYLSAGGVIATVLIAVSTFFLGTTGGIGFHHTGHAV  320

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 IP   G+Y F Y+GH VFPNIY +M D +KF K  I  F +  ++Y   A MG  M
Sbjct  321   KWNGIPFAIGIYGFCYSGHSVFPNIYQSMADKTKFNKAVITCFILCVLIYGGTAIMGYLM  380

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+   F+KVA W TV++P TKYAL   P A  ++  LP  +  +I  
Sbjct  381   FGEATLSQITLNMPKDQFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPERISENIWC  440

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T  +L+   +  A  +P+F  V++L GSL+SI ++IV+P   + +I   K +R  
Sbjct  441   FLLLRT--VLVASSVCSAFLIPFFGLVMALIGSLLSILVAIVMPALCFIRIMRNKATRTQ  498

Query  1326  LIFNVVLIVFGTLLAVSGTVSSFKLLVISLQ  1418
             +I + +++  G +    GT SS   +V + Q
Sbjct  499   MILSSIIVAIGVVSGTLGTYSSVAKIVRNYQ  529



>emb|CDY67831.1| BnaCnng56610D [Brassica napus]
Length=533

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/382 (36%), Positives = 212/382 (55%), Gaps = 2/382 (1%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   + N I ++ G+G LSTP+ +++ GW S  +L+   VIC +T  L+  C       
Sbjct  146   SFTQTIFNAINVMAGVGLLSTPFTVKEAGWASMVILLLFAVICCYTASLMKDCFEAKTGI  205

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GRIL    +Y E++   V + I   DNL  +F GT +   GI++ +
Sbjct  206   ITYPDIGEAAFGKYGRILICVILYTELYSYCVEFIILEGDNLTGLFPGTSIDWLGIRIDS  265

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  +   LV LP++W +DL  IS+LS+ G++ ++LI V+       G +  +H  P +
Sbjct  266   KHLFGIFTALVVLPTVWLKDLRIISYLSAGGVIATVLIAVSTFFLGTTGGIGFHHTGPAV  325

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
                 IP   G+Y F Y+GH V PNIY +M D +KF K  I +F +   LY  +A MG  M
Sbjct  326   KWNGIPFAIGIYGFCYSGHSVIPNIYQSMADKTKFNKAVITTFILCVFLYGGVAIMGYCM  385

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG    SQITL+MP+ + F+KVA W TV++P TKYAL   P A  ++  LP  +  +I  
Sbjct  386   FGEATLSQITLNMPKGLFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPERISENIWC  445

Query  1146  IIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKISRPL  1325
              +   T   L+   +  A  +P+F  V++L GS +SI ++IV+P   + +I   K +R  
Sbjct  446   FLLLRTA--LVASSVCSAFLIPFFGLVMALIGSFLSILVAIVMPALCFIRIMGNKATRTQ  503

Query  1326  LIFNVVLIVFGTLLAVSGTVSS  1391
             +I + +++V G +    GT SS
Sbjct  504   MILSSIIVVIGLVSGALGTYSS  525



>ref|XP_004965465.1| PREDICTED: vacuolar amino acid transporter 1-like [Setaria italica]
Length=569

 Score =   249 bits (637),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/395 (35%), Positives = 224/395 (57%), Gaps = 3/395 (1%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E +   N S+   V+N I +L G+G LSTPYA+++GGWI   +L    ++  +T  LL  
Sbjct  174   EVSPYRNCSYTQGVMNGINVLCGVGILSTPYAIKQGGWIGLVILALFALLAWYTGVLLRH  233

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL      + Y DIG  AFG  GR++ +  +Y+E++   + Y I   DNL+ +F   HL 
Sbjct  234   CLDSKEGLETYPDIGHAAFGRTGRLVISIILYVELYACCIEYLILESDNLSKLFPTAHLT  293

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             L  + L++  L  ++  ++ +P+ W RDLS +S++S+ G++ S+L+ + +    V   V 
Sbjct  294   LGSLTLNSHVLFAILTTIIVMPTTWLRDLSCLSYISAGGVIASILVVICLLWVGVVDDVG  353

