BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c89726_g1_i1 len=677 path=[1:0-676]

Length=677
                                                                      Score     E

ref|XP_011092436.1|  PREDICTED: basic form of pathogenesis-relate...    177   2e-52   
ref|XP_010041202.1|  PREDICTED: basic form of pathogenesis-relate...    175   3e-51   
ref|XP_011092471.1|  PREDICTED: basic form of pathogenesis-relate...    175   3e-51   
ref|XP_010065837.1|  PREDICTED: pathogenesis-related protein 1A-like    174   4e-51   
ref|XP_002313935.2|  hypothetical protein POPTR_0009s08660g             174   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_002274307.1|  PREDICTED: pathogenesis-related leaf protein 6     174   6e-51   Vitis vinifera
ref|XP_002273355.1|  PREDICTED: basic form of pathogenesis-relate...    174   6e-51   Vitis vinifera
gb|KHN19052.1|  Basic form of pathogenesis-related protein 1            174   6e-51   
ref|XP_003543105.1|  PREDICTED: basic form of pathogenesis-relate...    174   8e-51   
gb|KCW44547.1|  hypothetical protein EUGRSUZ_L01945                     174   9e-51   
ref|XP_002274371.1|  PREDICTED: basic form of pathogenesis-relate...    174   1e-50   Vitis vinifera
gb|KCW63507.1|  hypothetical protein EUGRSUZ_G01138                     173   1e-50   
ref|XP_011091978.1|  PREDICTED: basic form of pathogenesis-relate...    173   1e-50   
ref|NP_001238109.1|  uncharacterized protein LOC100499927 precursor     173   2e-50   
ref|XP_004486257.1|  PREDICTED: basic form of pathogenesis-relate...    173   2e-50   
ref|XP_002265050.1|  PREDICTED: basic form of pathogenesis-relate...    173   2e-50   Vitis vinifera
gb|ABK94784.1|  unknown                                                 173   2e-50   Populus trichocarpa [western balsam poplar]
gb|KHN19054.1|  Basic form of pathogenesis-related protein 1            173   2e-50   
gb|ADN43433.1|  pathogenesis-related protein 1                          173   2e-50   
ref|XP_011092435.1|  PREDICTED: basic form of pathogenesis-relate...    172   2e-50   
gb|ADN43443.1|  pathogenesis-related protein 1                          172   2e-50   
ref|XP_007041425.1|  Pathogenesis-related protein 1                     172   3e-50   
ref|XP_010252393.1|  PREDICTED: basic form of pathogenesis-relate...    172   5e-50   
ref|XP_006379156.1|  pathogenesis-related family protein                171   6e-50   
dbj|BAB78476.1|  PR-1                                                   171   8e-50   Solanum torvum [berenjena cimarrona]
gb|AFJ93090.1|  pathogenesis-related protein 1                          172   8e-50   
gb|KDP37603.1|  hypothetical protein JCGZ_06946                         171   1e-49   
gb|ADN43441.1|  pathogenesis-related protein 1                          171   1e-49   
gb|KDP37606.1|  hypothetical protein JCGZ_06949                         171   1e-49   
emb|CAN68901.1|  hypothetical protein VITISV_019988                     170   2e-49   Vitis vinifera
gb|KHN33603.1|  Basic form of pathogenesis-related protein 1            170   2e-49   
ref|XP_011002601.1|  PREDICTED: pathogenesis-related protein 1-like     170   3e-49   
ref|XP_004292311.1|  PREDICTED: cysteine-rich secretory protein 1...    173   3e-49   
gb|KDP37611.1|  hypothetical protein JCGZ_06954                         169   4e-49   
gb|ADN43439.1|  pathogenesis-related protein 1                          169   4e-49   
ref|NP_001237253.1|  uncharacterized protein LOC100527778 precursor     169   7e-49   
gb|AEV57469.1|  pathogensis-related protein 1b                          169   9e-49   
gb|ADN43440.1|  pathogenesis-related protein 1                          168   1e-48   
gb|ADN43429.1|  pathogenesis-related protein 1                          168   1e-48   
ref|NP_001234358.1|  PR1 protein precursor                              169   1e-48   
gb|KGN43826.1|  hypothetical protein Csa_7G070232                       168   2e-48   
ref|NP_001238168.1|  PR1a precursor                                     168   2e-48   
gb|ADN43438.1|  pathogenesis-related protein 1                          167   2e-48   
ref|XP_004137080.1|  PREDICTED: basic form of pathogenesis-relate...    167   2e-48   
ref|XP_006583787.1|  PREDICTED: basic form of pathogenesis-relate...    167   2e-48   
gb|ADN43442.1|  pathogenesis-related protein 1                          167   3e-48   
gb|ADN43432.1|  pathogenesis-related protein 1                          167   3e-48   
ref|XP_004289701.1|  PREDICTED: pathogenesis-related protein 1B-like    167   3e-48   
emb|CAD60273.1|  putative pathogenesis related protein 1 precursor      167   4e-48   Vitis vinifera
ref|XP_009787159.1|  PREDICTED: basic form of pathogenesis-relate...    167   4e-48   
gb|ADN43419.1|  pathogenesis-related protein 1                          167   4e-48   
gb|ADN43415.1|  pathogenesis-related protein 1                          167   4e-48   
ref|XP_002522071.1|  STS14 protein precursor, putative                  167   5e-48   Ricinus communis
ref|XP_002273416.1|  PREDICTED: basic form of pathogenesis-relate...    166   5e-48   Vitis vinifera
ref|XP_011092472.1|  PREDICTED: basic form of pathogenesis-relate...    166   5e-48   
ref|XP_011016555.1|  PREDICTED: basic form of pathogenesis-relate...    166   5e-48   
ref|XP_007148307.1|  hypothetical protein PHAVU_006G197500g             166   6e-48   
ref|XP_002273199.1|  PREDICTED: basic form of pathogenesis-relate...    166   6e-48   Vitis vinifera
gb|ADN43416.1|  pathogenesis-related protein 1                          166   6e-48   
gb|ADN43427.1|  pathogenesis-related protein 1                          166   6e-48   
ref|XP_003545775.1|  PREDICTED: basic form of pathogenesis-relate...    167   7e-48   
ref|XP_008236150.1|  PREDICTED: basic form of pathogenesis-relate...    166   7e-48   
ref|XP_004170277.1|  PREDICTED: LOW QUALITY PROTEIN: basic form o...    167   7e-48   
ref|XP_004230669.1|  PREDICTED: pathogenesis-related leaf protein 6     166   7e-48   
ref|XP_009605695.1|  PREDICTED: basic form of pathogenesis-relate...    167   7e-48   
ref|XP_009605697.1|  PREDICTED: pathogenesis-related leaf protein...    166   7e-48   
gb|ADN43418.1|  pathogenesis-related protein 1                          166   8e-48   
gb|ADN43435.1|  pathogenesis-related protein 1                          166   8e-48   
ref|XP_006486821.1|  PREDICTED: basic form of pathogenesis-relate...    166   8e-48   
ref|XP_009605696.1|  PREDICTED: basic form of pathogenesis-relate...    167   8e-48   
ref|XP_006367091.1|  PREDICTED: basic form of pathogenesis-relate...    166   9e-48   
gb|ADN43436.1|  pathogenesis-related protein 1                          166   1e-47   
gb|ADN43428.1|  pathogenesis-related protein 1                          166   1e-47   
ref|XP_002522065.1|  STS14 protein precursor, putative                  166   1e-47   Ricinus communis
emb|CAA47374.1|  prb-1b                                                 166   1e-47   Nicotiana tabacum [American tobacco]
ref|XP_011002613.1|  PREDICTED: basic form of pathogenesis-relate...    165   1e-47   
ref|XP_006422713.1|  hypothetical protein CICLE_v10029459mg             165   1e-47   
ref|XP_009788195.1|  PREDICTED: basic form of pathogenesis-relate...    166   2e-47   
ref|XP_006367102.1|  PREDICTED: basic form of pathogenesis-relate...    166   2e-47   
ref|XP_008455069.1|  PREDICTED: basic form of pathogenesis-relate...    165   2e-47   
ref|XP_003608313.1|  Pathogenesis-related protein 1A                    165   2e-47   
ref|XP_007041422.1|  Pathogenesis-related protein 1                     164   3e-47   
ref|XP_002313936.2|  pathogenesis-related family protein                164   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_008372933.1|  PREDICTED: basic form of pathogenesis-relate...    165   3e-47   
ref|NP_188603.1|  putative pathogenesis-related protein                 164   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004136923.1|  PREDICTED: pathogenesis-related leaf protein...    164   3e-47   
ref|XP_002272115.1|  PREDICTED: basic form of pathogenesis-relate...    164   3e-47   Vitis vinifera
ref|XP_007199090.1|  hypothetical protein PRUPE_ppa020367mg             164   3e-47   
ref|XP_008236236.1|  PREDICTED: basic form of pathogenesis-relate...    164   3e-47   
ref|XP_007148303.1|  hypothetical protein PHAVU_006G197100g             164   3e-47   
gb|AAK30143.1|AF348141_1  pathogenesis-related protein PR-1 precu...    165   3e-47   Capsicum annuum
gb|KGN43830.1|  hypothetical protein Csa_7G070252                       164   4e-47   
gb|ADN43437.1|  pathogenesis-related protein 1                          164   4e-47   
gb|AES63607.2|  CAP, cysteine-rich secretory protein, antigen 5         164   4e-47   
ref|XP_003593356.1|  Pathogenesis-related protein                       164   4e-47   
ref|XP_010252392.1|  PREDICTED: basic form of pathogenesis-relate...    164   4e-47   
gb|ADN43417.1|  pathogenesis-related protein 1                          164   5e-47   
ref|XP_006369711.1|  Pathogenesis-related family protein                164   5e-47   
gb|AGS80328.1|  pathogenesis-related protein 1                          164   6e-47   
ref|XP_010088980.1|  hypothetical protein L484_013560                   164   8e-47   
emb|CDO97323.1|  unnamed protein product                                164   8e-47   
ref|XP_008455068.1|  PREDICTED: basic form of pathogenesis-relate...    163   9e-47   
ref|XP_009342363.1|  PREDICTED: pathogenesis-related leaf protein...    163   1e-46   
ref|XP_008245926.1|  PREDICTED: basic form of pathogenesis-relate...    163   1e-46   
ref|XP_011092473.1|  PREDICTED: pathogenesis-related leaf protein...    163   1e-46   
ref|XP_010461858.1|  PREDICTED: pathogenesis-related leaf protein...    163   1e-46   
gb|AFK46675.1|  unknown                                                 163   1e-46   
ref|XP_008455071.1|  PREDICTED: basic form of pathogenesis-relate...    163   1e-46   
gb|KDP35900.1|  hypothetical protein JCGZ_09872                         163   1e-46   
ref|XP_006367089.1|  PREDICTED: pathogenesis-related protein 1A1-...    163   1e-46   
ref|XP_006367094.1|  PREDICTED: pathogenesis-related leaf protein...    163   2e-46   
ref|XP_010478439.1|  PREDICTED: pathogenesis-related leaf protein...    162   2e-46   
ref|XP_006422719.1|  hypothetical protein CICLE_v10029950mg             162   2e-46   
ref|XP_006367096.1|  PREDICTED: pathogenesis-related leaf protein...    162   2e-46   
gb|KDP37600.1|  hypothetical protein JCGZ_06943                         162   2e-46   
ref|XP_007041421.1|  CAP (Cysteine-rich secretory proteins, Antig...    162   2e-46   
gb|ADN43434.1|  pathogenesis-related protein 1                          162   2e-46   
ref|XP_010500562.1|  PREDICTED: pathogenesis-related leaf protein...    162   2e-46   
ref|XP_002274275.1|  PREDICTED: basic form of pathogenesis-relate...    162   2e-46   Vitis vinifera
ref|XP_006486819.1|  PREDICTED: pathogenesis-related protein 1-like     162   2e-46   
gb|ADP69172.1|  pathogenesis related protein-1                          162   3e-46   
ref|XP_007201612.1|  hypothetical protein PRUPE_ppa019807mg             162   3e-46   
ref|XP_007148301.1|  hypothetical protein PHAVU_006G196900g             163   3e-46   
ref|XP_003631695.1|  PREDICTED: basic form of pathogenesis-relate...    162   3e-46   
sp|P11670.1|PRB1_TOBAC  RecName: Full=Basic form of pathogenesis-...    162   3e-46   Nicotiana tabacum [American tobacco]
ref|XP_004170276.1|  PREDICTED: basic form of pathogenesis-relate...    162   3e-46   
gb|AFK93503.1|  pathogenesis related protein 1 isoform 4                162   3e-46   
ref|XP_006486832.1|  PREDICTED: pathogenesis-related protein PR-1...    162   3e-46   
ref|XP_002274105.1|  PREDICTED: pathogenesis-related leaf protein 6     162   4e-46   Vitis vinifera
ref|XP_002885324.1|  hypothetical protein ARALYDRAFT_898358             162   4e-46   
ref|XP_010525646.1|  PREDICTED: pathogenesis-related leaf protein...    162   4e-46   
ref|XP_006406470.1|  hypothetical protein EUTSA_v10022205mg             162   4e-46   
ref|XP_008236237.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    161   5e-46   
ref|XP_004136922.1|  PREDICTED: basic form of pathogenesis-relate...    161   5e-46   
ref|XP_006367093.1|  PREDICTED: basic form of pathogenesis-relate...    162   6e-46   
ref|XP_006422707.1|  hypothetical protein CICLE_v10030029mg             161   6e-46   
ref|XP_004230668.1|  PREDICTED: pathogenesis-related leaf protein...    161   6e-46   
ref|XP_010530685.1|  PREDICTED: pathogenesis-related protein 1-like     160   6e-46   
ref|XP_003545770.1|  PREDICTED: basic form of pathogenesis-relate...    161   6e-46   
ref|XP_010088981.1|  hypothetical protein L484_013561                   161   8e-46   
ref|XP_004136928.1|  PREDICTED: pathogenesis-related protein 1C-like    162   8e-46   
ref|XP_006486833.1|  PREDICTED: pathogenesis-related leaf protein...    161   8e-46   
ref|XP_010252394.1|  PREDICTED: basic form of pathogenesis-relate...    161   8e-46   
ref|XP_006422718.1|  hypothetical protein CICLE_v10029873mg             161   8e-46   
ref|XP_008796970.1|  PREDICTED: pathogenesis-related protein PRB1...    160   1e-45   
ref|XP_009787160.1|  PREDICTED: pathogenesis-related leaf protein...    160   1e-45   
ref|XP_009378590.1|  PREDICTED: pathogenesis-related leaf protein...    160   1e-45   
ref|XP_006367092.1|  PREDICTED: basic form of pathogenesis-relate...    161   1e-45   
gb|KCW56841.1|  hypothetical protein EUGRSUZ_I02509                     160   2e-45   
ref|XP_009398311.1|  PREDICTED: pathogenesis-related protein PRB1...    160   2e-45   
ref|XP_010065836.1|  PREDICTED: pathogenesis-related protein 1-like     160   2e-45   
ref|XP_002313932.2|  pathogenesis-related family protein                160   2e-45   Populus trichocarpa [western balsam poplar]
gb|ADB54822.1|  pathogenesis-related protein 1                          160   2e-45   Vitis pseudoreticulata
gb|ACB45874.1|  pathogen-related protein 1                              159   2e-45   Cucumis melo var. inodorus [casaba melon]
ref|XP_006367090.1|  PREDICTED: pathogenesis-related protein 1-like     160   2e-45   
ref|XP_010065833.1|  PREDICTED: pathogenesis-related protein 1-like     160   3e-45   
ref|XP_004136921.1|  PREDICTED: basic form of pathogenesis-relate...    160   3e-45   
gb|KHN33609.1|  Basic form of pathogenesis-related protein 1            162   3e-45   
gb|AHA56682.1|  pathogenesis related protein                            159   3e-45   
ref|XP_010270273.1|  PREDICTED: pathogenesis-related leaf protein...    160   3e-45   
ref|XP_010029887.1|  PREDICTED: pathogenesis-related protein PR-1...    160   3e-45   
ref|XP_010065835.1|  PREDICTED: pathogenesis-related protein PR-1...    159   3e-45   
ref|XP_009605694.1|  PREDICTED: pathogenesis-related leaf protein...    159   3e-45   
ref|XP_010691524.1|  PREDICTED: pathogenesis-related protein PR-1...    159   3e-45   
ref|XP_008455065.1|  PREDICTED: pathogenesis-related leaf protein...    159   3e-45   
gb|AHA43767.1|  pathogenesis related protein 1 isoform 4                160   3e-45   
ref|XP_008796972.1|  PREDICTED: pathogenesis-related protein PRB1...    159   3e-45   
gb|KCW44084.1|  hypothetical protein EUGRSUZ_L02505                     159   4e-45   
ref|XP_009788194.1|  PREDICTED: pathogenesis-related leaf protein...    159   4e-45   
ref|XP_007159202.1|  hypothetical protein PHAVU_002G217800g             159   4e-45   
emb|CDY22960.1|  BnaC03g41090D                                          159   4e-45   
emb|CDX82282.1|  BnaA03g35390D                                          159   4e-45   
ref|XP_010943469.1|  PREDICTED: pathogenesis-related protein PRB1...    159   5e-45   
ref|XP_009135645.1|  PREDICTED: pathogenesis-related protein 1          159   5e-45   
ref|XP_010507919.1|  PREDICTED: pathogenesis-related protein 1A-like    159   5e-45   
ref|XP_004485656.1|  PREDICTED: pathogenesis-related protein 1B-like    159   6e-45   
dbj|BAO09561.1|  pathogenesis-related protein 1                         159   6e-45   
emb|CBI25093.3|  unnamed protein product                                158   8e-45   
ref|XP_010040969.1|  PREDICTED: pathogenesis-related protein 1-like     159   8e-45   
ref|XP_010489949.1|  PREDICTED: pathogenesis-related protein 1A-like    158   8e-45   
ref|XP_007041423.1|  Basic pathogenesis-related protein 1               160   9e-45   
ref|XP_002273546.1|  PREDICTED: basic form of pathogenesis-relate...    158   1e-44   Vitis vinifera
ref|XP_003545772.1|  PREDICTED: basic form of pathogenesis-relate...    158   1e-44   
ref|XP_006367104.1|  PREDICTED: basic form of pathogenesis-relate...    159   1e-44   
gb|AHW81904.1|  pathogenesis-related protein                            158   1e-44   
ref|XP_006306376.1|  hypothetical protein CARUB_v10012281mg             158   1e-44   
ref|XP_010065834.1|  PREDICTED: pathogenesis-related protein 1-like     158   1e-44   
gb|ADN43431.1|  pathogenesis-related protein 1                          158   1e-44   
ref|XP_011030276.1|  PREDICTED: basic form of pathogenesis-relate...    158   1e-44   
emb|CDY68267.1|  BnaA06g37750D                                          158   1e-44   
ref|XP_010245650.1|  PREDICTED: basic form of pathogenesis-relate...    157   2e-44   
ref|XP_002522070.1|  STS14 protein precursor, putative                  157   2e-44   Ricinus communis
ref|XP_010530686.1|  PREDICTED: pathogenesis-related protein 1-like     157   2e-44   
ref|XP_006299640.1|  hypothetical protein CARUB_v10015827mg             157   2e-44   
ref|XP_006367095.1|  PREDICTED: basic form of pathogenesis-relate...    158   2e-44   
ref|XP_006368158.1|  PREDICTED: pathogenesis-related protein 1A-like    156   3e-44   
ref|XP_003608310.1|  F-box/FBD/LRR-repeat protein                       169   3e-44   
ref|XP_010530683.1|  PREDICTED: pathogenesis-related protein 1-like     157   3e-44   
ref|XP_010052996.1|  PREDICTED: pathogenesis-related protein 1-like     157   4e-44   
gb|KFK30004.1|  hypothetical protein AALP_AA7G205200                    157   4e-44   
emb|CDO97328.1|  unnamed protein product                                166   4e-44   
ref|XP_010065838.1|  PREDICTED: pathogenesis-related protein 1-like     157   4e-44   
ref|XP_008798894.1|  PREDICTED: pathogenesis-related protein PRB1...    156   5e-44   
ref|XP_009378591.1|  PREDICTED: pathogenesis-related leaf protein...    156   5e-44   
ref|XP_002270128.1|  PREDICTED: pathogenesis-related leaf protein 4     156   5e-44   Vitis vinifera
ref|XP_011030266.1|  PREDICTED: basic form of pathogenesis-relate...    156   6e-44   
emb|CDY69373.1|  BnaCnng63210D                                          156   6e-44   
ref|XP_010065842.1|  PREDICTED: pathogenesis-related protein 1-like     156   6e-44   
emb|CDY49367.1|  BnaA03g50560D                                          156   7e-44   
gb|KCW63509.1|  hypothetical protein EUGRSUZ_G01140                     156   7e-44   
ref|XP_003593363.1|  Pathogenesis-related protein 1B                    156   7e-44   
ref|XP_007148304.1|  hypothetical protein PHAVU_006G197200g             155   8e-44   
ref|XP_006393183.1|  hypothetical protein EUTSA_v10011955mg             155   8e-44   
gb|ADD97801.1|  pathogenesis-related protein 1                          155   8e-44   
ref|XP_010052997.1|  PREDICTED: pathogenesis-related protein 1-like     155   9e-44   
emb|CDY69090.1|  BnaAnng29270D                                          155   9e-44   
gb|KCW63515.1|  hypothetical protein EUGRSUZ_G01148                     155   1e-43   
ref|XP_009335379.1|  PREDICTED: LOW QUALITY PROTEIN: basic form o...    155   1e-43   
ref|XP_004289700.1|  PREDICTED: basic form of pathogenesis-relate...    155   1e-43   
ref|XP_010065832.1|  PREDICTED: pathogenesis-related protein 1-like     155   1e-43   
dbj|BAF95881.1|  putative pathogenesis-related protein 1                155   1e-43   Vitis hybrid cultivar
ref|XP_003529280.2|  PREDICTED: pathogenesis-related protein 1A-like    155   1e-43   
gb|ABK41053.2|  pathogenesis-related protein 1                          155   1e-43   Musa acuminata [banana]
ref|XP_009138211.1|  PREDICTED: pathogenesis-related protein 1-like     155   1e-43   
ref|XP_008382391.1|  PREDICTED: pathogenesis-related protein 1A-like    155   1e-43   
emb|CAN77102.1|  hypothetical protein VITISV_021166                     155   2e-43   Vitis vinifera
gb|KDP36356.1|  hypothetical protein JCGZ_09853                         155   2e-43   
gb|KCW63502.1|  hypothetical protein EUGRSUZ_G01132                     155   2e-43   
gb|AFK38989.1|  unknown                                                 155   2e-43   
gb|AGK89727.1|  pathogenesis-related 1 protein                          154   2e-43   
ref|XP_010266628.1|  PREDICTED: pathogenesis-related protein 1A-like    154   2e-43   
ref|XP_002273788.2|  PREDICTED: pathogenesis-related protein 1          155   3e-43   Vitis vinifera
ref|XP_009398310.1|  PREDICTED: pathogenesis-related protein 1-like     154   3e-43   
ref|XP_011002583.1|  PREDICTED: pathogenesis-related leaf protein...    154   3e-43   
ref|XP_010437726.1|  PREDICTED: pathogenesis-related protein 1-like     154   3e-43   
ref|XP_006412319.1|  hypothetical protein EUTSA_v10026438mg             154   3e-43   
gb|AEM36335.1|  pathogenesis-related protein                            154   3e-43   
gb|ADN43430.1|  pathogenesis-related protein 1                          154   3e-43   
ref|XP_003545771.1|  PREDICTED: pathogenesis-related protein PR-1...    154   3e-43   
gb|AFM76999.1|  pathogenesis related protein 1a                         154   3e-43   
ref|XP_007201285.1|  hypothetical protein PRUPE_ppa012617mg             154   4e-43   
ref|XP_010691525.1|  PREDICTED: pathogenesis-related protein 1A-like    154   4e-43   
ref|NP_001234128.1|  pathogenesis-related protein 1A1 precursor         154   4e-43   
emb|CDY46098.1|  BnaA03g52700D                                          154   4e-43   
gb|EPS71111.1|  hypothetical protein M569_03651                         154   5e-43   
ref|XP_010941969.1|  PREDICTED: pathogenesis-related protein PRB1...    154   5e-43   
gb|AAN37409.1|  pathogenesis-related protein 1                          154   5e-43   Brassica juncea [brown mustard]
ref|XP_009342365.1|  PREDICTED: pathogenesis-related protein 1-like     153   7e-43   
ref|XP_011030278.1|  PREDICTED: pathogenesis-related protein 1-like     154   7e-43   
ref|XP_010065846.1|  PREDICTED: pathogenesis-related protein 1-like     153   7e-43   
ref|XP_004289699.1|  PREDICTED: pathogenesis-related protein 1B-like    153   8e-43   
gb|AFK93502.1|  pathogenesis related protein 1 isoform 3                153   8e-43   
gb|AFM77011.1|  pathogenesis related protein 1a                         153   9e-43   
ref|XP_011030277.1|  PREDICTED: pathogenesis-related protein 1-like     153   9e-43   
gb|AFK64734.1|  pathogenesis related protein 1a                         153   9e-43   
ref|XP_009147855.1|  PREDICTED: pathogenesis-related leaf protein 6     153   1e-42   
gb|KDP37604.1|  hypothetical protein JCGZ_06947                         153   1e-42   
gb|AAB06458.1|  pathogenesis-related protein PR1                        153   1e-42   Brassica napus [oilseed rape]
ref|XP_004504945.1|  PREDICTED: basic form of pathogenesis-relate...    153   1e-42   
ref|XP_009138212.1|  PREDICTED: pathogenesis-related protein 1-like     153   1e-42   
emb|CDO97325.1|  unnamed protein product                                153   1e-42   
ref|XP_009378592.1|  PREDICTED: pathogenesis-related protein PR-1...    153   1e-42   
ref|XP_010941967.1|  PREDICTED: pathogenesis-related protein PRB1...    153   1e-42   
ref|XP_010270442.1|  PREDICTED: basic form of pathogenesis-relate...    152   1e-42   
ref|XP_008372945.1|  PREDICTED: pathogenesis-related protein 1-like     152   1e-42   
ref|XP_009138205.1|  PREDICTED: pathogenesis-related protein 1-like     152   1e-42   
ref|XP_009346545.1|  PREDICTED: pathogenesis-related protein 1A-like    152   2e-42   
ref|XP_007148306.1|  hypothetical protein PHAVU_006G197400g             152   2e-42   
gb|KFK35951.1|  hypothetical protein AALP_AA4G059500                    152   2e-42   
ref|XP_010547940.1|  PREDICTED: pathogenesis-related protein 1-like     152   2e-42   
ref|XP_010691520.1|  PREDICTED: pathogenesis-related protein 1C-like    152   2e-42   
ref|XP_009335372.1|  PREDICTED: pathogenesis-related leaf protein...    152   2e-42   
ref|XP_004292153.1|  PREDICTED: basic form of pathogenesis-relate...    154   2e-42   
ref|XP_002522062.1|  Protein PRY2 precursor, putative                   152   2e-42   Ricinus communis
ref|XP_004136924.1|  PREDICTED: basic form of pathogenesis-relate...    152   2e-42   
gb|AFK93500.1|  pathogenesis related protein 1 isoform 1                152   2e-42   
ref|XP_004968783.1|  PREDICTED: pathogenesis-related protein PRMS...    152   2e-42   
gb|KGN43831.1|  hypothetical protein Csa_7G070254                       152   2e-42   
ref|XP_004136929.1|  PREDICTED: pathogenesis-related protein 1-like     151   3e-42   
ref|XP_010530682.1|  PREDICTED: pathogenesis-related protein 1A-like    152   3e-42   
ref|XP_008455066.1|  PREDICTED: basic form of pathogenesis-relate...    152   3e-42   
ref|XP_002522066.1|  STS14 protein precursor, putative                  152   3e-42   
ref|XP_010052998.1|  PREDICTED: basic form of pathogenesis-relate...    151   3e-42   
ref|XP_008346349.1|  PREDICTED: pathogenesis-related protein 1-like     152   3e-42   
gb|ADB54823.1|  pathogenesis-related protein 1                          151   4e-42   
gb|KGN43833.1|  hypothetical protein Csa_7G070255                       151   4e-42   
ref|XP_009138206.1|  PREDICTED: pathogenesis-related protein 1-like     151   4e-42   
ref|XP_009136247.1|  PREDICTED: pathogenesis-related protein 1-like     151   5e-42   
ref|XP_002891554.1|  hypothetical protein ARALYDRAFT_474142             151   5e-42   
ref|NP_179064.1|  pathogenesis-related protein 1                        151   5e-42   
ref|XP_010941968.1|  PREDICTED: pathogenesis-related protein PRB1...    151   5e-42   
gb|AAQ19681.1|  cytoplasmic small heat shock protein class I            151   5e-42   
ref|XP_008455070.1|  PREDICTED: basic form of pathogenesis-relate...    151   5e-42   
ref|XP_010904546.1|  PREDICTED: pathogenesis-related protein PRB1...    151   5e-42   
ref|XP_008798893.1|  PREDICTED: pathogenesis-related protein 1B-like    152   6e-42   
gb|KCW77204.1|  hypothetical protein EUGRSUZ_D01555                     150   7e-42   
emb|CDX89632.1|  BnaC03g45460D                                          150   7e-42   
gb|ACU15426.1|  unknown                                                 151   7e-42   
ref|XP_002300292.2|  Pathogenesis-related family protein                151   7e-42   
ref|XP_007199955.1|  hypothetical protein PRUPE_ppa1027191mg            150   7e-42   
gb|AAX20041.1|  cytoplasmic small heat shock protein class I            150   7e-42   
ref|XP_007159200.1|  hypothetical protein PHAVU_002G217600g             150   8e-42   
emb|CAA36790.1|  unnamed protein product                                151   8e-42   
gb|KCW63526.1|  hypothetical protein EUGRSUZ_G01161                     150   8e-42   
ref|XP_010065853.1|  PREDICTED: basic form of pathogenesis-relate...    150   9e-42   
ref|XP_010527028.1|  PREDICTED: pathogenesis-related protein PR-1...    150   9e-42   
gb|ABA41593.1|  pathogenesis-related protein                            149   1e-41   
ref|XP_010911073.1|  PREDICTED: pathogenesis-related protein PRB1...    150   1e-41   
ref|XP_009388942.1|  PREDICTED: pathogenesis-related protein 1-like     150   1e-41   
ref|XP_002522064.1|  STS14 protein precursor, putative                  150   1e-41   
ref|XP_006282972.1|  hypothetical protein CARUB_v10007846mg             150   1e-41   
ref|XP_009342367.1|  PREDICTED: pathogenesis-related protein PR-1...    150   1e-41   
gb|KCW77219.1|  hypothetical protein EUGRSUZ_D01572                     149   1e-41   
gb|ABK25508.1|  unknown                                                 150   1e-41   
ref|XP_004136927.1|  PREDICTED: basic form of pathogenesis-relate...    150   1e-41   
gb|KDP36353.1|  hypothetical protein JCGZ_09850                         150   1e-41   
ref|XP_010691521.1|  PREDICTED: pathogenesis-related protein PR-1...    150   1e-41   
ref|XP_008454501.1|  PREDICTED: basic form of pathogenesis-relate...    150   1e-41   
ref|XP_010065843.1|  PREDICTED: pathogenesis-related protein 1-like     150   1e-41   
ref|XP_010053000.1|  PREDICTED: pathogenesis-related protein 1-like     150   2e-41   
ref|XP_010691519.1|  PREDICTED: pathogenesis-related protein 1A-like    150   2e-41   
gb|KDP37598.1|  hypothetical protein JCGZ_06941                         149   2e-41   
ref|XP_010687897.1|  PREDICTED: pathogenesis-related protein PR-1...    150   2e-41   
ref|NP_001234314.1|  pathogenesis-related leaf protein 6 precursor      150   2e-41   
gb|KCW77208.1|  hypothetical protein EUGRSUZ_D01560                     150   2e-41   
ref|XP_008798895.1|  PREDICTED: pathogenesis-related protein 1-like     150   2e-41   
gb|KDP35893.1|  hypothetical protein JCGZ_09865                         149   2e-41   
ref|XP_010042397.1|  PREDICTED: basic form of pathogenesis-relate...    149   2e-41   
gb|AFK36478.1|  unknown                                                 150   2e-41   
dbj|BAF03626.1|  pathogenesis related protein 1                         149   2e-41   
emb|CDX93140.1|  BnaA03g38620D                                          149   2e-41   
ref|XP_010065847.1|  PREDICTED: basic form of pathogenesis-relate...    149   3e-41   
ref|XP_004485657.1|  PREDICTED: pathogenesis-related protein PR-1...    149   3e-41   
gb|KCW63519.1|  hypothetical protein EUGRSUZ_G01152                     149   3e-41   
ref|XP_010054710.1|  PREDICTED: pathogenesis-related leaf protein...    150   3e-41   
emb|CAA31008.1|  PR1a preprotein                                        149   3e-41   
gb|AEQ33601.1|  pathogenesis-related protein 1a                         149   4e-41   
gb|KDP35902.1|  hypothetical protein JCGZ_09874                         151   4e-41   
ref|XP_002436405.1|  hypothetical protein SORBIDRAFT_10g001940          149   4e-41   
ref|XP_009388943.1|  PREDICTED: pathogenesis-related protein 1-like     149   4e-41   
ref|XP_010054707.1|  PREDICTED: basic form of pathogenesis-relate...    149   4e-41   
ref|XP_010468301.1|  PREDICTED: pathogenesis-related protein 1A-like    149   4e-41   
dbj|BAK01044.1|  predicted protein                                      149   4e-41   
ref|XP_009610821.1|  PREDICTED: pathogenesis-related protein 1B         149   4e-41   
ref|WP_009336546.1|  SCP-like protein                                   150   5e-41   
gb|AAL84768.1|AF475286_1  pathogenesis-related protein 1-1a             148   5e-41   
ref|XP_006845767.1|  hypothetical protein AMTR_s00019p00250630          149   5e-41   
ref|XP_004137079.1|  PREDICTED: basic form of pathogenesis-relate...    149   5e-41   
ref|XP_010447203.1|  PREDICTED: pathogenesis-related protein 1-like     149   5e-41   
ref|XP_009798466.1|  PREDICTED: pathogenesis-related protein 1A         149   5e-41   
sp|P08299.1|PR1A_TOBAC  RecName: Full=Pathogenesis-related protei...    149   5e-41   
ref|XP_004138862.1|  PREDICTED: basic form of pathogenesis-relate...    148   5e-41   
ref|XP_009803803.1|  PREDICTED: pathogenesis-related protein 1C-like    149   5e-41   
gb|AEL99925.1|  pathogenesis-related protein 1                          148   6e-41   
ref|XP_010053002.1|  PREDICTED: basic form of pathogenesis-relate...    148   6e-41   
ref|XP_010065845.1|  PREDICTED: basic form of pathogenesis-relate...    148   6e-41   
emb|CDP12737.1|  unnamed protein product                                148   6e-41   
ref|XP_010548693.1|  PREDICTED: basic form of pathogenesis-relate...    149   7e-41   
ref|XP_008236223.1|  PREDICTED: pathogenesis-related protein 1-like     148   7e-41   
ref|XP_009147856.1|  PREDICTED: pathogenesis-related leaf protein...    148   7e-41   
emb|CAA65420.1|  pathogenesis-related protein 1                         148   7e-41   
ref|XP_004955414.1|  PREDICTED: pathogenesis-related protein 1-like     148   7e-41   
ref|XP_004168739.1|  PREDICTED: basic form of pathogenesis-relate...    148   7e-41   
dbj|BAA14220.1|  PR1a protein precursor                                 148   7e-41   
ref|XP_010095627.1|  hypothetical protein L484_003728                   148   8e-41   
pdb|1CFE|A  Chain A, P14a, Nmr, 20 Structures                           147   8e-41   
ref|XP_001777065.1|  predicted protein                                  149   8e-41   
ref|XP_009136246.1|  PREDICTED: pathogenesis-related protein 1-like     148   8e-41   
ref|NP_195098.1|  putative pathogenesis-related protein                 148   9e-41   
gb|AFG50742.1|  hypothetical protein 0_18914_01                         147   9e-41   
gb|KDP37608.1|  hypothetical protein JCGZ_06951                         148   9e-41   
ref|XP_002869194.1|  hypothetical protein ARALYDRAFT_491308             147   9e-41   
gb|KDP37613.1|  hypothetical protein JCGZ_06956                         148   9e-41   
gb|AFR90191.1|  pathogenesis-related protein 1a                         148   9e-41   
emb|CAD38276.1|  pathogenesis related protein isoform b1                148   1e-40   
gb|AFK37568.1|  unknown                                                 148   1e-40   
gb|KGN48339.1|  hypothetical protein Csa_6G483242                       147   1e-40   
gb|AFM77000.1|  pathogenesis related protein 1a                         148   1e-40   
ref|XP_007199465.1|  hypothetical protein PRUPE_ppa027049mg             147   1e-40   
emb|CAA30017.1|  unnamed protein product                                148   1e-40   
ref|XP_007199179.1|  hypothetical protein PRUPE_ppa020025mg             147   1e-40   
ref|XP_004168740.1|  PREDICTED: basic form of pathogenesis-relate...    147   1e-40   
gb|KDP37607.1|  hypothetical protein JCGZ_06950                         147   1e-40   
ref|XP_006486822.1|  PREDICTED: pathogenesis-related protein 1-like     147   1e-40   
ref|XP_002270281.2|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    147   1e-40   
gb|ABK22175.1|  unknown                                                 148   1e-40   
ref|XP_004246724.1|  PREDICTED: pathogenesis-related leaf protein 4     147   2e-40   
emb|CAA31009.1|  PR1b preprotein                                        147   2e-40   
ref|XP_006412320.1|  hypothetical protein EUTSA_v10027447mg             147   2e-40   
gb|AGO62049.1|  pathogenesis-related protein 1                          146   2e-40   
emb|CAA29022.1|  PR-1b protein                                          147   2e-40   
gb|AEZ52390.1|  pathogenesis-related protein 1                          147   2e-40   
ref|XP_010065841.1|  PREDICTED: basic form of pathogenesis-relate...    147   2e-40   
ref|XP_010095626.1|  hypothetical protein L484_003727                   146   2e-40   
ref|XP_008236225.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    147   2e-40   
ref|XP_006412318.1|  hypothetical protein EUTSA_v10027251mg             147   2e-40   
ref|XP_010672685.1|  PREDICTED: pathogenesis-related protein PRB1...    149   2e-40   
ref|XP_006850133.1|  hypothetical protein AMTR_s00022p00231670          147   2e-40   
ref|XP_004152970.1|  PREDICTED: basic form of pathogenesis-relate...    147   2e-40   
gb|KDP35901.1|  hypothetical protein JCGZ_09873                         146   3e-40   
emb|CAD38277.1|  pathogenesis related protein isoform b2                147   3e-40   
ref|NP_001234523.1|  pathogenesis-related leaf protein 4 precursor      146   3e-40   
ref|XP_004955412.1|  PREDICTED: pathogenesis-related protein PRB1...    146   3e-40   
gb|KDP35896.1|  hypothetical protein JCGZ_09868                         147   3e-40   
ref|XP_010052995.1|  PREDICTED: basic form of pathogenesis-relate...    146   3e-40   
ref|XP_010068342.1|  PREDICTED: basic form of pathogenesis-relate...    146   3e-40   
gb|ACJ62544.1|  pathogenesis-related maize seed protein                 147   3e-40   
gb|KDP36354.1|  hypothetical protein JCGZ_09851                         153   3e-40   
gb|KDP37597.1|  hypothetical protein JCGZ_06940                         153   3e-40   
gb|AFG50738.1|  hypothetical protein 0_18914_01                         146   4e-40   
ref|XP_010904557.1|  PREDICTED: pathogenesis-related protein 1-like     146   4e-40   
ref|XP_006286103.1|  hypothetical protein CARUB_v10007651mg             146   4e-40   
ref|XP_002885924.1|  predicted protein                                  146   4e-40   
gb|AAB05225.1|  pathogenesis-related protein-1                          146   5e-40   
emb|CAB58263.1|  pathogenesis related protein PR-1                      146   5e-40   
ref|XP_010943479.1|  PREDICTED: pathogenesis-related protein PRB1...    146   6e-40   
ref|XP_004289697.1|  PREDICTED: pathogenesis-related protein 1C-like    146   6e-40   
gb|KGN62936.1|  hypothetical protein Csa_2G381380                       145   6e-40   
ref|XP_010467244.1|  PREDICTED: pathogenesis-related protein 1-like     145   6e-40   
gb|KCW63528.1|  hypothetical protein EUGRSUZ_G01163                     145   6e-40   
ref|XP_006486820.1|  PREDICTED: pathogenesis-related protein 1-like     145   7e-40   
ref|XP_006848057.1|  hypothetical protein AMTR_s00029p00197310          145   7e-40   
gb|AFK39516.1|  unknown                                                 145   7e-40   
ref|XP_010052994.1|  PREDICTED: basic form of pathogenesis-relate...    145   8e-40   
ref|NP_001275095.1|  pathogenesis-related protein 1b precursor          145   8e-40   
ref|XP_010531558.1|  PREDICTED: pathogenesis-related protein 1          145   9e-40   
ref|XP_010068331.1|  PREDICTED: protein PRY2-like                       152   9e-40   
ref|NP_175428.1|  putative pathogenesis-related protein                 145   9e-40   
ref|XP_010488898.1|  PREDICTED: pathogenesis-related protein 1-like     145   9e-40   
gb|KFK39965.1|  hypothetical protein AALP_AA3G312200                    145   1e-39   
ref|XP_006422714.1|  hypothetical protein CICLE_v10029431mg             145   1e-39   
gb|AFK35640.1|  unknown                                                 145   1e-39   
ref|XP_010266519.1|  PREDICTED: pathogenesis-related protein 1A-like    145   2e-39   
gb|AEH25629.1|  pathogenesis-related protein 1-14                       145   2e-39   
ref|XP_006409652.1|  hypothetical protein EUTSA_v10022888mg             144   2e-39   
ref|XP_007201551.1|  hypothetical protein PRUPE_ppa017637mg             144   2e-39   
ref|XP_007199020.1|  hypothetical protein PRUPE_ppa017707mg             144   2e-39   
ref|XP_004138861.1|  PREDICTED: basic form of pathogenesis-relate...    144   2e-39   
gb|ABA34024.1|  pathogenesis-related maize seed protein                 144   2e-39   
gb|ACJ62562.1|  pathogenesis-related maize seed protein                 144   3e-39   
gb|ACQ41880.1|  pathogenisis-related protein 1.1                        144   3e-39   
ref|XP_010046906.1|  PREDICTED: pathogenesis-related protein 1C-like    144   3e-39   
ref|XP_008241724.1|  PREDICTED: basic form of pathogenesis-relate...    144   3e-39   
gb|EEC81457.1|  hypothetical protein OsI_24759                          144   3e-39   
gb|KCW77203.1|  hypothetical protein EUGRSUZ_D01554                     144   3e-39   
ref|XP_001786038.1|  predicted protein                                  143   3e-39   
emb|CAA31010.1|  PR1c preprotein                                        144   3e-39   
ref|XP_008236222.1|  PREDICTED: basic form of pathogenesis-relate...    144   3e-39   
sp|Q00008.1|PRMS_MAIZE  RecName: Full=Pathogenesis-related protei...    144   3e-39   
ref|XP_009769213.1|  PREDICTED: pathogenesis-related protein 1C         144   3e-39   
ref|XP_008455062.1|  PREDICTED: pathogenesis-related protein 1-like     144   3e-39   
ref|XP_009342369.1|  PREDICTED: basic form of pathogenesis-relate...    144   3e-39   
gb|AHE81254.1|  pathogenesis-related protein 1-11                       144   3e-39   
gb|AFG50743.1|  hypothetical protein 0_18914_01                         143   3e-39   
gb|ACJ62554.1|  pathogenesis-related maize seed protein                 144   4e-39   
sp|Q41359.1|PR1_SAMNI  RecName: Full=Pathogenesis-related protein...    144   4e-39   
gb|AHE81275.1|  pathogenesis-related protein 1-11                       144   4e-39   
emb|CAA29023.1|  PR-1c protein                                          144   4e-39   
ref|XP_008453637.1|  PREDICTED: pathogenesis-related protein PR-1       144   4e-39   
gb|KDP35899.1|  hypothetical protein JCGZ_09871                         144   4e-39   
ref|XP_011088028.1|  PREDICTED: pathogenesis-related protein 1A-like    144   4e-39   
ref|NP_001058815.1|  Os07g0129200                                       144   5e-39   
ref|XP_006845587.1|  hypothetical protein AMTR_s00019p00199400          142   5e-39   
gb|ACJ62587.1|  pathogenesis-related maize seed protein                 144   5e-39   
gb|EAZ02649.1|  hypothetical protein OsI_24760                          143   5e-39   
ref|XP_003593357.1|  Pathogenesis-related protein 1a                    148   5e-39   
gb|ACJ62589.1|  pathogenesis-related maize seed protein                 144   5e-39   
ref|XP_008386535.1|  PREDICTED: basic form of pathogenesis-relate...    143   6e-39   
ref|XP_008372930.1|  PREDICTED: basic form of pathogenesis-relate...    143   6e-39   
dbj|BAN09077.1|  pathogenesis related protein-1.2                       144   6e-39   
ref|XP_009335371.1|  PREDICTED: basic form of pathogenesis-relate...    143   6e-39   
ref|XP_003593453.1|  Pathogenesis-related protein 1a                    144   6e-39   
ref|XP_007199342.1|  hypothetical protein PRUPE_ppa024466mg             142   7e-39   
ref|NP_001058816.1|  Os07g0129300                                       143   7e-39   
ref|XP_002459696.1|  hypothetical protein SORBIDRAFT_02g008970          143   7e-39   
ref|XP_006426334.1|  hypothetical protein CICLE_v10026661mg             143   7e-39   
ref|XP_009388944.1|  PREDICTED: pathogenesis-related protein 1C-like    143   8e-39   
ref|XP_010517582.1|  PREDICTED: pathogenesis-related protein 1-like     143   8e-39   
ref|XP_006466261.1|  PREDICTED: basic form of pathogenesis-relate...    143   8e-39   
dbj|BAD11072.1|  pathogenesis-related protein 1                         143   9e-39   
ref|XP_004146301.1|  PREDICTED: pathogenesis-related protein PR-1...    143   9e-39   
ref|XP_007204056.1|  hypothetical protein PRUPE_ppa027209mg             143   9e-39   
ref|XP_010052992.1|  PREDICTED: basic form of pathogenesis-relate...    142   9e-39   
ref|XP_007051550.1|  CAP, putative                                      145   9e-39   
ref|XP_007205909.1|  hypothetical protein PRUPE_ppa011521mg             144   9e-39   
ref|XP_010467245.1|  PREDICTED: pathogenesis-related protein 1-like     142   9e-39   
gb|ACT99721.1|  pathogen-related protein 1                              143   1e-38   
gb|ACJ62559.1|  pathogenesis-related maize seed protein                 143   1e-38   
ref|XP_007199990.1|  hypothetical protein PRUPE_ppa025062mg             142   1e-38   
ref|XP_007199458.1|  hypothetical protein PRUPE_ppa026973mg             142   1e-38   
ref|XP_007198982.1|  hypothetical protein PRUPE_ppa023361mg             142   1e-38   
dbj|BAL63013.1|  pathogenesis-related protein 1-1a                      141   1e-38   
emb|CDP02944.1|  unnamed protein product                                143   1e-38   
ref|XP_008798890.1|  PREDICTED: pathogenesis-related protein PR-1...    142   1e-38   
ref|XP_010943450.1|  PREDICTED: pathogenesis-related protein PR-1...    142   1e-38   
dbj|BAA05473.1|  tumor-related protein                                  141   1e-38   
ref|XP_009346538.1|  PREDICTED: basic form of pathogenesis-relate...    142   1e-38   
gb|ABK55610.1|  pathogenesis-related protein PR1c                       142   1e-38   
ref|XP_009394873.1|  PREDICTED: pathogenesis-related protein PRMS...    143   1e-38   
gb|ACJ62603.1|  pathogenesis-related maize seed protein                 142   1e-38   



