BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c89703_g1_i1 len=467 path=[445:0-466]

Length=467
                                                                      Score     E

gb|KDP37793.1|  hypothetical protein JCGZ_06695                         144   7e-40   
ref|XP_010674892.1|  PREDICTED: 22.0 kDa class IV heat shock protein    137   4e-37   
ref|XP_006441858.1|  hypothetical protein CICLE_v10022300mg             136   1e-36   
gb|KDO42942.1|  hypothetical protein CISIN_1g028798mg                   136   1e-36   
ref|XP_007143922.1|  hypothetical protein PHAVU_007G113700g             135   2e-36   
ref|XP_007200247.1|  hypothetical protein PRUPE_ppa015151mg             133   1e-35   
ref|XP_007020057.1|  HSP20-like chaperones superfamily protein          133   2e-35   
ref|XP_006478285.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    133   2e-35   
ref|XP_010542493.1|  PREDICTED: 22.0 kDa heat shock protein             131   1e-34   
ref|XP_010470252.1|  PREDICTED: 22.0 kDa heat shock protein-like        128   2e-34   
ref|XP_011013596.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    129   3e-34   
ref|XP_009371038.1|  PREDICTED: 22.0 kDa class IV heat shock protein    128   1e-33   
gb|AEL00035.1|  HSP22                                                   128   1e-33   
gb|KEH42837.1|  22.0 kDa class IV heat shock protein                    127   2e-33   
ref|XP_006289058.1|  hypothetical protein CARUB_v10002455mg             127   2e-33   
ref|XP_006397087.1|  hypothetical protein EUTSA_v10029237mg             127   2e-33   
ref|XP_003622354.1|  22.7 kDa class IV heat shock protein               127   2e-33   
ref|XP_002872502.1|  ATHSP22.0                                          127   4e-33   
gb|KFK32008.1|  hypothetical protein AALP_AA6G188000                    125   9e-33   
ref|XP_008372421.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    126   1e-32   
ref|XP_010455425.1|  PREDICTED: 22.0 kDa heat shock protein-like        125   1e-32   
gb|AEL00027.1|  HSP22                                                   125   1e-32   
ref|XP_009134184.1|  PREDICTED: 22.0 kDa heat shock protein             125   1e-32   
gb|AEL00032.1|  HSP22                                                   125   1e-32   
ref|XP_010421943.1|  PREDICTED: 22.0 kDa heat shock protein isofo...    125   1e-32   
gb|ACN29310.1|  unknown                                                 125   1e-32   Zea mays [maize]
gb|AEL00031.1|  HSP22                                                   125   1e-32   
gb|AEL00036.1|  HSP22                                                   125   1e-32   
sp|P19244.1|HSP41_PEA  RecName: Full=22.7 kDa class IV heat shock...    125   2e-32   Pisum sativum [garden pea]
ref|XP_004975738.1|  PREDICTED: 23.2 kDa heat shock protein-like        125   2e-32   
ref|XP_003622351.1|  22.7 kDa class IV heat shock protein               124   2e-32   
gb|AEL00026.1|  HSP22                                                   124   3e-32   
ref|NP_001275139.1|  uncharacterized protein LOC102577794 precursor     124   3e-32   
ref|XP_008459498.1|  PREDICTED: 22.0 kDa class IV heat shock protein    124   3e-32   
ref|XP_006350340.1|  PREDICTED: 22.7 kDa class IV heat shock prot...    124   3e-32   
ref|NP_192763.1|  heat shock protein 22                                 124   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007152427.1|  hypothetical protein PHAVU_004G129400g             123   9e-32   
ref|XP_002446542.1|  hypothetical protein SORBIDRAFT_06g017850          124   9e-32   Sorghum bicolor [broomcorn]
ref|XP_009415020.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    122   2e-31   
ref|NP_001151139.1|  22.0 kDa class IV heat shock protein precursor     123   2e-31   Zea mays [maize]
gb|ACB71397.1|  ER-localized small heat-shock protein                   121   6e-31   Morus bombycis
gb|ACO06861.2|  endoplasmic reticulum sHSP protein                      120   1e-30   Capsicum annuum var. annuum [chilli pepper]
ref|NP_001236586.1|  uncharacterized protein LOC100526965 precursor     120   1e-30   
sp|P30236.1|HSP41_SOYBN  RecName: Full=22.0 kDa class IV heat sho...    120   1e-30   Glycine max [soybeans]
gb|KHN30529.1|  22.0 kDa class IV heat shock protein                    120   1e-30   
gb|AFW58362.1|  class IV heat shock protein                             120   2e-30   
ref|XP_002519933.1|  heat-shock protein, putative                       119   2e-30   Ricinus communis
ref|XP_004141518.1|  PREDICTED: 22.0 kDa heat shock protein-like        119   2e-30   
ref|NP_001149613.1|  22.0 kDa class IV heat shock protein precursor     120   3e-30   Zea mays [maize]
ref|XP_009781711.1|  PREDICTED: 22.0 kDa class IV heat shock protein    119   4e-30   
ref|XP_008382664.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    119   5e-30   
ref|XP_002519929.1|  heat-shock protein, putative                       117   1e-29   Ricinus communis
ref|XP_003622349.1|  class IV heat shock protein                        117   2e-29   
ref|NP_001236302.1|  uncharacterized protein LOC100500319 precursor     117   2e-29   
emb|CAH67235.1|  OSIGBa0140O07.3                                        117   2e-29   Oryza sativa [red rice]
ref|NP_001052899.1|  Os04g0445100                                       117   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002319884.2|  hypothetical protein POPTR_0013s09600g             117   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010912722.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    116   4e-29   
gb|ADU55793.1|  HSP20.3                                                 115   6e-29   
ref|XP_009589993.1|  PREDICTED: 22.0 kDa class IV heat shock protein    115   1e-28   
ref|XP_010063746.1|  PREDICTED: 22.0 kDa class IV heat shock protein    114   3e-28   
ref|NP_001234600.1|  small heat shock protein precursor                 113   5e-28   
ref|XP_006653451.1|  PREDICTED: 23.2 kDa heat shock protein-like        113   6e-28   
ref|XP_002263376.1|  PREDICTED: 22.0 kDa class IV heat shock protein    112   2e-27   Vitis vinifera
gb|KHN36477.1|  22.7 kDa class IV heat shock protein                    112   2e-27   
ref|XP_006606825.1|  PREDICTED: uncharacterized protein LOC100807920    114   5e-27   
ref|XP_004495437.1|  PREDICTED: 22.7 kDa class IV heat shock prot...    110   7e-27   
ref|XP_010252436.1|  PREDICTED: 22.0 kDa class IV heat shock protein    110   9e-27   
ref|XP_009594185.1|  PREDICTED: 22.0 kDa heat shock protein-like        108   2e-26   
gb|KHN24436.1|  22.0 kDa heat shock protein                             106   3e-26   
ref|XP_003579829.1|  PREDICTED: 23.2 kDa heat shock protein-like        109   3e-26   
gb|EMS51510.1|  hypothetical protein TRIUR3_31593                       107   7e-26   
ref|XP_010478759.1|  PREDICTED: 22.0 kDa heat shock protein-like        107   1e-25   
ref|XP_010499882.1|  PREDICTED: 22.0 kDa heat shock protein-like        107   1e-25   
emb|CDX93767.1|  BnaA09g23670D                                          106   2e-25   
ref|XP_007023156.1|  HSP20-like chaperones superfamily protein          105   3e-25   
ref|XP_010099736.1|  hypothetical protein L484_025169                   103   4e-25   
ref|XP_010065221.1|  PREDICTED: 18.1 kDa class I heat shock prote...    105   4e-25   
emb|CDO97663.1|  unnamed protein product                                105   7e-25   
ref|XP_007223469.1|  hypothetical protein PRUPE_ppa011656mg             105   8e-25   
ref|XP_010912721.1|  PREDICTED: 22.7 kDa class IV heat shock prot...    105   8e-25   
tpg|DAA41888.1|  TPA: class IV heat shock protein                       105   1e-24   
ref|XP_010657906.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    104   1e-24   
ref|XP_008218631.1|  PREDICTED: 16.9 kDa class I heat shock prote...    104   1e-24   
ref|XP_006415096.1|  hypothetical protein EUTSA_v10009865mg             103   1e-24   
gb|EMT15210.1|  hypothetical protein F775_26258                         104   2e-24   
ref|XP_010461162.1|  PREDICTED: 22.0 kDa heat shock protein-like        103   2e-24   
gb|EMS61250.1|  hypothetical protein TRIUR3_23889                       104   2e-24   
gb|KFK45072.1|  hypothetical protein AALP_AA1G339700                    103   2e-24   
emb|CDX86006.1|  BnaC06g21280D                                          103   2e-24   
gb|KDP40897.1|  hypothetical protein JCGZ_24896                         103   2e-24   
ref|XP_002893762.1|  predicted protein                                  103   3e-24   
ref|XP_004236141.1|  PREDICTED: 22.7 kDa class IV heat shock prot...    103   3e-24   
ref|XP_008452205.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    103   3e-24   
ref|XP_006345019.1|  PREDICTED: 22.7 kDa class IV heat shock prot...    103   3e-24   
ref|XP_009114798.1|  PREDICTED: 22.0 kDa heat shock protein-like        102   4e-24   
gb|AES61059.2|  22.0 kDa class IV heat shock protein                    102   5e-24   
emb|CBI29627.3|  unnamed protein product                                104   5e-24   
ref|XP_003590808.1|  Heat shock protein 17a.17                          102   5e-24   
ref|XP_004978986.1|  PREDICTED: 21.9 kDa heat shock protein-like        103   6e-24   
ref|NP_001148473.1|  22.0 kDa class IV heat shock protein               103   6e-24   Zea mays [maize]
ref|XP_002449275.1|  hypothetical protein SORBIDRAFT_05g007030          102   8e-24   Sorghum bicolor [broomcorn]
ref|NP_001236784.1|  low molecular weight heat shock protein Hsp2...    102   1e-23   
ref|XP_009758848.1|  PREDICTED: 16.9 kDa class I heat shock prote...    101   2e-23   
ref|XP_008781974.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    101   2e-23   
dbj|BAK06101.1|  predicted protein                                      101   2e-23   
ref|XP_003622353.1|  class I heat shock protein                         100   4e-23   
ref|XP_008781973.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    100   6e-23   
ref|XP_004133737.1|  PREDICTED: 22.7 kDa class IV heat shock prot...    100   6e-23   
ref|XP_010529902.1|  PREDICTED: 22.0 kDa class IV heat shock prot...    100   8e-23   
gb|EMT19819.1|  hypothetical protein F775_30396                       97.4    1e-22   
ref|XP_003622352.1|  class IV heat shock protein                      98.6    2e-22   
gb|KDO37796.1|  hypothetical protein CISIN_1g044197mg                 97.8    5e-22   
ref|XP_010252299.1|  PREDICTED: 17.6 kDa class I heat shock prote...  97.1    9e-22   
ref|XP_008352881.1|  PREDICTED: 22.0 kDa heat shock protein-like      97.4    1e-21   
ref|XP_002521274.1|  heat-shock protein, putative                     96.7    1e-21   Ricinus communis
gb|AGZ80569.1|  heat shock protein                                    94.0    1e-21   
ref|XP_010682100.1|  PREDICTED: 17.6 kDa class I heat shock prote...  96.7    1e-21   
gb|AGZ80567.1|  heat shock protein                                    94.0    1e-21   
gb|AGZ80566.1|  heat shock protein                                    93.6    1e-21   
gb|KDO36121.1|  hypothetical protein CISIN_1g037002mg                 95.5    2e-21   
ref|XP_010911644.1|  PREDICTED: 22.7 kDa class IV heat shock prot...  93.2    4e-21   