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
               ++   L+LP IP   GLY + Y+GH VFPNIY ++K+ ++F  +      + T+LY+ 
Sbjct  354   FENKGTVLNLPGIPIALGLYGYCYSGHGVFPNIYLSLKNRNQFPSILFTCIGLSTVLYSG  413

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
              A MG KMFG    SQ TL++P + V +KVA+W TV  P+TKYAL   P A+ L+  LP 
Sbjct  414   AAVMGYKMFGEATESQFTLNLPDNSVVSKVAVWTTVANPITKYALTIIPLAMSLEELLPT  473

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
             + + +   I+     S L++  L +AL VP+F  V++L GSL ++ ++ +LPC  +  I 
Sbjct  474   NQQKYSNIIM---LRSALVVSTLLIALSVPFFGLVMALVGSLFAMLVTYILPCACFLAIL  530

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLV  1406
               K+    +     +IV G   A  GT SS   ++
Sbjct  531   KTKVGWHQIAACSFIIVVGVCCACVGTYSSLSRII  565



>ref|XP_004951173.1| PREDICTED: vacuolar amino acid transporter 1-like [Setaria italica]
Length=565

 Score =   249 bits (636),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/397 (35%), Positives = 226/397 (57%), Gaps = 3/397 (1%)
 Frame = +3

Query  222   EQAEKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGK  401
             E +     S+  AV+N I +L G+G LSTPYA+++GGW+   +L    ++  +T  LL +
Sbjct  170   EVSPHQKCSYTQAVVNGINVLCGVGILSTPYAIKQGGWLGLAILCLFAILAWYTGVLLRR  229

Query  402   CLGKDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLK  581
             CL      + Y DIG  AFGT GRI  +  +Y+E++   + Y I   DNL+ +F   HL 
Sbjct  230   CLDSKEGLETYPDIGHAAFGTTGRIAISIILYVELYACCIEYLILESDNLSKLFPNAHLT  289

Query  582   LTGIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVN  761
             +  + L++     ++  ++ +P+ W RDLS +S+LS+ G++ S+L  + +        V 
Sbjct  290   IGSLTLNSHVFFAILTTIIVMPTTWLRDLSCLSYLSAGGVIASILGVICLFWAGAVDNVG  349

Query  762   PNHRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTA  941
               +    L+LP IP   GLY + Y+GH VFPNIY+++K+ ++F  +     ++ TILY  
Sbjct  350   FENEGTVLNLPGIPIAIGLYGYCYSGHGVFPNIYSSLKNRNQFPSILFTCIALSTILYAG  409

Query  942   LAFMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPP  1121
              A MG KMFG    SQ TL++P ++V +KVA+W TV  P+TKYAL   P ++ L+  LPP
Sbjct  410   AAVMGYKMFGEATKSQFTLNLPENLVVSKVAVWTTVANPITKYALTIIPLSMSLEELLPP  469

Query  1122  SMKHHIKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
             + + +   ++     S L++  L +AL VP+F  V++L GSL+++ ++ +LPC  +  I 
Sbjct  470   NQQKYSNIMM---LRSALVVSTLLIALSVPFFGLVMALVGSLLTMLVTYILPCACFLAIL  526

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLLVIS  1412
               K++   +     ++  G   A  GT SS   ++ S
Sbjct  527   KTKVTWHQVAACSFIMAVGVCCACVGTYSSLSRIIQS  563



>ref|XP_002975417.1| hypothetical protein SELMODRAFT_33314, partial [Selaginella moellendorffii]
 gb|EFJ23618.1| hypothetical protein SELMODRAFT_33314, partial [Selaginella moellendorffii]
Length=387

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/385 (38%), Positives = 223/385 (58%), Gaps = 10/385 (3%)
 Frame = +3