>ref|XP_011092436.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 108/170 (64%), Gaps = 13/170 (8%)
 Frame = +2

Query  23   EMGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNT  202
            ++ + S L VC+ + +            + AC     + +L AHN  R  VG PPL WN 
Sbjct  2    DIPKLSLLSVCLMVAL------------QLACAQNSPDDYLKAHNAGRAQVGVPPLAWNE  49

Query  203  TLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNAC  382
            TL  YAE YA KRA DC ++HS GPYGEN+A    +++A+ +V++W+DEK +Y+  TN C
Sbjct  50   TLVAYAEDYAKKRAGDCAMKHSDGPYGENLAKGSWDVNAKEAVQMWLDEKKFYDEATNTC  109

Query  383  VSQE-CLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  E CLHYTQVVW  +T +GCAR  C  GW FVTCNY PPGNY G++PY
Sbjct  110  IGGEPCLHYTQVVWRGSTHVGCARVKCSNGWTFVTCNYDPPGNYVGERPY  159



>ref|XP_010041202.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=163

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 111/166 (67%), Gaps = 7/166 (4%)
 Frame = +2

Query  38   SFLQVCVAIN-IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAE  214
            SF +  +AI  +  L A ++ SF +S       + F+ AHN AR  VG  PL WN T+A 
Sbjct  3    SFSKSSLAITCLTFLLAFAETSFAQST-----HQDFVDAHNAARAQVGVAPLAWNDTVAA  57

Query  215  YAESYATKRAAD-CLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQ  391
            YA++YA KRAA  C LEHS GPYGEN+A    ELS E +VK+W+ E+  Y+H++NACV  
Sbjct  58   YAQTYANKRAATGCALEHSMGPYGENLAEGYGELSGEDAVKMWVSERANYDHHSNACVGG  117

Query  392  ECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            ECLHYTQVVW ++  +GCAR  C  GW FVTCNY PPGNY G+ PY
Sbjct  118  ECLHYTQVVWRSSIHLGCARVKCSNGWWFVTCNYDPPGNYEGESPY  163



>ref|XP_011092471.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 109/170 (64%), Gaps = 13/170 (8%)
 Frame = +2

Query  23   EMGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNT  202
            ++ + S L +C+ + +            + AC       FL AHN  R  VG PPL WN 
Sbjct  2    DIPKLSILSICLMVAL------------QLACAQNSPGDFLKAHNAGRAQVGVPPLAWNE  49

Query  203  TLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNAC  382
            TL  YA+ YA KR+ DC ++HS GPYGEN+A    +++A+ +V++W+DEK +Y+  +N+C
Sbjct  50   TLVAYAQDYAKKRSGDCAMKHSDGPYGENLAAGSWDVNAKEAVQMWLDEKKFYDVGSNSC  109

Query  383  VSQE-CLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  E CLHYTQVVW  +T +GCARA C  GW FVTCNY PPGNY G++PY
Sbjct  110  IGGEPCLHYTQVVWRGSTHVGCARAKCSNGWTFVTCNYDPPGNYVGERPY  159



>ref|XP_010065837.1| PREDICTED: pathogenesis-related protein 1A-like [Eucalyptus grandis]
Length=163

 Score =   174 bits (442),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 112/166 (67%), Gaps = 7/166 (4%)
 Frame = +2

Query  38   SFLQVCVAIN-IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAE  214
            SF +  +AI  +  L AI++ S  +S       + F+ AHN AR  VG  PL WN T+A 
Sbjct  3    SFNKSSLAITCLTFLLAIAETSLAQST-----HQDFVDAHNGARAQVGVAPLTWNDTVAA  57

Query  215  YAESYATKRAAD-CLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQ  391
            YA++YA+KRAA  C LEHS GPYGEN+A    ELS E +VK+W+ E+  Y+H++NACV  
Sbjct  58   YAQTYASKRAATGCALEHSMGPYGENLAEGYGELSGEDAVKMWVSERANYDHHSNACVGG  117

Query  392  ECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            ECLHYTQVVW ++  +GCAR  C  GW FVTCNY PPGNY G+ PY
Sbjct  118  ECLHYTQVVWRSSIHLGCARVKCSNGWWFVTCNYDPPGNYEGESPY  163



>ref|XP_002313935.2| hypothetical protein POPTR_0009s08660g [Populus trichocarpa]
 gb|EEE87890.2| hypothetical protein POPTR_0009s08660g [Populus trichocarpa]
Length=160

 Score =   174 bits (442),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR AVG  PL W+TT+  YA++YA +RA DC L HSGGPYGENIA + ++L
Sbjct  28   QDYLDAHNTARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVHSGGPYGENIAWSSADL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +VK+W+DE  YY++N+N+C S Q+C HYTQVVWGN+ ++GCA+ TC  G  F+ CN
Sbjct  88   SGTDAVKMWVDEMAYYDYNSNSCASGQQCGHYTQVVWGNSVSLGCAKVTCSAGGTFIVCN  147

Query  491  YYPPGNYAGQKPY  529
            Y PPGN  GQKPY
Sbjct  148  YDPPGNVVGQKPY  160



>ref|XP_002274307.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=161

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 102/154 (66%), Gaps = 3/154 (2%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAA  247
            ++GL  ++ A      C     + ++ AHN AR  VG   + WN T+A YA++YA KR +
Sbjct  11   LVGLMGLALAHV---CCAQNSPQDYVNAHNAARAQVGVGSMTWNDTVAAYAQNYANKRIS  67

Query  248  DCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGN  427
            DC L HSGGPYGEN+A     L+   +V LW+ EKP Y++N+N+CV  ECLHYTQVVW N
Sbjct  68   DCNLVHSGGPYGENLAKGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGECLHYTQVVWSN  127

Query  428  TTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  +GCAR  C  GW FVTCNY PPGNY GQ+PY
Sbjct  128  SVRLGCARVQCNNGWWFVTCNYDPPGNYVGQRPY  161



>ref|XP_002273355.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
Length=160

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = +2

Query  41   FLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYA  220
            F +  +AI I G +A++  S  +S+      + ++ AHN AR  VG  P+ WN T+A YA
Sbjct  3    FHKFLLAIYIFG-SALAHFSLAQSS-----PQDYVDAHNAARAQVGVQPITWNETVAAYA  56

Query  221  ESYATKRAAD-CLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQEC  397
              YA+ R A+ C +EHSGGPYGEN+A     +S   +V+ W+ EKP Y+HN+N+CV  EC
Sbjct  57   RRYASSRVAEQCSMEHSGGPYGENLAEGYGSMSGSDAVEFWLTEKPNYDHNSNSCVGGEC  116

Query  398  LHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            LHYTQ+VWG +  +GCAR  CK GW F+TCNYYPPGN  G++PY
Sbjct  117  LHYTQIVWGGSLHLGCARVQCKNGWWFITCNYYPPGNIEGERPY  160



>gb|KHN19052.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=160

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL  HN+AR  VG  PL WN TL  YA+SYA KR  DC LEHS GP+GENIA   +E+
Sbjct  29   QDFLDVHNQARAEVGVGPLSWNHTLQAYAQSYANKRIPDCNLEHSMGPFGENIAEGYAEM  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
                +VK W+ EKPYY+H++NACV  ECLHYTQ+VW ++  +GCARA C   W+FV C+Y
Sbjct  89   KGSDAVKFWLTEKPYYDHHSNACVHDECLHYTQIVWRDSVHLGCARAKCNNDWVFVICSY  148

Query  494  YPPGNYAGQKPY  529
             PPGN  G++PY
Sbjct  149  SPPGNIEGERPY  160



>ref|XP_003543105.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
 ref|XP_003543107.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
isoform 1 [Glycine max]
 ref|XP_003543109.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
isoform 1 [Glycine max]
 ref|XP_003543111.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
 gb|ACU15480.1| unknown [Glycine max]
Length=174

 Score =   174 bits (441),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 112/175 (64%), Gaps = 18/175 (10%)
 Frame = +2

Query  32   EFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGS---------P  184
            + SF  +CV    +GL  +   ++ + +      E ++ AHN AR  VGS         P
Sbjct  7    KISFCVMCV----LGLVIVGDVAYAQDSA-----EDYVNAHNAARAEVGSQSPRQTVIVP  57

Query  185  PLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYN  364
             L W+ T+A YAESYA +R  DC L HSGG YGENIAM+  ELS   +VK+W+DEK  Y+
Sbjct  58   SLAWDDTVAAYAESYANQRKGDCQLIHSGGEYGENIAMSTGELSGTDAVKMWVDEKSNYD  117

Query  365  HNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +++N+CV  ECLHYTQVVW N+  +GCA+ TC  G  F+TCNY PPGN+ G++PY
Sbjct  118  YDSNSCVGGECLHYTQVVWANSVRLGCAKVTCDNGGTFITCNYDPPGNFVGERPY  172



>gb|KCW44547.1| hypothetical protein EUGRSUZ_L01945 [Eucalyptus grandis]
Length=179

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = +2

Query  92   QASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAAD-CLLEHS  268
            Q +F E++      + F+ AHN AR  VG  PL WN T+A YA++YA KRAA  C LEHS
Sbjct  33   QPAFAETSFAQSTHQDFVDAHNAARAQVGVAPLAWNDTVAAYAQTYANKRAATGCALEHS  92

Query  269  GGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCA  448
             GPYGEN+A    ELS E +VK+W+ E+  Y+H++NACV  ECLHYTQVVW ++  +GCA
Sbjct  93   MGPYGENLAEGYGELSGEDAVKMWVSERANYDHHSNACVGGECLHYTQVVWRSSIHLGCA  152

Query  449  RATCKTGWMFVTCNYYPPGNYAGQKPY  529
            R  C  GW FVTCNY PPGNY G+ PY
Sbjct  153  RVKCSNGWWFVTCNYDPPGNYEGESPY  179



>ref|XP_002274371.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN80994.1| hypothetical protein VITISV_042545 [Vitis vinifera]
Length=161

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 103/154 (67%), Gaps = 3/154 (2%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAA  247
            ++GL  ++ A    + C     + ++ AHN AR  VG   + WN T+A YA++YA +R +
Sbjct  11   LVGLMGLALA---HTCCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRIS  67

Query  248  DCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGN  427
            DC L HSGGPYGEN+A     L+   +V LW+ EKPYY++N+N+CV  EC HYTQVVW N
Sbjct  68   DCNLVHSGGPYGENLAKGSGSLTGTDAVNLWVGEKPYYDYNSNSCVGGECGHYTQVVWRN  127

Query  428  TTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  +GCAR  C  GW FVTCNY PPGNY GQ+PY
Sbjct  128  SVRLGCARVQCNNGWWFVTCNYDPPGNYVGQRPY  161



>gb|KCW63507.1| hypothetical protein EUGRSUZ_G01138 [Eucalyptus grandis]
Length=149

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 105/152 (69%), Gaps = 6/152 (4%)
 Frame = +2

Query  77   LAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAAD-C  253
            L AI++ S  +S       + F+ AHN AR  VG  PL WN T+A YA++YA+KRAA  C
Sbjct  3    LKAIAETSLAQST-----HQDFVDAHNGARAQVGVAPLTWNDTVAAYAQTYASKRAATGC  57

Query  254  LLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTT  433
             LEHS GPYGEN+A    ELS E +VK+W+ E+  Y+H++NACV  ECLHYTQVVW ++ 
Sbjct  58   ALEHSMGPYGENLAEGYGELSGEDAVKMWVSERANYDHHSNACVGGECLHYTQVVWRSSI  117

Query  434  TIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             +GCAR  C  GW FVTCNY PPGNY G+ PY
Sbjct  118  HLGCARVKCSNGWWFVTCNYDPPGNYEGESPY  149



>ref|XP_011091978.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 108/170 (64%), Gaps = 13/170 (8%)
 Frame = +2

Query  23   EMGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNT  202
            ++ + S L +C+ + +            + AC       FL AHN  R  VG PPL WN 
Sbjct  2    DIPKLSILLICLMVAL------------QLACAQNSPGDFLKAHNAGRAQVGVPPLAWNE  49

Query  203  TLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNAC  382
            TL  YA+ YA KR+ DC ++HS GPYGEN+A    +++A+  V++W+DEK +Y+  +N+C
Sbjct  50   TLVAYAQDYAKKRSGDCAMKHSDGPYGENLAAGSWDVNAKEVVQMWLDEKKFYDVGSNSC  109

Query  383  VSQE-CLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  E CLHYTQVVW  +T +GCARA C  GW FVTCNY PPGNY G++PY
Sbjct  110  IGGEPCLHYTQVVWRGSTHVGCARAKCSNGWTFVTCNYDPPGNYVGERPY  159



>ref|NP_001238109.1| uncharacterized protein LOC100499927 precursor [Glycine max]
 gb|ACU14207.1| unknown [Glycine max]
Length=161

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL  HN+AR  VG  PL WN TL  YA+SYA KR  DC LEHS GP+GENI+   +E+
Sbjct  30   QDFLDVHNQARAEVGVGPLSWNHTLQAYAQSYANKRIPDCNLEHSMGPFGENISEGYAEM  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
                +VK W+ EKPYY+H++NACV  ECLHYTQ+VW ++  +GCARA C   W+FV C+Y
Sbjct  90   KGSDAVKFWLTEKPYYDHHSNACVHDECLHYTQIVWRDSVHLGCARAKCNNDWVFVICSY  149

Query  494  YPPGNYAGQKPY  529
             PPGN  G++PY
Sbjct  150  SPPGNIEGERPY  161



>ref|XP_004486257.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cicer arietinum]
Length=158

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + F+  HN+ARE VG  PL WN TL  YA++YA KR  DC LEHS GP+GEN+A    E+
Sbjct  27   QDFVDVHNEAREVVGVGPLYWNHTLEAYAQNYANKRIKDCELEHSMGPFGENLAEGYGEM  86

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +VK W+ EKPYY++N+N+CV  ECLHYTQ++W ++  +GCA++ C+ GW+FV C+Y
Sbjct  87   NGSDAVKFWLTEKPYYDYNSNSCVHDECLHYTQIIWSDSVHLGCAKSKCQNGWVFVICSY  146

Query  494  YPPGNYAGQKPY  529
             PPGN  GQ+PY
Sbjct  147  SPPGNVEGQRPY  158



>ref|XP_002265050.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CBI35453.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 103/154 (67%), Gaps = 5/154 (3%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAA  247
            +IG A +   S+ +++      + +L AHN AR  V   P+ WN T+A YA+SYA K+  
Sbjct  13   LIGSALLVHTSYAQNS-----QQDYLNAHNTARAQVSVGPMTWNNTVAAYAQSYANKQIG  67

Query  248  DCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGN  427
            DC L HS GPYGEN+A      +  A+V LW+ EKP Y++N+N+CV  EC HYTQVVW N
Sbjct  68   DCNLVHSNGPYGENLAKGSGSFTGTAAVNLWVAEKPNYDYNSNSCVGGECRHYTQVVWRN  127

Query  428  TTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            + ++GCARA C  GW ++ CNYYPPGNY GQ+PY
Sbjct  128  SVSLGCARAQCNNGWWYIICNYYPPGNYIGQRPY  161



>gb|ABK94784.1| unknown [Populus trichocarpa]
 gb|ABK96093.1| unknown [Populus trichocarpa]
Length=161

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR AVG  PL W+TT+  YA++YA +RA DC L HSGGPYGENIA + ++L
Sbjct  29   QDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVHSGGPYGENIAWSSADL  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +VK+W+DEK YY++N+N+C + Q+C HYTQVVW N+  +GCA+  C TG  F+ CN
Sbjct  89   SGTDAVKMWVDEKAYYDYNSNSCAAGQQCGHYTQVVWRNSARLGCAKVKCSTGGTFIGCN  148

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQKPY
Sbjct  149  YDPPGNYVGQKPY  161



>gb|KHN19054.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
 gb|KHN19058.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=162

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 107/163 (66%), Gaps = 14/163 (9%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGS---------PPLKWNTTLAEYA  220
            ++GL  +   ++ + +      E ++ AHN AR  VGS         P L W+ T+A YA
Sbjct  3    VLGLVIVGDVAYAQDSA-----EDYVNAHNAARAEVGSQSPRQTVIVPSLAWDDTVAAYA  57

Query  221  ESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECL  400
            ESYA +R  DC L HSGG YGENIAM+  ELS   +VK+W+DEK  Y++++N+CV  ECL
Sbjct  58   ESYANQRKGDCQLIHSGGEYGENIAMSTGELSGTDAVKMWVDEKSNYDYDSNSCVGGECL  117

Query  401  HYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            HYTQVVW N+  +GCA+ TC  G  F+TCNY PPGN+ G++PY
Sbjct  118  HYTQVVWANSVRLGCAKVTCDNGGTFITCNYDPPGNFVGERPY  160



>gb|ADN43433.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 108/168 (64%), Gaps = 7/168 (4%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F  + + + + ++GLA         + C    ++ ++ AHN AR  VG  P+ WN T
Sbjct  1    MGLFK-ISLALXVGLMGLA------LAHTCCAQNSLQDYVDAHNAARAQVGVGPMTWNNT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HSGGPYGENIA     L++  +V +W+ EKP Y++N+N+CV
Sbjct  54   VAAYAQNYANQRIGDCSLVHSGGPYGENIAWGSPSLTSTDAVNMWVGEKPNYDYNSNSCV  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              EC HYTQVVW N+  +GCAR  C  G  FVTCNY PPGNY GQ+PY
Sbjct  114  GGECGHYTQVVWRNSVRLGCARVQCDNGGWFVTCNYDPPGNYVGQRPY  161



>ref|XP_011092435.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 108/170 (64%), Gaps = 13/170 (8%)
 Frame = +2

Query  23   EMGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNT  202
            ++ + S L VC+ + +            + AC     + +L AHN  R  VG PPL W+ 
Sbjct  2    DIPKLSLLSVCLMVAL------------QLACAQNSPDDYLKAHNAGRAQVGVPPLAWSE  49

Query  203  TLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNAC  382
            TL  YAE YA KRA DC ++HS GPYGEN+A    +++A+ +V++W+DEK +Y+  TN C
Sbjct  50   TLVAYAEDYAKKRAGDCAMKHSDGPYGENLAKGSWDVNAKEAVQMWLDEKKFYDEATNTC  109

Query  383  VSQE-CLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  E CLHYTQVVW  +T +GCA+  C  GW FV+CNY PPGNY G++PY
Sbjct  110  IGGEPCLHYTQVVWRGSTHVGCAKVKCANGWAFVSCNYDPPGNYVGERPY  159



>gb|ADN43443.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43444.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +2

Query  116  CDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIA  295
            C     + ++ AHN AR  VG   + WN T+A YA++YA KR +DC L HSGGPYGEN+A
Sbjct  24   CAQNSPQDYVNAHNAARAQVGVGSMTWNDTVAAYAQNYANKRISDCNLVHSGGPYGENLA  83

Query  296  MAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWM  475
                 L+   +V LW+ EKP Y++N+N+CV  ECLHYTQVVW N+  +GCAR  C  GW 
Sbjct  84   KGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGECLHYTQVVWSNSVRLGCARVQCNNGWW  143

Query  476  FVTCNYYPPGNYAGQKPY  529
            FVTCNY PPGNY GQ+PY
Sbjct  144  FVTCNYDPPGNYVGQRPY  161



>ref|XP_007041425.1| Pathogenesis-related protein 1 [Theobroma cacao]
 gb|EOX97256.1| Pathogenesis-related protein 1 [Theobroma cacao]
Length=159

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L+ H+ AR  VG  P+ W+  +A YA+ YA  R ADC L HS GPYGENIA A   L
Sbjct  28   QDYLSVHDAARAQVGVGPMTWDPEVAAYAQDYANIRVADCGLVHSYGPYGENIAEASYAL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +V++W+DEKPYYN++ N CV  ECLHYTQVVW N+T +GCAR  C +GW FVTCNY
Sbjct  88   TGAEAVQMWVDEKPYYNYDANICVGGECLHYTQVVWRNSTRLGCARVECNSGWWFVTCNY  147

Query  494  YPPGNYAGQKPY  529
             PPGNY G++PY
Sbjct  148  DPPGNYVGERPY  159



>ref|XP_010252393.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=167

 Score =   172 bits (436),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 102/154 (66%), Gaps = 5/154 (3%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAA  247
            IIGLAA    S  + +      + ++ AHN AR  VG   + W+  +A YA+ YA +R  
Sbjct  19   IIGLAAGLHVSLAQDS-----PQDYINAHNAARAEVGVGSMTWDDKVAAYAQQYANQRIG  73