ref|XP_006349271.1|  PREDICTED: 22.7 kDa class IV heat shock prot...  95.1    5e-21   
ref|XP_011087610.1|  PREDICTED: 22.0 kDa heat shock protein-like      94.7    7e-21   
ref|XP_009794744.1|  PREDICTED: class I heat shock protein            91.7    1e-20   
gb|AEM97868.1|  heat shock protein 22                                 94.0    1e-20   
ref|XP_006431415.1|  hypothetical protein CICLE_v10003697mg           92.4    1e-20   
ref|XP_010501751.1|  PREDICTED: 22.0 kDa heat shock protein-like      94.4    2e-20   
gb|AFG60826.1|  hypothetical protein CL3601Contig1_03                 90.1    3e-20   
ref|XP_004230409.1|  PREDICTED: 22.7 kDa class IV heat shock prot...  93.2    3e-20   
ref|XP_006431410.1|  hypothetical protein CICLE_v10003210mg           92.8    3e-20   
gb|EYU35046.1|  hypothetical protein MIMGU_mgv1a018909mg              93.6    3e-20   
ref|XP_006306010.1|  hypothetical protein CARUB_v10011304mg           92.8    3e-20   
ref|XP_008378954.1|  PREDICTED: 22.0 kDa class IV heat shock prot...  92.8    4e-20   
ref|XP_008357666.1|  PREDICTED: 22.0 kDa class IV heat shock prot...  92.8    4e-20   
ref|XP_006494583.1|  PREDICTED: 22.7 kDa class IV heat shock prot...  90.9    4e-20   
gb|AAP33014.1|  HSP22                                                 89.0    5e-20   Citrus x paradisi [grapefruit]
gb|KDO39514.1|  hypothetical protein CISIN_1g042495mg                 92.0    6e-20   
ref|XP_009763486.1|  PREDICTED: 22.0 kDa class IV heat shock prot...  92.0    8e-20   
gb|AHI18142.1|  22.7 kDa class IV small heat shock protein            91.7    8e-20   
ref|XP_006431414.1|  hypothetical protein CICLE_v10003244mg           92.0    9e-20   
sp|P27879.1|HSP11_MEDSA  RecName: Full=18.1 kDa class I heat shoc...  90.5    1e-19   Medicago sativa [alfalfa]
gb|KDO38867.1|  hypothetical protein CISIN_1g042820mg                 89.7    1e-19   
ref|XP_006431523.1|  hypothetical protein CICLE_v10003649mg           90.9    1e-19   
ref|XP_010273704.1|  PREDICTED: 17.3 kDa class I heat shock prote...  90.1    2e-19   
gb|AFG50263.1|  hypothetical protein CL428Contig1_02                  88.2    2e-19   
gb|KDP46549.1|  hypothetical protein JCGZ_08521                       89.4    2e-19   
gb|AFK41064.1|  unknown                                               90.1    2e-19   
ref|XP_003576111.1|  PREDICTED: 21.9 kDa heat shock protein           90.9    2e-19   
gb|ABP35941.1|  small heat shock protein                              90.9    2e-19   Cyclamen persicum
ref|XP_006431361.1|  hypothetical protein CICLE_v10003876mg           90.1    2e-19   
emb|CDP19641.1|  unnamed protein product                              89.7    2e-19   
gb|AES97913.2|  22.0 kDa class IV heat shock protein                  89.0    4e-19   
gb|AAR01521.1|  cytosolic class I small heat shock protein 3A         88.6    4e-19   Nicotiana tabacum [American tobacco]
ref|XP_009594301.1|  PREDICTED: 17.6 kDa class I heat shock prote...  89.4    4e-19   
gb|AAR01523.1|  cytosolic class I small heat shock protein 3B         88.6    4e-19   Nicotiana tabacum [American tobacco]
ref|XP_011084972.1|  PREDICTED: 17.3 kDa class I heat shock prote...  89.4    4e-19   
ref|XP_011036031.1|  PREDICTED: 18.1 kDa class I heat shock prote...  89.4    4e-19   
gb|AGV54294.1|  class I heat shock protein                            89.0    5e-19   
gb|AAR01527.1|  cytosolic class I small heat shock protein 3C         88.2    5e-19   Nicotiana tabacum [American tobacco]
ref|XP_006350804.1|  PREDICTED: 17.7 kDa class I heat shock prote...  89.0    5e-19   
ref|XP_008808960.1|  PREDICTED: 22.0 kDa class IV heat shock prot...  89.4    5e-19   
ref|XP_007159360.1|  hypothetical protein PHAVU_002G231600g           89.0    6e-19   
ref|XP_003614955.1|  class I heat shock protein                       89.4    6e-19   
gb|KDP40796.1|  hypothetical protein JCGZ_24795                       87.4    6e-19   
ref|XP_003619703.1|  18.2 kDa class I heat shock protein              89.0    6e-19   
ref|XP_003619696.1|  18.2 kDa class I heat shock protein              89.0    6e-19   
gb|AFG50264.1|  hypothetical protein CL428Contig1_02                  86.7    6e-19   
gb|KDO37787.1|  hypothetical protein CISIN_1g043940mg                 87.8    7e-19   
ref|XP_009599505.1|  PREDICTED: 17.6 kDa class I heat shock prote...  88.6    7e-19   
gb|AIE47706.1|  HSP17.4                                               88.6    7e-19   
ref|XP_010930366.1|  PREDICTED: 22.7 kDa class IV heat shock prot...  89.0    7e-19   
ref|XP_009762901.1|  PREDICTED: 17.6 kDa class I heat shock prote...  88.2    8e-19   
gb|ABR17924.1|  unknown                                               88.6    8e-19   Picea sitchensis
gb|ADK36668.1|  cytosolic class I small heat shock protein 3B         88.2    8e-19   
gb|ABK22474.1|  unknown                                               88.6    8e-19   Picea sitchensis
gb|KDP46547.1|  hypothetical protein JCGZ_08519                       87.4    8e-19   
ref|XP_010273703.1|  PREDICTED: 17.3 kDa class I heat shock prote...  88.6    8e-19   
ref|XP_006494163.1|  PREDICTED: 22.0 kDa heat shock protein-like      89.0    9e-19   
gb|AAB63310.1|  18.6 kDa heat-shock protein                           88.6    9e-19   Helianthus annuus
ref|XP_009355390.1|  PREDICTED: 16.9 kDa class I heat shock prote...  89.4    9e-19   
ref|XP_008464642.1|  PREDICTED: 17.8 kDa class I heat shock prote...  88.2    9e-19   
ref|XP_003608277.1|  18.2 kDa class I heat shock protein              88.2    9e-19   
ref|XP_011005463.1|  PREDICTED: 18.1 kDa class I heat shock prote...  88.2    9e-19   
sp|P27880.1|HSP12_MEDSA  RecName: Full=18.2 kDa class I heat shoc...  88.2    1e-18   Medicago sativa [alfalfa]
ref|XP_002520462.1|  heat-shock protein, putative                     88.2    1e-18   Ricinus communis
ref|XP_010087898.1|  hypothetical protein L484_006034                 88.2    1e-18   
ref|XP_004505085.1|  PREDICTED: 18.5 kDa class I heat shock prote...  88.2    1e-18   
ref|XP_003519372.1|  PREDICTED: 18.2 kDa class I heat shock protein   87.8    1e-18   
ref|XP_006384657.1|  17.6 kDa class I small heat shock family pro...  87.8    1e-18   
ref|XP_008354272.1|  PREDICTED: 18.5 kDa class I heat shock prote...  87.8    1e-18   
gb|KDP20449.1|  hypothetical protein JCGZ_05294                       87.8    1e-18   
ref|XP_008362807.1|  PREDICTED: 18.5 kDa class I heat shock prote...  87.8    1e-18   
emb|CAQ64473.1|  cytosolic class I small heat shock protein type 1    87.4    1e-18   Rhododendron simsii
ref|XP_009761476.1|  PREDICTED: 17.6 kDa class I heat shock prote...  87.8    1e-18   
ref|XP_009344304.1|  PREDICTED: 18.1 kDa class I heat shock prote...  87.8    1e-18   
ref|XP_004504869.1|  PREDICTED: 18.2 kDa class I heat shock prote...  87.8    2e-18   
gb|AFG50265.1|  hypothetical protein CL428Contig1_02                  85.9    2e-18   
gb|ACV93249.1|  CI small heat shock protein 2                         87.4    2e-18   Prunus salicina [Japanese plum]
gb|KGN50609.1|  hypothetical protein Csa_5G190530                     87.8    2e-18   
emb|CAQ64460.1|  cytosolic class I small heat shock protein type 1    87.4    2e-18   Rhododendron hyperythrum
gb|ABK24124.1|  unknown                                               87.4    2e-18   Picea sitchensis
gb|ABK21324.1|  unknown                                               87.4    2e-18   Picea sitchensis
gb|ABW89467.1|  low molecular weight heat shock protein               87.4    2e-18   Gossypium hirsutum [American cotton]
ref|XP_004505963.1|  PREDICTED: 18.5 kDa class I heat shock prote...  88.6    2e-18   
ref|XP_009416183.1|  PREDICTED: 17.3 kDa class I heat shock prote...  87.4    2e-18   
ref|XP_009409760.1|  PREDICTED: 18.1 kDa class I heat shock prote...  89.0    2e-18   
gb|AFN89710.1|  heat shock protein 21.4                               88.2    2e-18   
gb|ABC41131.1|  17.3 kDa class I heat shock protein                   87.4    2e-18   Arachis hypogaea [goober]
ref|XP_009589718.1|  PREDICTED: 17.6 kDa class I heat shock protein   87.4    2e-18   
gb|AFK38102.1|  unknown                                               87.4    2e-18   
ref|XP_002520459.1|  heat-shock protein, putative                     88.2    2e-18   Ricinus communis
ref|XP_011099770.1|  PREDICTED: 17.5 kDa class I heat shock prote...  87.0    2e-18   
ref|NP_001275610.1|  17.6 kDa class I heat shock protein-like         87.0    2e-18   
ref|XP_010271886.1|  PREDICTED: 17.8 kDa class I heat shock prote...  87.4    2e-18   
gb|KDP42159.1|  hypothetical protein JCGZ_02889                       87.4    2e-18   
ref|XP_010689968.1|  PREDICTED: 17.8 kDa class I heat shock prote...  87.0    2e-18   
ref|XP_004505083.1|  PREDICTED: 18.5 kDa class I heat shock prote...  87.4    2e-18   
sp|P30221.1|HSP11_SOLLC  RecName: Full=17.8 kDa class I heat shoc...  87.0    2e-18   Solanum lycopersicum
ref|NP_001266045.1|  17.8 kDa class I heat shock protein-like         87.0    2e-18   
gb|KDP42161.1|  hypothetical protein JCGZ_02891                       87.0    2e-18   
emb|CAQ64462.1|  cytosolic class I small heat shock protein type 1    87.0    2e-18   Rhododendron formosanum
ref|XP_011044573.1|  PREDICTED: 18.1 kDa class I heat shock prote...  87.0    2e-18   
ref|XP_004505087.1|  PREDICTED: 18.5 kDa class I heat shock prote...  87.0    2e-18   
ref|XP_010033073.1|  PREDICTED: 18.1 kDa class I heat shock prote...  87.4    2e-18   
ref|XP_007016258.1|  HSP20-like chaperones superfamily protein        87.0    2e-18   
gb|ABW89470.1|  low molecular weight heat shock protein               87.0    2e-18   Gossypium hirsutum [American cotton]
gb|AFK46274.1|  unknown                                               87.0    2e-18   
gb|AEA86322.1|  class I heat shock protein                            87.0    3e-18   
ref|XP_008464901.1|  PREDICTED: 17.6 kDa class I heat shock prote...  87.0    3e-18   
ref|XP_004516546.1|  PREDICTED: 18.5 kDa class I heat shock prote...  87.0    3e-18   
ref|XP_011003996.1|  PREDICTED: 17.5 kDa class I heat shock prote...  87.0    3e-18   
gb|ACJ85922.1|  unknown                                               87.0    3e-18   Medicago truncatula
ref|XP_009344353.1|  PREDICTED: 18.5 kDa class I heat shock prote...  87.0    3e-18   
emb|CAQ64458.1|  cytosolic class I small heat shock protein type 1    86.7    3e-18   Rhododendron breviperulatum
ref|XP_002520464.1|  heat-shock protein, putative                     87.0    3e-18   Ricinus communis
emb|CAQ64464.1|  cytosolic class I small heat shock protein type 1    86.7    3e-18   Rhododendron morii
ref|XP_004294276.1|  PREDICTED: 18.2 kDa class I heat shock prote...  87.0    3e-18   
ref|XP_002313360.1|  17.5 kd heat shock family protein                86.7    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006387302.1|  hypothetical protein POPTR_1310s00200g           86.7    3e-18   
ref|XP_002325979.2|  17.5 kd heat shock family protein                86.7    3e-18   Populus trichocarpa [western balsam poplar]
gb|ADD21573.1|  hypothetical protein                                  86.3    3e-18   
ref|XP_002520482.1|  heat-shock protein, putative                     86.7    4e-18   Ricinus communis
ref|XP_008809153.1|  PREDICTED: 17.8 kDa class I heat shock prote...  86.7    4e-18   