Query  279   MLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKSKDYKDIGQQAF  458
             +L GLG LS PY+L  GGW+   +L   G I  +T ++L +CLG  P +  ++ +G  AF
Sbjct  1     LLPGLGMLSCPYSLHNGGWLGLIVLFSCGAIFCYTAYILARCLGSKPGTSTFQQVGALAF  60

Query  459   GTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLSTSQLLTVMAVLV  638
             G  GRI  A+ + LEI   LV +TISL DNL  +F    + L  ++L+ +Q L +  VL 
Sbjct  61    GRTGRIFVAAIVDLEILGTLVGFTISLRDNLVRIFPHAGVHLPWLELAPTQFLPIAGVLA  120

Query  639   ALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPLHLPNIPSVSGL  818
              LP +W RDLS +S++S  GI   L+I + V    +   +  +H I  ++   +  V+GL
Sbjct  121   VLPIIWVRDLSWLSYVSLGGIATYLIIVLGVLWAGIVDGIGFHHSIALVNPTKLAEVAGL  180

Query  819   YAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKMFGPGVSSQITL  998
             YAF Y+GH++ P IY++MKDPS++ KV+ +SFS+ T++Y  +A  GA MFG  + SQ+TL
Sbjct  181   YAFCYSGHVILPRIYSSMKDPSQYPKVAALSFSIATLIYAVVAIAGATMFGSSIQSQVTL  240

Query  999   SMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSL--PPSMKHHIKTIIRG-----  1157
             S+P+ +   K+ L+  VL P+TKYAL     A+ ++  +  PPS+               
Sbjct  241   SLPKELAVAKLVLFLMVLIPLTKYALVVNTLAVHMESLIPSPPSLSGGGGGGGGAWRSWS  300

Query  1158  --GTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKIS-RPLL  1328
                  S ++ ++L LAL VP FE  ++L GS +S+   ++LP  F+ KIF  + + R  L
Sbjct  301   SVSVRSAIMAVVLLLALAVPAFETTVALIGSGISVTTCVILPAIFFVKIFGARGAPRHEL  360

Query  1329  IFNVVLIVFGTLLAVSGTVSSFKLL  1403
                V+  V G +L + GTVSS + L
Sbjct  361   TLTVIFGVAGVVLGIVGTVSSIRKL  385



>ref|XP_010653971.1| PREDICTED: vacuolar amino acid transporter 1 isoform X1 [Vitis 
vinifera]
Length=537

 Score =   248 bits (634),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 143/386 (37%), Positives = 217/386 (56%), Gaps = 10/386 (3%)
 Frame = +3

Query  246   SFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLGKDPKS  425
             SF   V N + +L G+G LSTPYA+++ GW S  +L+   V+C +T  LL  CL      
Sbjct  150   SFTQTVFNGVNVLAGIGLLSTPYAVKEAGWASLAVLVLFAVVCCYTASLLRYCLESKEGI  209

Query  426   KDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKLTGIQLST  605
               Y DIG+ AFG  GR+  +  +Y E++   V + I   DNL  +F G  L   G QL +
Sbjct  210   ITYPDIGEAAFGRYGRLFVSFVLYTELYSYCVEFIILEGDNLTRLFPGASLNWGGFQLDS  269

Query  606   SQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPNHRIPPL  785
               L  ++  L+ LP++W RDL  IS LS+ G+L ++LI V+V    +   +  +     +
Sbjct  270   LHLFGILTALIVLPTVWLRDLRVISCLSAGGVLATVLIVVSVIFVGITAGIGFHQTGKLV  329

Query  786   HLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALAFMGAKM  965
             +   IP   G+Y F ++GH VFPNIY +M D +KF+K  IVS  +  I+Y  +A +G  M
Sbjct  330   NWGGIPFSIGVYGFCFSGHTVFPNIYQSMADKTKFSKALIVSILLCVIIYGGIAIVGFLM  389

Query  966   FGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLPPSMKHHIKT  1145
             FG G  SQITL++PRHV  +K+ALW TV+ P TKYAL   P A  ++  LP  + +    
Sbjct  390   FGQGTMSQITLNIPRHVFASKIALWTTVINPFTKYALLMNPLARSIEELLPVRISNSFWC  449