Query  248  DCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGN  427
            DC L HSGGPYGEN+A A   LS   +VK+W+DEK YY++N+N+C   ECLHYTQVVW +
Sbjct  74   DCALVHSGGPYGENLAAAMPSLSGTDAVKMWVDEKQYYDYNSNSCSGGECLHYTQVVWRD  133

Query  428  TTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  +GCA+  C  GW FVTCNY PPGNY GQ+PY
Sbjct  134  SVRLGCAKVHCNNGWDFVTCNYDPPGNYVGQRPY  167



>ref|XP_006379156.1| pathogenesis-related family protein [Populus trichocarpa]
 gb|ERP56953.1| pathogenesis-related family protein [Populus trichocarpa]
Length=161

 Score =   171 bits (434),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR AVG  PL W+TT+  YA++YA +RA DC L HSGGPYGEN+A + ++L
Sbjct  29   QDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLIHSGGPYGENLAWSSADL  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +VK+W+DEK YY++N+N+C + Q+C HYTQVVW N+  +GCA+  C TG  F+ CN
Sbjct  89   SGTDAVKMWVDEKAYYDYNSNSCAAGQQCGHYTQVVWRNSARLGCAKVKCSTGGTFIGCN  148

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQKPY
Sbjct  149  YDPPGNYVGQKPY  161



>dbj|BAB78476.1| PR-1 [Solanum torvum]
Length=168

 Score =   171 bits (434),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            E FL AHN AR  VG  P+ W+ TLA YA++YA +R  DC+++HS GPYGEN+A A  +L
Sbjct  20   ENFLNAHNAARRRVGVGPMTWDNTLAAYAQNYANQRIGDCMMQHSDGPYGENLAAAFPQL  79

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +A  +VK+W DEK +Y++N+N C   + C HYTQVVW N+  +GCAR  C +GW+F+TCN
Sbjct  80   NAAGAVKMWEDEKQWYDYNSNTCAPGKVCGHYTQVVWRNSVRLGCARVRCSSGWVFITCN  139

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQ+PY
Sbjct  140  YDPPGNYIGQRPY  152



>gb|AFJ93090.1| pathogenesis-related protein 1 [Bacopa monnieri]
Length=176

 Score =   172 bits (435),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL AHN AR  VG  PL WN T+A YA  YA KR  DC LEHS GPYGEN+A     L
Sbjct  45   QDFLNAHNHARAQVGVKPLVWNDTIASYALDYARKRYGDCELEHSDGPYGENLAEGWGRL  104

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            SA  +V +W+ EK  Y++N+N+CV  ECLHYTQVVW ++T +GCAR  C  GW+FVTCNY
Sbjct  105  SAVDAVGMWVSEKSCYDYNSNSCVGGECLHYTQVVWRDSTHLGCARLQCHNGWLFVTCNY  164

Query  494  YPPGNYAGQKPY  529
             PPGNY G++PY
Sbjct  165  DPPGNYVGERPY  176



>gb|KDP37603.1| hypothetical protein JCGZ_06946 [Jatropha curcas]
Length=157

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN+AR AVG  PL W+ T+A YA++YA++RA DC L HSGGPYGEN+A + +EL
Sbjct  25   QDYLDAHNQARAAVGVGPLSWDDTVAAYAQNYASQRAGDCNLVHSGGPYGENLAWSSAEL  84

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +VK+W+DEK YY++++N+C   Q C HYTQVVW ++  +GCA+  C  G  FVTCN
Sbjct  85   SGTDAVKMWVDEKAYYDYDSNSCSPGQMCGHYTQVVWSSSVRVGCAKVRCSNGGTFVTCN  144

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQKPY
Sbjct  145  YDPPGNYVGQKPY  157



>gb|ADN43441.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = +2

Query  116  CDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIA  295
            C     + +  AHN AR  VG   + WN T+A YA++YA KR +DC L HSGGPYGEN+A
Sbjct  24   CAQNSPQDYANAHNAARAQVGVGSMTWNDTVAAYAQNYANKRISDCNLVHSGGPYGENLA  83

Query  296  MAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWM  475
                 L+   +V LW+ EKP Y++N+N+CV  ECLHYTQ+VW N+  +GCAR  C  GW 
Sbjct  84   KGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGECLHYTQIVWSNSVRLGCARVQCNNGWW  143

Query  476  FVTCNYYPPGNYAGQKPY  529
            FVTCNY PPGNY GQ+PY
Sbjct  144  FVTCNYDPPGNYVGQRPY  161



>gb|KDP37606.1| hypothetical protein JCGZ_06949 [Jatropha curcas]
Length=163

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN+AR AVG  PL W+ T+A YA++YA++RA DC L HSGGPYGEN+A + +EL
Sbjct  31   QDYLDAHNQARAAVGVGPLSWDDTVAAYAQNYASQRAGDCNLVHSGGPYGENLAWSSAEL  90

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +VK+W+DEK YY++++N+C   Q C HYTQVVW ++  +GCA+  C  G  FVTCN
Sbjct  91   SGTDAVKMWVDEKAYYDYDSNSCSPGQMCGHYTQVVWRDSVRVGCAKVRCSNGGTFVTCN  150

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQKPY
Sbjct  151  YDPPGNYVGQKPY  163



>emb|CAN68901.1| hypothetical protein VITISV_019988 [Vitis vinifera]
Length=150

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR  V   P+ WN T+A YA+SYA K+  DC L HS GPYGEN+A      
Sbjct  19   QDYLNAHNTARAQVSVGPMTWNNTVAAYAQSYANKQIGDCNLVHSNGPYGENLAKGSGSF  78

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +  A+V LW+ EKP Y++++N+CV  EC HYTQVVW N+ ++GCARA C  GW F+ CNY
Sbjct  79   TGTAAVNLWVAEKPNYDYSSNSCVGGECRHYTQVVWRNSVSLGCARAQCNNGWWFIICNY  138

Query  494  YPPGNYAGQKPY  529
            YPPGNY GQ+PY
Sbjct  139  YPPGNYIGQRPY  150



>gb|KHN33603.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=161

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL  HN+AR  VG  PL WN TL  YA+ YA +R  DC LEHS GP+GEN+A    E+
Sbjct  30   QDFLDVHNQARAEVGVGPLSWNHTLQAYAQRYANERIPDCNLEHSMGPFGENLAEGYGEM  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
                +VK W+ EKPYY+H +NACV  ECLHYTQ+VW ++  +GCARA C  GW+FV C+Y
Sbjct  90   KGSDAVKFWLTEKPYYDHYSNACVHDECLHYTQIVWRDSVHLGCARAKCNNGWVFVICSY  149

Query  494  YPPGNYAGQKPY  529
             PPGN  G++PY
Sbjct  150  SPPGNIEGERPY  161



>ref|XP_011002601.1| PREDICTED: pathogenesis-related protein 1-like [Populus euphratica]
Length=162

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR AVG  PL W+TT+  YA++YA +RA DC L HSGGPYGEN+A + ++L
Sbjct  30   QDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVHSGGPYGENLAWSSADL  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +VK+W+DEK YY++++N+C + Q+C HYTQVVW N+  +GCA+  C TG  F+ CN
Sbjct  90   SGTDAVKMWVDEKAYYDYSSNSCAAGQQCGHYTQVVWRNSARLGCAKVKCSTGGTFIGCN  149

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQKPY
Sbjct  150  YDPPGNYVGQKPY  162



>ref|XP_004292311.1| PREDICTED: cysteine-rich secretory protein 1-like [Fragaria vesca 
subsp. vesca]
Length=267

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            +GFL  HNKAR  VG  PLKWN TLA YA+ YA K++  C + HSGGPYGE IA    ++
Sbjct  136  QGFLDEHNKARAEVGVAPLKWNETLAAYAQDYANKKSKTCEMVHSGGPYGECIAENFPDM  195

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            + E + KLWM EKP Y++ TN C +  CLHYTQ+VW  TT +GCA+A CK GW+FV CNY
Sbjct  196  TGEEATKLWMTEKPDYDYATNTCHTDSCLHYTQIVWKTTTDLGCAKAHCKNGWVFVICNY  255

Query  494  YPPGNYAGQKPY  529
            YP GNY G +PY
Sbjct  256  YPIGNYPGVRPY  267



>gb|KDP37611.1| hypothetical protein JCGZ_06954 [Jatropha curcas]
Length=163

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN+AR AVG  PL W+ T+A YA++YA +RA DC L HSGGPYGEN+A + +EL
Sbjct  31   QDYLDAHNQARTAVGVGPLSWDDTVAAYAQNYANQRAGDCNLVHSGGPYGENLAWSSAEL  90

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +VK+W+DEK YY++++N+C   Q C HYTQVVW ++  +GCA+  C  G  F+TCN
Sbjct  91   SGTDAVKMWVDEKAYYDYDSNSCSPGQMCGHYTQVVWSSSVRVGCAKVRCSNGGTFITCN  150

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQKPY
Sbjct  151  YDPPGNYVGQKPY  163



>gb|ADN43439.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 106/168 (63%), Gaps = 7/168 (4%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F  + + + + ++GLA         + C     + ++ AHN AR  VG   + WN T
Sbjct  1    MGLFK-ISLALLVGLMGLA------LAHTCCAQNSAQDYVDAHNAARAQVGVGSITWNDT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R +DC L HSGG YGEN+A     L+   +V LW+ EKP Y++N+N+CV
Sbjct  54   VAAYAQNYANQRISDCNLVHSGGRYGENLAKGSPSLTGTDAVNLWVGEKPNYDYNSNSCV  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              EC HYTQVVW N+  +GCAR  C  GW FVTCNY PPGNY GQ+PY
Sbjct  114  GGECGHYTQVVWRNSVRLGCARVQCNNGWWFVTCNYDPPGNYVGQRPY  161



>ref|NP_001237253.1| uncharacterized protein LOC100527778 precursor [Glycine max]
 gb|ACU16951.1| unknown [Glycine max]
Length=161

 Score =   169 bits (427),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL  HN+AR  VG  PL WN TL  YA+ YA +R  DC LEHS GP+GEN+A    E+
Sbjct  30   QDFLDVHNQARAEVGVGPLSWNHTLQAYAQRYANERIPDCNLEHSMGPFGENLAEGYGEM  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
                +VK W+ EKPYY+H +NACV  ECLHYTQ+VW  +  +GCARA C  GW+FV C+Y
Sbjct  90   KGSDAVKFWLTEKPYYDHYSNACVHDECLHYTQIVWRGSVHLGCARAKCNNGWVFVICSY  149

Query  494  YPPGNYAGQKPY  529
             PPGN  G++PY
Sbjct  150  SPPGNIEGERPY  161



>gb|AEV57469.1| pathogensis-related protein 1b [Prunus persica]
Length=190

 Score =   169 bits (429),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 96/137 (70%), Gaps = 1/137 (1%)
 Frame = +2

Query  131  IEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSE  310
            I+GF+  HNKAR  VG+ PLKWN TLA+YA+ YA KR  DC +EHSGGPYGEN+A +G  
Sbjct  30   IDGFVEEHNKARAQVGNRPLKWNATLAKYAQDYADKRVDDCAMEHSGGPYGENLA-SGEG  88

Query  311  LSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +S  A+ K W+ EK +Y+++ N CV  EC HY  V+WG TT +GC  + CK G  +V CN
Sbjct  89   MSGAAAAKYWVTEKEFYDYDLNKCVRDECGHYLGVIWGKTTEVGCGISKCKNGLNYVICN  148

Query  491  YYPPGNYAGQKPY*TYT  541
            Y PPGNY G+KPY  Y 
Sbjct  149  YDPPGNYVGEKPYEPYN  165



>gb|ADN43440.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = +2

Query  116  CDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIA  295
            C     + ++ AHN AR  VG   +  N T+A YA++YA KR +DC L HSGGPYGEN+A
Sbjct  24   CAQNSPQDYVNAHNAARAQVGVGSMTRNDTVAAYAQNYANKRISDCNLVHSGGPYGENLA  83

Query  296  MAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWM  475
                 L+   +V LW+ EKP Y++N+N+CV  ECLHYTQVVW N+  +GCAR  C  GW 
Sbjct  84   KGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGECLHYTQVVWSNSVRLGCARVQCNNGWW  143

Query  476  FVTCNYYPPGNYAGQKPY  529
            FVTCNY PPGNY GQ+PY
Sbjct  144  FVTCNYDPPGNYVGQRPY  161



>gb|ADN43429.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 0/141 (0%)
 Frame = +2

Query  107  ESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGE  286
             + C     + ++ AHN AR  VG   + WN T+A YA++YA +R +DC L HSGGPYGE
Sbjct  21   HTCCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHSGGPYGE  80

Query  287  NIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKT  466
            N+A     L+   +V LW+ EK YY++N+N+CV  EC HYTQVVW N+  +GCAR  C  
Sbjct  81   NLAKGSGSLTGTDAVNLWVGEKSYYDYNSNSCVGGECGHYTQVVWRNSVRLGCARVQCNN  140

Query  467  GWMFVTCNYYPPGNYAGQKPY  529
            GW FVTCNY PPGNY GQ+PY
Sbjct  141  GWWFVTCNYDPPGNYVGQRPY  161



>ref|NP_001234358.1| PR1 protein precursor [Solanum lycopersicum]
 gb|ACB88202.1| PR1 protein [Solanum lycopersicum]
Length=179

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR  VG  P+ W+  LA +A++YA +RA DC ++HSGGPYGEN+A A  +L
Sbjct  28   QDYLNAHNAARRQVGVGPMTWDNRLAAFAQNYANQRAGDCRMQHSGGPYGENLAAAFPQL  87

Query  314  SAEASVKLWMDEKPYYNHNTNAC-VSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +A  +VK+W+DEK +YN+N+N C   + C HYTQVVW N+  +GCAR  C  GW F+TCN
Sbjct  88   NAAGAVKMWVDEKQWYNYNSNTCQAGKVCGHYTQVVWRNSVRLGCARVRCNNGWYFITCN  147

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ GQ+PY
Sbjct  148  YDPPGNWRGQRPY  160



>gb|KGN43826.1| hypothetical protein Csa_7G070232 [Cucumis sativus]
Length=171

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN  R AVG  PL WN+TLA+YA++YA  + A C +EHSGGPYGEN+A     +
Sbjct  38   KNYIDAHNAVRAAVGVEPLHWNSTLADYAQNYANTKIATCQMEHSGGPYGENLAEGNEVM  97

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQ--ECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
            +AE +V LW DEK +Y++N+N C +    CLHYTQ+VW NT ++GCA+  C+  W+F+ C
Sbjct  98   TAETAVSLWADEKKHYDYNSNTCSNDPSNCLHYTQLVWSNTKSVGCAQVKCQNNWVFLIC  157

Query  488  NYYPPGNYAGQKPY  529
            +YYPPGNY GQ+PY
Sbjct  158  SYYPPGNYNGQRPY  171



>ref|NP_001238168.1| PR1a precursor [Glycine max]
 gb|AAD33696.1|AF136636_1 PR1a precursor [Glycine max]
Length=174

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 110/175 (63%), Gaps = 18/175 (10%)
 Frame = +2

Query  32   EFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGS---------P  184
            + SF  +CV    +GL  +   ++ + +      E ++ AHN A   VGS         P
Sbjct  7    KISFCVMCV----LGLVIVGDVAYAQDS-----AEDYVNAHNAAEAEVGSQSPRQTVIVP  57

Query  185  PLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYN  364
             L W+ T+A YAESYA +R  DC L HSGG YGENIAM+  ELS   +VK+W+DEK   +
Sbjct  58   SLAWDDTVAAYAESYANQRKGDCQLIHSGGEYGENIAMSTGELSGTDAVKMWVDEKSNCD  117

Query  365  HNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +++N+CV  ECLHYTQVVW N+  +GCA+ TC  G  F+TCNY PPGN+ G++PY
Sbjct  118  YDSNSCVGGECLHYTQVVWANSVRLGCAKVTCDNGGTFITCNYDPPGNFVGERPY  172



>gb|ADN43438.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 106/168 (63%), Gaps = 7/168 (4%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F  + + + + ++GLA         SA D      ++ AHN AR  VG   + WN T
Sbjct  1    MGLFK-ISLALLVGLMGLALAHTCRAQNSAQD------YVDAHNAARARVGVGSITWNDT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R +DC L HSGG YGEN A     L+   +V LW+ EKP Y++N+N+CV
Sbjct  54   VAAYAQNYANQRISDCNLVHSGGRYGENPAKGSPSLTGTDAVNLWVGEKPNYDYNSNSCV  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              EC HYTQVVW N+  +GCARA C  GW FVTCNY PPGNY GQ+PY
Sbjct  114  GGECGHYTQVVWRNSVRLGCARAQCNNGWWFVTCNYDPPGNYVGQRPY  161



>ref|XP_004137080.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=169

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN  R AVG  PL WN+TLA+YA++YA  + A C +EHSGGPYGEN+A     +
Sbjct  36   KNYIDAHNAVRAAVGVEPLHWNSTLADYAQNYANTKIATCQMEHSGGPYGENLAEGNEVM  95

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQ--ECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
            +AE +V LW DEK +Y++N+N C +    CLHYTQ+VW NT ++GCA+  C+  W+F+ C
Sbjct  96   TAETAVSLWADEKKHYDYNSNTCSNDPSNCLHYTQLVWSNTKSVGCAQVKCQNNWVFLIC  155

Query  488  NYYPPGNYAGQKPY  529
            +YYPPGNY GQ+PY
Sbjct  156  SYYPPGNYNGQRPY  169



>ref|XP_006583787.1| PREDICTED: basic form of pathogenesis-related protein 1-like, 
partial [Glycine max]
Length=160

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 98/150 (65%), Gaps = 7/150 (5%)
 Frame = +2

Query  92   QASFGESACDSGCIEGFLAAHNKAREAVGS----PPLKWNTTLAEYAESYATKRAADCLL  259
            Q   G + C     E FL   N AR  V      PPL WN TLAEYA+ YA +R ++C L
Sbjct  14   QPHVGHAQCSQ---EDFLNGQNDARSDVDVQVPLPPLVWNNTLAEYAQDYAKQRKSNCQL  70

Query  260  EHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTI  439
             HS GPYGEN+A +  ++S   +VKLW+DEKPYY+ N+N+CV   C HYTQVVW ++T +
Sbjct  71   VHSNGPYGENLAGSTGDISCANAVKLWVDEKPYYDRNSNSCVGGVCGHYTQVVWRDSTQV  130

Query  440  GCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            GCA+  C  G  F+ CNYYPPGNY GQ+PY
Sbjct  131  GCAKVECDNGGTFICCNYYPPGNYVGQRPY  160



>gb|ADN43442.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 0/141 (0%)
 Frame = +2

Query  107  ESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGE  286
             + C     + ++ AHN AR  VG   + WN T+A YA++YA +R +DC L HSGGPYGE
Sbjct  21   HTCCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHSGGPYGE  80

Query  287  NIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKT  466
            N+A     L+   +V LW+ EKPYY++N+N+CV  EC  YTQVVW N+  +GCAR  C  
Sbjct  81   NLAKGSGSLTGTDAVNLWVGEKPYYDYNSNSCVGGECGLYTQVVWRNSVRLGCARVQCNN  140

Query  467  GWMFVTCNYYPPGNYAGQKPY  529
            GW FVTCNY PPGNY GQ+PY
Sbjct  141  GWWFVTCNYDPPGNYVGQRPY  161



>gb|ADN43432.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 105/168 (63%), Gaps = 7/168 (4%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F  + + + + ++G A         + C     + ++ +HN AR  VG  P+ WN T
Sbjct  1    MGLFK-ISLALLVGLMGFA------LAHTCCAQNSPQDYVDSHNAARAQVGVGPITWNDT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HSGGPYGENIA     L+   +V +W+ EKP Y++N+N+CV
Sbjct  54   VAAYAQNYANQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCV  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              EC HYTQVVW N+  +GCAR  C  G  FVTCNY PPGNY GQ+PY
Sbjct  114  GGECGHYTQVVWRNSVRLGCARVQCDNGGWFVTCNYDPPGNYVGQRPY  161



>ref|XP_004289701.1| PREDICTED: pathogenesis-related protein 1B-like [Fragaria vesca 
subsp. vesca]
Length=159

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 104/156 (67%), Gaps = 8/156 (5%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAA  247
            +IGLAA+  +    S  D      +L AHN AR  VG   + W++T+A YA++YA  R A
Sbjct  10   LIGLAAVHPSHAQNSQQD------YLNAHNTARAHVGVANIIWDSTVAAYAQNYANSRIA  63

Query  248  DCLLEHSGGPYGENIAM-AGSELSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVW  421
            DC L HSGGPYGEN+A  + S L+  A+V LW+ EKPYYN+ +N+C   Q+CLHYTQVVW
Sbjct  64   DCNLVHSGGPYGENLAKGSSSALTGTAAVNLWVAEKPYYNYTSNSCTGGQQCLHYTQVVW  123

Query  422  GNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             N+  +GCAR  C   W FVTCNY PPGNY GQ PY
Sbjct  124  ANSIRLGCARVQCTNTWWFVTCNYDPPGNYVGQLPY  159



>emb|CAD60273.1| putative pathogenesis related protein 1 precursor [Vitis vinifera]
Length=161

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 98/154 (64%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   IGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAAD  250
            + L      +     C     + ++ AHN AR  VG   + WN T+A YA++YA KR +D
Sbjct  8    LALLCFMWLALAHICCAQNSPQDYVNAHNAARAQVGVGSITWNDTVAAYAQNYANKRISD  67

Query  251  CLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNT  430
            C L HSGGPYGEN+A     L+   +V LW+ EKP Y++N+N+CV  ECLHYTQVVW N+
Sbjct  68   CNLVHSGGPYGENLAKGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGECLHYTQVVWSNS  127

Query  431  TTIGCARATCKTGWMFVTCNYYPP-GNYAGQKPY  529
              +GCAR  C  GW FVTCNY PP GNY GQ+PY
Sbjct  128  VRLGCARVQCNNGWWFVTCNYDPPRGNYIGQRPY  161



>ref|XP_009787159.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nicotiana sylvestris]
Length=179

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR  VG  P+ W+  +A +A++YA +RA DC ++HSGGPYGEN+A A  +L
Sbjct  28   QDYLNAHNAARRRVGVGPMTWDNRVAAFAQNYANQRAGDCRMQHSGGPYGENLAAAFPQL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +A  +VK+W+DEK +Y++N+N+C + + C HYTQVVW N+  +GCAR  C  GW F+TCN
Sbjct  88   NAAGAVKMWVDEKQFYDYNSNSCAAGKVCGHYTQVVWRNSVRLGCARVRCNNGWYFITCN  147

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ GQ+PY
Sbjct  148  YDPPGNWRGQRPY  160



>gb|ADN43419.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 106/170 (62%), Gaps = 12/170 (7%)
 Frame = +2

Query  26   MGEF--SFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWN  199
            MG F  S + +CV    +GLA +       ++C     + +L AHN AR  VG   + WN
Sbjct  1    MGLFKISLVFICV----LGLALV------HTSCAQNSQQDYLNAHNTARAQVGVGSMTWN  50

Query  200  TTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNA  379
             T+A YA++YA +R  DC L HS GPYGENIA     L+   +V LW+ EKP Y++N+N+
Sbjct  51   NTVASYAQNYANQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNS  110

Query  380  CVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            CV  +C HYTQVVW N+  +GCAR  C  G  FVTCNY PPGNY GQ+PY
Sbjct  111  CVGGKCGHYTQVVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  160



>gb|ADN43415.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 106/170 (62%), Gaps = 12/170 (7%)
 Frame = +2

Query  26   MGEF--SFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWN  199
            MG F  S + +CV    +GLA +       ++C     + +L AHN AR  VG   + WN
Sbjct  1    MGLFKISLVFICV----LGLALV------HTSCAQNSQQDYLNAHNTARAQVGVGSMTWN  50

Query  200  TTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNA  379
             T+A YA++YA +R  DC L HS GPYGENIA     L+   +V LW+ EKP Y++N+N+
Sbjct  51   NTVASYAQNYANQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVDLWVGEKPNYDYNSNS  110

Query  380  CVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            CV  +C HYTQVVW N+  +GCAR  C  G  FVTCNY PPGNY GQ+PY
Sbjct  111  CVGGKCGHYTQVVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  160



>ref|XP_002522071.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40271.1| STS14 protein precursor, putative [Ricinus communis]
Length=164

 Score =   167 bits (422),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 108/170 (64%), Gaps = 8/170 (5%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG     QV V++ ++GLA +      +++      + +L AHN AR  VG   + W+ T
Sbjct  1    MGSLKISQVLVSL-LMGLALVVHPCHAQNS-----QQDYLDAHNAARAQVGVANIVWDNT  54

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSELSAEASVKLWMDEKPYYNHNTNAC  382
            +A YA++YA  R  DC L HS G YGEN+A  + S L+  A+V LW+ EKPYYN+ +N+C
Sbjct  55   VATYAQNYANSRIGDCNLVHSSGSYGENLAKGSSSSLTGTAAVNLWVAEKPYYNYTSNSC  114

Query  383  VS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
               Q+CLHYTQVVW  +  +GCAR  C  GW FVTCNY PPGNY GQKPY
Sbjct  115  TGGQQCLHYTQVVWSKSVRLGCARVQCTNGWWFVTCNYDPPGNYIGQKPY  164



>ref|XP_002273416.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 gb|ADN43420.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43421.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43422.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43423.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43424.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43425.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=160

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 104/168 (62%), Gaps = 8/168 (5%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F      V I ++GLA +       ++C     + +L AHN AR  VG   + WN T
Sbjct  1    MGLFKI--SLVFICLVGLALV------HTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNT  52

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HS GPYGENIA     L+   +V LW+ EKP Y++N+N+CV
Sbjct  53   VASYAQNYANQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCV  112

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              +C HYTQVVW N+  +GCAR  C  G  FVTCNY PPGNY GQ+PY
Sbjct  113  GGKCGHYTQVVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  160



>ref|XP_011092472.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=158

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL AHN+AR  VG  PL WN T+A YA  YA KR  DC LEHS GPYGEN+A     L
Sbjct  27   QAFLDAHNRARAQVGVRPLVWNETVARYALDYAHKRYGDCELEHSQGPYGENLAEGWGTL  86

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            S   +V +W+ EK  Y++++N+CV  ECLHYTQVVW ++  +GCAR  C+ GW+FV C+Y
Sbjct  87   SGTDAVGMWVSEKSCYDYSSNSCVGGECLHYTQVVWNDSVHLGCARVQCRNGWLFVICSY  146

Query  494  YPPGNYAGQKPY  529
             PPGNY G++PY
Sbjct  147  DPPGNYVGRRPY  158



>ref|XP_011016555.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Populus euphratica]
Length=159

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN  R  VG  P+ WN T+A YA+ YA  R   C LEHSGGPYGENIA     L
Sbjct  28   QDYVDAHNAVRAEVGVGPITWNNTVAAYAQKYANSRVEKCELEHSGGPYGENIAEGYGNL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +VK+W  EKP+Y+H+TN+CV  ECLHYTQVVW  +  +GC RA CK GW FVTCNY
Sbjct  88   NGVDAVKMWASEKPFYSHDTNSCVGDECLHYTQVVWRKSVHLGCGRAKCKNGWWFVTCNY  147

Query  494  YPPGNYAGQKPY  529
             P GN  GQ PY
Sbjct  148  DPVGNIEGQSPY  159



>ref|XP_007148307.1| hypothetical protein PHAVU_006G197500g [Phaseolus vulgaris]
 gb|ESW20301.1| hypothetical protein PHAVU_006G197500g [Phaseolus vulgaris]
Length=157

 Score =   166 bits (421),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++  HN+AR  VG  P+ WN TL  YA+ YA KR  DC LEHS GPYGEN+A    E+
Sbjct  26   QDYVEVHNQARAEVGVGPISWNHTLEAYAQRYANKRIPDCNLEHSMGPYGENLAEGYGEM  85

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
                +VK W+ EKPYY++ +N CV  EC HYTQ+VW ++  +GCARA CK GWMFV C+Y
Sbjct  86   KGSDAVKFWLTEKPYYDYKSNKCVHDECGHYTQIVWRDSVNLGCARAKCKNGWMFVICSY  145

Query  494  YPPGNYAGQKPY  529
             PPGN  G++PY
Sbjct  146  SPPGNVEGERPY  157



>ref|XP_002273199.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CBI25090.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   166 bits (421),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 116/170 (68%), Gaps = 11/170 (6%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG   FL   +AI I+G +A++  S  +++      + ++ AHN AR  VG  P+ WN T
Sbjct  1    MGIHKFL---LAIYILG-SALAHFSLAQTS-----PQDYVDAHNAARAQVGVQPIAWNET  51

Query  206  LAEYAESYATKR-AADCLLEHSGGPYGENIA-MAGSELSAEASVKLWMDEKPYYNHNTNA  379
            +A YA  YA+ R AA C LE+SGGPYGEN+A + G+ +S   +V+ W+ EKP Y++N+N+
Sbjct  52   VAAYARRYASSRVAAHCSLENSGGPYGENLAKVYGTSVSGSDAVEFWVTEKPNYDYNSNS  111

Query  380  CVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            CV  ECLHYTQ+VWG++  +GCA   CK GW F+TCNY+PPGN  GQ+PY
Sbjct  112  CVGGECLHYTQIVWGDSLYLGCASVHCKNGWWFITCNYHPPGNMEGQRPY  161



>gb|ADN43416.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   166 bits (421),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 106/170 (62%), Gaps = 12/170 (7%)
 Frame = +2

Query  26   MGEF--SFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWN  199
            MG F  S + +CV    +GLA +       ++C     + +L AHN AR  VG   + WN
Sbjct  1    MGLFKISLVFICV----LGLALV------HTSCAQNSQQDYLNAHNTARAQVGVGSMTWN  50

Query  200  TTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNA  379
             T+A YA++YA +R  DC L HS GPYGENIA     L+   +V LW+ EKP Y++N+N+
Sbjct  51   NTVASYAQNYANQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNS  110

Query  380  CVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            CV  +C HYTQVVW N+  +GCAR  C  G  F+TCNY PPGNY GQ+PY
Sbjct  111  CVGGKCGHYTQVVWRNSVRLGCARVQCNNGGWFITCNYDPPGNYVGQRPY  160



>gb|ADN43427.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=159

 Score =   166 bits (421),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            V I ++GLA +       ++C     + +L AHN AR  VG   + WN T+A YA++YA 
Sbjct  8    VFICLVGLALV------HTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYAN  61

Query  236  KRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQV  415
            +R  DC L HS GPYGENIA     L+   +V LW+ EKP Y++N+N+CV  +C HYTQV
Sbjct  62   QRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCVGGKCGHYTQV  121

Query  416  VWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            VW N+  +GCAR  C  G  FVTCNY PPGNY GQ+PY
Sbjct  122  VWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  159



>ref|XP_003545775.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
Length=174

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 109/175 (62%), Gaps = 18/175 (10%)
 Frame = +2

Query  32   EFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGS---------P  184
            + SF  +CV    +GL  +   ++ + +      + ++ AHN AR  V S         P
Sbjct  7    KVSFCVMCV----LGLVIVGDVAYAQDSA-----QDYVNAHNAARAEVSSQSPRANVIVP  57

Query  185  PLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYN  364
             L W+ T+A YAESYA +R  DC L HSGG YGENIAM+  ELS   +VK+W+DEK  Y+
Sbjct  58   SLAWDDTVAAYAESYANQRKGDCALIHSGGKYGENIAMSTGELSGTDAVKMWVDEKANYD  117

Query  365  HNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +N+N+CV  ECLHYTQVVW ++  +GCA+ TC  G  F+TCNY PPGN  G+ PY
Sbjct  118  YNSNSCVGGECLHYTQVVWAHSLRLGCAKVTCDNGGTFITCNYDPPGNLVGESPY  172



>ref|XP_008236150.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Prunus mume]
Length=169

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 107/169 (63%), Gaps = 4/169 (2%)
 Frame = +2

Query  35   FSFLQVCVAINIIGLAAISQASF----GESACDSGCIEGFLAAHNKAREAVGSPPLKWNT  202
             +F  + ++I  I L   +Q S     G +   S   + F+  HN+AR AVG  P++WN 
Sbjct  1    MAFSNLSLSICSIALLLAAQVSLARKVGYAPNPSNPHQDFVDEHNRARAAVGVGPVRWNN  60

Query  203  TLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNAC  382
            T+A YA++YA  R   C +EHSGGPYGEN+A    E++   +VK W+ EKP Y++ +N C
Sbjct  61   TVAAYAQNYANTRIRGCDMEHSGGPYGENLAEGYGEMTGAQAVKFWVTEKPNYDYGSNKC  120

Query  383  VSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            V  EC HYTQVVW N+  +GCARA C   W+FV C+Y PPGNY G++PY
Sbjct  121  VGDECGHYTQVVWRNSVHLGCARAKCDNNWVFVICSYDPPGNYEGERPY  169



>ref|XP_004170277.1| PREDICTED: LOW QUALITY PROTEIN: basic form of pathogenesis-related 
protein 1-like [Cucumis sativus]
Length=171

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN  R AVG  PL WN+TLA+YA++YA  + A C +EHSGGPYGEN A     +
Sbjct  38   KNYIDAHNAVRAAVGVEPLHWNSTLADYAQNYANTKIATCQMEHSGGPYGENXAEGNEVM  97

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQ--ECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
            +AE +V LW DEK +Y++N+N C +    CLHYTQ+VW NT ++GCA+  C+  W+F+ C
Sbjct  98   TAETAVSLWADEKKHYDYNSNTCSNDPSNCLHYTQLVWSNTKSVGCAQVKCQNNWVFLIC  157

Query  488  NYYPPGNYAGQKPY  529
            +YYPPGNY GQ+PY
Sbjct  158  SYYPPGNYNGQRPY  171



>ref|XP_004230669.1| PREDICTED: pathogenesis-related leaf protein 6 [Solanum lycopersicum]
Length=164

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 95/132 (72%), Gaps = 2/132 (2%)
 Frame = +2