ref|NP_001234225.1|  type I small heat shock protein 17.6 kDa iso...  86.7    4e-18   
ref|XP_002325980.2|  17.5 kd heat shock family protein                86.7    4e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010094785.1|  hypothetical protein L484_000756                 86.7    4e-18   
gb|KEH31005.1|  17.6 kDa class I heat shock protein                   87.8    4e-18   
ref|XP_008233691.1|  PREDICTED: 18.5 kDa class I heat shock prote...  86.7    4e-18   
ref|XP_002312898.2|  hypothetical protein POPTR_0009s15020g           86.7    4e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006350803.1|  PREDICTED: 17.6 kDa class I heat shock prote...  86.3    4e-18   
emb|CAQ64463.1|  cytosolic class I small heat shock protein type 1    86.3    4e-18   Rhododendron kanehirae
gb|KDP46551.1|  hypothetical protein JCGZ_08523                       87.8    4e-18   
emb|CAQ64468.1|  cytosolic class I small heat shock protein type 1    86.3    4e-18   Rhododendron oldhamii
emb|CAQ64469.1|  cytosolic class I small heat shock protein type 1    86.3    4e-18   Rhododendron ovatum
emb|CAQ64459.1|  cytosolic class I small heat shock protein type 1    86.3    4e-18   Rhododendron ellipticum
ref|XP_004241201.1|  PREDICTED: 17.7 kDa class I heat shock prote...  86.3    5e-18   
emb|CAA12387.1|  Hsp20.1 protein                                      86.3    5e-18   Solanum peruvianum [Peruvian tomato]
ref|XP_010042507.1|  PREDICTED: 18.1 kDa class I heat shock prote...  86.3    5e-18   
ref|XP_004150236.1|  PREDICTED: 17.6 kDa class I heat shock prote...  86.3    5e-18   
gb|AEP95305.1|  class I small heat shock protein 20.1                 86.3    5e-18   
ref|NP_001236198.1|  uncharacterized protein LOC100305750             86.3    5e-18   
ref|XP_010033053.1|  PREDICTED: 18.1 kDa class I heat shock prote...  86.3    5e-18   
gb|ABK21289.1|  unknown                                               86.3    5e-18   Picea sitchensis
ref|XP_010322336.1|  PREDICTED: 17.6 kDa class I heat shock protein   86.3    5e-18   
ref|XP_010033068.1|  PREDICTED: 18.1 kDa class I heat shock prote...  86.3    5e-18   
ref|XP_010271883.1|  PREDICTED: 17.8 kDa class I heat shock prote...  86.3    5e-18   
ref|XP_010262690.1|  PREDICTED: 17.3 kDa class I heat shock prote...  86.3    6e-18   
ref|XP_010041501.1|  PREDICTED: 18.1 kDa class I heat shock prote...  86.3    6e-18   
ref|XP_010033072.1|  PREDICTED: 18.1 kDa class I heat shock prote...  86.3    6e-18   
ref|XP_010033071.1|  PREDICTED: 18.1 kDa class I heat shock prote...  86.3    6e-18   
emb|CAB93514.1|  HSP17.x protein                                      85.5    6e-18   Brassica oleracea
ref|XP_011084974.1|  PREDICTED: 17.5 kDa class I heat shock prote...  86.3    6e-18   
emb|CBW38485.1|  heat shock protein 17                                85.9    6e-18   
ref|XP_010925290.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.9    6e-18   
ref|XP_007016253.1|  HSP20-like chaperones superfamily protein        85.9    6e-18   
ref|XP_007159361.1|  hypothetical protein PHAVU_002G231700g           86.3    6e-18   
gb|KGN50622.1|  Chloroplast small heat shock protein class I          85.9    7e-18   
ref|XP_002280821.1|  PREDICTED: 18.1 kDa class I heat shock protein   85.9    7e-18   Vitis vinifera
emb|CAN70834.1|  hypothetical protein VITISV_007166                   85.9    7e-18   
gb|KHN13304.1|  22.7 kDa class IV heat shock protein                  85.9    7e-18   
gb|ABC46712.1|  17.5 kDa class I HSP                                  85.5    7e-18   
ref|NP_001235609.1|  uncharacterized protein LOC100526893             85.9    7e-18   
ref|XP_003529344.1|  PREDICTED: 17.5 kDa class I heat shock protein   85.9    7e-18   
ref|XP_008809154.1|  PREDICTED: class I heat shock protein-like       85.5    7e-18   
ref|XP_010271819.1|  PREDICTED: 17.5 kDa class I heat shock prote...  85.9    8e-18   
ref|XP_003543386.1|  PREDICTED: 22.0 kDa class IV heat shock prot...  86.7    8e-18   
emb|CAQ64471.1|  cytosolic class I small heat shock protein type 1    85.5    8e-18   
emb|CAQ64472.1|  cytosolic class I small heat shock protein type 1    85.5    8e-18   
gb|KCW52591.1|  hypothetical protein EUGRSUZ_J01959                   87.4    8e-18   
gb|KDP42157.1|  hypothetical protein JCGZ_02887                       85.9    8e-18   
ref|XP_002280935.1|  PREDICTED: 18.1 kDa class I heat shock protein   85.9    8e-18   
emb|CAN60868.1|  hypothetical protein VITISV_020895                   85.9    8e-18   
gb|AAQ19680.1|  chloroplast small heat shock protein class I          85.9    8e-18   
ref|XP_010033075.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.9    9e-18   
ref|XP_010925994.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.5    9e-18   
emb|CAN68540.1|  hypothetical protein VITISV_039648                   85.5    9e-18   
ref|XP_009589640.1|  PREDICTED: class I heat shock protein-like       85.5    9e-18   
gb|AHI18144.1|  17.6 kDa class 1 small heat shock protein             85.5    9e-18   
emb|CAQ64457.1|  cytosolic class I small heat shock protein type 2    85.1    9e-18   
ref|XP_006350800.1|  PREDICTED: 17.8 kDa class I heat shock prote...  85.5    9e-18   
ref|XP_007016262.1|  HSP20-like chaperones superfamily protein        85.5    9e-18   
ref|XP_007218546.1|  hypothetical protein PRUPE_ppa012795mg           85.5    9e-18   
ref|XP_010247906.1|  PREDICTED: 17.8 kDa class I heat shock prote...  85.5    9e-18   
ref|XP_008782317.1|  PREDICTED: 16.9 kDa class I heat shock prote...  85.5    1e-17   
ref|XP_006384654.1|  hypothetical protein POPTR_0004s19860g           85.5    1e-17   
ref|XP_004984667.1|  PREDICTED: 17.9 kDa class I heat shock prote...  85.5    1e-17   
ref|XP_006387303.1|  17.5 kd heat shock family protein                85.5    1e-17   
ref|XP_008782319.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.5    1e-17   
gb|AAD30453.1|AF123256_1  17.8 kD class I small heat shock protein    85.5    1e-17   
ref|XP_009407532.1|  PREDICTED: 17.3 kDa class I heat shock prote...  85.5    1e-17   
gb|ABF61863.1|  chaperone                                             85.5    1e-17   
gb|AEH30706.1|  low molecular weight heat shock protein               85.5    1e-17   
gb|KHN09971.1|  17.5 kDa class I heat shock protein                   84.7    1e-17   
ref|XP_002315187.1|  18.2 kDa class I heat shock family protein       85.5    1e-17   
gb|ADU55794.1|  HSP18.1B                                              85.5    1e-17   
ref|XP_010271882.1|  PREDICTED: 17.8 kDa class I heat shock prote...  85.5    1e-17   
gb|KDO69245.1|  hypothetical protein CISIN_1g037294mg                 85.5    1e-17   
ref|XP_010033066.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.5    1e-17   
ref|XP_011044585.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.5    1e-17   
gb|ACF74309.1|  heat shock protein 2                                  85.5    1e-17   
ref|XP_011038231.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.5    1e-17   
gb|ADB85094.1|  heat-shock protein                                    85.1    1e-17   
gb|KDP46581.1|  hypothetical protein JCGZ_08553                       85.1    1e-17   
ref|XP_010033076.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.5    1e-17   
emb|CAQ64461.1|  cytosolic class I small heat shock protein type 1    84.7    1e-17   
prf||1107298A  protein,small heat shock                               85.1    1e-17
gb|KCW52608.1|  hypothetical protein EUGRSUZ_J01979                   87.0    1e-17   
ref|NP_001235546.1|  uncharacterized protein LOC100527912             85.1    1e-17   
ref|XP_002520483.1|  heat-shock protein, putative                     85.1    1e-17   
gb|AAB63311.1|  17.7 kDa heat shock protein                           85.1    1e-17   
ref|XP_008343822.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.1    1e-17   
sp|P30693.1|HSP11_HELAN  RecName: Full=17.6 kDa class I heat shoc...  85.1    1e-17   
ref|XP_010271881.1|  PREDICTED: 17.8 kDa class I heat shock prote...  85.1    1e-17   
ref|XP_006854036.1|  hypothetical protein AMTR_s00048p00060010        85.1    1e-17   
ref|XP_004294589.1|  PREDICTED: 18.2 kDa class I heat shock prote...  85.1    1e-17   
ref|XP_010033055.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.1    1e-17   
emb|CDP19639.1|  unnamed protein product                              85.1    1e-17   
gb|AIN76716.1|  18.2 class I small shock hsp                          85.1    1e-17   
sp|O82012.1|HSP12_SOLPE  RecName: Full=17.6 kDa class I heat shoc...  85.1    2e-17   
ref|XP_010033069.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.1    2e-17   
ref|XP_002312132.1|  18.2 kDa class I heat shock family protein       85.1    2e-17   
sp|P04794.1|HSP14_SOYBN  RecName: Full=17.5 kDa class I heat shoc...  84.7    2e-17   
emb|CAQ64450.1|  cytosolic class I small heat shock protein type 2    84.3    2e-17   
gb|EYU23187.1|  hypothetical protein MIMGU_mgv1a024259mg              84.7    2e-17   
gb|KCW52606.1|  hypothetical protein EUGRSUZ_J01977                   86.7    2e-17   
ref|XP_010925996.1|  PREDICTED: 16.9 kDa class I heat shock prote...  84.7    2e-17   
gb|KCW52592.1|  hypothetical protein EUGRSUZ_J01960                   85.1    2e-17   
ref|XP_011084986.1|  PREDICTED: 17.3 kDa class I heat shock prote...  85.1    2e-17   
ref|XP_009589641.1|  PREDICTED: 18.2 kDa class I heat shock prote...  84.7    2e-17   
ref|XP_010033067.1|  PREDICTED: 18.1 kDa class I heat shock protein   85.1    2e-17   
ref|XP_010033054.1|  PREDICTED: 18.1 kDa class I heat shock prote...  85.9    2e-17   
ref|NP_001238680.1|  uncharacterized protein LOC100500475             84.7    2e-17   
ref|XP_002313410.1|  hypothetical protein POPTR_0009s04410g           84.7    2e-17   
ref|XP_011084977.1|  PREDICTED: 17.3 kDa class I heat shock prote...  84.7    2e-17   
gb|ADU55786.1|  HSP22.9                                               85.5    2e-17   
ref|XP_011084982.1|  PREDICTED: 17.8 kDa class I heat shock prote...  84.7    2e-17   
ref|NP_001240953.1|  uncharacterized protein LOC100812935             84.7    2e-17   
ref|XP_010542656.1|  PREDICTED: 17.6 kDa class I heat shock prote...  84.7    2e-17   
ref|XP_011084988.1|  PREDICTED: 17.3 kDa class I heat shock prote...  84.3    2e-17   
gb|KHN09974.1|  17.5 kDa class I heat shock protein                   84.3    2e-17   
ref|XP_002520481.1|  heat-shock protein, putative                     84.7    2e-17   
gb|AAR99375.1|  small heat shock protein                              84.3    2e-17   
ref|XP_011091950.1|  PREDICTED: 17.8 kDa class I heat shock prote...  84.3    2e-17   
ref|XP_009344315.1|  PREDICTED: 16.9 kDa class I heat shock prote...  85.1    2e-17   
gb|EYU35310.1|  hypothetical protein MIMGU_mgv1a015592mg              84.3    2e-17   
gb|AGA62461.1|  low molecular weight heat shock protein               84.3    2e-17   
ref|NP_001235177.1|  18.5 kDa class I heat shock protein              84.7    2e-17   
ref|XP_006826727.1|  hypothetical protein AMTR_s00136p00020380        84.3    2e-17   
ref|XP_009589642.1|  PREDICTED: 17.3 kDa class I heat shock prote...  84.3    2e-17   
ref|XP_010690464.1|  PREDICTED: 18.2 kDa class I heat shock prote...  84.3    3e-17   