Query  1146  IIRGGTGSililiilalalCV----PYFEHVLSLTGSLVSIGISIVLPCGFYTKIFWPKI  1313
              I      +L   ++  ++CV    P+F  V+SL GSL+S+ +S+++P   Y +I   K 
Sbjct  450   FI------LLRTALVISSVCVAFLLPFFGLVMSLIGSLLSVLVSVIIPTLCYLRIMGNKA  503

Query  1314  SRPLLIFNVVLIVFGTLLAVSGTVSS  1391
             ++  +I +  +   G + A+ GT SS
Sbjct  504   TKAQVIVSSGVAALGVICAILGTYSS  529



>ref|XP_010490634.1| PREDICTED: vacuolar amino acid transporter 1-like isoform X1 
[Camelina sativa]
Length=553

 Score =   249 bits (635),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/394 (37%), Positives = 229/394 (58%), Gaps = 7/394 (2%)
 Frame = +3

Query  231   EKNNSSFMHAVINMIGMLIGLGQLSTPYALEKGGWISAFLLIGLGVICAFTTHLLGKCLG  410
             E N  SF  +V+N   +L GLG ++ PYA+++ GW+   +L+  GVI  +T  L+ +CL 
Sbjct  159   ETNLCSFSQSVLNGTNVLCGLGLITMPYAIKESGWLGLLILLFFGVITCYTGVLMKRCLE  218

Query  411   KDPKSKDYKDIGQQAFGTKGRILAASFIYLEIFMALVSYTISLHDNLATVFLGTHLKL-T  587
               P  + Y DIGQ AFG  GR + +  +Y+E++ A V Y I + DNL+ +F    L + +
Sbjct  219   SSPGLQTYPDIGQAAFGITGRFIISILLYVELYAACVEYIIMMSDNLSGLFPNISLSIAS  278

Query  588   GIQLSTSQLLTVMAVLVALPSLWFRDLSSISFLSSAGILMSLLIFVTVACTAVFGVVNPN  767
             GI L +SQ+  ++  ++ LP++W +DLS +S+LS  G+L S+L+ + +    V   +  +
Sbjct  279   GISLDSSQIFAILTTILVLPTVWLKDLSLLSYLSVGGVLASILLGLCLFWIGVVDGIGFH  338

Query  768   HRIPPLHLPNIPSVSGLYAFSYAGHIVFPNIYTAMKDPSKFTKVSIVSFSVVTILYTALA  947
                      N+P   G++ F Y+ H VFPNIY++MKDPSKF  V ++ F+  T LY A+A
Sbjct  339   ATGKVFDFSNLPVAIGIFGFGYSRHSVFPNIYSSMKDPSKFPLVLVICFTFCTFLYIAVA  398

Query  948   FMGAKMFGPGVSSQITLSMPRHVVFTKVALWATVLTPMTKYALEFAPFAIELDHSLP-PS  1124
               G  MFG  V SQ TL+MP+    +KVA+W  V+TPMTKYAL   P  + L+  +P   
Sbjct  399   TCGYTMFGEAVESQFTLNMPKQFFASKVAVWTAVITPMTKYALTITPIVMSLEELIPMAK  458

Query  1125  MKHH-IKTIIRGGTGSililiilalalCVPYFEHVLSLTGSLVSIGISIVLPCGFYTKIF  1301
             M+ H +  I R    ++L+   L +AL VP+F  V +L GS +++ ++++ PC  Y  I 
Sbjct  459   MRSHGVSIIFR----TVLVTSTLVVALSVPFFAIVAALIGSFLAMLVALIFPCLCYLSIL  514

Query  1302  WPKISRPLLIFNVVLIVFGTLLAVSGTVSSFKLL  1403
               K+S   +   V +I+FG +    GT S+   L
Sbjct  515   KGKLSNTQIGLCVFIILFGVVSGCCGTYSAISRL  548



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4346988257292