Query  140  FLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSELS  316
            +L  HN AR  VG   + WNTTL  YA++YA +R +DC L HS GPYGENIA  +GS ++
Sbjct  33   YLNTHNSARSQVGVGAITWNTTLENYAQNYANQRISDCNLVHSNGPYGENIAKGSGSFMT  92

Query  317  AEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
              A+V LW+ EKPYY++N+N+C   +EC HYTQVVW N+  +GCAR  C  GW FVTCNY
Sbjct  93   GTAAVNLWVGEKPYYDYNSNSCTGGKECRHYTQVVWKNSIQLGCARVQCTNGWWFVTCNY  152

Query  494  YPPGNYAGQKPY  529
             PPGNY GQ+PY
Sbjct  153  NPPGNYIGQRPY  164



>ref|XP_009605695.1| PREDICTED: basic form of pathogenesis-related protein 1 [Nicotiana 
tomentosiformis]
Length=177

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 107/168 (64%), Gaps = 9/168 (5%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG  + L  C     I  A +  +S  +++      + +L  HN AR  VG  P+ W+  
Sbjct  1    MGSLTTLVAC----FITFAILFHSSQAQNS-----PQDYLNPHNTARRQVGVGPMIWDNR  51

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            LA YA++YA +R  DC + HS GPYGEN+A A  +L+A  +VK+W+DEK +Y++N+N+CV
Sbjct  52   LAAYAQNYANQRIGDCGMIHSHGPYGENLAAAFPQLNAAGAVKMWVDEKRFYDYNSNSCV  111

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
               C HYTQVVW N+  +GCAR  C  GW F+TCNY PPGNY GQ+P+
Sbjct  112  GGVCGHYTQVVWRNSVRLGCARVRCNNGWFFITCNYDPPGNYRGQRPF  159



>ref|XP_009605697.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nicotiana 
tomentosiformis]
Length=163

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 101/167 (60%), Gaps = 11/167 (7%)
 Frame = +2

Query  32   EFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLA  211
             FS L +C  I      + +Q S  +          +LAAHN AR  VG   + W+TTLA
Sbjct  7    SFSTLLICFIILAFAFPSHAQNSQTD----------YLAAHNSARSQVGVSAITWDTTLA  56

Query  212  EYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-S  388
             YA++YA +R  DC L HS GPYGEN+A      +  A+V LW+ EKPYY++  N C   
Sbjct  57   NYAQNYANQRIGDCNLVHSNGPYGENLAKGTGSFTGTAAVNLWVAEKPYYDYTNNYCTGG  116

Query  389  QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             +CLHYTQVVW N+  +GCARA C  GW FV C+Y PPGNY GQ+PY
Sbjct  117  NQCLHYTQVVWRNSVRVGCARAQCNNGWWFVICSYDPPGNYVGQRPY  163



>gb|ADN43418.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43426.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 104/168 (62%), Gaps = 8/168 (5%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F    V + +  +GLA +       ++C     + +L AHN AR  VG   + WN T
Sbjct  1    MGLFKISLVFICL--VGLALV------HTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNT  52

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HS GPYGENIA     L+   +V LW+ EKP Y++N+N+CV
Sbjct  53   VASYAQNYANQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCV  112

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              +C HYTQVVW N+  +GCAR  C  G  F+TCNY PPGNY GQ+PY
Sbjct  113  GGKCGHYTQVVWRNSVRLGCARVQCNNGGWFITCNYDPPGNYVGQRPY  160



>gb|ADN43435.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 105/168 (63%), Gaps = 7/168 (4%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F  + + + +  +GLA         + C     + ++ AHN AR  VG  P+ WN T
Sbjct  1    MGLFK-ISLALLVGPMGLA------LAHTCCAQNSPQDYVDAHNAARAQVGVGPMTWNNT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HSGGPYGENIA     L+   +V +W+ EKP Y++N+N+CV
Sbjct  54   VAAYAQNYANQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCV  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              +C HYTQVVW N+  +GCAR  C  G  F+TCNY PPGNY GQ+PY
Sbjct  114  GGKCGHYTQVVWRNSVRLGCARVQCNNGGWFITCNYDPPGNYVGQRPY  161



>ref|XP_006486821.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Citrus sinensis]
 ref|XP_006486823.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Citrus sinensis]
Length=159

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            +  + AHN AR  VG  P+ WN T+A YA+ YA +R  DC LEHS GPYGEN+A    +L
Sbjct  28   QDIVNAHNAARAEVGVDPMTWNDTVAAYAQDYANQRMGDCNLEHSMGPYGENLAEGYGKL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
                +VK W+ EKP Y+H +N+CV  ECLHYTQ+VW  + ++GC R  CK  W FV CNY
Sbjct  88   DGVDAVKFWLTEKPNYDHASNSCVGDECLHYTQIVWRKSVSVGCGRVKCKNDWWFVICNY  147

Query  494  YPPGNYAGQKPY  529
            YPPGN  G++PY
Sbjct  148  YPPGNIEGERPY  159



>ref|XP_009605696.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nicotiana tomentosiformis]
Length=179

 Score =   167 bits (422),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L  HN AR  VG  P+ W+  LA +A++YA +RA DC ++HSGGPYGEN+A A  +L
Sbjct  28   QDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYANQRAGDCRMQHSGGPYGENLAAAYPQL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
             A  +VK+W+DEK +YN+N+N C + + C HYTQVVW N+  +GCAR  C  GW F+TCN
Sbjct  88   HAAGAVKMWVDEKQFYNYNSNTCAAGKVCGHYTQVVWRNSVRLGCARVRCNNGWYFITCN  147

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ GQ+PY
Sbjct  148  YDPPGNWRGQRPY  160



>ref|XP_006367091.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=179

 Score =   166 bits (421),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L  HN AR  VG  P+ W+  LA +A++YA +RA DC ++HSGGPYGEN+A A  +L
Sbjct  28   QDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYANQRAGDCRMQHSGGPYGENLAAAFPQL  87

Query  314  SAEASVKLWMDEKPYYNHNTNAC-VSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +A  +VK+W DEK +YN+N+N C   + C HYTQVVW N+  +GCAR  C  GW F+TCN
Sbjct  88   NAAGAVKMWFDEKQWYNYNSNTCQAGKVCGHYTQVVWRNSVRLGCARVRCNNGWYFITCN  147

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ GQ+PY
Sbjct  148  YDPPGNWRGQRPY  160



>gb|ADN43436.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 104/168 (62%), Gaps = 7/168 (4%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F  + + + + ++G A         + C     + ++  HN AR  VG  P+ WN T
Sbjct  1    MGLFK-ISLALLVGLMGFA------LAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HSGGPYGENIA     L+   +V LW+ EKP Y++N+N+CV
Sbjct  54   VAAYAQNYANQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNLWVGEKPNYDYNSNSCV  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              +C HYTQVVW N+  +GCAR  C  G  FVTCNY PPGNY GQ+PY
Sbjct  114  GGKCGHYTQVVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  161



>gb|ADN43428.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=160

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 104/168 (62%), Gaps = 8/168 (5%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F      V I ++GL+ +       ++C     + +L AHN AR  VG   + WN T
Sbjct  1    MGLFKI--SLVFICLVGLSLV------HTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNT  52

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HS GPYGENIA     L+   +V LW+ EKP Y++N+N+CV
Sbjct  53   VASYAQNYANQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYNSNSCV  112

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              +C HYTQVVW N+  +GCAR  C  G  FVTCNY PPGNY GQ+PY
Sbjct  113  GGKCGHYTQVVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  160



>ref|XP_002522065.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40265.1| STS14 protein precursor, putative [Ricinus communis]
Length=161

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN AR AVG  P+ W+ T+A YA++YA +R  DC L HSGG YGENIA +  +L
Sbjct  29   QDYINAHNAARAAVGVGPMTWDNTVAAYAQNYANQRINDCRLVHSGGRYGENIAWSSGDL  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S  A+VKLW+DEK +YN+N+N C + Q+C HYTQVVW N+  +GCA+  C+ G  F+TCN
Sbjct  89   SGTAAVKLWVDEKAFYNYNSNTCAAGQQCGHYTQVVWRNSVRLGCAKVRCRNGGTFITCN  148

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+  Q+PY
Sbjct  149  YDPPGNFVNQRPY  161



>emb|CAA47374.1| prb-1b [Nicotiana tabacum]
Length=179

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L  HN AR  VG  P+ W+  LA +A++YA +RA DC ++HSGGPYGEN+A A  +L
Sbjct  28   QDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYANQRAGDCRMQHSGGPYGENLAAAYPQL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
             A  +VK+W+DEK +YN+N+N C +   C HYTQVVW N+  +GCAR  C  GW F+TCN
Sbjct  88   HAAGAVKMWVDEKQFYNYNSNTCAAGNVCGHYTQVVWRNSVRLGCARVRCNNGWYFITCN  147

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ GQ+PY
Sbjct  148  YDPPGNWRGQRPY  160



>ref|XP_011002613.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Populus euphratica]
Length=159

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN  R  VG  P+ WN T+A YA+ YA  R   C LEHSGGPYGENIA     L
Sbjct  28   QDYVDAHNAVRAEVGVGPITWNNTVAAYAQKYANSRVEKCELEHSGGPYGENIAEGYGNL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +VK+W  EKP+Y+H TN+CV  ECLHYTQVVW  +  +GC RA CK GW FVTCNY
Sbjct  88   NGVDAVKMWASEKPFYSHGTNSCVGDECLHYTQVVWRKSVHLGCGRAKCKNGWWFVTCNY  147

Query  494  YPPGNYAGQKPY  529
             P GN  GQ PY
Sbjct  148  DPVGNIEGQSPY  159



>ref|XP_006422713.1| hypothetical protein CICLE_v10029459mg [Citrus clementina]
 gb|ESR35953.1| hypothetical protein CICLE_v10029459mg [Citrus clementina]
Length=159

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            +  + AHN AR  VG  P+ WN T+A YA+ YA +R  DC +EHS GPYGEN+A    +L
Sbjct  28   QDIVNAHNAARAEVGVDPMTWNDTVAAYAQDYANQRMGDCNMEHSMGPYGENLAEGYGKL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
                +VK W+ EKP Y+H +N+CV  ECLHYTQ+VW  + ++GC R  CK  W FV CNY
Sbjct  88   DGVDAVKFWLTEKPNYDHASNSCVGDECLHYTQIVWRKSVSVGCGRVKCKNDWWFVICNY  147

Query  494  YPPGNYAGQKPY  529
            YPPGN  G++PY
Sbjct  148  YPPGNIEGERPY  159



>ref|XP_009788195.1| PREDICTED: basic form of pathogenesis-related protein 1 [Nicotiana 
sylvestris]
Length=177

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L  HN AR  VG  P+ W+  LA YA++YA +R  DC + HS GPYGEN+A A  +L
Sbjct  28   QDYLNPHNAARRQVGVGPMTWDNRLAAYAQNYANQRIGDCGMIHSHGPYGENLAAAFPQL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +A  +VK+W+DEK +Y++N+N+CV   C HYTQVVW N+  +GCAR  C  GW F+TCNY
Sbjct  88   NAAGAVKMWVDEKRFYDYNSNSCVGGVCGHYTQVVWRNSVRLGCARVRCNNGWFFITCNY  147

Query  494  YPPGNYAGQKPY  529
             PPGN+ GQ+P+
Sbjct  148  DPPGNFIGQRPF  159



>ref|XP_006367102.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=167

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 104/154 (68%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   IGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAAD  250
            I +A +   S   S+    C + +L  HN+AR  VG  P+ WN +LA+YA++YA +R  D
Sbjct  5    IWVACLITFSIFHSSQGQNCPQNYLIPHNEARRQVGVGPMTWNNSLADYAQNYANQRIGD  64

Query  251  CLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNAC-VSQECLHYTQVVWGN  427
            C + HS GPYGEN+A A  +L+A  +VK+W+DEK +Y+ ++N C + + C HYTQVVW N
Sbjct  65   CGMIHSQGPYGENLAAAFPDLNAADAVKMWVDEKQWYDSDSNTCALGEVCGHYTQVVWRN  124

Query  428  TTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  +GCA+  C  GW F+TCNY PPGNY GQ+PY
Sbjct  125  SIRVGCAKVQCNNGWYFITCNYDPPGNYIGQRPY  158



>ref|XP_008455069.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis melo]
Length=165

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN  R  VG  PL WN+TLA YA++YA  + A C +EHSGGPYGEN+A    E+
Sbjct  32   KNYVDAHNAIRAEVGVDPLHWNSTLAAYAQNYANTKIATCQMEHSGGPYGENLAEGYEEM  91

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQ--ECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
            +AE +V LW DEK +Y++N+N C +    CLHYTQ+VW NT ++GCA   C+  W+F+ C
Sbjct  92   TAEMAVSLWADEKKHYDYNSNTCTNDASNCLHYTQLVWRNTKSVGCAEVKCQNNWVFLIC  151

Query  488  NYYPPGNYAGQKPY  529
            +YYPPGNY GQ+PY
Sbjct  152  SYYPPGNYIGQRPY  165



>ref|XP_003608313.1| Pathogenesis-related protein 1A [Medicago truncatula]
 gb|AES90510.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=159

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGS-E  310
            + +L  HNKAR  VG  PL WN TLA YA +YA  +   C + HS GPYGEN+A     +
Sbjct  27   QDYLDVHNKARAEVGVGPLVWNETLASYAMNYAKSKHETCEMVHSQGPYGENLAEGSDPQ  86

Query  311  LSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            ++A  +VKLW+DEK +Y++ TNACV  EC HYTQVVW NT  +GCAR +CK GW F  C+
Sbjct  87   MNAADAVKLWVDEKAFYDYGTNACVKDECRHYTQVVWSNTKQLGCARESCKNGWTFFICS  146

Query  491  YYPPGNYAGQKPY  529
            YYPPGNY G KPY
Sbjct  147  YYPPGNYVGDKPY  159



>ref|XP_007041422.1| Pathogenesis-related protein 1 [Theobroma cacao]
 gb|EOX97253.1| Pathogenesis-related protein 1 [Theobroma cacao]
Length=156

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 109/163 (67%), Gaps = 13/163 (8%)
 Frame = +2

Query  47   QVCVAIN--IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYA  220
            ++ +AIN  ++GLA I+Q S           + +L AHN AR  V   P++W+  +A YA
Sbjct  5    RISLAINFCLLGLA-IAQNS----------PQDYLNAHNSARARVNVGPMRWDDRVAAYA  53

Query  221  ESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECL  400
             +YA +R  DC L HSGGPYGEN+A + ++LS  A+V LW+ E+P Y++N+N+CV  EC 
Sbjct  54   TNYANQRKGDCRLVHSGGPYGENLAWSSADLSGTAAVNLWVAERPNYDYNSNSCVGGECR  113

Query  401  HYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            HYTQVVW N+  +GCA+  C +G  F+TCNY PPGNY  Q+PY
Sbjct  114  HYTQVVWRNSVRLGCAKVRCNSGGTFITCNYDPPGNYVNQRPY  156



>ref|XP_002313936.2| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE87891.2| pathogenesis-related family protein [Populus trichocarpa]
Length=160

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR AVG  PL W+ T+  YA++YA++RA DC L  SGGPYGE +  + ++L
Sbjct  28   QDYLDAHNAARAAVGVGPLTWDNTVQAYAQAYASQRAGDCNLVLSGGPYGEILQWSSADL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +VKLW+DEK +Y++N+N+C S Q+C+ YTQVVWGN+ ++GCA+ TC  G  F+ CN
Sbjct  88   SGTDAVKLWVDEKAFYDYNSNSCASGQQCVSYTQVVWGNSVSLGCAKVTCSAGGTFIVCN  147

Query  491  YYPPGNYAGQKPY  529
            Y PPGN  GQKPY
Sbjct  148  YDPPGNVVGQKPY  160



>ref|XP_008372933.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Malus domestica]
Length=168

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 103/168 (61%), Gaps = 0/168 (0%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG  S L +C+    + LAA +  +           + F+  HN+AR AVG  P+KWN T
Sbjct  1    MGYSSXLLLCIFSTALILAAHTSJARKVGYYPPNPHQDFVDEHNRARAAVGVGPIKWNDT  60

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA+ YA  R   C +EHSGGPYGEN+A    E++   +VK W+ EKP YN+ +N CV
Sbjct  61   VAAYAQQYANTRVRGCDMEHSGGPYGENLAEGYGEMTGAQAVKFWVTEKPNYNYASNKCV  120

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              EC HYTQVVW N+  +GCAR  C   W+FV C+Y PPGNY  ++PY
Sbjct  121  GDECGHYTQVVWRNSIHLGCARXKCDNNWVFVICSYDPPGNYEDERPY  168



>ref|NP_188603.1| putative pathogenesis-related protein [Arabidopsis thaliana]
 dbj|BAB02556.1| pathogenesis-related protein-like [Arabidopsis thaliana]
 gb|ABN04774.1| At3g19690 [Arabidopsis thaliana]
 gb|AEE76276.1| putative pathogenesis-related protein [Arabidopsis thaliana]
Length=161

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 106/158 (67%), Gaps = 6/158 (4%)
 Frame = +2

Query  65   NIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRA  244
            NI+ L AI+   +G  A D    + FL AHN+AR  VG  PL W+  +A YA SYA +R 
Sbjct  7    NILFLLAIA-LFYGSLAED--LQQQFLEAHNEARNEVGLDPLVWDDEVAAYAASYANQRI  63

Query  245  ADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQE---CLHYTQV  415
             DC L HS GP+GENIAM+  E+SAE + ++W++EK YY++++N C       CLHYTQV
Sbjct  64   NDCALVHSNGPFGENIAMSSGEMSAEDAAEMWINEKQYYDYDSNTCNDPNGGTCLHYTQV  123

Query  416  VWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            VW NT  +GCA+  C +G  F+TCNY PPGNY G+KP+
Sbjct  124  VWKNTVRLGCAKVVCNSGGTFITCNYDPPGNYIGEKPF  161



>ref|XP_004136923.1| PREDICTED: pathogenesis-related leaf protein 4-like [Cucumis 
sativus]
 ref|XP_004169190.1| PREDICTED: pathogenesis-related leaf protein 4-like [Cucumis 
sativus]
Length=157

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++  HN AR  VG   + WNTTLA YA++YA  R +DC L HS GPYGENIA   +  
Sbjct  26   QDYINGHNSARSTVGVGNIVWNTTLAAYAQTYANSRKSDCQLIHSNGPYGENIAKGNNGF  85

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            S  A+VKLW+DEKPYY+++ NAC   ECLHYTQVVW  +  +GCAR  C  GW F++CNY
Sbjct  86   SGAAAVKLWVDEKPYYSYSKNACDGGECLHYTQVVWETSYRVGCARVQCNNGWWFISCNY  145

Query  494  YPPGNYAGQKPY  529
             PPGN+  ++PY
Sbjct  146  DPPGNWDEERPY  157



>ref|XP_002272115.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN62956.1| hypothetical protein VITISV_018198 [Vitis vinifera]
Length=161

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 113/163 (69%), Gaps = 8/163 (5%)
 Frame = +2

Query  47   QVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAES  226
            +  +AI I+G +A++  S  +S+      + ++ AHN AR  VG  P+ WN T+A YA  
Sbjct  5    KFLLAIYILG-SALAHFSLAQSS-----PQDYVDAHNAARAQVGVQPITWNETVAAYARR  58

Query  227  YATKR-AADCLLEHSGGPYGENIA-MAGSELSAEASVKLWMDEKPYYNHNTNACVSQECL  400
            YA+ R AA C +E+SGGPYGEN+A + G+ +S   +V+ W+ EKP Y++N+N+CV  ECL
Sbjct  59   YASSRVAARCSMENSGGPYGENLAKVYGTSVSGSDAVEFWVTEKPNYDYNSNSCVGGECL  118

Query  401  HYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            HYTQ+VWG++  +GCA   CK GW F+TCNY+PPGN  GQ+PY
Sbjct  119  HYTQIVWGDSLYLGCASVHCKNGWWFITCNYHPPGNMEGQRPY  161



>ref|XP_007199090.1| hypothetical protein PRUPE_ppa020367mg, partial [Prunus persica]
 gb|EMJ00289.1| hypothetical protein PRUPE_ppa020367mg, partial [Prunus persica]
Length=131

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +2

Query  140  FLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSA  319
            F+  HN+AR  VG  P+KWN T+A YA+ YA  +   C + HS GPYGEN+A    E++ 
Sbjct  2    FIDEHNRARAEVGVGPIKWNDTVAAYAQKYADSKIETCEMVHSQGPYGENLAEGYGEMTG  61

Query  320  EASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYP  499
              +VK W+ EKP Y++ +N CV   C HYTQVVW N+T +GCARA CK GWMFV C+YYP
Sbjct  62   GQAVKFWVTEKPNYDYASNTCVGDVCGHYTQVVWRNSTHVGCARAMCKNGWMFVICSYYP  121

Query  500  PGNYAGQKPY  529
            PGNY G++PY
Sbjct  122  PGNYIGERPY  131



>ref|XP_008236236.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Prunus mume]
Length=165

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + F+  HN+AR  VG  P+KWN T+A YA+ YA  +   C + HS GPYGEN+A    E+
Sbjct  34   QDFIDEHNRARAEVGVGPIKWNDTVAAYAQKYADSKIETCEMVHSQGPYGENLAEGYGEM  93

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +VK W+ EKP Y++ +N CV   C HYTQVVW N+T +GCARA CK GWMFV C+Y
Sbjct  94   TGGQAVKFWVTEKPNYDYASNTCVGDVCGHYTQVVWRNSTHVGCARAKCKNGWMFVICSY  153

Query  494  YPPGNYAGQKPY  529
            YPPGNY G++PY
Sbjct  154  YPPGNYIGERPY  165



>ref|XP_007148303.1| hypothetical protein PHAVU_006G197100g [Phaseolus vulgaris]
 gb|ESW20297.1| hypothetical protein PHAVU_006G197100g [Phaseolus vulgaris]
Length=166

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 107/160 (67%), Gaps = 8/160 (5%)
 Frame = +2

Query  59   AINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATK  238
            A++++GL  +    + + +     I  ++  HN AR  VG P + W+ T+A +A++YA +
Sbjct  12   ALSVLGLVIVGDVVYAQDS-----IADYVNEHNAARSQVGVPNIVWDNTVASFAQNYANQ  66

Query  239  RAADCLLEHSGG--PYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS-QECLHYT  409
            R  DC L HSGG   YGEN+A +  +LS + +VKLW+DEK YY++N+N+C + Q+C HYT
Sbjct  67   RQGDCNLIHSGGGGKYGENLAKSSGDLSGKDAVKLWVDEKQYYDYNSNSCAAGQQCGHYT  126

Query  410  QVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            QVVW N+  +GCA+  C  G  F+TCNY PPGNY GQKPY
Sbjct  127  QVVWRNSVRVGCAKVRCSNGGTFITCNYSPPGNYVGQKPY  166



>gb|AAK30143.1|AF348141_1 pathogenesis-related protein PR-1 precursor [Capsicum annuum]
 gb|AAC06244.2| basic PR-1 protein precursor [Capsicum annuum]
 gb|AAU20808.1| basic PR-1 protein precursor [Capsicum annuum]
Length=179

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR  VG  P+ W+  LA +A++YA +R  DC ++HSGGPYGEN+A A  +L
Sbjct  28   QDYLNAHNAARRQVGVGPMTWDNRLAAFAQNYANQRIGDCRMQHSGGPYGENLAAAFPQL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +A  +VK+W++EK +YN+N+N+C   + C HYTQVVW N+  +GCAR  C  GW F+TCN
Sbjct  88   NAAGAVKMWVNEKQWYNYNSNSCAPGKVCGHYTQVVWRNSVRLGCARVRCNNGWYFITCN  147

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ GQ+PY
Sbjct  148  YDPPGNWRGQRPY  160



>gb|KGN43830.1| hypothetical protein Csa_7G070252 [Cucumis sativus]
Length=163

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++  HN AR  VG   + WNTTLA YA++YA  R +DC L HS GPYGENIA   +  
Sbjct  32   QDYINGHNSARSTVGVGNIVWNTTLAAYAQTYANSRKSDCQLIHSNGPYGENIAKGNNGF  91

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            S  A+VKLW+DEKPYY+++ NAC   ECLHYTQVVW  +  +GCAR  C  GW F++CNY
Sbjct  92   SGAAAVKLWVDEKPYYSYSKNACDGGECLHYTQVVWETSYRVGCARVQCNNGWWFISCNY  151

Query  494  YPPGNYAGQKPY  529
             PPGN+  ++PY
Sbjct  152  DPPGNWDEERPY  163



>gb|ADN43437.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=161

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 103/168 (61%), Gaps = 7/168 (4%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F  + + + + ++G A         + C     + ++  HN AR  VG  P+ WN T
Sbjct  1    MGLFK-ISLALLVGLMGFA------LAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HSGGPYGENIA     L+   +V +W+ EKP Y++N+N+C 
Sbjct  54   VAAYAQNYANQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCF  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              EC HYTQVVW N+  +GCAR  C  G  FVTCNY PPGNY GQ+PY
Sbjct  114  GGECGHYTQVVWRNSVRLGCARVQCDNGGWFVTCNYDPPGNYVGQRPY  161



>gb|AES63607.2| CAP, cysteine-rich secretory protein, antigen 5, partial [Medicago 
truncatula]
Length=164

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL  HN+AR+ VG  PL W  TL  YA++YA KR  +C LEHS GPYGEN+A    E+
Sbjct  33   QDFLEVHNQARDEVGVGPLYWEQTLEAYAQNYANKRIKNCELEHSMGPYGENLAEGYGEV  92

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   SVK W+ EKP Y++N+N+CV+ EC HYTQ++W ++  +GCA++ CK GW+FV C+Y
Sbjct  93   NGTDSVKFWLSEKPNYDYNSNSCVNDECGHYTQIIWRDSVHLGCAKSKCKNGWVFVICSY  152

Query  494  YPPGNYAGQKPY  529
             PPGN  G++PY
Sbjct  153  SPPGNVEGERPY  164



>ref|XP_003593356.1| Pathogenesis-related protein [Medicago truncatula]
Length=158

 Score =   164 bits (415),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL  HN+AR+ VG  PL W  TL  YA++YA KR  +C LEHS GPYGEN+A    E+
Sbjct  27   QDFLEVHNQARDEVGVGPLYWEQTLEAYAQNYANKRIKNCELEHSMGPYGENLAEGYGEV  86

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   SVK W+ EKP Y++N+N+CV+ EC HYTQ++W ++  +GCA++ CK GW+FV C+Y
Sbjct  87   NGTDSVKFWLSEKPNYDYNSNSCVNDECGHYTQIIWRDSVHLGCAKSKCKNGWVFVICSY  146

Query  494  YPPGNYAGQKPY  529
             PPGN  G++PY
Sbjct  147  SPPGNVEGERPY  158



>ref|XP_010252392.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=162

 Score =   164 bits (415),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 106/176 (60%), Gaps = 20/176 (11%)
 Frame = +2

Query  2    KKKRSKEEMGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGS  181
            K  R    +G  ++L VC+A +                        +L AHN AR  VG 
Sbjct  7    KSARFFVSIGALAWLHVCLAQDAPA--------------------DYLNAHNAARADVGV  46

Query  182  PPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYY  361
             PL W+  +A YA++YA +RA DC + HSGGPYGEN+A     LS  A+V+ W+ EK YY
Sbjct  47   GPLTWDDNVAAYAQAYANERAGDCAMVHSGGPYGENLATGTPSLSGTAAVEGWVGEKQYY  106

Query  362  NHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            ++++N+CV  ECLHYTQVVW ++  +GCA+  C +GW FV C+Y PPGNY GQ+PY
Sbjct  107  DYSSNSCVGGECLHYTQVVWSDSVRLGCAKVHCNSGWDFVICSYDPPGNYVGQRPY  162



>gb|ADN43417.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   164 bits (415),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 104/168 (62%), Gaps = 8/168 (5%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F      V I ++GLA +       ++C     + +L AHN AR  VG   + WN T
Sbjct  1    MGLFKI--SLVFICLVGLALV------HTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNT  52

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HS GPYGENIA     L+   +V LW+ EKP Y++++N+CV
Sbjct  53   VASYAQNYANQRIGDCNLVHSNGPYGENIAWGSGSLTGTDAVNLWVGEKPNYDYSSNSCV  112

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              +C HYTQVVW N+  +GCAR  C  G  F+TCNY PPGNY GQ+PY
Sbjct  113  GGKCGHYTQVVWRNSVRLGCARVQCNNGGWFITCNYDPPGNYVGQRPY  160



>ref|XP_006369711.1| Pathogenesis-related family protein [Populus trichocarpa]
 gb|ERP66280.1| Pathogenesis-related family protein [Populus trichocarpa]
Length=161

 Score =   164 bits (415),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAA  247
            +I LA I   S  + +      + ++ AHN AR  VG   + W+T +A YA  Y  +   
Sbjct  13   LIALAIIIPLSLAQDS-----PQDYVNAHNNARAQVGVGNIVWDTNVAAYASDYVKRLTG  67

Query  248  DCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGN  427
            DC L HSGGPYGEN+A    +L+  A+VKLW+DEKP Y++N+N+CV  EC HYTQVVW N
Sbjct  68   DCRLVHSGGPYGENLAGGSGDLTGSAAVKLWVDEKPKYDYNSNSCVGGECRHYTQVVWRN  127

Query  428  TTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  +GCA+A C  G   ++CNY PPGNY GQ+PY
Sbjct  128  SVRLGCAKARCSNGGTVISCNYSPPGNYVGQRPY  161



>gb|AGS80328.1| pathogenesis-related protein 1 [Actinidia eriantha]
Length=173

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 97/153 (63%), Gaps = 0/153 (0%)
 Frame = +2

Query  71   IGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAAD  250
            + LA++   +   S+      + +L AHN AR AVG  P++W+  LA YA  YA  R  D
Sbjct  10   LALASLMVLAMVHSSLAQNSPQDYLNAHNAARAAVGVGPIRWDNNLANYARDYANSRIKD  69

Query  251  CLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNT  430
            C L HS GPYGEN+A     L+   SVK+W+DEK YY++N+N+C+   C HYTQVVW  +
Sbjct  70   CNLVHSKGPYGENLAKGFPGLTGRDSVKMWVDEKKYYDYNSNSCIGGVCGHYTQVVWSRS  129

Query  431  TTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              +GCAR  C  GW F+ C+Y PPGN +GQ+PY
Sbjct  130  VRVGCARVKCTNGWWFIICSYDPPGNVSGQRPY  162



>ref|XP_010088980.1| hypothetical protein L484_013560 [Morus notabilis]
 gb|EXB37195.1| hypothetical protein L484_013560 [Morus notabilis]
Length=171

 Score =   164 bits (414),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 105/168 (63%), Gaps = 9/168 (5%)
 Frame = +2

Query  35   FSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAE  214
             S + + + + I+GL         ES C     + FL  HN+AR  VG  P+ W+ ++A 
Sbjct  3    LSRISLALIMCILGLGVT------ESCCAQNTPQDFLTPHNRARAEVGVGPMTWDDSVAA  56

Query  215  YAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQE  394
            YA+ YA +R  DC L HS GPYGEN+A +  +LSA  +VK+W+ EK  Y+HN+N CV + 
Sbjct  57   YAQRYANQRRGDCKLIHSSGPYGENLAWSSGDLSAAGAVKMWVAEKSLYDHNSNKCVGKN  116

Query  395  ---CLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
               CLHYTQVVW ++T +GCA+  C +G  FV CNY PPGNY GQ PY
Sbjct  117  PMGCLHYTQVVWRDSTRLGCAKVRCNSGGSFVICNYNPPGNYIGQWPY  164



>emb|CDO97323.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   164 bits (414),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L  HN AR  VG  P+ W+TT+A YA++YA +R +DC L HS GPYGEN+A      
Sbjct  32   QDYLNVHNSARSQVGVGPMTWDTTVAAYAQNYANQRISDCNLVHSQGPYGENLAKGTGTF  91

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +  A+  LW+ EKPYYN+ +N+CV  ECLHYTQVVW ++  +GCAR  C   W FV C+Y
Sbjct  92   TGTAAANLWVAEKPYYNYTSNSCVGGECLHYTQVVWRDSVRLGCARVQCTNSWWFVICSY  151

Query  494  YPPGNYAGQKPY  529
             PPGNY GQ+PY
Sbjct  152  DPPGNYIGQRPY  163



>ref|XP_008455068.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis melo]
Length=162

 Score =   163 bits (413),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 98/161 (61%), Gaps = 3/161 (2%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCI---EGFLAAHNKAREAVGSPPLKWNTTLAEYAES  226
            V+  II L+ I   SF  +   S      + F+  HN  R AVG  P+ W+ TLA YA+S
Sbjct  2    VSSTIIILSTICLVSFLLATTISNAQNSPQDFVDTHNDIRAAVGVGPVSWDDTLAAYAQS  61

Query  227  YATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHY  406
            YA  +   C +EHS GPYGEN+A    E++   +VK W  EK +YNH+ N CV  EC HY
Sbjct  62   YADSKIDTCEMEHSNGPYGENLAEGYDEMTGVEAVKFWATEKKFYNHHLNRCVGDECGHY  121

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQ+VW +TT IGC R  C+  W+FV CNY PPGNY GQ PY
Sbjct  122  TQIVWRHTTNIGCGRVKCENNWVFVICNYNPPGNYIGQHPY  162



>ref|XP_009342363.1| PREDICTED: pathogenesis-related leaf protein 4-like [Pyrus x 
bretschneideri]
Length=168

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 103/168 (61%), Gaps = 0/168 (0%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG  S L +C+    + LAA +  +           + F+  HN+AR AVG  P+KWN T
Sbjct  1    MGCSSNLLLCIFSTALILAAHTSLARKVGYYPPNPHQDFVDEHNRARAAVGVGPIKWNDT  60

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA+ YA  R   C +EHSGGPYGEN+A    E++   +VK W+ EKP YN+ +N CV
Sbjct  61   VAAYAQQYANTRVRGCDMEHSGGPYGENLAEGYGEMTGAQAVKFWVTEKPNYNYASNKCV  120

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              EC HYTQVVW N+  +GCAR  C   W+FV C+Y PPGNY  ++PY
Sbjct  121  GDECGHYTQVVWRNSIHLGCARVKCDNNWVFVICSYDPPGNYEDERPY  168



>ref|XP_008245926.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Prunus mume]
Length=165