ref|XP_007016257.1|  HSP20-like chaperones superfamily protein        84.3    3e-17   
gb|AFB35142.1|  small heat shock protein                              84.3    3e-17   
gb|ABK32539.1|  heat shock protein 17.8                               84.3    3e-17   
gb|KCW52611.1|  hypothetical protein EUGRSUZ_J01982                   85.1    3e-17   
ref|XP_009344296.1|  PREDICTED: 18.1 kDa class I heat shock prote...  84.3    3e-17   
gb|KHN46263.1|  17.3 kDa class I heat shock protein                   84.0    3e-17   
ref|XP_010928954.1|  PREDICTED: 18.1 kDa class I heat shock prote...  84.3    3e-17   
ref|XP_008354273.1|  PREDICTED: 18.1 kDa class I heat shock prote...  84.0    3e-17   
ref|XP_004294277.1|  PREDICTED: 18.5 kDa class I heat shock prote...  84.0    3e-17   
ref|XP_002530399.1|  heat-shock protein, putative                     84.3    3e-17   
ref|XP_003529343.1|  PREDICTED: 17.5 kDa class I heat shock protein   84.0    3e-17   
emb|CBW38480.1|  heat shock protein 17                                84.0    3e-17   
gb|ADW08704.1|  heat shock protein                                    84.0    3e-17   
gb|ABW89468.1|  low molecular weight heat shock protein               84.0    3e-17   
emb|CAN65185.1|  hypothetical protein VITISV_028926                   84.0    4e-17   
ref|XP_006854037.1|  hypothetical protein AMTR_s00048p00062080        84.0    4e-17   
ref|XP_010680831.1|  PREDICTED: 17.8 kDa class I heat shock prote...  84.0    4e-17   
ref|XP_007159359.1|  hypothetical protein PHAVU_002G231500g           84.0    4e-17   
ref|XP_006431530.1|  hypothetical protein CICLE_v10003298mg           83.2    4e-17   
ref|XP_010033058.1|  PREDICTED: 18.2 kDa class I heat shock prote...  84.0    4e-17   
gb|ACE60625.1|  low molecular weight heat shock protein               83.6    4e-17   
ref|XP_010042556.1|  PREDICTED: 18.1 kDa class I heat shock prote...  84.0    4e-17   
gb|KDP44853.1|  hypothetical protein JCGZ_01353                       84.0    4e-17   
gb|KHN46264.1|  17.3 kDa class I heat shock protein                   83.6    4e-17   
gb|ADW78609.1|  heat shock protein 17                                 83.6    4e-17   
gb|KDO37746.1|  hypothetical protein CISIN_1g046909mg                 83.6    4e-17   
sp|O82011.1|HSP11_SOLPE  RecName: Full=17.7 kDa class I heat shoc...  83.6    5e-17   
ref|XP_010088689.1|  hypothetical protein L484_016474                 84.3    5e-17   
emb|CAQ64451.1|  cytosolic class I small heat shock protein type 2    83.2    5e-17   
ref|XP_006486450.1|  PREDICTED: 18.2 kDa class I heat shock prote...  83.6    5e-17   
ref|XP_007159358.1|  hypothetical protein PHAVU_002G231400g           83.6    5e-17   
ref|XP_010916441.1|  PREDICTED: 16.9 kDa class I heat shock prote...  83.6    5e-17   
gb|EYU35305.1|  hypothetical protein MIMGU_mgv1a017856mg              83.6    5e-17   
ref|XP_006435570.1|  hypothetical protein CICLE_v10032971mg           83.6    5e-17   
gb|AIE47711.1|  HSP19.8                                               83.2    5e-17   
ref|XP_010241154.1|  PREDICTED: 18.2 kDa class I heat shock prote...  83.6    5e-17   
ref|XP_007016261.1|  HSP20-like chaperones superfamily protein        83.6    5e-17   
ref|XP_006350801.1|  PREDICTED: 17.7 kDa class I heat shock prote...  83.6    6e-17   
gb|ADT65203.1|  small heat shock protein                              83.6    6e-17   
ref|XP_003526885.1|  PREDICTED: 18.5 kDa class I heat shock protein   83.2    6e-17   
gb|EYU35289.1|  hypothetical protein MIMGU_mgv1a015334mg              83.6    6e-17   
gb|AAN74634.1|  heat shock protein                                    83.6    6e-17   
ref|XP_010033062.1|  PREDICTED: 18.1 kDa class I heat shock prote...  83.2    7e-17   
ref|XP_009351157.1|  PREDICTED: 16.9 kDa class I heat shock prote...  83.2    7e-17   
gb|KDP32460.1|  hypothetical protein JCGZ_13385                       82.0    7e-17   
gb|ACC86142.1|  heat shock protein 17.5                               83.2    7e-17   
ref|XP_010106458.1|  hypothetical protein L484_025215                 83.2    7e-17   
ref|XP_009412571.1|  PREDICTED: 17.3 kDa class I heat shock prote...  84.3    7e-17   
ref|XP_010106457.1|  hypothetical protein L484_025214                 83.2    7e-17   
ref|XP_007016254.1|  HSP20-like chaperones superfamily protein        83.2    7e-17   
ref|XP_010087895.1|  hypothetical protein L484_006031                 83.2    7e-17   
emb|CAA63903.1|  heat shock protein 17.9                              83.2    7e-17   
ref|XP_007159362.1|  hypothetical protein PHAVU_002G231800g           83.2    7e-17   
gb|ACR78191.1|  heat shock protein 17.9                               83.2    7e-17   
ref|XP_011076756.1|  PREDICTED: 17.6 kDa class I heat shock prote...  83.2    7e-17   
ref|XP_003529341.1|  PREDICTED: 17.5 kDa class I heat shock protein   83.2    7e-17   
ref|NP_001238499.1|  uncharacterized protein LOC100527855             83.2    7e-17   
gb|AAR25848.1|  17.5 kDa class I heat shock protein                   83.2    8e-17   
gb|AAM28293.1|  class-1 LMW heat shock protein                        83.2    8e-17   
ref|XP_010034588.1|  PREDICTED: 18.1 kDa class I heat shock prote...  83.2    8e-17   
emb|CAC84406.1|  17.6 kDa heat-shock protein                          83.2    8e-17   
ref|XP_010928953.1|  PREDICTED: 18.1 kDa class I heat shock protein   82.8    8e-17   
ref|XP_002530396.1|  heat-shock protein, putative                     83.2    8e-17   
ref|XP_006827596.1|  hypothetical protein AMTR_s00009p00236890        83.2    8e-17   
gb|EMT19853.1|  hypothetical protein F775_43097                       81.3    9e-17   
ref|XP_010033050.1|  PREDICTED: 18.1 kDa class I heat shock prote...  83.2    9e-17   
ref|XP_010557232.1|  PREDICTED: 17.6 kDa class I heat shock prote...  82.8    9e-17   
ref|XP_010685785.1|  PREDICTED: 17.4 kDa class I heat shock prote...  82.8    9e-17   
ref|XP_004294286.1|  PREDICTED: 18.5 kDa class I heat shock prote...  82.8    9e-17   
ref|XP_010271818.1|  PREDICTED: 17.8 kDa class I heat shock prote...  82.8    9e-17   
ref|XP_004136960.1|  PREDICTED: 22.7 kDa class IV heat shock prot...  83.6    9e-17   
ref|XP_010520294.1|  PREDICTED: 17.6 kDa class I heat shock prote...  82.8    1e-16   
sp|P19243.1|HSP11_PEA  RecName: Full=18.1 kDa class I heat shock ...  82.8    1e-16   
ref|XP_010271817.1|  PREDICTED: 17.8 kDa class I heat shock prote...  82.8    1e-16   
ref|XP_009415784.1|  PREDICTED: 16.9 kDa class I heat shock prote...  82.8    1e-16   
ref|XP_010033064.1|  PREDICTED: 18.1 kDa class I heat shock prote...  82.8    1e-16   
ref|XP_006379320.1|  hypothetical protein POPTR_0009s15010g           84.0    1e-16   
ref|XP_009344328.1|  PREDICTED: 18.1 kDa class I heat shock prote...  82.8    1e-16   
ref|XP_007207296.1|  hypothetical protein PRUPE_ppa015344mg           82.8    1e-16   
ref|XP_010041500.1|  PREDICTED: 18.1 kDa class I heat shock prote...  82.8    1e-16   
gb|EYU35315.1|  hypothetical protein MIMGU_mgv1a020002mg              82.4    1e-16   
ref|XP_010691892.1|  PREDICTED: 18.2 kDa class I heat shock prote...  82.8    1e-16   
ref|XP_008219998.1|  PREDICTED: 18.5 kDa class I heat shock prote...  82.8    1e-16   
ref|NP_001148751.1|  16.9 kDa class I heat shock protein 1            82.4    1e-16   
gb|KHN46262.1|  17.3 kDa class I heat shock protein                   82.4    1e-16   
ref|XP_003542732.1|  PREDICTED: 17.6 kDa class I heat shock prote...  82.4    1e-16   
ref|XP_010557231.1|  PREDICTED: 17.6 kDa class I heat shock prote...  82.4    1e-16   
ref|XP_006447219.1|  hypothetical protein CICLE_v10017121mg           82.0    1e-16   
ref|XP_010658493.1|  PREDICTED: 18.1 kDa class I heat shock protein   82.8    1e-16   
gb|EYU35316.1|  hypothetical protein MIMGU_mgv1a023981mg              82.4    1e-16   
gb|KFK24148.1|  hypothetical protein AALP_AAs50253U000100             80.9    1e-16   
gb|ADE77283.1|  unknown                                               82.4    1e-16   
emb|CAQ64453.1|  cytosolic class I small heat shock protein type 2    82.0    1e-16   
ref|XP_003544146.1|  PREDICTED: 18.2 kDa class I heat shock protein   82.4    1e-16   
ref|XP_009351164.1|  PREDICTED: 18.2 kDa class I heat shock prote...  82.4    1e-16   
emb|CAQ64447.1|  cytosolic class I small heat shock protein type 2    82.0    1e-16   
ref|XP_010033057.1|  PREDICTED: 18.1 kDa class I heat shock prote...  82.4    1e-16   
gb|EYU35285.1|  hypothetical protein MIMGU_mgv1a015362mg              82.4    1e-16   
ref|XP_009351173.1|  PREDICTED: 16.9 kDa class I heat shock prote...  82.4    1e-16   
emb|CAC81964.1|  small heat-shock protein                             82.4    2e-16   
gb|AAD09178.1|  cytosolic I small heat shock protein HSP17.2IA        82.0    2e-16   
emb|CDY49575.1|  BnaA10g12710D                                        82.4    2e-16   
ref|XP_002520461.1|  heat-shock protein, putative                     82.0    2e-16   
ref|XP_002298362.1|  17.4 kDa class I heat shock family protein       82.4    2e-16   
ref|XP_007159139.1|  hypothetical protein PHAVU_002G212000g           82.0    2e-16   
ref|XP_009772746.1|  PREDICTED: 18.1 kDa class I heat shock prote...  80.9    2e-16   
gb|EMS57741.1|  hypothetical protein TRIUR3_24152                     81.3    2e-16   
ref|XP_010443747.1|  PREDICTED: 18.1 kDa class I heat shock protein   82.0    2e-16   
ref|XP_008463198.1|  PREDICTED: 18.1 kDa class I heat shock prote...  82.0    2e-16   
gb|AEH30707.1|  low molecular weight heat shock protein               82.0    2e-16   
ref|XP_006281238.1|  hypothetical protein CARUB_v10027281mg           82.0    2e-16   
ref|XP_004307598.1|  PREDICTED: 18.2 kDa class I heat shock prote...  82.0    2e-16   
ref|XP_011081426.1|  PREDICTED: 18.2 kDa class I heat shock prote...  82.0    2e-16   
ref|XP_003615125.1|  class I heat shock protein                       82.0    2e-16   
ref|XP_006400925.1|  hypothetical protein EUTSA_v10015805mg           82.0    2e-16   
ref|XP_004307601.1|  PREDICTED: 18.2 kDa class I heat shock prote...  82.0    2e-16   
gb|EAY89381.1|  hypothetical protein OsI_10886                        82.0    2e-16   
gb|AAR01500.1|  cytosolic class I small heat shock protein 1A         81.6    2e-16   
emb|CDY56096.1|  BnaC02g44300D                                        82.0    2e-16   
ref|NP_001049662.1|  Os03g0267200                                     82.0    2e-16   
ref|XP_011032068.1|  PREDICTED: 18.1 kDa class I heat shock prote...  82.0    2e-16   
gb|AAR01504.1|  cytosolic class I small heat shock protein 1A         81.6    2e-16   
ref|XP_007137745.1|  hypothetical protein PHAVU_009G152400g           81.6    2e-16   
emb|CDP22094.1|  unnamed protein product                              81.3    2e-16   
gb|AAR01506.1|  cytosolic class I small heat shock protein 1B         81.3    2e-16   
gb|ADR30404.1|  17.3 kDa heat shock protein                           82.0    2e-16   
emb|CAQ64449.1|  cytosolic class I small heat shock protein type 2    81.3    2e-16   
ref|XP_008234050.1|  PREDICTED: 17.8 kDa class I heat shock prote...  82.4    2e-16   
gb|KDP42160.1|  hypothetical protein JCGZ_02890                       81.6    2e-16   



>gb|KDP37793.1| hypothetical protein JCGZ_06695 [Jatropha curcas]
Length=194

 Score =   144 bits (363),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 86/95 (91%), Gaps = 1/95 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGDHWHR ER +GKFWR+F+LP+N DLDSVKA+LENGVLT+
Sbjct  100  VEENRVLRVSGERKREEEKKGDHWHRVERSYGKFWRQFKLPDNVDLDSVKAKLENGVLTL  159

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEINEA-AKQEL  282
            SF+KL+PD++K P+VVSI GE+ A + ++ AKQEL
Sbjct  160  SFSKLSPDKIKGPRVVSIAGEENAMLTDSGAKQEL  194



>ref|XP_010674892.1| PREDICTED: 22.0 kDa class IV heat shock protein [Beta vulgaris 
subsp. vulgaris]
Length=201

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGDHWHR ER +GKFWR+FRLPEN DLD+VKA+LENGVL+I
Sbjct  101  VEENRVLRVSGERKREEEKKGDHWHRSERCYGKFWRKFRLPENVDLDAVKAKLENGVLSI  160

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEINEAAKQE  279
            +  KL+PD++K P+VVS+EG    E+ + A  +
Sbjct  161  NLVKLSPDKIKGPRVVSVEGGSENEMLKVASTD  193



>ref|XP_006441858.1| hypothetical protein CICLE_v10022300mg [Citrus clementina]
 gb|ESR55098.1| hypothetical protein CICLE_v10022300mg [Citrus clementina]
Length=203

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 82/96 (85%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGD WHR ER HGKFWR+F+LP+N DLDSV+A+LENGVLT+
Sbjct  108  VEENRVLRVSGERKREEEKKGDQWHRVERSHGKFWRQFKLPDNVDLDSVQAKLENGVLTL  167

Query  181  SFAKLAPDRVKVPKVVSIEG--EKPAEINEAAKQEL  282
            S  KL+PD++K P+VV I G  ++PA++   A+QEL
Sbjct  168  SLKKLSPDQIKGPRVVGIAGGEDEPAKLQSEARQEL  203



>gb|KDO42942.1| hypothetical protein CISIN_1g028798mg [Citrus sinensis]
Length=203

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 82/96 (85%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGD WHR ER HGKFWR+F+LP+N DLDSV+A+LENGVLT+
Sbjct  108  VEENRVLRVSGERKREEEKKGDQWHRVERSHGKFWRQFKLPDNVDLDSVQAKLENGVLTL  167

Query  181  SFAKLAPDRVKVPKVVSIEG--EKPAEINEAAKQEL  282
            S  KL+PD++K P+VV I G  ++PA++   A+QEL
Sbjct  168  SLKKLSPDQIKGPRVVGIAGGEDEPAKLQSEARQEL  203