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + F+  HN+AR  VG  P+KWN T+A YA+ YA  +   C + HS GPYGEN+A    E+
Sbjct  34   QDFIDEHNRARAEVGVGPIKWNDTVAAYAQKYADSKIETCEMVHSQGPYGENLAEGYGEM  93

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   ++K W+ EKP Y++ +N CV   C HYTQVVW N+T +GCARA CK GWMFV C+Y
Sbjct  94   TGGQAMKFWVTEKPNYDYASNTCVGDVCGHYTQVVWRNSTHVGCARAKCKNGWMFVICSY  153

Query  494  YPPGNYAGQKPY  529
            YPPGNY G++PY
Sbjct  154  YPPGNYIGERPY  165



>ref|XP_011092473.1| PREDICTED: pathogenesis-related leaf protein 6-like [Sesamum 
indicum]
Length=162

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 104/161 (65%), Gaps = 4/161 (2%)
 Frame = +2

Query  50   VCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESY  229
            + VA+    +A I Q S   S       + +++AHN AR  VG  P+ W+  +A +A +Y
Sbjct  5    ILVALFFFAIATILQYS---SCHAQNSPQDYVSAHNAARAQVGVGPIAWDEKVAAFARNY  61

Query  230  ATKRAADCLLEHSGG-PYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHY  406
              +R  DC L HS   PYGEN+A    E +  A+V+LW+ EKP+Y++++N+CV  ECLHY
Sbjct  62   VNQRIGDCNLVHSTNRPYGENLAKGSGEFTGRAAVELWVREKPFYDYSSNSCVGGECLHY  121

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQVVW N+  +GCARA C  GW F++CNY PPGNY GQ+PY
Sbjct  122  TQVVWRNSVRVGCARARCNNGWWFISCNYDPPGNYIGQRPY  162



>ref|XP_010461858.1| PREDICTED: pathogenesis-related leaf protein 6-like [Camelina 
sativa]
Length=160

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 103/161 (64%), Gaps = 11/161 (7%)
 Frame = +2

Query  50   VCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESY  229
            + VAI+ + +A  +Q S           + +L AHN AR  VG   L W+TT+A YA +Y
Sbjct  10   LIVAISFLVIATTAQNS----------QQDYLTAHNNARAQVGVANLVWDTTVATYALNY  59

Query  230  ATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQECLHY  406
            A  R A+C L HS GPYGEN+A      +A A+VKLW+DEKPYY++ TNAC   Q+CLHY
Sbjct  60   ANTRKANCSLIHSNGPYGENLAKGSGNFTAIAAVKLWVDEKPYYSYTTNACTGGQQCLHY  119

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQVVW  +  IGCAR  C  GW FV+CNY  PGN+ G+ PY
Sbjct  120  TQVVWRESVKIGCARVQCTNGWWFVSCNYDAPGNWIGEYPY  160



>gb|AFK46675.1| unknown [Lotus japonicus]
Length=164

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +2

Query  140  FLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSA  319
            FL  HN+AR  VG  PL WN  L  YA++YA  R+ DC LEHS GPYGENIA    E+  
Sbjct  35   FLDVHNQARAEVGVGPLSWNHNLEAYAQNYADLRSHDCNLEHSNGPYGENIAEGYGEMKD  94

Query  320  EASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYP  499
              + KLW  EKP Y+  +N+CV+ ECLHYTQ+VW ++  +GCA++ C  GW+FV CNY P
Sbjct  95   ADAAKLWFAEKPNYDPQSNSCVNDECLHYTQMVWRDSVHLGCAKSKCNNGWVFVVCNYDP  154

Query  500  PGNYAGQKPY  529
            PGNY G +PY
Sbjct  155  PGNYVGDRPY  164



>ref|XP_008455071.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis melo]
Length=161

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = +2

Query  50   VCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESY  229
            + ++  ++GL  ++  +  +++      + F+ AHN AR  VG  P+ WN TLA YA++Y
Sbjct  7    LLISFMMMGLITLAPITLAQNSH-----QDFVNAHNNARAKVGVGPVSWNYTLAAYAQTY  61

Query  230  ATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYT  409
            A K+   C ++HS GPYGEN+A    E++A  +V  W+ EK YY+H++N C+  EC HYT
Sbjct  62   ANKKIGTCEMQHSYGPYGENLAEGYGEMTAVEAVNFWVSEKKYYDHHSNRCIGDECRHYT  121

Query  410  QVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            QVVW  T  +GCAR  C   W+FV CNY PPGNY GQ PY
Sbjct  122  QVVWRGTKHVGCARVKCHNNWIFVICNYDPPGNYVGQFPY  161



>gb|KDP35900.1| hypothetical protein JCGZ_09872 [Jatropha curcas]
Length=160

 Score =   163 bits (412),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN AR AVG  P+ W+ T+A YA +YA +   DC L HSGGPYGEN+A +   L
Sbjct  28   QDYVNAHNTARAAVGVGPVTWDNTVAAYARNYANRHIGDCRLVHSGGPYGENLAGSSGYL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S  A+VKLW+DEK +YN+N+N C + + C HYTQVVW N+  IGCA+  C  G  F+TCN
Sbjct  88   SGTAAVKLWVDEKAFYNYNSNTCAAGKVCGHYTQVVWRNSVRIGCAKVKCNNGGTFITCN  147

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQ+PY
Sbjct  148  YDPPGNYVGQRPY  160



>ref|XP_006367089.1| PREDICTED: pathogenesis-related protein 1A1-like [Solanum tuberosum]
Length=179

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 108/167 (65%), Gaps = 10/167 (6%)
 Frame = +2

Query  32   EFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLA  211
            ++S L VC     I  A I  +S  ++       E FL AHN AR  VG  P+ W+  LA
Sbjct  2    KYSILVVC----FITFAIIFHSSQAQTP-----QENFLNAHNAARRQVGVGPMTWDYGLA  52

Query  212  EYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-S  388
             YA++YA +R  DC + HS GPYGEN+A A  +L+A  +VK+W DEK +Y++N+N C   
Sbjct  53   AYAQNYANQRIGDCGMIHSDGPYGENLAAAFPQLNAAGAVKMWDDEKQWYDYNSNTCAPG  112

Query  389  QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            + C HYTQVVW ++  +GCAR  C +GW+F+TCNY PPGNY G++PY
Sbjct  113  KVCGHYTQVVWRDSVRLGCARVRCNSGWVFITCNYDPPGNYIGRRPY  159



>ref|XP_006367094.1| PREDICTED: pathogenesis-related leaf protein 6-like [Solanum 
tuberosum]
Length=164

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = +2

Query  140  FLAAHNKAREAV-GSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSEL  313
            +L  HN AR  V G   + WNTTL  YA++YA +R +DC L HS GPYGENIA  +GS +
Sbjct  32   YLNTHNSARSQVTGVSAITWNTTLENYAQTYANQRISDCNLVHSNGPYGENIAKGSGSFM  91

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +  A+V LW+ EKPYY++N+N+C   +EC HYTQVVW N+  +GCAR  C  GW FVTCN
Sbjct  92   TGTAAVNLWVGEKPYYDYNSNSCTGGKECRHYTQVVWKNSIQLGCARVQCTNGWWFVTCN  151

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQ+PY
Sbjct  152  YNPPGNYIGQRPY  164



>ref|XP_010478439.1| PREDICTED: pathogenesis-related leaf protein 6-like [Camelina 
sativa]
Length=160

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 100/152 (66%), Gaps = 3/152 (2%)
 Frame = +2

Query  77   LAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCL  256
            + AIS      +A +S   + +L AHN AR  VG   L W+TT+A YA +YA  R A+C 
Sbjct  11   IVAISFLVIATNAQNSQ--QDYLTAHNNARTQVGVANLVWDTTVATYALNYANTRKANCS  68

Query  257  LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTT  433
            L HS GPYGEN+A      +A A+VKLW+DEKPYY++ TNAC   Q+CLHYTQVVW  + 
Sbjct  69   LIHSNGPYGENLAKGSGNFTAIAAVKLWVDEKPYYSYTTNACTGGQQCLHYTQVVWRESV  128

Query  434  TIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             IGCAR  C  GW FV+CNY  PGN+ G+ PY
Sbjct  129  KIGCARVQCTNGWWFVSCNYDAPGNWIGEYPY  160



>ref|XP_006422719.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
 gb|ESR35959.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
Length=159

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 106/169 (63%), Gaps = 11/169 (7%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            M   S   +C    ++ LA    +S   S  D      +L AHN+AR +V   P++W+  
Sbjct  1    MSNISLAILC----LVALATTQLSSAQNSQQD------YLRAHNEARASVRVGPMRWDNK  50

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HSGGPYGEN+A +  +L+  A+VKLW+DE+P YN+N+N CV
Sbjct  51   VAAYAQNYANQRKGDCRLVHSGGPYGENLAWSSGDLTGTAAVKLWVDERPKYNYNSNTCV  110

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGW-MFVTCNYYPPGNYAGQKPY  529
              EC HYTQVVW N+  +GCAR  C      FV C+Y PPGN AG++PY
Sbjct  111  GGECRHYTQVVWRNSVRLGCARVKCNNNRGTFVICSYDPPGNVAGKRPY  159



>ref|XP_006367096.1| PREDICTED: pathogenesis-related leaf protein 6-like [Solanum 
tuberosum]
Length=164

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = +2

Query  140  FLAAHNKAREAV-GSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSEL  313
            +L  HN AR  V G   + WNTTL  YA++YA +R +DC L HS GPYGENIA  +GS +
Sbjct  32   YLNTHNSARSQVTGVSAITWNTTLENYAQTYANQRISDCNLVHSNGPYGENIAKGSGSFM  91

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +  A+V LW+ EKPYY++N+N+C   +EC HYTQVVW N+  +GCAR  C  GW FVTCN
Sbjct  92   TGTAAVNLWVGEKPYYDYNSNSCTGGKECRHYTQVVWKNSIQLGCARVQCTNGWWFVTCN  151

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQ+PY
Sbjct  152  YNPPGNYIGQRPY  164



>gb|KDP37600.1| hypothetical protein JCGZ_06943 [Jatropha curcas]
Length=148

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN AR AVG  P+ W+ T+A YA +YA +   DC L HSGGPYGEN+A +  +L
Sbjct  16   QDYVNAHNTARAAVGVGPVTWDNTVAAYARNYANQHIGDCRLVHSGGPYGENLAGSSGDL  75

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S  A+VKLW+DEK +Y++N+N C + + C HYTQVVW N+  IGCA+  C  G  F+TCN
Sbjct  76   SDPAAVKLWVDEKAFYDYNSNTCAAGKVCGHYTQVVWRNSVRIGCAKVKCNNGGTFITCN  135

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQ+PY
Sbjct  136  YDPPGNYVGQRPY  148



>ref|XP_007041421.1| CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein) superfamily protein [Theobroma cacao]
 gb|EOX97252.1| CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein) superfamily protein [Theobroma cacao]
Length=159

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 97/154 (63%), Gaps = 1/154 (1%)
 Frame = +2

Query  71   IGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAAD  250
            + LA +   SF   +      + FL A N+AR  V   P+ W+  +A YA+ YA +R AD
Sbjct  6    LALACLIIVSFALPSLAKTLKQEFLDAQNEARAEVNVEPMAWDAQVAAYAQEYANQRIAD  65

Query  251  CLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGN  427
            C L HSGGPYGENIA    +LS   +VK+W+DEK YY+H +N C S Q C HYTQVVW N
Sbjct  66   CDLVHSGGPYGENIAWGSDDLSVADAVKMWVDEKVYYDHGSNTCASGQVCAHYTQVVWRN  125

Query  428  TTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  +GCA+  C  G  F+TCNY PPGNY G+ PY
Sbjct  126  SVRLGCAKVRCDNGGTFITCNYDPPGNYIGETPY  159



>gb|ADN43434.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 104/168 (62%), Gaps = 7/168 (4%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F  + + + + ++G A         + C     + ++  HN A+  VG  P+ WN T
Sbjct  1    MGLFK-ISLALLVGLMGFA------LAHTCCAQNSPQDYVDPHNAAQAQVGVGPITWNDT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HSGGPYGENIA     L+   +V +W+ EKP Y++N+N+CV
Sbjct  54   VAAYAQNYANQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCV  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              +C HYTQVVW N+  +GCAR  C  G  F+TCNY PPGNY GQ+PY
Sbjct  114  GGKCGHYTQVVWRNSVRLGCARVQCNNGGWFITCNYDPPGNYVGQRPY  161



>ref|XP_010500562.1| PREDICTED: pathogenesis-related leaf protein 6-like [Camelina 
sativa]
Length=160

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 100/152 (66%), Gaps = 3/152 (2%)
 Frame = +2

Query  77   LAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCL  256
            + AIS      +A +S   + +L AHN AR  VG   L W+TT+A YA +YA  R A+C 
Sbjct  11   IVAISFLVIATNAQNSQ--QDYLTAHNNARAQVGVANLVWDTTVATYALNYANTRKANCS  68

Query  257  LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTT  433
            L HS GPYGEN+A      +A A+VKLW+DEKPYY++ TNAC   Q+CLHYTQVVW  + 
Sbjct  69   LIHSNGPYGENLAKGSGNFTAIAAVKLWVDEKPYYSYTTNACTGGQQCLHYTQVVWRESV  128

Query  434  TIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             IGCAR  C  GW FV+CNY  PGN+ G+ PY
Sbjct  129  KIGCARVQCTNGWWFVSCNYDAPGNWIGEYPY  160



>ref|XP_002274275.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
Length=161

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN AR  VG   + W+ T+A YA++YA +R  DC L HSGGPYGEN+A     L
Sbjct  30   QDYVNAHNTARAQVGVGSMTWDDTVATYAQNYANQRIGDCNLVHSGGPYGENLAWGSPSL  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +V +W+ EKPYY++N+N+CV  EC HYTQVVW N+  +GCAR  C +G  FVTCNY
Sbjct  90   TGTDAVNMWVAEKPYYDYNSNSCVGGECRHYTQVVWSNSVRLGCARVQCNSGGWFVTCNY  149

Query  494  YPPGNYAGQKPY  529
             PPGNY GQ PY
Sbjct  150  DPPGNYQGQHPY  161



>ref|XP_006486819.1| PREDICTED: pathogenesis-related protein 1-like, partial [Citrus 
sinensis]
Length=154

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN+AR +V   P++W+  +A YA++YA +R ADC L HSGGPYGEN+A +  +L
Sbjct  22   QDYLRAHNEARASVRIGPMRWDNKVAAYAQNYANQRKADCRLVHSGGPYGENLAWSSGDL  81

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGW-MFVTCN  490
            +  A+VKLW+DE+P YN+N+N CV  EC HYTQVVW N+  +GCAR  C      FV C+
Sbjct  82   TGTAAVKLWVDERPKYNYNSNTCVGGECRHYTQVVWHNSVRLGCARVKCNNNRGTFVICS  141

Query  491  YYPPGNYAGQKPY  529
            Y PPGN AG++PY
Sbjct  142  YDPPGNVAGKRPY  154



>gb|ADP69172.1| pathogenesis related protein-1 [Populus tomentosa]
Length=161

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN AR  VG   + W+T +A YA +Y  +   DC L HSGGPYGEN+A    +L
Sbjct  30   QDYVNAHNNARAQVGVGNIVWDTNVAAYASNYIKRLTGDCRLVHSGGPYGENLAGGSGDL  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +  A+VKLW+DEKP Y++N+N+CV  EC HYTQVVW N+  +GCA+A C  G   ++CNY
Sbjct  90   TGSAAVKLWVDEKPKYDYNSNSCVGGECRHYTQVVWRNSVRLGCAKAKCSNGGTVISCNY  149

Query  494  YPPGNYAGQKPY  529
             PPGNY GQ+PY
Sbjct  150  SPPGNYVGQRPY  161



>ref|XP_007201612.1| hypothetical protein PRUPE_ppa019807mg [Prunus persica]
 gb|EMJ02811.1| hypothetical protein PRUPE_ppa019807mg [Prunus persica]
Length=157

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN ARE VG P + W++T+  YA++YA  RAADC L HS G YGEN+A      
Sbjct  25   QDYLNAHNVAREQVGVPNITWDSTVEAYAQNYANSRAADCNLVHSNGTYGENLAEGSGSF  84

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +  ++V LW+ EKP YN+ +N+CV  Q+CLHYTQVVW N+  +GCAR  C  G  FVTCN
Sbjct  85   TGTSAVNLWVAEKPNYNYTSNSCVGGQQCLHYTQVVWKNSVRLGCARVKCSNGLWFVTCN  144

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQ+PY
Sbjct  145  YDPPGNYVGQRPY  157



>ref|XP_007148301.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
 gb|ESW20295.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
Length=183

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 107/159 (67%), Gaps = 3/159 (2%)
 Frame = +2

Query  62   INIIGLAAISQASFGES-ACDS-GCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            I ++ L AI  A+   S  CD+    + FL AHN AR  VG  P++W+ T+A +A++Y  
Sbjct  6    IPMLPLVAILLATSTLSQICDAQNSPQDFLNAHNTARSQVGVGPMRWDATVASFAQNYVN  65

Query  236  KRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQV  415
            K   +C + HSGGPYGEN+A +  +L+A A+VKLW+ EKPYY++N+N CV  EC HYTQV
Sbjct  66   KLKGNCKMVHSGGPYGENLAWSSGDLTATAAVKLWVGEKPYYDYNSNTCVGGECRHYTQV  125

Query  416  VWGNTTTIGCARATCKTGW-MFVTCNYYPPGNYAGQKPY  529
            VW N+  +GCA+  C  G    ++CNY PPGNY GQ+P+
Sbjct  126  VWRNSVRLGCAKVRCNDGRATIISCNYDPPGNYIGQRPF  164



>ref|XP_003631695.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN83925.1| hypothetical protein VITISV_002104 [Vitis vinifera]
 emb|CBI25102.3| unnamed protein product [Vitis vinifera]
Length=176

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL AHN AR  VG   + WN T+A YA++YA +R  DC L HS GPYGENIA     L
Sbjct  30   QDFLDAHNAARAEVGVESMTWNDTVAAYAQNYANQRIGDCNLVHSSGPYGENIAWGTPSL  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +V +W+ EKPYY++N+N+CV  ECL Y +V+W N+  +GCAR  C TG  FVTCNY
Sbjct  90   TGTDAVNMWVGEKPYYDYNSNSCVGGECLQYIKVIWRNSLHLGCARVQCNTGGWFVTCNY  149

Query  494  YPPGNYAGQKPY  529
             PPGNY GQ+P+
Sbjct  150  DPPGNYVGQRPF  161



>sp|P11670.1|PRB1_TOBAC RecName: Full=Basic form of pathogenesis-related protein 1; Short=PRP 
1; Flags: Precursor [Nicotiana tabacum]
 emb|CAA32228.1| PRP 1 precursor (AA -23 to 154) [Nicotiana tabacum]
 prf||1807333A pathogenesis-related protein 1
Length=177

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L  HN AR  VG  P+ W+  LA YA++YA +R  DC + HS GPYGEN+A A  +L
Sbjct  28   QDYLNPHNAARRQVGVGPMTWDNRLAAYAQNYANQRIGDCGMIHSHGPYGENLAAAFPQL  87

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +A  +VK+W+DEK +Y++N+N+CV   C HYTQVVW N+  +GCAR     GW F+TCNY
Sbjct  88   NAAGAVKMWVDEKRFYDYNSNSCVGGVCGHYTQVVWRNSVRLGCARVRSNNGWFFITCNY  147

Query  494  YPPGNYAGQKPY  529
             PPGN+ GQ+P+
Sbjct  148  DPPGNFIGQRPF  159



>ref|XP_004170276.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=162

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            + I+ + +  I+Q +    A +S   + F+ AHN AR  VG  P+ WN TLA YA++YA 
Sbjct  7    LLISFMMMGLITQLASITLAQNSH--QDFVNAHNAARAKVGVGPVSWNYTLAAYAQTYAN  64

Query  236  KRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQV  415
            K+   C ++HS GPYGEN+A    E++A  +V  W+ EK YY+H++N C+  EC HYTQV
Sbjct  65   KKIGTCEMQHSYGPYGENLAEGYGEMTAVEAVNFWVSEKKYYDHHSNRCIGDECRHYTQV  124

Query  416  VWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            VW  T  +GCAR  C   W+FV CNY PPGNY GQ PY
Sbjct  125  VWRGTKHVGCARVKCHNNWIFVICNYDPPGNYVGQFPY  162



>gb|AFK93503.1| pathogenesis related protein 1 isoform 4 [Ficus pumila var. awkeotsang]
Length=169

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 103/167 (62%), Gaps = 8/167 (5%)
 Frame = +2

Query  35   FSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAE  214
             S + + + + I+GLA +      +S  D      FLA HN+AR  VG  P+ W+ ++A 
Sbjct  3    LSRISLALIMCILGLAVLESCRAQDSPQD------FLAPHNRARAEVGVGPMTWDESVAA  56

Query  215  YAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQE  394
            YA  YA +R  DC L HSGGPYGENIA    +LSA  +V +W+ EK  Y++N N C+   
Sbjct  57   YARDYANRRKGDCKLIHSGGPYGENIAWGSGDLSAARAVGMWVAEKSLYDYNNNKCIGDP  116

Query  395  --CLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              CLHYTQVVW  +T +GCA+  C +G  F+ CNY PPGNY GQ+PY
Sbjct  117  WGCLHYTQVVWRKSTRLGCAKVRCVSGGTFIICNYNPPGNYKGQRPY  163



>ref|XP_006486832.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Citrus 
sinensis]
Length=164

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 108/168 (64%), Gaps = 7/168 (4%)
 Frame = +2

Query  32   EFSFLQVCVAINIIG-LAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTL  208
            + S + + +AI  +G LA + Q S  +++      + +L AHN AR AV  P + WN T+
Sbjct  2    KMSSISLALAICFMGSLALLIQTSHAQNS-----PQDYLDAHNSARAAVYVPNIIWNDTV  56

Query  209  AEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS  388
            A YA++Y+  R ADC L HSGGPYGENIA      +  A+V LW+ EK  YN++TN C +
Sbjct  57   AAYAQNYSNSRIADCNLVHSGGPYGENIAKGSGTFTGTAAVSLWVAEKANYNYSTNTCAA  116

Query  389  -QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             + C HYTQVVW N+  +GCAR  C  GW FVTC+Y PPGNY GQKPY
Sbjct  117  GKVCGHYTQVVWRNSIRVGCARVQCSNGWWFVTCSYDPPGNYIGQKPY  164



>ref|XP_002274105.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=176

 Score =   162 bits (410),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL AHN AR  VG  P+ W+ T+A YA++Y  +R  DC L HSGGPYGEN+A     L
Sbjct  30   QDFLDAHNVARAEVGVGPMSWDNTVAAYAQNYTNQRIGDCNLVHSGGPYGENLAWGSPSL  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +V LW+ EK  Y++N+N+CV  EC HYTQV+W N+  +GCARA C +G  FVTCNY
Sbjct  90   TGIDAVNLWVGEKTNYDYNSNSCVGGECRHYTQVIWRNSLRLGCARAQCNSGGWFVTCNY  149

Query  494  YPPGNYAGQKPY  529
             PPGNY GQ+P+
Sbjct  150  DPPGNYVGQRPF  161



>ref|XP_002885324.1| hypothetical protein ARALYDRAFT_898358 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61583.1| hypothetical protein ARALYDRAFT_898358 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   162 bits (409),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +2

Query  140  FLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSA  319
            FL AHN+AR  VG  PL W+  +A YA SYA +R  DC L HS GP+GENIAM+  ++ A
Sbjct  29   FLEAHNEARNEVGLDPLVWDDEVAAYAASYANQRINDCALVHSNGPFGENIAMSSGDMPA  88

Query  320  EASVKLWMDEKPYYNHNTNACVSQE---CLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            E + ++W++EK YY++N+N C       CLHYTQVVW NT  +GCA+  C +G  F+TCN
Sbjct  89   EDAAEMWINEKQYYDYNSNTCNDPNGGTCLHYTQVVWKNTVRLGCAKVVCNSGGTFITCN  148

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQ PY
Sbjct  149  YDPPGNYIGQNPY  161



>ref|XP_010525646.1| PREDICTED: pathogenesis-related leaf protein 6-like [Tarenaya 
hassleriana]
Length=163

 Score =   162 bits (409),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            +G+L AHN AR  VG   + W+ T+A YA+SYA  RA+DC L HS GPYGEN+A      
Sbjct  31   QGYLNAHNSARTQVGVANIAWDDTVAAYAQSYANSRASDCSLVHSNGPYGENLAKGSGSF  90

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +  A+V LW+ EK YYN+ TN+C   ++CLHYTQVVW ++  +GCAR  C  G+ FVTCN
Sbjct  91   TGTAAVNLWVAEKLYYNYTTNSCTGGKQCLHYTQVVWRDSVRLGCARVQCIDGYWFVTCN  150

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY G++PY
Sbjct  151  YDPPGNYVGERPY  163



>ref|XP_006406470.1| hypothetical protein EUTSA_v10022205mg [Eutrema salsugineum]
 gb|ESQ47923.1| hypothetical protein EUTSA_v10022205mg [Eutrema salsugineum]
Length=165

 Score =   162 bits (409),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 104/159 (65%), Gaps = 4/159 (3%)
 Frame = +2

Query  65   NIIGLAAISQA-SFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKR  241
            NI+ L AI+ + S    +      + FL AHN+AR  VG  PL W+  +A YA SYA +R
Sbjct  7    NILFLFAIAISYSLTVPSLAEDWKQDFLEAHNEARNEVGLSPLVWDDEVAAYASSYANQR  66

Query  242  AADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQE---CLHYTQ  412
             +DC + HS GP+GENIA +  ++SAE + ++W+DEK YY++N+N C       CLHYTQ
Sbjct  67   ISDCAMVHSNGPFGENIAWSSGDMSAEDASEMWIDEKKYYDYNSNTCNDPNGGTCLHYTQ  126

Query  413  VVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            VVW NT  +GCA+  C +G  F+TCNY PPGNY G KPY
Sbjct  127  VVWQNTLRLGCAKVVCNSGGTFITCNYDPPGNYIGVKPY  165



>ref|XP_008236237.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related leaf protein 
6-like [Prunus mume]
Length=157

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR+ VG P + W++T+  YA++YA   AADC L HS G YGEN+A      
Sbjct  25   QDYLNAHNVARKQVGVPNITWDSTVEAYAQNYANSSAADCNLVHSNGTYGENLAKGSGSF  84

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +  A+V LW+ EKP YN+ +N+CV  Q+CLHYTQVVW N+  +GCAR  C  GW F TCN
Sbjct  85   TGTAAVNLWVAEKPNYNYTSNSCVGGQQCLHYTQVVWKNSVRLGCARVQCSNGWWFATCN  144

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY GQ+PY
Sbjct  145  YDPPGNYVGQRPY  157



>ref|XP_004136922.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004169191.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 gb|KGN43827.1| hypothetical protein Csa_7G070235 [Cucumis sativus]
Length=161

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + F+  HN  R AVG  P+ W+ TLA YA+SYA  +   C +EHS GPYGEN+A    E+
Sbjct  30   QDFVDTHNDIRAAVGVGPVSWDDTLAAYAQSYADSKMDTCEMEHSNGPYGENLAEGYDEM  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +V+ W  EK +YNH+ N CV  EC HYTQ+VW +TT IGC R  C+  W+FV CNY
Sbjct  90   TGVEAVRFWATEKKFYNHHLNRCVGDECGHYTQIVWRHTTNIGCGRVKCENNWVFVICNY  149

Query  494  YPPGNYAGQKPY  529
             PPGNY GQ PY
Sbjct  150  NPPGNYIGQHPY  161



>ref|XP_006367093.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=188

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 109/171 (64%), Gaps = 13/171 (8%)
 Frame = +2

Query  41   FLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYA  220
            +  + + I  +  A I  +S  +++      + +L  HN+AR  VG  P+ W+  LA +A
Sbjct  3    YSNIALIICFLSFAIIFHSSQAQNS-----PQDYLNPHNEARRQVGVSPMTWDNRLAAFA  57

Query  221  ESYATKRAADC-------LLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNA  379
            ++YA +RA DC       L++HSGGPYGEN+A    +L+A  +VK+W+DEK +YN+N+N 
Sbjct  58   QNYANQRAGDCRMHYNILLMQHSGGPYGENLAAGFPQLNAAGAVKMWVDEKQWYNYNSNT  117

Query  380  C-VSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            C   + C HYTQVVW N+  +GCAR  C  GW F+TCNY PPGN+ GQ+PY
Sbjct  118  CQAGKVCGHYTQVVWRNSVRLGCARVRCNNGWYFITCNYDPPGNWNGQRPY  168



>ref|XP_006422707.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
 gb|ESR35947.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
Length=159

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN+AR +V   P++W+  +A YA++YA +R  DC L HSGGPYGEN+A +  +L
Sbjct  27   QDYLRAHNEARASVRVGPMRWDNKVAAYAKNYANQRKGDCRLVHSGGPYGENLAWSSGDL  86

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGW-MFVTCN  490
            +  A+VKLW+DE+P YN+N+N CV  EC HYTQVVW N+  +GCAR  C      FV C+
Sbjct  87   TGTAAVKLWVDERPKYNYNSNTCVGGECRHYTQVVWRNSVRLGCARVKCNNNRGTFVICS  146

Query  491  YYPPGNYAGQKPY  529
            Y PPGN AG++PY
Sbjct  147  YDPPGNVAGKRPY  159



>ref|XP_004230668.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
lycopersicum]
Length=162

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 100/169 (59%), Gaps = 11/169 (7%)
 Frame = +2

Query  32   EFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSP--PLKWNTT  205
            E S L   V + ++GLA         S+      +  +  HNKAR  VG P  PLKWN T
Sbjct  2    EMSKLSTFVVLLVLGLA--------HSSVAQNLPQDIVVVHNKARAEVGVPLPPLKWNDT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            LA YA  YAT R  +C L HS  PYGEN+AM   + +A  +V LW+ EK  Y++ +N C 
Sbjct  54   LAAYAHEYATTRLGECTLVHSDSPYGENLAMGSGDFTAVQAVNLWVGEKKNYDYASNTCR  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTG-WMFVTCNYYPPGNYAGQKPY  529
               C HYTQVVW NT  +GCAR  C  G W FV+CNYYPPGNY G+KPY
Sbjct  114  EGMCGHYTQVVWKNTEQVGCARLKCSNGEWWFVSCNYYPPGNYVGEKPY  162



>ref|XP_010530685.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=140

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + F+ AHN+AR  VG  P++W+ T+A YA  YA +R  DC L HS GPYGENIA  G +L
Sbjct  8    QDFVDAHNRARAEVGVGPIEWDETVAAYARDYANQRRGDCSLTHSSGPYGENIAWGGGDL  67

Query  314  SAEASVKLWMDEKPYYNHNTNAC-VSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S  A+VK+W+DEK  Y++NTN C   ++C HYTQ+VW N+  +GCA+ TC  G  F+TCN
Sbjct  68   SGTAAVKMWVDEKADYDYNTNTCRAGKQCGHYTQIVWRNSVRLGCAKVTCDDGGTFITCN  127

Query  491  YYPPGNYAGQKPY  529
            Y P GN+ GQ PY
Sbjct  128  YDPRGNFIGQWPY  140



>ref|XP_003545770.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
 gb|KHN33604.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=164

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 110/168 (65%), Gaps = 10/168 (6%)
 Frame = +2

Query  32   EFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLA  211
            + SF  +CV   ++ ++ ++ A   +S  D      ++ AHN AR  VG   L W+ T+A
Sbjct  5    KVSFPVLCVLGLVMIVSHVANAQ--DSPAD------YVNAHNAARSEVGVQNLAWDDTVA  56

Query  212  EYAESYATKRAADCLLEHSGG--PYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
             +A++YA +R  DC L HSGG   YGEN+AM+  +LS   +VKLW+DEK  Y++N+N+CV
Sbjct  57   AFAQNYANQRKGDCQLIHSGGGGQYGENLAMSTGDLSGTDAVKLWVDEKSNYDYNSNSCV  116

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              ECLHYTQVVW ++  +GCA+  C  G  F+TCNY PPGNY GQ+PY
Sbjct  117  GGECLHYTQVVWRDSVRLGCAKVACDNGGTFITCNYAPPGNYVGQRPY  164



>ref|XP_010088981.1| hypothetical protein L484_013561 [Morus notabilis]
 gb|EXB37196.1| hypothetical protein L484_013561 [Morus notabilis]
Length=171

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 104/168 (62%), Gaps = 9/168 (5%)
 Frame = +2

Query  35   FSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAE  214
             S + + + I I+GL  I       +  D      FLA HN+AR  VG  P+ W+ ++A 
Sbjct  3    LSRISLALVICILGLGVIELCYAQTTPQD------FLAPHNRARAEVGVGPMTWDDSVAA  56

Query  215  YAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQE  394
            YA +YA +R  DC L HSGGPYGENIA +  +LSA  +V +W+ EK  Y++ +N CV Q 
Sbjct  57   YARNYANQRQGDCKLVHSGGPYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNKCVGQN  116

Query  395  ---CLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
               CLHYTQVVW  +T +GCA+  C +G  FV CNY PPGNY GQ+PY
Sbjct  117  PMGCLHYTQVVWRKSTRLGCAKVRCNSGGSFVICNYNPPGNYIGQRPY  164



>ref|XP_004136928.1| PREDICTED: pathogenesis-related protein 1C-like [Cucumis sativus]
 ref|XP_004155419.1| PREDICTED: pathogenesis-related protein 1C-like [Cucumis sativus]
 gb|KGN43835.1| hypothetical protein Csa_7G070510 [Cucumis sativus]
Length=179

 Score =   162 bits (409),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 108/169 (64%), Gaps = 4/169 (2%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            M  F ++ + + ++ +    +S   F  SA DS  I+ F+ AHN AR  VG  P+ WN T
Sbjct  1    MDLFKYISLSLLLSPLSFIMLSMLPF-SSAQDS--IQNFVDAHNTARAEVGVGPVHWNET  57

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A+YA  YA KR  DC L HS GPYGENIA     L+   +V++W++EK +YN+ TN+CV
Sbjct  58   VADYARRYANKRIKDCNLVHSKGPYGENIAWGSRNLAGTVAVRMWVNEKQFYNYETNSCV  117