>ref|XP_007143922.1| hypothetical protein PHAVU_007G113700g [Phaseolus vulgaris]
 gb|ESW15916.1| hypothetical protein PHAVU_007G113700g [Phaseolus vulgaris]
Length=192

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 81/97 (84%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGDHWHR ER +GKFWR+FRLP+N DLDSVKA+LENGVLT+
Sbjct  96   VEENRVLRVSGERKREEEKKGDHWHRVERSYGKFWRQFRLPQNVDLDSVKAKLENGVLTL  155

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEI---NEAAKQEL  282
            +  KL+P+++K P+VVSI GE   +     + AKQEL
Sbjct  156  TLDKLSPEKIKGPRVVSIAGEDQQQAKLSTDGAKQEL  192



>ref|XP_007200247.1| hypothetical protein PRUPE_ppa015151mg [Prunus persica]
 ref|XP_008232532.1| PREDICTED: 22.0 kDa class IV heat shock protein [Prunus mume]
 gb|EMJ01446.1| hypothetical protein PRUPE_ppa015151mg [Prunus persica]
Length=200

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 6/100 (6%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE NRVLRVSGER+REE+KKGDHWHR ER +GKFWR+FRLPEN DLDSV A+LENGVLT+
Sbjct  101  VEANRVLRVSGERKREEEKKGDHWHRVERSYGKFWRQFRLPENVDLDSVNAKLENGVLTL  160

Query  181  SFAKLAPDRVKVPKVVSIEG-----EKPAEINEA-AKQEL  282
            + AKL+PD++K PKV+SI       ++PA++  +  KQEL
Sbjct  161  TLAKLSPDKIKGPKVISIASTGGHEDEPAQLKASEVKQEL  200



>ref|XP_007020057.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
 gb|EOY17282.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
Length=191

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 83/98 (85%), Gaps = 4/98 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KK DHWHR ER +GKFWR+FRLP+N DLD+VKA+LE+GVL +
Sbjct  94   VEENRVLRVSGERKREEEKKCDHWHRVERSYGKFWRQFRLPDNVDLDTVKAKLEDGVLIL  153

Query  181  SFAKLAPDRVKVPKVVSIEG---EKPAEINEA-AKQEL  282
            S AKL+PD++K P+VVSI G    +PA++  + AKQEL
Sbjct  154  SLAKLSPDKIKGPRVVSIAGGDANEPAKLKSSEAKQEL  191



>ref|XP_006478285.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Citrus 
sinensis]
Length=203

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGD WHR ER HGKFWR+F+LP+N DLDSV+A+LENGVLT+
Sbjct  108  VEENRVLRVSGERKREEEKKGDQWHRVERSHGKFWRQFKLPDNVDLDSVQAKLENGVLTL  167

Query  181  SFAKLAPDRVKVPKVVSIEG--EKPAEINEAAKQEL  282
            S  KL+PD++K P+VV I G  ++ A++   A+QEL
Sbjct  168  SLKKLSPDQIKGPRVVGIAGGEDETAKLQSEARQEL  203



>ref|XP_010542493.1| PREDICTED: 22.0 kDa heat shock protein [Tarenaya hassleriana]
Length=201

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 83/97 (86%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            + E+RVLRVSGER+REE+KKGDHWHR ER +GKFWR+F+LP+N DLDSVKA+LE+GVLTI
Sbjct  104  IGESRVLRVSGERKREEEKKGDHWHRVERSYGKFWRQFKLPDNVDLDSVKAKLEDGVLTI  163

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEA-AKQEL  282
            +  KL+PD++K PKVVSI+ E  +P+++  +  KQEL
Sbjct  164  NLTKLSPDKIKGPKVVSIDAEENEPSKLKSSQTKQEL  200



>ref|XP_010470252.1| PREDICTED: 22.0 kDa heat shock protein-like [Camelina sativa]
Length=150

 Score =   128 bits (322),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 78/91 (86%), Gaps = 4/91 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  55   VEENRVLRVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  114

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEINEAAK  273
            +  KL+PD+VK P+VV+I    PAE ++ AK
Sbjct  115  NLTKLSPDQVKGPRVVNI----PAEEDQTAK  141



>ref|XP_011013596.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Populus 
euphratica]
Length=192

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 83/96 (86%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +++NRVLRVSGER+REE+KKGDHWHR ER +GKF R+F+LPEN DLDSVKA+LENGVL +
Sbjct  97   IDQNRVLRVSGERKREEEKKGDHWHRVERSYGKFIRQFKLPENVDLDSVKAKLENGVLML  156

Query  181  SFAKLAPDRVKVPKVVSIE-GEKPAEIN-EAAKQEL  282
            SF+ L+ D++K P VVSIE GE+PA++  + AKQEL
Sbjct  157  SFSNLSIDKIKGPTVVSIEGGEEPAKLKIDEAKQEL  192



>ref|XP_009371038.1| PREDICTED: 22.0 kDa class IV heat shock protein [Pyrus x bretschneideri]
Length=204

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE KKGDHWHR ER +GKFWRRF+LPEN DLDS+ A+LENGVLT+
Sbjct  102  VEENRVLRVSGERKREEDKKGDHWHRVERSYGKFWRRFKLPENVDLDSINAKLENGVLTV  161

Query  181  SFAKLAPDRVK-VPKVVSI  234
            + AKL+PD++K  P+V+SI
Sbjct  162  TLAKLSPDKIKATPRVISI  180



>gb|AEL00035.1| HSP22 [Raphanus sativus]
Length=197

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRVL VSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  102  VEDNRVLSVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  161

Query  181  SFAKLAPDRVKVPKVVSI--EGEKPAEINEAAKQEL  282
            +  KLAP++VK P+VV+I  E ++ A+IN +  +EL
Sbjct  162  NLTKLAPEKVKCPRVVNILAEEDQTAKINSSESKEL  197



>gb|KEH42837.1| 22.0 kDa class IV heat shock protein [Medicago truncatula]
Length=196

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 80/96 (83%), Gaps = 8/96 (8%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER++EE+K+GDHWHR ER +GKFWR+FRLPEN DLDSVKA++ENGVLT+
Sbjct  107  VEENRVLRVSGERKKEEEKQGDHWHRVERSYGKFWRQFRLPENVDLDSVKAKMENGVLTL  166

Query  181  SFAKLAPDRVKVPKVVSI--EGEKPAEINEAAKQEL  282
            +  KL+ D++K P++VSI  E EKP      +KQEL
Sbjct  167  TLNKLSHDKIKGPRMVSIAEEDEKP------SKQEL  196



>ref|XP_006289058.1| hypothetical protein CARUB_v10002455mg [Capsella rubella]
 gb|EOA21956.1| hypothetical protein CARUB_v10002455mg [Capsella rubella]
Length=194

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+K GD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  99   VEENRVLRVSGERKREEEKNGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  158

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KL+PD+VK P+VV+I  E  + A+I+ +  +EL
Sbjct  159  NLTKLSPDQVKGPRVVNIAAEEDQTAKISSSESKEL  194



>ref|XP_006397087.1| hypothetical protein EUTSA_v10029237mg [Eutrema salsugineum]
 gb|ESQ38540.1| hypothetical protein EUTSA_v10029237mg [Eutrema salsugineum]
Length=197

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D+DSVKA+LENGVLTI
Sbjct  102  VEENRVLRVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMDSVKAKLENGVLTI  161

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KL+P++VK P+VV+I  E  + A+I+ +  +EL
Sbjct  162  NLNKLSPEKVKGPRVVNIAAEEDQTAKISSSESKEL  197



>ref|XP_003622354.1| 22.7 kDa class IV heat shock protein [Medicago truncatula]
Length=187

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 80/96 (83%), Gaps = 8/96 (8%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER++EE+K+GDHWHR ER +GKFWR+FRLPEN DLDSVKA++ENGVLT+
Sbjct  98   VEENRVLRVSGERKKEEEKQGDHWHRVERSYGKFWRQFRLPENVDLDSVKAKMENGVLTL  157

Query  181  SFAKLAPDRVKVPKVVSI--EGEKPAEINEAAKQEL  282
            +  KL+ D++K P++VSI  E EKP      +KQEL
Sbjct  158  TLNKLSHDKIKGPRMVSIAEEDEKP------SKQEL  187



>ref|XP_002872502.1| ATHSP22.0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48761.1| ATHSP22.0 [Arabidopsis lyrata subsp. lyrata]
Length=195

 Score =   127 bits (318),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  100  VEENRVLRVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  159

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KL+P++VK P+VV+I  E  + A+I+ +  +EL
Sbjct  160  NLTKLSPEKVKGPRVVNIAAEEDQTAKISSSESKEL  195



>gb|KFK32008.1| hypothetical protein AALP_AA6G188000 [Arabis alpina]
Length=197

 Score =   125 bits (315),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  102  VEENRVLRVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  161

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  K++P++VK P+VV+I  E  + A+I+ +  +EL
Sbjct  162  NLTKMSPEKVKGPRVVNIAAEEDQTAKISSSESKEL  197



>ref|XP_008372421.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Malus domestica]
Length=206

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE KKGDHWHR ER +GKFWRRF+LPEN DLDS+ A+LENGVLT+
Sbjct  102  VEENRVLRVSGERKREEDKKGDHWHRVERSYGKFWRRFKLPENVDLDSINAKLENGVLTV  161

Query  181  SFAKLAPDRVK-VPKVVSI  234
            + AKL+PD++K   +V+SI
Sbjct  162  TLAKLSPDKIKAATRVISI  180



>ref|XP_010455425.1| PREDICTED: 22.0 kDa heat shock protein-like [Camelina sativa]
Length=194

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVL VSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  99   VEENRVLWVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  158

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KL+PD+VK P+VV+I  E  + A+I+ +  +EL
Sbjct  159  NLTKLSPDQVKGPRVVNIAAEEGQTAKISSSESKEL  194



>gb|AEL00027.1| HSP22 [Brassica juncea]
 gb|AEL00033.1| HSP22 [Brassica juncea]
 gb|AEL00034.1| HSP22 [Brassica juncea]
Length=197

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVL VSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  102  VEENRVLSVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  161

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KLAP++VK P+VV+I  E  + A+I+ +  +EL
Sbjct  162  NLTKLAPEKVKGPRVVNIAAEEDQTAKISSSESKEL  197



>ref|XP_009134184.1| PREDICTED: 22.0 kDa heat shock protein [Brassica rapa]
 gb|AEL00028.1| HSP22 [Brassica rapa subsp. pekinensis]
 gb|AEL00029.1| HSP22 [Brassica rapa subsp. chinensis]
 gb|AEL00030.1| HSP22 [Brassica oleracea var. capitata]
 gb|AHM23827.1| heat shock protein 22 [Brassica rapa]
 emb|CDX90748.1| BnaA03g24280D [Brassica napus]
Length=197