Query  386  -SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              + C HYTQVVW N+  IGCA+  C++G  F+TCNY P GN  GQ+PY
Sbjct  118  IGKMCGHYTQVVWRNSVRIGCAKVRCRSGGTFITCNYDPRGNIRGQRPY  166



>ref|XP_006486833.1| PREDICTED: pathogenesis-related leaf protein 6-like [Citrus sinensis]
Length=159

 Score =   161 bits (407),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 103/169 (61%), Gaps = 11/169 (7%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            M   S   +C    ++ LA    +S   S  D      +L AHN+ R +V   P++W+  
Sbjct  1    MSNISLAILC----LVALATTQLSSAQNSQQD------YLRAHNETRASVRVGPMRWDNK  50

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HSGGPY EN+A +  +L+  A+VKLW+DE+P YN+N+N CV
Sbjct  51   VAAYAQNYANQRKGDCRLVHSGGPYSENLAWSNGDLTGMAAVKLWVDERPKYNYNSNTCV  110

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGW-MFVTCNYYPPGNYAGQKPY  529
              EC HYTQVVW N+  +GC R  C      FV CNY PPGN AGQ+PY
Sbjct  111  GGECRHYTQVVWRNSVRLGCTRVKCNNNRGTFVICNYDPPGNVAGQRPY  159



>ref|XP_010252394.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
 ref|XP_010252398.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=162

 Score =   161 bits (407),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (67%), Gaps = 7/157 (4%)
 Frame = +2

Query  62   INIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKR  241
            I ++GLA +  +   +S  D      ++ AHN+AR AVG  P+ W+ TLA YA+ YA +R
Sbjct  12   ILMVGLALLHVSEAQDSPQD------YINAHNEARRAVGVGPMTWDNTLAGYAQRYANQR  65

Query  242  AADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVV  418
              DC ++HS GPYGEN+A A   LS   +VK+W++EK +Y++N+N+C + + C HYTQVV
Sbjct  66   IGDCAMKHSNGPYGENLAAAMPSLSGTNAVKMWVNEKQFYBYNSNSCAAGKVCGHYTQVV  125

Query  419  WGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            W ++  +GCA+  C  GW FV CNY P GNY GQ+PY
Sbjct  126  WRSSVRLGCAKVHCNNGWDFVICNYAPRGNYVGQRPY  162



>ref|XP_006422718.1| hypothetical protein CICLE_v10029873mg [Citrus clementina]
 gb|ESR35958.1| hypothetical protein CICLE_v10029873mg [Citrus clementina]
 gb|KDO37560.1| hypothetical protein CISIN_1g048073mg [Citrus sinensis]
Length=164

 Score =   161 bits (407),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 108/168 (64%), Gaps = 7/168 (4%)
 Frame = +2

Query  32   EFSFLQVCVAINIIG-LAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTL  208
            + S + + +AI  +G LA + Q S  +++      + +L AHN AR AV  P + WN T+
Sbjct  2    KMSSISLALAICFMGSLALLIQTSHAQNS-----PQDYLDAHNSARAAVYVPNIIWNDTV  56

Query  209  AEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS  388
            A YA++Y+  R ADC L HSGGPYGEN+A      +  A+V LW+ EK  YN++TN C +
Sbjct  57   AAYAQNYSNSRIADCNLVHSGGPYGENLAKGSGTFTGTAAVSLWVAEKANYNYSTNTCAA  116

Query  389  -QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             + C HYTQVVW N+  +GCAR  C  GW FVTC+Y PPGNY GQKPY
Sbjct  117  GKVCGHYTQVVWRNSIRVGCARVQCSNGWWFVTCSYDPPGNYIGQKPY  164



>ref|XP_008796970.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 100/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENI-AMAGSE  310
            + F++AHN AR AVG   + W+ T+A YA++YA +R +DC L+HSGGPYGEN+   +G++
Sbjct  29   QDFVSAHNAARAAVGVGSVSWDDTVAAYAQNYANQRISDCQLKHSGGPYGENLFGGSGAD  88

Query  311  LSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
             +A  +V  W+DEK +Y++NTN C +  EC HYTQVVW ++T IGCAR TC +G +F+ C
Sbjct  89   FTAADAVNSWVDEKQWYDYNTNTCAAGHECGHYTQVVWRDSTNIGCARVTCNSGAIFIIC  148

Query  488  NYYPPGNYAGQKPY  529
            +Y PPGN+ GQ+PY
Sbjct  149  DYKPPGNFVGQRPY  162



>ref|XP_009787160.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nicotiana 
sylvestris]
Length=163

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 99/167 (59%), Gaps = 11/167 (7%)
 Frame = +2

Query  32   EFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLA  211
             FS L +C  I      + +Q S  +          +L AHN AR  VG   + W+ TLA
Sbjct  7    SFSTLLICFIILAFAFPSHAQNSQTD----------YLNAHNSARTQVGVSAITWDITLA  56

Query  212  EYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS-  388
             YA++YA +R  DC L HS GPYGEN+A      +  A+V +W+ EKPYY++  N C + 
Sbjct  57   NYAQNYANQRIGDCNLVHSNGPYGENLAKGSGSFTGAAAVNMWVAEKPYYDYTNNCCTTG  116

Query  389  QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             +CLHYTQVVW N+  +GCARA C  GW FV C+Y PPGN  GQ+PY
Sbjct  117  NQCLHYTQVVWSNSVRVGCARAQCSNGWWFVICSYDPPGNVVGQRPY  163



>ref|XP_009378590.1| PREDICTED: pathogenesis-related leaf protein 4-like [Pyrus x 
bretschneideri]
Length=168

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 102/168 (61%), Gaps = 0/168 (0%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG  S L +C+    + LAA +  +           + F+  HN+AR AVG  P+KWN T
Sbjct  1    MGCSSNLLLCIFSTALILAAHTSLARKVGYYPPNPHQDFVDEHNRARAAVGVGPIKWNDT  60

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA+ YA  R   C +EHSGGPYGEN+A     ++   +VK W+ EKP YN+ +N CV
Sbjct  61   VAAYAQQYANTRVRGCDMEHSGGPYGENLAEGYGGMTGAQAVKFWVTEKPNYNYASNKCV  120

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              EC HYTQVVW N+  +GCAR  C   W+FV C+Y PPGNY  ++PY
Sbjct  121  GDECGHYTQVVWRNSIHLGCARVKCDNNWVFVICSYDPPGNYEDERPY  168



>ref|XP_006367092.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=178

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L  HN+AR  VG  P+ W+  LA +A++YA +R  DC ++HSGGPYGEN+A    +L
Sbjct  25   QDYLNPHNEARRQVGVGPMAWDNRLAAFAQNYANQRIGDCRMQHSGGPYGENLAAGFPQL  84

Query  314  SAEASVKLWMDEKPYYNHNTNAC-VSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +A  +VK+W+DEK +Y++N+N+C   + C HYTQVVW N+  +GCAR  C  GW F+TCN
Sbjct  85   NAAGAVKMWVDEKQWYDYNSNSCQPGKVCGHYTQVVWRNSVRLGCARVRCNNGWDFITCN  144

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ GQ+P+
Sbjct  145  YDPPGNWIGQRPF  157



>gb|KCW56841.1| hypothetical protein EUGRSUZ_I02509 [Eucalyptus grandis]
Length=164

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 104/161 (65%), Gaps = 6/161 (4%)
 Frame = +2

Query  50   VCVAINIIGLA-AISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAES  226
            + + + IIGL  A++  S  +++      + F+  HN AR  VG  P+ WN T+A YA  
Sbjct  9    LAIFVYIIGLICALAGISVAQNS-----HQDFVDEHNAARAEVGVGPITWNRTVAAYARK  63

Query  227  YATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHY  406
            YA +R  DC LEHSGGPYGEN+A     LS   SVK+W+ E+  Y++++N+CV  EC HY
Sbjct  64   YAEERRGDCNLEHSGGPYGENLAKGYGVLSGRDSVKMWVGEEDDYDYSSNSCVVGECRHY  123

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQVVW ++  +GCAR  C  GW FV C+Y PPGNY G++PY
Sbjct  124  TQVVWRDSVHLGCARVKCDDGWWFVICSYDPPGNYEGERPY  164



>ref|XP_009398311.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Musa acuminata 
subsp. malaccensis]
Length=163

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMA-GSE  310
            + F++ HN AR AVG  P+ W++T+A YA++YA +RAADC L HSGGPYGENI    G +
Sbjct  30   QDFVSPHNAARTAVGVVPVSWDSTVAAYAQNYANQRAADCQLVHSGGPYGENIFSGFGRD  89

Query  311  LSAEASVKLWMDEKPYYNHNTNACVSQE-CLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
             +A  ++K W+ EK YYNHN+N C   + C HYTQVVW ++T IGC R  C +G +F+TC
Sbjct  90   YTAADAIKYWVSEKQYYNHNSNKCAPNKVCGHYTQVVWRSSTAIGCGRVRCNSGGIFITC  149

Query  488  NYYPPGNYAGQKPY  529
            NY PPGN  GQ PY
Sbjct  150  NYKPPGNIEGQSPY  163



>ref|XP_010065836.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 ref|XP_010040970.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 ref|XP_010041778.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW44745.1| hypothetical protein EUGRSUZ_L01707 [Eucalyptus grandis]
 gb|KCW63506.1| hypothetical protein EUGRSUZ_G01137 [Eucalyptus grandis]
Length=165

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = +2

Query  47   QVCVAINIIGLAAISQASFGES-ACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAE  223
            ++ V ++II L A++ A    S A DS   + ++AAHN AR  VG   + W+  +A YA 
Sbjct  4    RMSVPLHIIFLVALALALIPLSIAQDSP--QDYVAAHNAARSQVGVGRITWDERVAGYAR  61

Query  224  SYATKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS-QEC  397
             YA K A DC  L HSGGPYGEN+A A  +L+   +V +W+ EKPYYN+N+N+C S + C
Sbjct  62   DYAKKHARDCTRLVHSGGPYGENLAWASPDLTGTRAVNMWVGEKPYYNYNSNSCASGKVC  121

Query  398  LHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             HYTQVVW N+  +GCA+A C TG   VTCNY PPGNY GQKPY
Sbjct  122  GHYTQVVWRNSVRLGCAKAKCATGGTLVTCNYDPPGNYVGQKPY  165



>ref|XP_002313932.2| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE87887.2| pathogenesis-related family protein [Populus trichocarpa]
Length=160

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR  V    + W+ T+A YA +YA  R +DC L HS GPYGEN+A      
Sbjct  29   QDYLNAHNAARSQVTVANIIWDNTVAAYALNYANSRISDCNLVHSNGPYGENLAKGSGSF  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +  A+V LW+ EKPYY++ +N+CV  +CLHYTQVVW N+  +GCAR  C  GW FV+CNY
Sbjct  89   TGTAAVNLWVAEKPYYDYASNSCVGGQCLHYTQVVWRNSVRVGCARVKCTNGWWFVSCNY  148

Query  494  YPPGNYAGQKPY  529
             PPGNY G++PY
Sbjct  149  DPPGNYIGERPY  160



>gb|ADB54822.1| pathogenesis-related protein 1 [Vitis pseudoreticulata]
Length=176

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL AHN  R  VG  P+ W+ T+A YA++Y  +R  DC L HSGGPYGEN+A     L
Sbjct  30   QDFLDAHNVPRAEVGVGPMSWDNTVAAYAQNYTNQRIGDCNLVHSGGPYGENLAWGSPSL  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +V LW+ EK  Y++N+N+CV  ECLHYTQV+W N+  +GCAR  C  G  F+TCNY
Sbjct  90   TGIDAVNLWVGEKINYDYNSNSCVGGECLHYTQVIWRNSLRLGCARVQCDNGGWFITCNY  149

Query  494  YPPGNYAGQKPY  529
             PPGNY GQ+P+
Sbjct  150  DPPGNYMGQRPF  161



>gb|ACB45874.1| pathogen-related protein 1 [Cucumis melo var. inodorus]
Length=151

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +2

Query  131  IEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSE  310
            I+ F+ AHN AR  VG  P+ WN T+A+YA  YA KR  DC L HS GPYGENIA     
Sbjct  11   IKDFVDAHNAARAQVGVGPVHWNKTVADYAHQYANKRIKDCNLVHSKGPYGENIAWGSRN  70

Query  311  LSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
            L+   +V++W+ EK +YN++TN+CV  + C HYTQVVW N+  IGCA+  CK+G  F+TC
Sbjct  71   LAGTVAVRMWVSEKQFYNYDTNSCVRGKMCGHYTQVVWRNSVRIGCAKVRCKSGGTFITC  130

Query  488  NYYPPGNYAGQKPY  529
            NY P GN  GQ+PY
Sbjct  131  NYDPRGNIRGQRPY  144



>ref|XP_006367090.1| PREDICTED: pathogenesis-related protein 1-like [Solanum tuberosum]
Length=162

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 99/169 (59%), Gaps = 11/169 (7%)
 Frame = +2

Query  32   EFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSP--PLKWNTT  205
            E S L   V   ++GLA  S A            +  +  HNKAR  VG P  PLKWN T
Sbjct  2    EISKLSTIVVFLVLGLAYSSLAQ--------NLPKDIVLVHNKARAEVGVPLPPLKWNDT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            LA YA  YAT R  +C L HS  PYGEN+AM   + +A  +V LW+ EK  Y++ +N C 
Sbjct  54   LAAYAHEYATTRLGECTLVHSDSPYGENLAMGSGDFTAVQAVNLWVGEKSNYDYASNTCR  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTG-WMFVTCNYYPPGNYAGQKPY  529
               C HYTQVVW NT  +GCAR  C  G W FV+CNYYPPGNY G+KPY
Sbjct  114  EGMCGHYTQVVWKNTQQVGCARLKCSNGEWWFVSCNYYPPGNYIGEKPY  162



>ref|XP_010065833.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW63503.1| hypothetical protein EUGRSUZ_G01133 [Eucalyptus grandis]
Length=170

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 103/160 (64%), Gaps = 3/160 (2%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            V +++I L A++ A    S       + ++AAHN AR  VG  P+ W+  +A YA  YA 
Sbjct  12   VPLHVIFLVALTLALISLSVAQDS-PQDYVAAHNAARSQVGVGPITWDERVASYARDYAQ  70

Query  236  KRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQECLHYT  409
            K A DC  L HSGGPYGEN+A A  +L+   +V LW+ EKP YN+N+N+C   + C HYT
Sbjct  71   KHARDCTRLVHSGGPYGENLAWASPDLTGTRAVNLWVGEKPDYNYNSNSCAPGKVCGHYT  130

Query  410  QVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            QVVW N+  +GCA+A C TG   VTCNY PPGNY GQKPY
Sbjct  131  QVVWRNSVRVGCAKAQCATGGTLVTCNYDPPGNYIGQKPY  170



>ref|XP_004136921.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 gb|KGN43824.1| hypothetical protein Csa_7G070225 [Cucumis sativus]
Length=162

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 100/158 (63%), Gaps = 2/158 (1%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            + I+ + +  I+Q +    A +S   + F+ AHN AR  VG  P+ WN TLA YA++YA 
Sbjct  7    LLISFMMMGLITQLASITLAQNSH--QDFVNAHNAARAKVGVGPVSWNYTLAAYAQTYAN  64

Query  236  KRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQV  415
            K+   C ++HS GPYGEN+A    E++A  +V  W+ EK YY+H++N C+  EC HYTQV
Sbjct  65   KKIGTCEMQHSYGPYGENLAEGYGEMTAVEAVNFWVSEKKYYDHHSNRCIGDECRHYTQV  124

Query  416  VWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            VW  T  +GCAR  C   W+FV CNY PP NY GQ PY
Sbjct  125  VWRGTKHVGCARVKCHNNWIFVICNYDPPDNYVGQFPY  162



>gb|KHN33609.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=239

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = +2

Query  149  AHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEAS  328
            AHN AR  VG P L W+ ++A YAE+YA +R  DC L HSGG YGENIAM+  ELS   +
Sbjct  9    AHNAARSEVGVPDLAWDDSVAAYAENYANQRKGDCALIHSGGEYGENIAMSTGELSGTDA  68

Query  329  VKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGN  508
            VK+W+DEK  Y+H++N+CV  ECLHYTQVVW ++  +GCA+ TC  G  F+TCNY PPGN
Sbjct  69   VKMWVDEKANYDHDSNSCVGGECLHYTQVVWRDSVRLGCAKVTCDNGGTFITCNYDPPGN  128

Query  509  YA  514
            + 
Sbjct  129  FV  130



>gb|AHA56682.1| pathogenesis related protein [Camellia sinensis]
Length=162

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 91/134 (68%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR  VG  P+ W+  +A YA+ YA+ R  DC L HSGGPYGEN+A      
Sbjct  29   QDYLNAHNAARAQVGVGPMTWDNNVAAYAQRYASSRMGDCNLVHSGGPYGENLAEGNGSF  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQ-ECLHYTQVVWGNTTTIGCARATC-KTGWMFVTC  487
            +  A V LW+ EKPYY++N+N+CV + EC HYTQVVW N+  +GCAR  C   GW FV C
Sbjct  89   TGTAGVNLWVGEKPYYDYNSNSCVGRKECRHYTQVVWRNSVRLGCARVQCTNNGWWFVIC  148

Query  488  NYYPPGNYAGQKPY  529
            +Y PPGNY GQ+PY
Sbjct  149  SYDPPGNYIGQRPY  162



>ref|XP_010270273.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nelumbo 
nucifera]
Length=167

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGP-YGENIAMAGSE  310
            + +L AHN AR  VG  P++W+  +A YA +YA +R  DC L HSGG  YGEN+A     
Sbjct  29   QDYLNAHNAARAQVGVGPMRWDNNVAAYARNYANQRIRDCNLVHSGGGLYGENLAKGSGA  88

Query  311  LSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
             +   +V LW+ EKP+Y++N+N+C+  +CLHYTQVVW ++  +GCAR  C  GW FVTCN
Sbjct  89   FTGVDAVNLWVKEKPFYDYNSNSCIGGQCLHYTQVVWRDSVRLGCARVRCNNGWFFVTCN  148

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ G++PY
Sbjct  149  YDPPGNFIGERPY  161



>ref|XP_010029887.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Eucalyptus 
grandis]
Length=173

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 104/161 (65%), Gaps = 6/161 (4%)
 Frame = +2

Query  50   VCVAINIIGLA-AISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAES  226
            + + + IIGL  A++  S  +++      + F+  HN AR  VG  P+ WN T+A YA  
Sbjct  18   LAIFVYIIGLICALAGISVAQNSH-----QDFVDEHNAARAEVGVGPITWNRTVAAYARK  72

Query  227  YATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHY  406
            YA +R  DC LEHSGGPYGEN+A     LS   SVK+W+ E+  Y++++N+CV  EC HY
Sbjct  73   YAEERRGDCNLEHSGGPYGENLAKGYGVLSGRDSVKMWVGEEDDYDYSSNSCVVGECRHY  132

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQVVW ++  +GCAR  C  GW FV C+Y PPGNY G++PY
Sbjct  133  TQVVWRDSVHLGCARVKCDDGWWFVICSYDPPGNYEGERPY  173



>ref|XP_010065835.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Eucalyptus 
grandis]
 gb|KCW63505.1| hypothetical protein EUGRSUZ_G01135 [Eucalyptus grandis]
Length=161

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 103/160 (64%), Gaps = 3/160 (2%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            V +++I LAA++ A    S         ++AAHN AR  VG  P+ W+  +A YA  YA 
Sbjct  3    VPLHVIFLAALTLALISLSVAQD-LPRDYVAAHNAARSQVGVGPITWDERVASYARDYAQ  61

Query  236  KRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQECLHYT  409
            K A DC  L HSGGPYGEN+A A  +L+   +V +W+ EKP YN+N+N+C   + C HYT
Sbjct  62   KHARDCTRLVHSGGPYGENLAWASPDLTGTRAVNMWVGEKPDYNYNSNSCAPGKVCGHYT  121

Query  410  QVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            QVVW N+  +GCA+A C TG   VTCNY PPGNY GQKPY
Sbjct  122  QVVWRNSVRVGCAKAQCATGGTLVTCNYDPPGNYIGQKPY  161



>ref|XP_009605694.1| PREDICTED: pathogenesis-related leaf protein 4-like [Nicotiana 
tomentosiformis]
Length=161

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 93/136 (68%), Gaps = 5/136 (4%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSP--PLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGS  307
            +  +  HNKAR  VG P  PLKWN TLA YA  YAT + A+C L HS GPYGEN+AM   
Sbjct  27   KDIVIVHNKARAEVGVPLPPLKWNNTLASYAHDYATTKLAECKLVHSDGPYGENLAMGYG  86

Query  308  ELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTG--WMFV  481
            E SA  +V LW+ EKP Y + TN+C S  C HYTQV+W NT  +GCAR  C+ G  W FV
Sbjct  87   EFSAVDAVNLWVGEKPNYEYATNSCNSGMCGHYTQVIWRNTLQVGCARLKCQNGEAW-FV  145

Query  482  TCNYYPPGNYAGQKPY  529
            +CNYYPPGNY G++PY
Sbjct  146  SCNYYPPGNYIGERPY  161



>ref|XP_010691524.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
Length=166

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 98/136 (72%), Gaps = 4/136 (3%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGG--PYGENIAMA-G  304
            + ++ AHN AR AVG   ++W+  +A +A+ YA +R ADC L HSGG   YGENIA++ G
Sbjct  31   QDYVNAHNAARAAVGVGNIQWDDQVAAFAQQYANQRKADCALRHSGGGGRYGENIAVSSG  90

Query  305  SELSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFV  481
            S ++  A+VKLW+DEK +YN+NTN C S + C HYTQVVW N+  +GCAR  C  G +FV
Sbjct  91   SSMTGTAAVKLWVDEKAFYNYNTNTCASGKVCGHYTQVVWRNSNRLGCARVQCNNGGVFV  150

Query  482  TCNYYPPGNYAGQKPY  529
            TCNY PPGNY GQKPY
Sbjct  151  TCNYSPPGNYIGQKPY  166



>ref|XP_008455065.1| PREDICTED: pathogenesis-related leaf protein 6-like [Cucumis 
melo]
Length=163

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++  HN AR  V    + WN TLA YA++YA  R  DC L HS GPYGEN+A   +  
Sbjct  32   QDYINGHNSARSTVKVGNIVWNATLAAYAQTYANSRKGDCQLIHSNGPYGENLAKGNNGF  91

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            S  A+VKLW+DEKPYY+++ NAC   ECLHYTQVVW  +  +GCAR  C  GW F++CNY
Sbjct  92   SGAAAVKLWVDEKPYYSYSNNACNGGECLHYTQVVWKTSYRVGCARVQCNDGWWFISCNY  151

Query  494  YPPGNYAGQKPY  529
             PPGN+ G+ PY
Sbjct  152  DPPGNWDGEWPY  163



>gb|AHA43767.1| pathogenesis related protein 1 isoform 4 [Morus alba var. multicaulis]
 gb|AHW81905.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 103/168 (61%), Gaps = 9/168 (5%)
 Frame = +2

Query  35   FSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAE  214
             S + + + I I+GL  I       +  D      FL  HN+AR  VG  P+ W+ ++A 
Sbjct  3    LSRISLALVICILGLGVIELCYAQTTPQD------FLDPHNRARAKVGVGPMTWDDSVAA  56

Query  215  YAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQE  394
            YA +YA +R  DC L HSGGPYGENIA +  +LSA  +V +W+ EK  Y++ +N CV Q 
Sbjct  57   YARNYANQRQGDCKLVHSGGPYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNTCVGQN  116

Query  395  ---CLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
               CLHYTQVVW  +T +GCA+  C +G  FV CNY PPGNY GQ+PY
Sbjct  117  PMGCLHYTQVVWRKSTRLGCAKVRCNSGGSFVICNYNPPGNYIGQRPY  164



>ref|XP_008796972.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSE  310
            + F++AHN AR AVG   + W+ T+A YA++YA +R  DC L+HSGGPYGEN+   +G++
Sbjct  29   QDFVSAHNAARAAVGVGSVSWDDTVAAYAQNYANQRIGDCQLKHSGGPYGENLFWGSGAD  88

Query  311  LSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
             +A  +VK W+DEK +Y++NTN C S  +C HYTQVVW ++T IGCAR  C +G +F+ C
Sbjct  89   FTAADAVKSWVDEKQWYDYNTNTCASGHQCGHYTQVVWRDSTNIGCARVKCNSGAIFIIC  148

Query  488  NYYPPGNYAGQKPY  529
            NY PPGN  GQ+PY
Sbjct  149  NYKPPGNIVGQRPY  162



>gb|KCW44084.1| hypothetical protein EUGRSUZ_L02505 [Eucalyptus grandis]
Length=161

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 107/161 (66%), Gaps = 5/161 (3%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGES-ACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYA  232
            V ++II L A++ A    S A DS   + ++AAHN AR  VG   + W+  +A YA  YA
Sbjct  3    VPLHIIFLVALALALIPLSIAQDSP--QDYVAAHNAARSQVGVGRITWDERVAGYARDYA  60

Query  233  TKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS-QECLHY  406
             K A DC  L HSGGPYGEN+A A  +L+   +V +W+ EKPYYN+N+N+C S + C HY
Sbjct  61   KKHARDCTRLVHSGGPYGENLAWASPDLTGTRAVNMWVGEKPYYNYNSNSCASGKVCGHY  120

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQVVW N+  +GCA+A C TG   VTCNY PPGNY GQKPY
Sbjct  121  TQVVWRNSVRLGCAKAKCATGGTLVTCNYDPPGNYVGQKPY  161



>ref|XP_009788194.1| PREDICTED: pathogenesis-related leaf protein 4-like [Nicotiana 
sylvestris]
Length=161

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 92/136 (68%), Gaps = 5/136 (4%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSP--PLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGS  307
            +  +  HNKAR  VG P  PLKWN TLA YA  YAT   A+C L HS GPYGEN+AM   
Sbjct  27   KDIVIVHNKARAEVGVPLPPLKWNDTLASYAHDYATTELAECKLVHSDGPYGENLAMGYG  86

Query  308  ELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTG--WMFV  481
            E SA  +V LW+ EKP Y + TN+C S  C HYTQVVW NT  +GCAR  C+ G  W FV
Sbjct  87   EFSAVDAVNLWVGEKPNYEYATNSCKSGMCGHYTQVVWRNTLQVGCARLKCQNGEAW-FV  145

Query  482  TCNYYPPGNYAGQKPY  529
            +CNYYPPGNY G++PY
Sbjct  146  SCNYYPPGNYIGERPY  161



>ref|XP_007159202.1| hypothetical protein PHAVU_002G217800g [Phaseolus vulgaris]
 gb|ESW31196.1| hypothetical protein PHAVU_002G217800g [Phaseolus vulgaris]
Length=157

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 100/162 (62%), Gaps = 5/162 (3%)
 Frame = +2

Query  44   LQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAE  223
            +++   + I+ + ++    F ++       + +L  HN+AR+ VG+ PL WN TL EYA+
Sbjct  1    MKISNLVFILSIISLCSICFAQNT-----PKDYLDVHNEARKEVGAKPLTWNETLVEYAQ  55

Query  224  SYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLH  403
            +Y   +  +C  EHS GPYGEN+A +  +L+   SVKLW++EK +Y++  N CV  EC+H
Sbjct  56   NYVDSKKKNCEFEHSMGPYGENLAQSSGDLTGVNSVKLWLEEKEFYDYKNNKCVKDECMH  115

Query  404  YTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            Y Q VW  T ++GCAR  C   WM+V C+YYP GN  G  PY
Sbjct  116  YVQCVWNTTESVGCARTKCDNNWMYVICSYYPAGNIVGLLPY  157



>emb|CDY22960.1| BnaC03g41090D [Brassica napus]
Length=168

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = +2

Query  140  FLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSA  319
            FL AHN+AR  VG  PL W+  +A YA SYA +R +DC + HS GP+GENIA +  ++SA
Sbjct  36   FLEAHNEARHEVGVEPLVWSDEVAAYASSYANQRVSDCAMVHSNGPFGENIAWSSGDMSA  95

Query  320  EASVKLWMDEKPYYNHNTNACVSQE---CLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            E + ++W+DEK YY++++N C       CLHYTQVVW N+  +GCA+  C +G  F+TCN
Sbjct  96   EDASEMWIDEKKYYDYDSNTCNDPNGGTCLHYTQVVWRNSIRLGCAKVVCNSGGTFITCN  155

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY G+KPY
Sbjct  156  YDPPGNYNGEKPY  168



>emb|CDX82282.1| BnaA03g35390D [Brassica napus]
Length=168

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = +2

Query  140  FLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSA  319
            FL AHN+AR  VG  PL W+  +A YA SYA +R +DC + HS GP+GENIA +  ++SA
Sbjct  36   FLEAHNEARHEVGVEPLVWSDEVAAYASSYANQRVSDCAMVHSNGPFGENIAWSSVDMSA  95

Query  320  EASVKLWMDEKPYYNHNTNACVSQE---CLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            E + ++W+DEK YY++++N C       CLHYTQVVW N+  +GCA+  C +G  F+TCN
Sbjct  96   EDASEMWIDEKKYYDYDSNTCNDPNGGTCLHYTQVVWRNSLRLGCAKVVCNSGGTFITCN  155

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY G+KPY
Sbjct  156  YDPPGNYNGEKPY  168



>ref|XP_010943469.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENI-AMAGSE  310
            E F++ HN AR AVG  P+ WN ++A YA+ YA +R  DC L HS G YGEN+   +G++
Sbjct  29   EDFVSPHNSARAAVGVGPVSWNDSVAVYAQDYANQRTGDCQLVHSNGSYGENLFGGSGAD  88

Query  311  LSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
             +A  +V LW+ EK Y+++N+N C   Q C HYTQVVW ++T+IGCAR  C  G +F+TC
Sbjct  89   YTAADAVNLWVSEKQYHDYNSNTCADGQMCGHYTQVVWRDSTSIGCARVVCDNGGIFITC  148

Query  488  NYYPPGNYAGQKPY  529
            NYYPPGN+ GQ+PY
Sbjct  149  NYYPPGNFVGQRPY  162



>ref|XP_009135645.1| PREDICTED: pathogenesis-related protein 1 [Brassica rapa]
Length=168

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = +2

Query  140  FLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSA  319
            FL AHN+AR  VG  PL W+  +A YA SYA +R +DC + HS GP+GENIA +  ++SA
Sbjct  36   FLEAHNEARHEVGVEPLVWDEEVAGYASSYANQRVSDCAMVHSNGPFGENIAWSSGDMSA  95

Query  320  EASVKLWMDEKPYYNHNTNACVSQE---CLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            E + ++W+DEK YY++++N C       CLHYTQVVW N+  +GCA+  C +G  F+TCN
Sbjct  96   EDASEMWIDEKKYYDYDSNTCNDPNGGTCLHYTQVVWRNSLRLGCAKVVCNSGGTFITCN  155

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY G+KPY
Sbjct  156  YDPPGNYNGEKPY  168



>ref|XP_010507919.1| PREDICTED: pathogenesis-related protein 1A-like [Camelina sativa]
Length=161

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 104/161 (65%), Gaps = 6/161 (4%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            +  NI+ L AIS   +G  A D    + FL   N+AR AVG  PL W+  +A YA SYA 
Sbjct  4    LKTNILLLFAIS-LFYGSLADD--LRQEFLEPQNEARNAVGLDPLVWDDEVAAYAASYAN  60

Query  236  KRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQE---CLHY  406
            +R +DC L HS GP+GENIAM+  E+SAE +  +W++EK YY++++N C       CLHY
Sbjct  61   QRISDCALIHSNGPFGENIAMSSGEMSAEDAAGMWINEKQYYDYSSNTCNDPNGGTCLHY  120

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQVVW NT  +GCA+  C  G  F+TCNY PPGNY G+ PY
Sbjct  121  TQVVWRNTVRLGCAKVVCNGGGTFITCNYDPPGNYNGETPY  161



>ref|XP_004485656.1| PREDICTED: pathogenesis-related protein 1B-like [Cicer arietinum]
Length=160

 Score =   159 bits (401),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 107/171 (63%), Gaps = 14/171 (8%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            M  FS + V   I I+G  A +Q S  +          ++ AHN AR  VG P + W+ T
Sbjct  1    MSSFSLMCVLGLIFIMGHTAHAQDSPTD----------YVNAHNAARSEVGVPNIVWDNT  50

Query  206  LAEYAESYATKRAADCLLEHSGGP---YGENIAMAGSELSAEASVKLWMDEKPYYNHNTN  376
            +A +A+SYA +R  DC L HS G    YGENIA++  ++S   +V LW+DEK  Y++N+N
Sbjct  51   VASFAQSYANQRK-DCQLMHSDGNHGGYGENIALSSGDMSGTEAVSLWVDEKANYDYNSN  109

Query  377  ACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +CV  ECLHYTQVVW ++  +GCA+  C  G  F+TCNY PPGNY GQKPY
Sbjct  110  SCVGGECLHYTQVVWRDSHRVGCAKVKCDNGGTFITCNYSPPGNYIGQKPY  160



>dbj|BAO09561.1| pathogenesis-related protein 1, partial [Morus alba]
Length=164

 Score =   159 bits (401),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 93/135 (69%), Gaps = 3/135 (2%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FLA HN+AR  VG  P+ W+ ++A YA +YA +R  DC L HSGGPYGENIA +  +L
Sbjct  23   QDFLAPHNRARAEVGVGPMTWDDSVAAYARNYANQRQGDCKLVHSGGPYGENIAWSSGDL  82

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQE---CLHYTQVVWGNTTTIGCARATCKTGWMFVT  484
            SA  +V +W+ EK  Y++ +N CV Q    CLHYTQVVW  +T +GCA+  C +G  FV 
Sbjct  83   SAAGAVGMWVAEKSLYDYYSNTCVGQNPMGCLHYTQVVWRKSTRLGCAKVRCNSGGSFVI  142

Query  485  CNYYPPGNYAGQKPY  529
            CNY PPGNY GQ+PY
Sbjct  143  CNYNPPGNYIGQRPY  157



>emb|CBI25093.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   158 bits (400),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 111/172 (65%), Gaps = 13/172 (8%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG   FL   +AI I G +A++  S  +S+      + ++ AHN AR  VG  P+ WN T
Sbjct  1    MGFHKFL---LAIYIFG-SALAHFSLAQSS-----PQDYVDAHNAARAQVGVQPITWNET  51