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVL VSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  102  VEENRVLSVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  161

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KLAP++VK P+VV+I  E  + A+I+ +  +EL
Sbjct  162  NLTKLAPEKVKGPRVVNIAAEEDQTAKISSSESKEL  197



>gb|AEL00032.1| HSP22 [Brassica napus]
Length=197

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVL VSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  102  VEENRVLSVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  161

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KLAP++VK P+VV+I  E  + A+I+ +  +EL
Sbjct  162  NLTKLAPEKVKGPRVVNIAAEEDQTAKISSSESKEL  197



>ref|XP_010421943.1| PREDICTED: 22.0 kDa heat shock protein isoform X1 [Camelina sativa]
 ref|XP_010421944.1| PREDICTED: 22.0 kDa heat shock protein isoform X2 [Camelina sativa]
Length=194

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA LENGVLTI
Sbjct  99   VEENRVLRVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAYLENGVLTI  158

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +  KL+PD+VK P+VV+I  E
Sbjct  159  NLTKLSPDQVKGPRVVNIAAE  179



>gb|ACN29310.1| unknown [Zea mays]
 tpg|DAA37620.1| TPA: class IV heat shock protein [Zea mays]
Length=208

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRVLRVSGERRR E++KGDHWHREER +G+FWRRFRLPENADLDSV A L++GVLT+
Sbjct  103  VEDNRVLRVSGERRRAEERKGDHWHREERSYGRFWRRFRLPENADLDSVAASLDSGVLTV  162

Query  181  SFAKLAPDRVKVPKVVSIE-GEKPAEINEA  267
             F KLAP+++K P+VV I  G+  AE  E+
Sbjct  163  RFRKLAPEQIKGPRVVGIAGGDGGAEAKES  192



>gb|AEL00031.1| HSP22 [Brassica napus]
 emb|CDY05088.1| BnaC03g28860D [Brassica napus]
Length=197

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVL VSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  102  VEENRVLSVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  161

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KLAP++VK P+VV+I  E  + A+I+ +  +EL
Sbjct  162  NLTKLAPEKVKGPRVVNIAAEEDQTAKISSSESKEL  197



>gb|AEL00036.1| HSP22 [Brassica oleracea]
Length=197

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVL VSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  102  VEENRVLSVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  161

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KLAP++VK P+VV+I  E  + A+I+ +  +EL
Sbjct  162  NLTKLAPEKVKGPRVVNIAAEEDQTAKISSSESKEL  197



>sp|P19244.1|HSP41_PEA RecName: Full=22.7 kDa class IV heat shock protein; Flags: Precursor 
[Pisum sativum]
 gb|AAA33673.1| 22.7 kDa heat shock protein (hsp22.7) [Pisum sativum]
Length=197

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 77/88 (88%), Gaps = 2/88 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER++EE KKGDHWHR ER +GKFWR+F+LP+N DLDSVKA++ENGVLT+
Sbjct  104  VEENRVLRVSGERKKEEDKKGDHWHRVERSYGKFWRQFKLPQNVDLDSVKAKMENGVLTL  163

Query  181  SFAKLAPDRVKVPKVVSI--EGEKPAEI  258
            +  KL+ D++K P++VSI  E +KP++I
Sbjct  164  TLHKLSHDKIKGPRMVSIVEEDDKPSKI  191



>ref|XP_004975738.1| PREDICTED: 23.2 kDa heat shock protein-like [Setaria italica]
Length=216

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRVLRVSGERRR E++KGDHWHREER +G+FWR+FRLPENADLDSV A L+NGVLT+
Sbjct  108  VEDNRVLRVSGERRRAEEQKGDHWHREERSYGRFWRQFRLPENADLDSVAASLDNGVLTV  167

Query  181  SFAKLAPDRVKVPKVVSI  234
             F KLAP+++K P+VV I
Sbjct  168  RFRKLAPEQIKGPRVVGI  185



>ref|XP_003622351.1| 22.7 kDa class IV heat shock protein [Medicago truncatula]
 gb|KEH42834.1| 22.0 kDa class IV heat shock protein [Medicago truncatula]
Length=193

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 8/96 (8%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER++EE+K+GDHWHR ER +GKFWR+FRLPEN DLDSVKA++ENGVLT+
Sbjct  104  VEENRVLRVSGERKKEEEKQGDHWHRVERSYGKFWRQFRLPENVDLDSVKAKMENGVLTL  163

Query  181  SFAKLAPDRVKVPKVVSI--EGEKPAEINEAAKQEL  282
            +  KL+ D+ K P++VSI  E E P      +KQEL
Sbjct  164  TLNKLSQDKTKGPRMVSIAEESEHP------SKQEL  193



>gb|AEL00026.1| HSP22 [Capsella bursa-pastoris]
Length=197

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVL VSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  102  VEENRVLSVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  161

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KLAP++VK P+VV+I  E  + A+I+    +EL
Sbjct  162  NLTKLAPEKVKGPRVVNIAAEEDQTAKISSPESKEL  197



>ref|NP_001275139.1| uncharacterized protein LOC102577794 precursor [Solanum tuberosum]
 gb|AAB30525.1| small heat-shock protein homolog [Solanum tuberosum]
Length=197

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 2/84 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKG--DHWHREERVHGKFWRRFRLPENADLDSVKARLENGVL  174
            +EENRVLRVSGER++EE+K    +HWH  ER +GKFWR+FRLPENAD+D++KA+LENGVL
Sbjct  103  IEENRVLRVSGERKKEEEKNDEQNHWHCVERSYGKFWRQFRLPENADIDTMKAKLENGVL  162

Query  175  TISFAKLAPDRVKVPKVVSIEGEK  246
            TISFAKL+ DR+K PKVVSIE ++
Sbjct  163  TISFAKLSADRIKGPKVVSIESKQ  186



>ref|XP_008459498.1| PREDICTED: 22.0 kDa class IV heat shock protein [Cucumis melo]
Length=189

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 80/97 (82%), Gaps = 4/97 (4%)
 Frame = +1

Query  4    EENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTIS  183
            EENRVL+V GER+REE+K+ DHWHR ER +GKFWR+ RLP NADL+SVKA+LENGVL I+
Sbjct  93   EENRVLKVIGERKREEEKQSDHWHRLERSYGKFWRQLRLPVNADLESVKAKLENGVLKIT  152

Query  184  FAKLAPDRVKVPKVVSIEGEKP--AEINE--AAKQEL  282
             +KL+P+++K P+VV I  E+P   EIN+  AAKQEL
Sbjct  153  LSKLSPEKIKGPRVVGILDEQPPAGEINKSGAAKQEL  189



>ref|XP_006350340.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Solanum 
tuberosum]
Length=197

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 74/84 (88%), Gaps = 2/84 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKG--DHWHREERVHGKFWRRFRLPENADLDSVKARLENGVL  174
            +EENRVLRVSGER++EE+K    +HWH  ER +GKFWR+FRLPENAD+D++KA+LENGVL
Sbjct  103  IEENRVLRVSGERKKEEEKNDEQNHWHCVERSYGKFWRQFRLPENADIDTMKAKLENGVL  162

Query  175  TISFAKLAPDRVKVPKVVSIEGEK  246
            TISFAKL+ DR+K PKVVSIE ++
Sbjct  163  TISFAKLSADRIKGPKVVSIESKQ  186



>ref|NP_192763.1| heat shock protein 22 [Arabidopsis thaliana]
 sp|Q38806.1|HSP22_ARATH RecName: Full=22.0 kDa heat shock protein; Short=AtHsp22.0; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAA19931.1| AtHSP22.0 [Arabidopsis thaliana]
 gb|AAC62802.1| contains similarity to heat shock hsp20 proteins (Pfam: PF00011, 
E=1.2e-46 [Arabidopsis thaliana]
 emb|CAB39778.1| heat shock protein 22.0 [Arabidopsis thaliana]
 emb|CAB78148.1| heat shock protein 22.0 [Arabidopsis thaliana]
 gb|AAO44068.1| At4g10250 [Arabidopsis thaliana]
 dbj|BAE99751.1| heat shock protein 22.0 [Arabidopsis thaliana]
 gb|AEE82859.1| heat shock protein 22 [Arabidopsis thaliana]
 prf||2106413A small heat shock protein
Length=195

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEEN VLRVSGER+REE+KKGD WHR ER +GKFWR+F+LP+N D++SVKA+LENGVLTI
Sbjct  100  VEENGVLRVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI  159

Query  181  SFAKLAPDRVKVPKVVSIEGE--KPAEINEAAKQEL  282
            +  KL+P++VK P+VV+I  E  + A+I+ +  +EL
Sbjct  160  NLTKLSPEKVKGPRVVNIAAEEDQTAKISSSESKEL  195



>ref|XP_007152427.1| hypothetical protein PHAVU_004G129400g [Phaseolus vulgaris]
 gb|ESW24421.1| hypothetical protein PHAVU_004G129400g [Phaseolus vulgaris]
Length=186

 Score =   123 bits (308),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE NRVLRVSGER+ EE+++GDHWHR ER +GKFWR+F++P+N D DS+KA+LENGVLT+
Sbjct  99   VEGNRVLRVSGERKMEEEREGDHWHRVERSYGKFWRQFKVPDNVDFDSLKAKLENGVLTL  158

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            + AKL+PD++KVP+V SI G+
Sbjct  159  TMAKLSPDKIKVPRVTSIAGD  179



>ref|XP_002446542.1| hypothetical protein SORBIDRAFT_06g017850 [Sorghum bicolor]
 gb|EES10870.1| hypothetical protein SORBIDRAFT_06g017850 [Sorghum bicolor]
Length=228

 Score =   124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRVLRVSGERRR E++KGDHWHREER +G+FWR+FRLPENADLDSV A L+NGVLT+
Sbjct  106  VEDNRVLRVSGERRRVEEQKGDHWHREERSYGRFWRQFRLPENADLDSVAASLDNGVLTV  165

Query  181  SFAKLAPDRVKVPKVVSI  234
             F KLAP+++K P+VV I
Sbjct  166  RFRKLAPEQIKGPRVVGI  183



>ref|XP_009415020.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Musa acuminata 
subsp. malaccensis]
Length=203

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENR+LRVSGER+REE+KK +HWHR ER +GKFWR+FRLP+NADLDSV A+LE+GVLT+
Sbjct  102  VEENRILRVSGERQREEEKKDEHWHRVERSYGKFWRQFRLPDNADLDSVSAKLEDGVLTV  161

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            +  KLAP++++ P+VVSI G
Sbjct  162  ALPKLAPEKIRGPRVVSIAG  181