Query  206  LAEYAESYATKRAAD-CLLEHSGGPYGENIAMA-GS--ELSAEASVKLWMDEKPYYNHNT  373
            +A YA  YA+ R A+ C +EHSGGPYGEN+A   GS   L+   +V LW+ EKP Y++N+
Sbjct  52   VAAYARRYASSRVAEQCSMEHSGGPYGENLAEGYGSIGSLTGTDAVNLWVGEKPNYDYNS  111

Query  374  NACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            N+CV  +C HYTQVVW N+  +GCAR  C  G  FVTCNY PPGNY GQ+PY
Sbjct  112  NSCVGGKCGHYTQVVWRNSVRLGCARVQCNNGGWFVTCNYDPPGNYVGQRPY  163



>ref|XP_010040969.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW44744.1| hypothetical protein EUGRSUZ_L01705 [Eucalyptus grandis]
Length=170

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 103/160 (64%), Gaps = 3/160 (2%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            V +++I L A++ A    S       + ++AAHN AR  VG  P+ W+  +A YA  YA 
Sbjct  12   VPLHVIFLVALTLALISLSVAQDS-PQDYVAAHNAARSQVGVGPITWDERVASYARDYAQ  70

Query  236  KRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQECLHYT  409
            K A DC  L HSGGPYGEN+A A  +L+   +V LW+ EKP Y++N+N+C   + C HYT
Sbjct  71   KHARDCTRLVHSGGPYGENLAWASPDLTGTRAVNLWVGEKPDYDYNSNSCAPGKVCGHYT  130

Query  410  QVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            QVVW N+  +GCA+A C TG   VTCNY PPGNY GQKPY
Sbjct  131  QVVWRNSVRVGCAKAQCATGGTLVTCNYDPPGNYRGQKPY  170



>ref|XP_010489949.1| PREDICTED: pathogenesis-related protein 1A-like [Camelina sativa]
Length=161

 Score =   158 bits (400),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 104/161 (65%), Gaps = 6/161 (4%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            +  NI+ L AIS   +G  A D    + FL   N+AR AVG  PL W+  +A YA SYA 
Sbjct  4    LKTNILLLFAISLL-YGSLAED--LKQEFLEPQNEARNAVGLDPLVWDDEVAAYAASYAN  60

Query  236  KRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQ---ECLHY  406
            +R +DC L HS GP+GENIAM+  E+SAE +  +W++EK YY++++N C       CLHY
Sbjct  61   QRISDCALVHSNGPFGENIAMSSGEMSAEDAAGMWINEKQYYDYSSNTCNDPYGGTCLHY  120

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQVVW NT  +GCA+  C  G  F+TCNY PPGNY G+ PY
Sbjct  121  TQVVWRNTVRLGCAKVVCNGGGTFITCNYDPPGNYNGETPY  161



>ref|XP_007041423.1| Basic pathogenesis-related protein 1 [Theobroma cacao]
 gb|EOX97254.1| Basic pathogenesis-related protein 1 [Theobroma cacao]
Length=216

 Score =   160 bits (404),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = +2

Query  77   LAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCL  256
            L  +   S  ES  +    E FL AHN AR AVG  P+ WN T+A YA+ YA +R  D  
Sbjct  65   LGWVQWQSGSESKIEKDTPEDFLDAHNTARAAVGVGPMTWNDTVAAYAQDYANERIGDYN  124

Query  257  LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNA-CVSQECLHYTQVVWGNTT  433
            LEHS GPYGEN+A++  +LS   +V+LW+DEK YY+++TN     + C HYTQVVW N+ 
Sbjct  125  LEHSTGPYGENLAISSGDLSGTQAVRLWVDEKVYYDYDTNTRATDRVCGHYTQVVWRNSV  184

Query  434  TIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             +GCA+  C  G  F+ CNY PPGN+ G+KPY
Sbjct  185  RLGCAKVRCSNGGTFIGCNYDPPGNFGGEKPY  216



>ref|XP_002273546.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN74267.1| hypothetical protein VITISV_000653 [Vitis vinifera]
 emb|CBI25096.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 98/156 (63%), Gaps = 5/156 (3%)
 Frame = +2

Query  62   INIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKR  241
            I  IG+ A+   S  +++      + +L  HN AR  VG  P+ W+  +A YA  YA++R
Sbjct  11   ICFIGILALVHPSHAQNS-----QQDYLDVHNAARADVGVEPMTWDDNVAAYARDYASQR  65

Query  242  AADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVW  421
            + DC + HS GPYGEN+AM   + +A  +  LW+ EK  Y++N+N+CV  EC HYTQVVW
Sbjct  66   SGDCNMVHSNGPYGENLAMGSGDFTATDAANLWVGEKSNYDYNSNSCVGGECGHYTQVVW  125

Query  422  GNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             N+ ++GCAR  C  GW FV+CNY P GN  GQ PY
Sbjct  126  RNSVSLGCARVQCNNGWWFVSCNYSPQGNIIGQHPY  161



>ref|XP_003545772.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
 gb|KHN33606.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=165

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +2

Query  140  FLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGP--YGENIAMAGSEL  313
            F+ AHN AR  VG P + W+ T+A +A++YA +R  DC L HSGG   YGEN+A +   L
Sbjct  34   FVNAHNAARSQVGVPNIVWDDTVAAFAQNYANQRKGDCKLVHSGGDGKYGENLAGSTGNL  93

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            S   +VKLW+DEK  Y++N+N CV  EC HYTQVVW N+  +GC +  C  G  F+TCNY
Sbjct  94   SGTNAVKLWVDEKSKYDYNSNTCVGGECRHYTQVVWKNSVRLGCGKVRCDNGGTFITCNY  153

Query  494  YPPGNYAGQKPY  529
             PPGNY GQ+PY
Sbjct  154  APPGNYVGQRPY  165



>ref|XP_006367104.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=182

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN+AR  VG  P+ W+  LA +A++YA +RA DC ++HSGGPYGEN+A A  +L
Sbjct  29   QDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGDCRMQHSGGPYGENLASAFPQL  88

Query  314  SAEASVKLWMDEKPYYNHNTNAC-VSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +A  +V+ W++E+ +YN+N+N C   + C HYTQVVW N+  +GCAR  C  GW F+TCN
Sbjct  89   NAAGAVQQWVNERQWYNYNSNTCQAGRVCGHYTQVVWRNSVRLGCARVRCNNGWYFITCN  148

Query  491  YYPPGNYAGQKPY  529
            Y P GN +GQ+P+
Sbjct  149  YDPRGNMSGQRPF  161



>gb|AHW81904.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 103/168 (61%), Gaps = 9/168 (5%)
 Frame = +2

Query  35   FSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAE  214
             S + + + I I+GL  I       +  D      FL  HN+AR  VG  P+ W+ ++A 
Sbjct  3    LSRISLALVICILGLGVIELCYAQTTPQD------FLDPHNRARAKVGVGPMTWDDSVAA  56

Query  215  YAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQE  394
            YA +YA +R  DC L HSGGPYGENIA +  +LSA  +V +W+ EK  Y++ +N CV + 
Sbjct  57   YARNYANQRQGDCKLVHSGGPYGENIAWSSGDLSAAGAVGMWVAEKSLYDYYSNTCVGRN  116

Query  395  ---CLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
               CLHYTQVVW  +T +GCA+  C +G  FV CNY PPGNY GQ+PY
Sbjct  117  PMGCLHYTQVVWRKSTRLGCAKVRCNSGGSFVICNYNPPGNYIGQRPY  164



>ref|XP_006306376.1| hypothetical protein CARUB_v10012281mg [Capsella rubella]
 gb|EOA39274.1| hypothetical protein CARUB_v10012281mg [Capsella rubella]
Length=162

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSE  310
            + FL AHN AR  VG P L W++ +A YA +YA  R ADC L HS G YGEN+A  + S 
Sbjct  29   QDFLNAHNTARAQVGVPNLVWDSAVATYALNYANSRKADCSLTHSNGQYGENLAKGSSST  88

Query  311  LSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
             +A ASVKLW+DEKPYY+++TN C   ++CLHYTQVVW ++T +GCAR  C   W FVTC
Sbjct  89   FTALASVKLWVDEKPYYSYSTNNCTGGKQCLHYTQVVWRDSTKLGCARVQCTNTWWFVTC  148

Query  488  NYYPPGNYAGQKPY  529
            NY  PGN+ G+ PY
Sbjct  149  NYDAPGNWIGEYPY  162



>ref|XP_010065834.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW63504.1| hypothetical protein EUGRSUZ_G01134 [Eucalyptus grandis]
Length=165

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 108/164 (66%), Gaps = 5/164 (3%)
 Frame = +2

Query  47   QVCVAINIIGLAAISQASFGES-ACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAE  223
            ++ V ++II L A++ A    S A DS   + ++AAHN AR  VG   + W+  +A YA 
Sbjct  4    RMSVPLHIIFLVALALALIPLSIAQDSP--QDYVAAHNAARSQVGVGQITWDERVAGYAR  61

Query  224  SYATKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS-QEC  397
             YA K A DC  L HS GPYGEN+A A  +L+   +V +W+ EKPYYN+N+N+C S + C
Sbjct  62   DYAQKHARDCTRLVHSAGPYGENLAWASPDLTGTRAVNMWVGEKPYYNYNSNSCASGKVC  121

Query  398  LHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             HYTQVVW N+  +GCA+A C TG   VTCNY PPGNY GQKPY
Sbjct  122  GHYTQVVWRNSVRLGCAKAKCATGGTLVTCNYDPPGNYVGQKPY  165



>gb|ADN43431.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 102/168 (61%), Gaps = 7/168 (4%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F  + + + + ++G A         + C     + ++  HN AR  VG  P+ WN T
Sbjct  1    MGLFK-ISLALLVGLMGFA------LAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  DC L HSGGPYGENIA     L+   +V +W+ EKP Y++N+N+CV
Sbjct  54   VAAYAQNYANQRIGDCNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCV  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              EC HYTQVV  N+  +GCAR  C  G  FVTCNY P GNY GQ+PY
Sbjct  114  GGECGHYTQVVRRNSVRLGCARVQCDNGGWFVTCNYDPLGNYVGQRPY  161



>ref|XP_011030276.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Populus euphratica]
Length=161

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 100/154 (65%), Gaps = 5/154 (3%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAA  247
            +I LA I   S  +++      + +L AHN AR  V    + W+  +A YA +Y  + A 
Sbjct  13   LISLAIIIPLSLAQNS-----PQDYLNAHNNARAQVRVGNIVWDNNVAAYASNYIKRLAG  67

Query  248  DCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGN  427
            DC L HSGGPYGEN+A +  +L+  A+VKLW++EKP Y++N+N+CV  EC HYTQVVW N
Sbjct  68   DCRLVHSGGPYGENLAGSSGDLTGSAAVKLWVNEKPKYDYNSNSCVGGECRHYTQVVWRN  127

Query  428  TTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  +GCA+A C  G   ++CNY PPGNY  Q+PY
Sbjct  128  SVRLGCAKARCSNGGTVISCNYAPPGNYVNQRPY  161



>emb|CDY68267.1| BnaA06g37750D [Brassica napus]
Length=165

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 107/174 (61%), Gaps = 15/174 (9%)
 Frame = +2

Query  26   MGEFSFLQV-CVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNT  202
            M  F+   V  VAI+++ +A+  Q++  +          F+  HN AR  VG P L W+ 
Sbjct  1    MNTFTATSVLIVAISVLLIASSVQSTEQQD---------FINTHNAARSQVGVPNLVWDA  51

Query  203  TLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSELSAEASVKLWMDEKPYYNHNTNA  379
            T+A YA +YA  R +DC L HS GPYGEN+A  + S  SA ++V LW+ EKPYYN+ TN+
Sbjct  52   TVASYALNYANARKSDCNLVHSTGPYGENLAKGSSSTFSAISAVNLWVAEKPYYNYTTNS  111

Query  380  CVS----QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            C      Q+CLHYTQVVW  +  +GCAR  C  GW FVTCNY  PGNY G+ PY
Sbjct  112  CTGIYCGQQCLHYTQVVWRESVKLGCARVQCTNGWWFVTCNYDTPGNYIGEYPY  165



>ref|XP_010245650.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=163

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            E +L AHN  R  VG  PL W++ +A YA +YA++R  DC LEHS GPYGENIA  G   
Sbjct  32   EDYLHAHNIVRSEVGVGPLTWDSKVAAYAHNYASQRIGDCKLEHSDGPYGENIAGGGDPF  91

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
                +VK+W  EK YY++ +N+C+  EC HYTQVVW N+  +GCA+  C  G +F+ CNY
Sbjct  92   PGVDAVKMWASEKQYYDYASNSCIGGECGHYTQVVWRNSVRLGCAKVHCNNGGIFIICNY  151

Query  494  YPPGNYAGQKPY  529
             PPGNY G++PY
Sbjct  152  DPPGNYIGERPY  163



>ref|XP_002522070.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40270.1| STS14 protein precursor, putative [Ricinus communis]
Length=162

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 103/155 (66%), Gaps = 7/155 (5%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAA  247
            II +A I    F   A D+   + +L AHN AR  VG  PL W+  +A YA+ +A +  +
Sbjct  13   IISIALI----FSSHAQDTQ--QDYLNAHNSARGDVGLGPLTWDDKVASYAQHHANQHKS  66

Query  248  DCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWG  424
            DC L HS GPYGEN+A +  +LS   +VK+W+DEKPYY++N+N+C S Q C HYTQVVW 
Sbjct  67   DCSLVHSEGPYGENLAWSSGDLSGTDAVKMWIDEKPYYDYNSNSCASGQICGHYTQVVWR  126

Query  425  NTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            ++  +GCA+ +C  G  F+ CNY PPGNY GQ+PY
Sbjct  127  SSVRLGCAKVSCNNGGTFIGCNYDPPGNYIGQRPY  161



>ref|XP_010530686.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=157

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN+AR  VG  P++W+ T+A YA  YA +R  DC L HS GPYGENIA  G +L
Sbjct  25   QDYVDAHNQARAEVGVGPIEWDETVAAYARDYANQRRGDCSLTHSSGPYGENIAWGGGDL  84

Query  314  SAEASVKLWMDEKPYYNHNTNAC-VSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S  A+VK+W+DEK  Y++NTN C   ++C HYTQ+VW ++  +GCA+ TC  G  F+TCN
Sbjct  85   SGTAAVKMWVDEKADYDYNTNTCRAGKQCGHYTQIVWRDSVRLGCAKVTCDDGGTFITCN  144

Query  491  YYPPGNYAGQKPY  529
            Y P GN+ GQ PY
Sbjct  145  YDPRGNFIGQWPY  157



>ref|XP_006299640.1| hypothetical protein CARUB_v10015827mg [Capsella rubella]
 gb|EOA32538.1| hypothetical protein CARUB_v10015827mg [Capsella rubella]
Length=162

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 108/161 (67%), Gaps = 5/161 (3%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            +  NI+ L AIS   +G  A D    + FL  HN+AR+ VG  PL W+  +A YA SYA+
Sbjct  4    LKTNILLLVAISLVCYGSLAEDLK--QEFLEPHNEARQEVGLDPLVWDDEVAAYAASYAS  61

Query  236  KRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQE---CLHY  406
            +R +DC L HS GP+GENIAM+  E+SAE + ++W++EK YY+++TN C       CLHY
Sbjct  62   QRISDCALVHSNGPFGENIAMSSGEMSAEDAAEMWINEKQYYDYSTNTCNDPNGGTCLHY  121

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQVVW NT  +GCA+  C +G  F+TCNY PPGNY G+ PY
Sbjct  122  TQVVWKNTVRLGCAKVVCNSGGTFITCNYDPPGNYNGETPY  162



>ref|XP_006367095.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=182

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN+AR  VG  P+ W+  LA +A++YA +RA DC ++HSGGPYGEN+A A  +L
Sbjct  29   QDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGDCRMQHSGGPYGENLASAFPQL  88

Query  314  SAEASVKLWMDEKPYYNHNTNAC-VSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +A  +V+ W++E+ +YN+N+N C   + C HYTQVVW N   +GCAR  C  GW F+TCN
Sbjct  89   NAAGAVQQWVNERQWYNYNSNTCQAGRVCGHYTQVVWRNAVRLGCARVRCNNGWYFITCN  148

Query  491  YYPPGNYAGQKPY  529
            Y P GN +GQ+P+
Sbjct  149  YDPRGNMSGQRPF  161



>ref|XP_006368158.1| PREDICTED: pathogenesis-related protein 1A-like, partial [Solanum 
tuberosum]
Length=139

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 3/130 (2%)
 Frame = +2

Query  140  FLAAHNKAREAV-GSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSEL  313
            +L  HN AR  V G   + WNTTL  YA++YA +R +DC L HS GPYGENIA  +GS +
Sbjct  10   YLNTHNSARSQVTGVSAITWNTTLENYAQTYANQRISDCNLVHSNGPYGENIAKGSGSFM  69

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +  A+V LW+ EKPYY++N+N+C   +EC HYTQVVW N+  +GCAR  C  GW FVTCN
Sbjct  70   TGTAAVNLWVGEKPYYDYNSNSCTGGKECRHYTQVVWKNSIQLGCARVQCTNGWWFVTCN  129

Query  491  YYPPGNYAGQ  520
            Y PPGNY GQ
Sbjct  130  YNPPGNYIGQ  139



>ref|XP_003608310.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
Length=908

 Score =   169 bits (427),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 72/134 (54%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGS-E  310
            + F+ AHN AR  VG   + W+ T+A YA +YA  R +DC L HS GPYGEN+A   S  
Sbjct  31   QDFVDAHNTARAQVGVANITWDNTVATYALNYANSRKSDCNLVHSNGPYGENLAKGSSGT  90

Query  311  LSAEASVKLWMDEKPYYNHNTNACVSQ-ECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
             +   +V +W++EK YY++NTN+C++  +CLHYTQVVW N+  +GCAR  C  GW FVTC
Sbjct  91   FTGVTAVNMWVNEKQYYDYNTNSCINGGQCLHYTQVVWRNSVRLGCARVQCTNGWWFVTC  150

Query  488  NYYPPGNYAGQKPY  529
            NY PPGNY GQKPY
Sbjct  151  NYDPPGNYVGQKPY  164



>ref|XP_010530683.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=157

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + F+ AHN+AR AVG  P++W+ T+A YA  YA +R  DC L HS GPYGENIA +  ++
Sbjct  25   QDFVDAHNRARAAVGVGPIRWDETVAAYARDYANRRRGDCRLVHSSGPYGENIAWSSGDM  84

Query  314  SAEASVKLWMDEKPYYNHNTNAC-VSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S  ++V++W++EK  YN+NTN C   + C HYTQVVW  +  +GCA+  C  G  F+TCN
Sbjct  85   SGVSAVQMWVNEKADYNYNTNTCRAGKVCGHYTQVVWRKSVRLGCAKVRCNNGGTFITCN  144

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ G++PY
Sbjct  145  YDPPGNFNGERPY  157



>ref|XP_010052996.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW77202.1| hypothetical protein EUGRSUZ_D01552 [Eucalyptus grandis]
Length=165

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 110/164 (67%), Gaps = 5/164 (3%)
 Frame = +2

Query  47   QVCVAINIIGLAAISQASFGES-ACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAE  223
            ++ + +++I + A++ A    S A DS   + ++AAHN AR  VG  P+ W+ T+A YA 
Sbjct  4    RMTIPLHLIFIVALTLALIPLSIAQDSP--QDYVAAHNAARSQVGVGPMAWDETVAGYAR  61

Query  224  SYATKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQEC  397
             YA K A+DC  L HSGGPYGEN+A A  +L+   +V +W+ EKP Y++N+N+C   + C
Sbjct  62   DYANKHASDCTQLVHSGGPYGENLAWASPDLTGTVAVNMWVGEKPDYDYNSNSCAPGKVC  121

Query  398  LHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             HYTQVVW N+  +GCA+A C TG   VTCNY PPGN+ GQKPY
Sbjct  122  GHYTQVVWRNSVQLGCAKAQCATGGTLVTCNYDPPGNFVGQKPY  165



>gb|KFK30004.1| hypothetical protein AALP_AA7G205200 [Arabis alpina]
Length=163

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + F+AAHN+AR  VG  PL+W+ T+A YA +YA +R  DC L+HS GPYGEN+A +   +
Sbjct  31   QDFVAAHNRARAEVGVGPLRWDETVAAYARNYANQRKGDCALQHSSGPYGENLAWSSGSM  90

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S  A+VK+W+DE+  Y++++N C   + C HYTQVVW NT  +GCA+  C  G  F+TCN
Sbjct  91   SGVAAVKMWVDEQADYDYDSNTCAWDKICGHYTQVVWRNTERVGCAKVRCNNGQTFITCN  150

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ G+ PY
Sbjct  151  YDPPGNWVGEWPY  163



>emb|CDO97328.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 107/168 (64%), Gaps = 2/168 (1%)
 Frame = +2

Query  32   EFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLA  211
            +F  L +         A  S A+    A      + F+AAHNK R ++G P +KWN T+A
Sbjct  370  DFHILDITHMSEYRADAHPSTAALFSLAVAQNSPQAFVAAHNKVRASLGLPLVKWNATVA  429

Query  212  EYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQ  391
             YA  YA  R+ADC LEHS G YGEN+A A  +L+A  +VK+W DEK +Y + +N+C   
Sbjct  430  AYAGHYAAVRSADCNLEHSQGDYGENLAKASWDLTAAEAVKMWADEKKFYQYRSNSCAEG  489

Query  392  E-CLHYTQVVWGNTTTIGCARATCK-TGWMFVTCNYYPPGNYAGQKPY  529
            E C HYTQVVW +++ IGCA A C+  GW FVTCNYYPPGNY G++PY
Sbjct  490  EMCGHYTQVVWRDSSNIGCAAARCRNNGWTFVTCNYYPPGNYIGERPY  537



>ref|XP_010065838.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
Length=165

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 110/164 (67%), Gaps = 5/164 (3%)
 Frame = +2

Query  47   QVCVAINIIGLAAISQASFGES-ACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAE  223
            ++ + +++I + A++ A    S A DS   + ++AAHN AR  VG  P+ W+ T+A YA 
Sbjct  4    RMTIPLHLIFIVALTLALIPLSIAQDSP--QDYVAAHNAARSQVGVGPMAWDETVAGYAR  61

Query  224  SYATKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQEC  397
             YA K A+DC  L HSGGPYGEN+A A  +L+   +V +W+ EKP Y++N+N+C   + C
Sbjct  62   DYANKHASDCTQLVHSGGPYGENLAWASPDLTGTGAVNMWVGEKPDYDYNSNSCAPGKVC  121

Query  398  LHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             HYTQVVW N+  +GCA+A C TG   VTCNY PPGN+ GQKPY
Sbjct  122  GHYTQVVWRNSVRLGCAKAQCATGGTLVTCNYDPPGNFVGQKPY  165



>ref|XP_008798894.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Phoenix 
dactylifera]
Length=162

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMA-GSE  310
            E F++AHN AR AV   P+ W++T+A YA++YA +R  DC L HSGGPYGEN+    G+E
Sbjct  29   EDFVSAHNAARAAVNVGPVSWDSTVAAYAQNYANQRIGDCKLVHSGGPYGENLVGGPGAE  88

Query  311  LSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
            ++A  +VKLW+ EK +YN+N+N C + + C HYTQVVW  +T+IGCAR  C  G +F+TC
Sbjct  89   VTAADAVKLWVGEKQWYNYNSNTCAAGKVCGHYTQVVWRASTSIGCARVKCSGGGIFITC  148

Query  488  NYYPPGNYAGQKPY  529
            NY P GN  GQ+PY
Sbjct  149  NYKPAGNIVGQRPY  162



>ref|XP_009378591.1| PREDICTED: pathogenesis-related leaf protein 4-like [Pyrus x 
bretschneideri]
Length=161

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR  VG  PL W+T L  YA+ YA  R  DC L HSGGPYGENIA +G +L
Sbjct  29   QDYLNAHNAARAQVGVAPLSWDTNLVNYAQRYANSRIGDCNLVHSGGPYGENIASSGGDL  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S  A+V L++ EK  YN+ +N C + + C HYTQVVW ++T +GCA+  C  G  F+ CN
Sbjct  89   SGTAAVNLFVSEKANYNYYSNTCAAGKMCGHYTQVVWRSSTRLGCAKVRCNNGGTFIGCN  148

Query  491  YYPPGNYAGQKPY  529
            Y PPGNYAGQKPY
Sbjct  149  YDPPGNYAGQKPY  161



>ref|XP_002270128.1| PREDICTED: pathogenesis-related leaf protein 4 [Vitis vinifera]
 emb|CAN61902.1| hypothetical protein VITISV_012766 [Vitis vinifera]
Length=167

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 93/135 (69%), Gaps = 3/135 (2%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKR-AADCLLEHSGGPYGENIAMAG-S  307
            + +L AHN AR  VG  P+ W+  LA YA  Y +++   DC LEHSGGPYGEN+A  G +
Sbjct  27   QDYLTAHNAARAEVGVQPMTWDKKLANYASQYVSEKLIGDCNLEHSGGPYGENLAARGAT  86

Query  308  ELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTG-WMFVT  484
            +     +VK+W+ EKPYYN+++N+CV  EC HYTQVVW  +  +GCAR  CK G W  V+
Sbjct  87   DFDGADAVKMWVSEKPYYNYDSNSCVGGECGHYTQVVWNTSVNVGCARVLCKNGEWWIVS  146

Query  485  CNYYPPGNYAGQKPY  529
            CNY PPGNY G++PY
Sbjct  147  CNYDPPGNYFGERPY  161



>ref|XP_011030266.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Populus euphratica]
Length=161

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAA  247
            +I LA I   S  +++      + +L AHN AR  V    + W+  +A YA +Y  +   
Sbjct  13   LISLAIIIPLSLAQNS-----PQDYLNAHNNARAQVRVGNIVWDNNVAAYASNYIKRLTG  67

Query  248  DCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGN  427
            DC L HSGGPYGEN+A +  +L+  A+VKLW++EKP Y++N+N+CV  EC HYTQVVW N
Sbjct  68   DCRLVHSGGPYGENLAGSSGDLTGSAAVKLWVNEKPKYDYNSNSCVGGECRHYTQVVWRN  127

Query  428  TTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  +GCA+A C  G   ++CNY PPGNY  Q+PY
Sbjct  128  SVRLGCAKARCSNGGTVISCNYAPPGNYVNQRPY  161



>emb|CDY69373.1| BnaCnng63210D [Brassica napus]
Length=162

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 90/134 (67%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSE  310
            + F+  HN AR  VG P L W+  +A YA +YA  R +DC L HS GPYGEN+A  + S 
Sbjct  29   QDFINTHNAARSQVGVPNLVWDAAVASYALNYANARKSDCNLVHSTGPYGENLAKGSSST  88

Query  311  LSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
             SA ++V LW+ EKPYYN+ TN+C   Q+CLHYTQVVW  +  +GCAR  C  GW FVTC
Sbjct  89   FSAISAVNLWVAEKPYYNYTTNSCTGGQQCLHYTQVVWRESVKLGCARVQCTNGWWFVTC  148

Query  488  NYYPPGNYAGQKPY  529
            NY  PGNY G+ PY
Sbjct  149  NYDTPGNYIGEYPY  162



>ref|XP_010065842.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
Length=165

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = +2

Query  47   QVCVAINIIGLAAISQASFGES-ACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAE  223
            ++ + +++I L A++ A    S A DS   + ++AAHN AR  VG  P+ W+ T+A YA 
Sbjct  4    RMTIPLHLIFLVALTLALIPLSIAQDSP--QDYVAAHNAARSQVGVGPMAWDETVAGYAR  61

Query  224  SYATKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQEC  397
             YA K A+DC  L HSGGPYGEN+A A  +L+   +V +W+ EKP Y++N+N+C   + C
Sbjct  62   DYANKHASDCTQLVHSGGPYGENLAWASPDLTGTGAVNMWVGEKPDYDYNSNSCAPGKVC  121

Query  398  LHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             HYTQVVW N+  +GCA+A C TG   VTCNY PPGN  GQKPY
Sbjct  122  GHYTQVVWRNSVRLGCAKAQCATGGTLVTCNYDPPGNVVGQKPY  165



>emb|CDY49367.1| BnaA03g50560D [Brassica napus]
Length=163

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL AHN+AR AVG  PL W+ T+A YA+ YA +R  DC LEHS GPYGENIA +  ++
Sbjct  31   QDFLDAHNQARAAVGVDPLAWDETVAAYAQDYANQRRGDCALEHSSGPYGENIAWSSGDM  90

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +V +W++E+  Y++ +N C S ++C HYTQ+VW NT  +GCA+ +C  G  F+TCN
Sbjct  91   SGVEAVNMWVNEQADYDYGSNTCASGKQCGHYTQIVWKNTVRLGCAKVSCDNGQTFITCN  150

Query  491  YYPPGNYAGQKPY  529
            Y P GN+ GQ PY
Sbjct  151  YDPQGNFVGQWPY  163



>gb|KCW63509.1| hypothetical protein EUGRSUZ_G01140 [Eucalyptus grandis]
Length=161

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 108/161 (67%), Gaps = 5/161 (3%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGES-ACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYA  232
            + +++I + A++ A    S A DS   + ++AAHN AR  VG  P+ W+ T+A YA  YA
Sbjct  3    IPLHLIFIVALTLALIPLSIAQDSP--QDYVAAHNAARSQVGVGPMAWDETVAGYARDYA  60

Query  233  TKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQECLHY  406
             K A+DC  L HSGGPYGEN+A A  +L+   +V +W+ EKP Y++N+N+C   + C HY
Sbjct  61   NKHASDCTQLVHSGGPYGENLAWASPDLTGTGAVNMWVGEKPDYDYNSNSCAPGKVCGHY  120

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQVVW N+  +GCA+A C TG   VTCNY PPGN+ GQKPY
Sbjct  121  TQVVWRNSVRLGCAKAQCATGGTLVTCNYDPPGNFVGQKPY  161



>ref|XP_003593363.1| Pathogenesis-related protein 1B [Medicago truncatula]
 gb|AES63614.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=165

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 111/173 (64%), Gaps = 13/173 (8%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGS----PPLK  193
            MG FS +  C    ++GL  I   S    A DS     ++ AHN+AR AV +    P + 
Sbjct  1    MGSFSLI-FC----MLGLILIVHVSHVAHAQDSPA--DYVNAHNQARSAVDTNIKIPNII  53

Query  194  WNTTLAEYAESYATKRAADCLLEHSGGP-YGENIAMAGSELSAEASVKLWMDEKPYYNHN  370
            W+  +A YA++YA +R  DC L HSGG  YGENIA +  ++S   +VKL++DEKP Y+++
Sbjct  54   WDNKVAAYAQNYANQRK-DCQLVHSGGDRYGENIAESSGDMSGIEAVKLFVDEKPNYDYS  112

Query  371  TNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +N+CV  ECLHYTQVVW NT  IGCA+  C  G  F+TCNY PPGNY G++PY
Sbjct  113  SNSCVGGECLHYTQVVWRNTKRIGCAKVKCDNGGTFITCNYDPPGNYIGERPY  165



>ref|XP_007148304.1| hypothetical protein PHAVU_006G197200g [Phaseolus vulgaris]
 gb|ESW20298.1| hypothetical protein PHAVU_006G197200g [Phaseolus vulgaris]
Length=159

 Score =   155 bits (393),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGG--PYGENIAMAGS  307
            + ++  HN AR  VG P + W+ T+A +A+ YA +R  DC L HSGG   YGEN+A +  
Sbjct  26   DDYVNEHNAARSEVGVPNIVWDNTVAAFAQDYANQRQGDCNLIHSGGGGKYGENLAGSSG  85

Query  308  ELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
            +LS E +VK+W+ EK  Y++N+N+CV  ECLHYTQVVW N+  +GCA+  C  G  F+ C
Sbjct  86   DLSGEDAVKMWVGEKSNYDYNSNSCVGGECLHYTQVVWKNSVRVGCAKVRCNNGGTFIGC  145

Query  488  NYYPPGNYAGQKPY  529
            NY PPGNY G+KPY
Sbjct  146  NYDPPGNYVGEKPY  159



>ref|XP_006393183.1| hypothetical protein EUTSA_v10011955mg [Eutrema salsugineum]
 gb|ESQ30469.1| hypothetical protein EUTSA_v10011955mg [Eutrema salsugineum]
Length=161

 Score =   155 bits (393),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSE  310
            + +L  HN AR  VG   + W+ T+A YA++YA  R +DC L HS GPYGEN+A  + S 
Sbjct  28   QDYLNTHNTARSQVGVANVVWDATVATYAQNYANARKSDCNLVHSSGPYGENLAKGSSST  87

Query  311  LSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
             S  ++V LW++EKPYYN+ TN+C   ++CLHYTQVVW ++  IGCAR  C  GW FVTC
Sbjct  88   FSGISAVNLWINEKPYYNYTTNSCTGGKQCLHYTQVVWRDSVKIGCARVQCTNGWWFVTC  147

Query  488  NYYPPGNYAGQKPY  529
            NY  PGNY G+ PY
Sbjct  148  NYDAPGNYIGEYPY  161



>gb|ADD97801.1| pathogenesis-related protein 1 [Musa ABB Group]
Length=163

 Score =   155 bits (393),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENI-AMAGSE  310
            + F++ HN AR AVG  P+ W++T+A YA++YA +R ADC L HSGGPYGENI + +G +
Sbjct  30   QDFVSPHNAARAAVGVGPVSWDSTVAAYAQNYANQRKADCQLVHSGGPYGENIFSGSGRD  89

Query  311  LSAEASVKLWMDEKPYYNHNTNACVSQE-CLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
             +A  +V  W+ EK  Y++N+N C   + C HYTQVVW ++T IGC R  C  G +F+TC
Sbjct  90   YTAADAVNAWVSEKQDYDYNSNKCAPNKVCGHYTQVVWRSSTAIGCGRVRCNNGGIFITC  149

Query  488  NYYPPGNYAGQKPY  529
            NY PPGNYAGQ+PY
Sbjct  150  NYKPPGNYAGQRPY  163



>ref|XP_010052997.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
Length=165

 Score =   155 bits (393),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = +2

Query  47   QVCVAINIIGLAAISQASFGES-ACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAE  223
            ++ + +++I L A++ A    S A DS   + ++AAHN AR  V   P+ W+ T+A YA 
Sbjct  4    RMTIPLHLIFLVALTLALIPLSIAQDSP--QDYVAAHNAARSQVNVGPMAWDETVAGYAR  61

Query  224  SYATKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQEC  397
             YA K A+DC  L HSGGPYGEN+A A  +L+   +V +W+ EKP Y++N+N+C   ++C
Sbjct  62   DYANKHASDCTQLVHSGGPYGENLAWASPDLTGTGAVNMWVGEKPDYDYNSNSCAPGKDC  121

Query  398  LHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             HYTQVVW N+  +GCA+A C TG   VTCNY PPGN  GQKPY
Sbjct  122  GHYTQVVWRNSVRLGCAKAQCTTGGTLVTCNYDPPGNVVGQKPY  165



>emb|CDY69090.1| BnaAnng29270D [Brassica napus]
Length=162

 Score =   155 bits (393),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 106/171 (62%), Gaps = 12/171 (7%)
 Frame = +2

Query  26   MGEFSFLQV-CVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNT  202
            M  F+   V  VAI+I+ +A+  Q++  +          +L  HN AR  VG P + WN 
Sbjct  1    MNTFTTTSVLIVAISILIIASSVQSTEKQD---------YLNTHNAARSQVGVPNIVWNA  51

Query  203  TLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSELSAEASVKLWMDEKPYYNHNTNA  379
            T+A YA +YA  R +DC L +S GPYGEN+A  + S  SA ++V LW+ EKPYYN++TN+
Sbjct  52   TIASYALNYANARRSDCNLVYSAGPYGENLAKGSSSTFSAISAVNLWVAEKPYYNYSTNS  111

Query  380  CVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            C   + C HYTQVVW ++  +GCAR  C  GW FV CNY  PGNY GQ PY
Sbjct  112  CTGGKHCFHYTQVVWRDSVKLGCARVQCTNGWWFVICNYDTPGNYIGQYPY  162



>gb|KCW63515.1| hypothetical protein EUGRSUZ_G01148 [Eucalyptus grandis]
Length=161

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 107/161 (66%), Gaps = 5/161 (3%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGES-ACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYA  232
            + +++I L A++ A    S A DS   + ++AAHN AR  VG  P+ W+ T+A YA  YA
Sbjct  3    IPLHLIFLVALTLALIPLSIAQDSP--QDYVAAHNAARSQVGVGPMAWDETVAGYARDYA  60

Query  233  TKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQECLHY  406
             K A+DC  L HSGGPYGEN+A A  +L+   +V +W+ EKP Y++N+N+C   + C HY
Sbjct  61   NKHASDCTQLVHSGGPYGENLAWASPDLTGTGAVNMWVGEKPDYDYNSNSCAPGKVCGHY  120

Query  407  TQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            TQVVW N+  +GCA+A C TG   VTCNY PPGN  GQKPY
Sbjct  121  TQVVWRNSVRLGCAKAQCATGGTLVTCNYDPPGNVVGQKPY  161



>ref|XP_009335379.1| PREDICTED: LOW QUALITY PROTEIN: basic form of pathogenesis-related 
protein 1 [Pyrus x bretschneideri]
Length=157

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSG--GPYGENIAMAGS  307
            + FL AHN  R  V  P + W+  +A YA++YA  R  DC L HS   G YGE +A    
Sbjct  24   QDFLNAHNAVRAQVYVPDIVWDNAVAAYAQNYANSRIGDCNLVHSNSNGTYGEKLAKGSG  83

Query  308  ELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
              +  A+V LW+ EKP Y++N+N+C  Q+CLHYTQVVW N+  +GCAR  C  GW FVTC
Sbjct  84   SFTGVAAVNLWVAEKPNYDYNSNSCXGQQCLHYTQVVWKNSVKLGCARVQCTNGWWFVTC  143

Query  488  NYYPPGNYAGQKPY  529
            NY PPGNY GQ+PY
Sbjct  144  NYSPPGNYVGQRPY  157



>ref|XP_004289700.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Fragaria vesca subsp. vesca]
Length=164

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 104/167 (62%), Gaps = 8/167 (5%)
 Frame = +2

Query  38   SFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEY  217
            S L + +   ++ +  + Q S  +++      + ++ AHN AR  VG P + W+ T+A Y
Sbjct  3    SLLTILLCFIVLTVVLLVQPSHAQNS-----PQDYVDAHNAARLRVGVPNITWDDTVAAY  57

Query  218  AESYATKRAADCLLEHSGGPYGENIAMA--GSELSAEASVKLWMDEKPYYNHNTNACVSQ  391
            A+ YA  R+ DC L HS GPYGEN+A       ++   +V LW++EKPYYNHN+N CV  
Sbjct  58   AQHYANLRSGDCSLVHSHGPYGENLAYGYGSGAITGVNAVNLWLEEKPYYNHNSNCCVGG  117

Query  392  ECLHYTQVVWGNTTTIGCARATCKT-GWMFVTCNYYPPGNYAGQKPY  529
            ECLHYTQV+W  +  +GCAR  C   G  FVTCNY PPGNY G++PY
Sbjct  118  ECLHYTQVIWHYSIRLGCARVQCSNPGCWFVTCNYDPPGNYYGKRPY  164



>ref|XP_010065832.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
Length=165

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 104/163 (64%), Gaps = 3/163 (2%)
 Frame = +2

Query  47   QVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAES  226
            ++ V +++I L A++ A    S         ++ AHN AR  VG  P+ W+  +A YA  
Sbjct  4    RMSVPLHVIFLVALTLALIFVSVAQD-LPRNYVVAHNAARSQVGVGPITWDERVASYARD  62

Query  227  YATKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQECL  400
            YA K A DC  L HSGGPYGEN+A A  +L++ ++V LW+ EKP YN+N+N+C+  + C 
Sbjct  63   YAQKHARDCTRLVHSGGPYGENLAWASPDLTSTSAVNLWIGEKPDYNYNSNSCMPGKLCG  122

Query  401  HYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            HYTQVVW N+   GCA+A C TG   V CNY PPGNY GQ+PY
Sbjct  123  HYTQVVWRNSARFGCAKAQCATGGTLVICNYDPPGNYIGQRPY  165



>dbj|BAF95881.1| putative pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR  VG  P+ W+ T+A YA++YA +R  DC L HSGGPYGEN+A     L
Sbjct  29   QDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYANQRIGDCNLVHSGGPYGENLAWGSPSL  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +V +W+ EK  Y++N+N+CV  +C HYTQVVW N+  +GCAR  C  G  FVTCNY
Sbjct  89   TGTDAVNMWVGEKSNYDYNSNSCVGGQCGHYTQVVWRNSVRLGCARIQCNKGGWFVTCNY  148

Query  494  YPPGNYAGQKPY  529
             P GNY GQ+PY
Sbjct  149  DPRGNYIGQRPY  160



>ref|XP_003529280.2| PREDICTED: pathogenesis-related protein 1A-like [Glycine max]
Length=144

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL AHN AR  VG  PL W+ T+A YA+ YA  R  +C + HS GPYGEN+  +  ++
Sbjct  12   KDFLDAHNAARAEVGVEPLAWDDTVAAYAQQYADSRIKECQVVHSQGPYGENLVASPGDV  71

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +VK+W+ EK  Y+H  N CV +QEC+HY Q+VW NT  +GCAR+ C  GW FV C+
Sbjct  72   SGTDAVKMWVAEKANYDHKANKCVNNQECMHYAQLVWSNTFLVGCARSKCDNGWTFVICS  131

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ G++PY
Sbjct  132  YDPPGNFQGEQPY  144



>gb|ABK41053.2| pathogenesis-related protein 1 [Musa acuminata]
Length=162

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = +2

Query  59   AINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATK  238
            A+ ++   A++ A  G  A +S   + F++ HN AR AVG  P+ W+ T+A YA++YA +
Sbjct  7    ALAMLSAVALAMACTGILAQNSP--QDFVSPHNAARAAVGVGPVSWDNTVAAYAQNYANQ  64

Query  239  RAADCLLEHSGGPYGENIAM-AGSELSAEASVKLWMDEKPYYNHNTNACVSQE-CLHYTQ  412
            RAADC L HSGGPYGENI   +G + +A  +V  W+ EK YY++N+N C   + C HYTQ
Sbjct  65   RAADCQLVHSGGPYGENIFWGSGRDYTAADAVNAWVSEKQYYDYNSNTCAPNKVCGHYTQ  124

Query  413  VVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKP  526
            VVW ++T IGC R  C +G +F+ CNY PPGNY GQ+P
Sbjct  125  VVWRSSTAIGCGRVRCNSGAIFIICNYKPPGNYVGQRP  162



>ref|XP_009138211.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
Length=163

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL AHN+AR AVG  PL W+ T+A YA+ YA +R  DC LEHS GPYGENIA +  ++
Sbjct  31   QDFLDAHNQARAAVGVDPLAWDETVAAYAQDYANQRRGDCALEHSSGPYGENIAWSSGDM  90

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +V +W++E+  Y++ +N C S ++C HYTQ+VW N+  +GCA+ +C  G  F+TCN
Sbjct  91   SGVEAVNMWVNEQADYDYGSNTCASGKQCGHYTQIVWKNSVRLGCAKVSCDNGQTFITCN  150

Query  491  YYPPGNYAGQKPY  529
            Y P GN+ GQ PY
Sbjct  151  YDPQGNFVGQWPY  163



>ref|XP_008382391.1| PREDICTED: pathogenesis-related protein 1A-like [Malus domestica]
Length=166

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 107/165 (65%), Gaps = 7/165 (4%)
 Frame = +2

Query  41   FLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYA  220
            FL++   + I+    +SQA   +        + F+  HNKAR  VG  P+KWN T+A YA
Sbjct  7    FLRISSIVLILSTTYVSQARPAKEPH-----QDFIDEHNKARAEVGVGPIKWNETVAAYA  61

Query  221  ESYATKRAADCLLEHSGGPYGENIAMA-GSELSAEASVKLWMDEKPYYNHNTNACVS-QE  394
            + YA  +   C + HS GPYGEN+A   GSE++   +VK W+ EKP Y++++N+C + + 
Sbjct  62   QKYADSKIETCEMVHSQGPYGENLAEGWGSEMTGGQAVKFWVTEKPDYDYDSNSCTAGKV  121

Query  395  CLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            C HYTQVVW N+T +GCARA CK G +FV C+Y PPGN+ G++PY
Sbjct  122  CGHYTQVVWRNSTRVGCARAKCKNGMIFVICSYDPPGNWIGERPY  166



>emb|CAN77102.1| hypothetical protein VITISV_021166 [Vitis vinifera]
 emb|CBI25100.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR  VG  P+ W+ T+A YA++YA +R  DC L HSGGPYGEN+A     L
Sbjct  29   QDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYANQRIGDCNLVHSGGPYGENLAWGSPSL  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +V LW+ EK  Y++N+N+CV  +C HYTQVVW  +  +GCAR  C  G  FVTCNY
Sbjct  89   TGTDAVNLWVGEKSNYDYNSNSCVGGQCGHYTQVVWSKSVRLGCARVQCNNGGWFVTCNY  148

Query  494  YPPGNYAGQKPY  529
             P GNY GQ+PY
Sbjct  149  DPRGNYIGQRPY  160



>gb|KDP36356.1| hypothetical protein JCGZ_09853 [Jatropha curcas]
Length=170

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGG-PYGENIAMAGSE  310
            + +LAAHN AR  +G  PL WNTTL +YA+ Y     A C LEHS G PYGEN+A    +
Sbjct  38   KDYLAAHNCARAELGIAPLCWNTTLVKYAKHYKKSLVASCSLEHSVGCPYGENLAQGFGK  97

Query  311  LSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
             S    VKLW+DEK +Y++ +N CV  EC HYTQV+W +T  +GCA   C  GW  ++CN
Sbjct  98   FSGVDGVKLWVDEKAHYDYQSNTCVGGECRHYTQVIWKSTKEVGCASVRCGKGWKIISCN  157

Query  491  YYPPGNYAGQKPY  529
            YYPPGNY G+KPY
Sbjct  158  YYPPGNYVGEKPY  170



>gb|KCW63502.1| hypothetical protein EUGRSUZ_G01132 [Eucalyptus grandis]
Length=161

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 102/160 (64%), Gaps = 3/160 (2%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            V +++I L A++ A    S         ++ AHN AR  VG  P+ W+  +A YA  YA 
Sbjct  3    VPLHVIFLVALTLALIFVSVAQD-LPRNYVVAHNAARSQVGVGPITWDERVASYARDYAQ  61

Query  236  KRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQECLHYT  409
            K A DC  L HSGGPYGEN+A A  +L++ ++V LW+ EKP YN+N+N+C+  + C HYT
Sbjct  62   KHARDCTRLVHSGGPYGENLAWASPDLTSTSAVNLWIGEKPDYNYNSNSCMPGKLCGHYT  121

Query  410  QVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            QVVW N+   GCA+A C TG   V CNY PPGNY GQ+PY
Sbjct  122  QVVWRNSARFGCAKAQCATGGTLVICNYDPPGNYIGQRPY  161



>gb|AFK38989.1| unknown [Medicago truncatula]
 gb|AES63608.2| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=159

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 101/169 (60%), Gaps = 11/169 (7%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            M  FS + V     IIG  A +Q S  +          ++ +HN+AR  VG   + W+  
Sbjct  1    MSSFSLICVLGLFIIIGHVAHAQNSQAD----------YVNSHNEARRQVGVANVVWDNN  50

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            LA  A++YA  R  DC L HSGG YGEN+A +  +LS   +V+LW++EK  YN+N+N C 
Sbjct  51   LATVAQNYANSRRGDCRLTHSGGRYGENLAGSTGDLSGTDAVRLWVNEKNDYNYNSNTCA  110

Query  386  S-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            S + C HYTQVVW NT  IGCA+  C  G  F+ CNY PPGNY GQKPY
Sbjct  111  SGKVCGHYTQVVWRNTKRIGCAKVRCNNGGTFIICNYDPPGNYVGQKPY  159



>gb|AGK89727.1| pathogenesis-related 1 protein [Coffea canephora]
Length=162

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 91/134 (68%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + ++ AHN AR  VG  P+ W+ T+A YA++YA +R  DC LEHS G YGEN+A  G + 
Sbjct  29   QDYVDAHNAARAQVGVGPIAWDDTVAAYAQNYANQRINDCNLEHSDGRYGENLAEGGGDF  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATC-KTGWMFVTC  487
            +   +V LW+ EK YY++N+N C   Q+C HYTQVVW N+  +GCAR  C   GW FV C
Sbjct  89   TGRDAVNLWVSEKQYYDYNSNTCAQGQQCGHYTQVVWRNSVRLGCARVQCTNNGWWFVIC  148

Query  488  NYYPPGNYAGQKPY  529
            +Y PPGNY GQ+PY
Sbjct  149  SYDPPGNYDGQRPY  162



>ref|XP_010266628.1| PREDICTED: pathogenesis-related protein 1A-like [Nelumbo nucifera]
Length=162

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 102/170 (60%), Gaps = 13/170 (8%)
 Frame = +2

Query  23   EMGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNT  202
             +G F F      I  IGL  +S+A       DS   + +L AHN AR  VG   L W+ 
Sbjct  5    RLGIFLFF----LIMGIGLVHVSRAQ------DSH--QNYLDAHNAARAEVGVDALTWDD  52

Query  203  TLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNAC  382
            T+A YA+SYA KRA DC   HSG PYGEN+A +   LSA  +V LW+ EK YY+HN+N+C
Sbjct  53   TVAAYAQSYANKRADDCTRVHSGEPYGENLAGSTGSLSATDAVNLWVGEKQYYDHNSNSC  112

Query  383  V-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  QEC HYTQVVW  +  +GCA+  C  G  FV CNY P GN  G+ PY
Sbjct  113  IGEQECRHYTQVVWRKSFRVGCAKVQCNNGGTFVICNYDPAGNVVGELPY  162



>ref|XP_002273788.2| PREDICTED: pathogenesis-related protein 1 [Vitis vinifera]
Length=197

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 0/138 (0%)
 Frame = +2

Query  116  CDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIA  295
            C     + +L AHN AR  VG  P+ W+ T+A YA++YA +R  DC L HSGGPYGEN+A
Sbjct  60   CAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYANQRIGDCNLVHSGGPYGENLA  119

Query  296  MAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWM  475
                 L+   +V LW+ EK  Y++N+N+CV  +C HYTQVVW  +  +GCAR  C  G  
Sbjct  120  WGSPSLTGTDAVNLWVGEKSNYDYNSNSCVGGQCGHYTQVVWSKSVRLGCARVQCNNGGW  179

Query  476  FVTCNYYPPGNYAGQKPY  529
            FVTCNY P GNY GQ+PY
Sbjct  180  FVTCNYDPRGNYIGQRPY  197



>ref|XP_009398310.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=163

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 101/153 (66%), Gaps = 2/153 (1%)
 Frame = +2

Query  77   LAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCL  256
            L A++ A    SA      + F++ HN AR AVG  P+ W+ T+A YA++YA +RAADC 
Sbjct  11   LFAVALAMACTSALAQNSPQDFVSPHNAARAAVGVGPVSWDNTVAAYAQNYANQRAADCQ  70

Query  257  LEHSGGPYGENIAM-AGSELSAEASVKLWMDEKPYYNHNTNACVSQE-CLHYTQVVWGNT  430
            L HSGGPYGENI   +G + +A  +V  W+ EK  Y++N+N C   + C HYTQVVW ++
Sbjct  71   LVHSGGPYGENIFWGSGRDYTAADAVNAWVSEKQDYDYNSNKCAPNKVCGHYTQVVWRSS  130

Query  431  TTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            T IGC R  C +G +F+ CNY PPGNY GQ+PY
Sbjct  131  TAIGCGRVRCNSGAIFIICNYKPPGNYVGQRPY  163



>ref|XP_011002583.1| PREDICTED: pathogenesis-related leaf protein 6-like [Populus 
euphratica]
Length=160

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 97/154 (63%), Gaps = 6/154 (4%)
 Frame = +2

Query  68   IIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAA  247
            ++GLA +  +    S  D      +L AHN AR  V    + W+ T+A YA +Y+  R +
Sbjct  13   LVGLALVHPSHAQNSPQD------YLNAHNAARSQVTVANIIWDNTVAAYALNYSNSRIS  66

Query  248  DCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGN  427
            +C L HS GPYGEN+A      +  A+V LW+ EKPYY++ +N+CV  +CLHYTQVVW N
Sbjct  67   NCNLVHSNGPYGENLAKGSGSFTGTAAVNLWVAEKPYYDNASNSCVGGQCLHYTQVVWRN  126

Query  428  TTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            +  +GCAR  C  GW FV+CNY PPGNY  ++PY
Sbjct  127  SVRVGCARVQCTNGWWFVSCNYDPPGNYIEERPY  160



>ref|XP_010437726.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=163

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +2

Query  140  FLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSA  319
            FLAAHN+AR  VG  PL+W+  +A YA +YA +R  DC +EHS G YGENIA +  +++ 
Sbjct  33   FLAAHNRARAEVGVGPLRWDEKVAAYARNYANQRKGDCAMEHSSGSYGENIAWSSGDMTG  92

Query  320  EASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYY  496
             A+V +W+DE+  Y++++N C   ++C HYTQVVW NT  +GCA+  CK G  F+TCNY 
Sbjct  93   VAAVDMWVDEQFDYDYDSNTCAWDKQCGHYTQVVWRNTEKLGCAKVRCKNGQTFITCNYD  152

Query  497  PPGNYAGQKPY  529
            PPGN+ G+ PY
Sbjct  153  PPGNWVGEWPY  163



>ref|XP_006412319.1| hypothetical protein EUTSA_v10026438mg [Eutrema salsugineum]
 gb|ESQ53772.1| hypothetical protein EUTSA_v10026438mg [Eutrema salsugineum]
Length=163

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHNKAR AVG  PL+W+  +A YA  YA +R  DC L+HS GPYGENIA +  ++
Sbjct  31   QDYLDAHNKARAAVGVGPLRWDERVAAYARDYANQRRGDCALQHSSGPYGENIAWSSGDM  90

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   ++ +W++EK  YN+ +N C S + C HYTQVVW N+  +GCA+  C  G  F+TCN
Sbjct  91   SGVQAINMWVNEKVDYNYGSNTCASGKVCGHYTQVVWRNSVRMGCAKVRCNNGQTFITCN  150

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ GQ PY
Sbjct  151  YDPPGNFIGQWPY  163



>gb|AEM36335.1| pathogenesis-related protein [Vitis quinquangularis]
Length=160

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L AHN AR  VG  P+ W+ T+A YA++YA +R  DC L HSGGPYGEN+A     L
Sbjct  29   QDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYAKQRIGDCNLVHSGGPYGENLARGSPSL  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            +   +V LW+ EK  Y+HN+N+CV  +C HYTQVVW  +  +GCAR  C  G  FVTCNY
Sbjct  89   TGTDAVNLWVGEKSNYDHNSNSCVGGQCGHYTQVVWSKSVHLGCARVQCNNGGWFVTCNY  148

Query  494  YPPGNYAGQKPY  529
             P GN  GQ PY
Sbjct  149  DPRGNIVGQSPY  160



>gb|ADN43430.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 101/168 (60%), Gaps = 7/168 (4%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            MG F  + + + + ++G A         + C     + ++  HN AR  VG  P+ WN T
Sbjct  1    MGLFK-ISLALXVGLMGFA------LAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDT  53

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            +A YA++YA +R  D  L HSGGPYGENIA     L+   +V +W+ EKP Y++N+N+CV
Sbjct  54   VAAYAQNYANQRIGDRNLVHSGGPYGENIAWGSPSLTGTDAVNMWVGEKPNYDYNSNSCV  113

Query  386  SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
              EC HYTQVV  N+  +GCAR  C  G  FVTCNY P GNY GQ+PY
Sbjct  114  GGECGHYTQVVRRNSVRLGCARVQCDNGGWFVTCNYDPLGNYVGQRPY  161



>ref|XP_003545771.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Glycine 
max]
 gb|KHN33605.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=164

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = +2

Query  140  FLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGP--YGENIAMAGSEL  313
            ++ AHN AR  VG P + W+  +A +A++YA +R  DC L HSGG   YGEN+A +   L
Sbjct  33   YVNAHNAARSQVGVPNIVWDNAVAAFAQNYANQRKGDCKLVHSGGDGKYGENLAGSTGNL  92

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            S + +V+LW++EK  YN+N+N+CV  ECLHYTQVVW N+  +GCA+  C  G  F+ CNY
Sbjct  93   SGKDAVQLWVNEKSKYNYNSNSCVGGECLHYTQVVWRNSLRLGCAKVRCNNGGTFIGCNY  152

Query  494  YPPGNYAGQKPY  529
             PPGNY GQ+PY
Sbjct  153  APPGNYIGQRPY  164



>gb|AFM76999.1| pathogenesis related protein 1a, partial [Pyrus communis]
Length=153

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            +A+ ++G   I  +   ++  D      +L +HN AR AVG  PL W+  +A YA++YA 
Sbjct  1    LAVVVLGSVLIQSSHAQDTPQD------YLNSHNTARAAVGVGPLTWDDNVAGYAQNYAN  54

Query  236  KRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQ  412
            +   DC L HSGGPYGEN+AM+  ++S  A+V LW+ EK  YN+ +N+C   + C HYTQ
Sbjct  55   QHVGDCSLVHSGGPYGENLAMSTGDMSGTAAVDLWVAEKADYNYESNSCADGKVCGHYTQ  114

Query  413  VVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            VVW N+  +GCA+  C +G  F+ CNY PPGNY G+KPY
Sbjct  115  VVWRNSARVGCAKVRCSSGGTFIGCNYDPPGNYVGEKPY  153



>ref|XP_007201285.1| hypothetical protein PRUPE_ppa012617mg [Prunus persica]
 gb|AEV57468.1| pathogensis-related protein 1a, partial [Prunus persica]
 gb|EMJ02484.1| hypothetical protein PRUPE_ppa012617mg [Prunus persica]
Length=161

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 102/169 (60%), Gaps = 11/169 (7%)
 Frame = +2

Query  26   MGEFSFLQVCVAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTT  205
            + + SF  VC    +IGLA +      +S  D      +L AHN AR  VG  PL W+  
Sbjct  3    LSKISFAFVC----LIGLALLQSTGAQDSPQD------YLNAHNAARAQVGVAPLTWDPN  52

Query  206  LAEYAESYATKRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV  385
            L  YA+ YA  RA DC L HS GPYGENIA +  +LS  A+V L++ EKP Y++N+N C 
Sbjct  53   LVAYAQRYANSRAGDCNLVHSNGPYGENIAKSTGDLSGTAAVNLFVGEKPDYDYNSNTCA  112

Query  386  S-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            + + C HYTQVVW N+  +GCA+A C  G  F+ CNY P GN  GQ+PY
Sbjct  113  AGKMCGHYTQVVWRNSVRLGCAKARCTNGGTFIGCNYDPRGNIRGQRPY  161



>ref|XP_010691525.1| PREDICTED: pathogenesis-related protein 1A-like [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 96/137 (70%), Gaps = 5/137 (4%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGG--PYGENIAM--A  301
            + ++ AHN AR AVG   ++W+  +A +A+ YA +R ADC L HSGG   YGENIA   A
Sbjct  31   QDYVNAHNAARAAVGVGNIQWDDQVAAFAQQYANQRKADCALRHSGGGGRYGENIAAGPA  90

Query  302  GSELSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMF  478
            G  L+  ++VKLW+DEK +YN+N+N C S + C HYTQVVW N+  +GCAR  C  G +F
Sbjct  91   GVFLTGASAVKLWVDEKAFYNYNSNTCASGKVCGHYTQVVWRNSNRLGCARVQCNNGGIF  150

Query  479  VTCNYYPPGNYAGQKPY  529
            VTCNY PPGNY GQKPY
Sbjct  151  VTCNYSPPGNYNGQKPY  167



>ref|NP_001234128.1| pathogenesis-related protein 1A1 precursor [Solanum lycopersicum]
 sp|Q08697.1|PR1A_SOLLC RecName: Full=Pathogenesis-related protein 1A1; Short=PR-1A1; 
Flags: Precursor [Solanum lycopersicum]
 emb|CAA50596.1| PR-1a1 [Solanum lycopersicum]
Length=175

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            E FL AHN AR  VG  P+ W+  LA YA++YA +RA DC + HS GPYGEN+A A  +L
Sbjct  26   ENFLNAHNAARRRVGVGPMTWDDGLAAYAQNYANQRADDCGMIHSDGPYGENLAAAFPQL  85

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +A  +VK+W DEK +Y++N+N C   + C HYTQVVW  +  +GCAR  C +GW+F+TCN
Sbjct  86   NAAGAVKMWDDEKQWYDYNSNTCAPGKVCGHYTQVVWRKSVRLGCARVRCNSGWVFITCN  145

Query  491  YYPPGNY  511
            Y PPGNY
Sbjct  146  YDPPGNY  152



>emb|CDY46098.1| BnaA03g52700D [Brassica napus]
Length=163

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + FL AHN+AR AVG  PL W+ T+A YA+ YA +R  DC LEHS GPYGENIA +  ++
Sbjct  31   QDFLDAHNQARAAVGVDPLAWDETVAAYAQDYANQRRGDCALEHSSGPYGENIAWSSGDM  90

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S   +V +W++E+  YN+ +N C S ++C HYTQ+VW N+ ++GCA+ +C  G  F+TCN
Sbjct  91   SGVEAVNMWVNEQADYNYGSNTCASGKQCGHYTQIVWKNSVSLGCAKVSCDNGQTFITCN  150

Query  491  YYPPGNYAGQKPY  529
            Y P GN  G+ PY
Sbjct  151  YDPQGNIVGEWPY  163



>gb|EPS71111.1| hypothetical protein M569_03651, partial [Genlisea aurea]
Length=161

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
              F+ AHN+ R  +G PPL W+  LA YA +YA + A DC ++HSGGPYGEN+A    +L
Sbjct  29   RAFVGAHNEVRAFLGEPPLVWSPILAAYARNYANQSAGDCAMKHSGGPYGENLASGSWDL  88

Query  314  SAEASVKLWMDEKPYYNHNTNACV-SQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            +A+ +V LW++EK  +  N  AC+ S ECLHYTQVVW +T  +GC RA C  GW FV C+
Sbjct  89   TAKEAVGLWLEEKVGFLTNPKACMDSGECLHYTQVVWRSTKAVGCGRAKCADGWTFVVCS  148

Query  491  YYPPGNYAGQKPY  529
            Y PPGN+ G+ PY
Sbjct  149  YDPPGNFVGELPY  161



>ref|XP_010941969.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAM-AGSE  310
            + F++AHN AR AVG  P+ W+ T+A YA++YA +R  DC L HSGGPYGEN+   +G E
Sbjct  29   QDFVSAHNAARAAVGVGPVSWDNTVAAYAQNYANQRIGDCQLVHSGGPYGENLFWGSGRE  88

Query  311  LSAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTC  487
             +A  +V LW+ EK +Y+++TN C + + C HYTQVVW ++T IGCAR  C +G +F+ C
Sbjct  89   YTAADAVNLWVSEKQWYDYSTNTCAAGKVCGHYTQVVWRDSTHIGCARVKCNSGAIFIIC  148

Query  488  NYYPPGNYAGQKPY  529
            NY PPGN  GQ+PY
Sbjct  149  NYKPPGNIVGQRPY  162



>gb|AAN37409.1| pathogenesis-related protein 1 [Brassica juncea]
Length=160

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            +G++ AHN+AR+AVG  P++W+ TLA YA++YA +   DC L HS GPYGEN+A + ++ 
Sbjct  30   QGYVNAHNQARQAVGVGPVQWDGTLAAYAQNYADRLRGDCRLIHSDGPYGENLAGSSADF  89

Query  314  SAEASVKLWMDEKPYYNHNTNACVSQECLHYTQVVWGNTTTIGCARATCKTGWMFVTCNY  493
            S  ++V LW++EK  YNH++N C + ECLHYTQVVW  +  IGC +A C  G   ++CNY
Sbjct  90   SGVSAVNLWVNEKANYNHDSNTC-NGECLHYTQVVWRKSVRIGCGKARCNNGGTIISCNY  148

Query  494  YPPGNYAGQKPY  529
             P GNY  +KPY
Sbjct  149  DPRGNYVNEKPY  160



>ref|XP_009342365.1| PREDICTED: pathogenesis-related protein 1-like [Pyrus x bretschneideri]
Length=161

 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +2

Query  134  EGFLAAHNKAREAVGSPPLKWNTTLAEYAESYATKRAADCLLEHSGGPYGENIAMAGSEL  313
            + +L +HN AR AVG  PL W+  +A YA++YA +   DC L HSGGPYGEN+AM+  ++
Sbjct  29   QDYLNSHNTARAAVGVGPLTWDDNVAGYAQNYANQHVGDCNLVHSGGPYGENLAMSTGDM  88

Query  314  SAEASVKLWMDEKPYYNHNTNACVS-QECLHYTQVVWGNTTTIGCARATCKTGWMFVTCN  490
            S  A+V LW+ EK  YN+ +N+C   + C HYTQVVW N+  +GCA+  C +G  F+ CN
Sbjct  89   SGTAAVDLWVAEKADYNYESNSCADGKVCGHYTQVVWRNSARVGCAKVRCSSGGTFIGCN  148

Query  491  YYPPGNYAGQKPY  529
            Y PPGNY G+KPY
Sbjct  149  YDPPGNYVGEKPY  161



>ref|XP_011030278.1| PREDICTED: pathogenesis-related protein 1-like [Populus euphratica]
Length=167

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 100/158 (63%), Gaps = 2/158 (1%)
 Frame = +2

Query  56   VAINIIGLAAISQASFGESACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAESYAT  235
            +A+ II L  ++       A DS     FL AHN AR +VG  P++W+ T+A +A SY  
Sbjct  6    IALAIISLVILASTVHDAHAQDSP--RDFLNAHNAARASVGVGPMRWSNTVAAFARSYIN  63

Query  236  KRAADCLLEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACVSQECLHYTQV  415
                 C + HS GP GEN+A   ++L+  A+VK+W+DE+  Y++N+N+CV  +CLHYTQV
Sbjct  64   GLRDGCRMVHSSGPCGENLAWGSADLAGTAAVKMWVDERANYDYNSNSCVGGQCLHYTQV  123

Query  416  VWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
            VW N+  +GCA+  C  G   ++CNY PPGNY  Q+P+
Sbjct  124  VWRNSVRLGCAKVRCDNGGTIISCNYDPPGNYNDQRPF  161



>ref|XP_010065846.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW63535.1| hypothetical protein EUGRSUZ_G01171 [Eucalyptus grandis]
Length=165

 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 107/164 (65%), Gaps = 5/164 (3%)
 Frame = +2

Query  47   QVCVAINIIGLAAISQASFGES-ACDSGCIEGFLAAHNKAREAVGSPPLKWNTTLAEYAE  223
            ++ + +++I L A++ A    S A DS   + ++AAHN AR  V   P+ W+ T+A YA 
Sbjct  4    RMTIPLHLIFLVALTLALIPLSIAQDSP--QDYVAAHNAARSQVNVGPMAWDETVAGYAR  61

Query  224  SYATKRAADCL-LEHSGGPYGENIAMAGSELSAEASVKLWMDEKPYYNHNTNACV-SQEC  397
             YA K A+DC  L HSGGPYGEN+A A  +L+   +V +W+ EKP Y++N N+C   + C
Sbjct  62   DYANKHASDCTQLVHSGGPYGENLAWASPDLTGTGAVNMWVGEKPDYDYNANSCAPGKMC  121

Query  398  LHYTQVVWGNTTTIGCARATCKTGWMFVTCNYYPPGNYAGQKPY  529
             HYTQVVW N+  +GCA+A C TG   VTCNY PPGN  GQKPY
Sbjct  122  GHYTQVVWRNSVRLGCAKAQCATGGTLVTCNYDPPGNVVGQKPY  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028968069338