>ref|NP_001151139.1| 22.0 kDa class IV heat shock protein precursor [Zea mays]
 gb|ACG41748.1| 22.0 kDa class IV heat shock protein precursor [Zea mays]
Length=208

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRVLRVSGERRR E++KGDHWHREER +G+FWRRFRLPENADL SV A L++GVLT+
Sbjct  103  VEDNRVLRVSGERRRAEERKGDHWHREERSYGRFWRRFRLPENADLXSVAASLDSGVLTV  162

Query  181  SFAKLAPDRVKVPKVVSIEG  240
             F KLAP+++K P+VV I G
Sbjct  163  RFRKLAPEQIKGPRVVGIAG  182



>gb|ACB71397.1| ER-localized small heat-shock protein [Morus bombycis]
Length=191

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 79/103 (77%), Gaps = 9/103 (9%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENR+LRVSGER+ E+ +K DHWHR ER  GKFWR+FRLPEN DLDS+KA+LE+GVLT+
Sbjct  89   VEENRLLRVSGERKSEKVRKEDHWHRVERCQGKFWRQFRLPENVDLDSIKAKLEDGVLTL  148

Query  181  SFAKLAPDRVKVPKVVSIEG-----EKPAEIN----EAAKQEL  282
            +  KL+PD++K P+VV+I G     ++   IN    + AKQEL
Sbjct  149  TLHKLSPDKIKGPRVVNIAGSSDNHDQHGNINISAGDQAKQEL  191



>gb|ACO06861.2| endoplasmic reticulum sHSP protein [Capsicum annuum var. annuum]
Length=200

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 7/99 (7%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGD-----HWHREERVHGKFWRRFRLPENADLDSVKARLEN  165
            +EENRVLRVSGER++E+Q++       HWH  ER +GKFWR+FRLPENAD+D++KA+LEN
Sbjct  104  IEENRVLRVSGERKKEQQQQDINDDDNHWHCVERSYGKFWRQFRLPENADIDTLKAKLEN  163

Query  166  GVLTISFAKLAPDRVKVPKVVSIEGEKPAEINEAAKQEL  282
            GVLTISF KL+PDR+K P VVSIEG+       +AK+EL
Sbjct  164  GVLTISFTKLSPDRIKGPIVVSIEGKD--SYVSSAKEEL  200



>ref|NP_001236586.1| uncharacterized protein LOC100526965 precursor [Glycine max]
 gb|ACU15999.1| unknown [Glycine max]
Length=192

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 81/97 (84%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER++EE+KKGDHWHR ER +GKFWR+FRLP+N DLDSVKA+LENGVLT+
Sbjct  96   VEENRVLRVSGERKKEEEKKGDHWHRVERSYGKFWRQFRLPQNVDLDSVKAKLENGVLTL  155

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAE---INEAAKQEL  282
            +  KL+P ++K P+VVSI GE   +    N+ AKQEL
Sbjct  156  TLDKLSPGKIKGPRVVSIAGEDHQQGNLNNDGAKQEL  192



>sp|P30236.1|HSP41_SOYBN RecName: Full=22.0 kDa class IV heat shock protein; Flags: Precursor 
[Glycine max]
 emb|CAA44882.1| heat shock protein [Glycine max]
Length=192

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 81/97 (84%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER++EE+KKGDHWHR ER +GKFWR+FRLP+N DLDSVKA+LENGVLT+
Sbjct  96   VEENRVLRVSGERKKEEEKKGDHWHRVERSYGKFWRQFRLPQNVDLDSVKAKLENGVLTL  155

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAE---INEAAKQEL  282
            +  KL+P ++K P+VVSI GE   +    N+ AKQEL
Sbjct  156  TLDKLSPGKIKGPRVVSIAGEDHQQGNLNNDGAKQEL  192



>gb|KHN30529.1| 22.0 kDa class IV heat shock protein [Glycine soja]
Length=195

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 81/97 (84%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER++EE+KKGDHWHR ER +GKFWR+FRLP+N DLDSVKA++ENGVLT+
Sbjct  99   VEENRVLRVSGERKKEEEKKGDHWHRVERSYGKFWRQFRLPQNVDLDSVKAKMENGVLTL  158

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEIN---EAAKQEL  282
            +  KL+PD++K P++VSI GE   + N   +  KQEL
Sbjct  159  TLDKLSPDKIKGPRLVSIAGEDQQQGNLNSDGVKQEL  195



>gb|AFW58362.1| class IV heat shock protein [Zea mays]
Length=217

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 80/108 (74%), Gaps = 5/108 (5%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
            +RVLRVSGERRR E+ +GDHWHREER HG+FWR+FRLPENADLDSV A L+NGVLT+ F 
Sbjct  114  SRVLRVSGERRRAEEHRGDHWHREERSHGRFWRQFRLPENADLDSVGASLDNGVLTVRFR  173

Query  190  KLAPDRVKVPKVVSIEGEKPAEINEAAKQEL**WTGSGLAYYYTNSIE  333
            KLAP++VK P+VV I      + +  AK+ +    G+G  ++ T  +E
Sbjct  174  KLAPEQVKGPRVVGI---AGGDGDGDAKKSI--GGGAGDGHHQTKKVE  216



>ref|XP_002519933.1| heat-shock protein, putative [Ricinus communis]
 gb|EEF42537.1| heat-shock protein, putative [Ricinus communis]
Length=172

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 80/97 (82%), Gaps = 5/97 (5%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            ENRVLRVSGER++EE+KKGD WHR ER +GKFWR+FRLP+N DLDSVKA+LENGVLT+S 
Sbjct  76   ENRVLRVSGERKKEEEKKGDQWHRVERSYGKFWRQFRLPDNVDLDSVKAKLENGVLTLSL  135

Query  187  AKLAPDRVKVPKVVSIEG--EKPAEI---NEAAKQEL  282
             KL+PD++K P+VVSI G  EKP  +   N  AKQEL
Sbjct  136  NKLSPDKIKGPRVVSIAGEEEKPEPVKLNNNDAKQEL  172



>ref|XP_004141518.1| PREDICTED: 22.0 kDa heat shock protein-like [Cucumis sativus]
 ref|XP_004163736.1| PREDICTED: 22.0 kDa heat shock protein-like [Cucumis sativus]
 gb|KGN52600.1| hypothetical protein Csa_5G646740 [Cucumis sativus]
Length=189

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 78/97 (80%), Gaps = 4/97 (4%)
 Frame = +1

Query  4    EENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTIS  183
            EENRVL+V GER+REE+K+ DHWHR ER +GKFWR+ RLP NADL+SVKA+LENGVL IS
Sbjct  93   EENRVLKVIGERKREEEKQSDHWHRLERSYGKFWRQLRLPVNADLESVKAKLENGVLKIS  152

Query  184  FAKLAPDRVKVPKVVSIEGEKP--AEINE--AAKQEL  282
              KL+ +++K P+VV I  E+P   E+N+  AAKQEL
Sbjct  153  LLKLSQEKIKGPRVVGILDEQPPAGEMNKSGAAKQEL  189



>ref|NP_001149613.1| 22.0 kDa class IV heat shock protein precursor [Zea mays]
 gb|ACG36086.1| 22.0 kDa class IV heat shock protein precursor [Zea mays]
Length=232

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 5/112 (4%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
            +RVLRVSGERRR E+ +GDHWHREER HG+FWR+FRLPENADLDSV A L+NGVLT+ F 
Sbjct  114  SRVLRVSGERRRAEEHRGDHWHREERSHGRFWRQFRLPENADLDSVGASLDNGVLTVRFR  173

Query  190  KLAPDRVKVPKVVSIEGEKPAEINEAAKQEL**WTGSGLAYYYTNSIE*FHS  345
            KLAP++VK P+VV I      + +  AK+ +    G+G  ++ T  +E  +S
Sbjct  174  KLAPEQVKGPRVVGI---AGGDGDGDAKKSI--GGGAGDGHHQTKKVELLNS  220



>ref|XP_009781711.1| PREDICTED: 22.0 kDa class IV heat shock protein [Nicotiana sylvestris]
 gb|AIL30504.1| small heat shock protein [Nicotiana tabacum]
Length=198

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (84%), Gaps = 2/92 (2%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDH--WHREERVHGKFWRRFRLPENADLDSVKARLENGVLTIS  183
            NRVLRVSGER++EE+ K DH  WH  ER +GKF R+FRLPENAD+D++KA+LENGVLTIS
Sbjct  105  NRVLRVSGERKKEEENKDDHIHWHCVERSYGKFLRQFRLPENADIDTLKAKLENGVLTIS  164

Query  184  FAKLAPDRVKVPKVVSIEGEKPAEINEAAKQE  279
            FAKL+PD++K PKVV+IE ++  + + A+ +E
Sbjct  165  FAKLSPDKIKGPKVVAIETKEEGKNSSASVKE  196



>ref|XP_008382664.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Malus domestica]
Length=221

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER++EE KKGDHWHR ER +GKFWRRFRLPEN DLDSV+A+LENGVLT+
Sbjct  102  VEENRVLRVSGERKKEEDKKGDHWHRVERSYGKFWRRFRLPENVDLDSVEAKLENGVLTV  161

Query  181  SFAKLAPDRVK-VPKV  225
            + AKL+P  +K  P+V
Sbjct  162  TLAKLSPHTIKATPRV  177



>ref|XP_002519929.1| heat-shock protein, putative [Ricinus communis]
 gb|EEF42533.1| heat-shock protein, putative [Ricinus communis]
Length=192

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 81/97 (84%), Gaps = 5/97 (5%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            ENRVLRVSGER++EE+KKGD WHR ER +GKFWR+FRLP+N DLDSVKA+LENGVLT+S 
Sbjct  96   ENRVLRVSGERKKEEEKKGDQWHRVERSYGKFWRQFRLPDNVDLDSVKAKLENGVLTLSL  155

Query  187  AKLAPDRVKVPKVVSIEGE----KPAEINE-AAKQEL  282
             KL+PD++K P+VVSI GE    +P ++N   AKQEL
Sbjct  156  NKLSPDKIKGPRVVSIAGEEEKPEPVKLNSNNAKQEL  192



>ref|XP_003622349.1| class IV heat shock protein [Medicago truncatula]
 gb|KEH42832.1| 22.0 kDa class IV heat shock protein [Medicago truncatula]
Length=194

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 2/89 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEEN VLRV GER++E +KKGD WHR ER +GKFWR+FRLPENADLDSVKA++ENGVLT+
Sbjct  97   VEENSVLRVIGERKKEVEKKGDRWHRAERSYGKFWRQFRLPENADLDSVKAKIENGVLTL  156

Query  181  SFAKLAPDRVKVPKVVSI--EGEKPAEIN  261
            +  KL+ D++K  +VVSI  E EK  ++N
Sbjct  157  TLNKLSHDQIKSTRVVSIDEENEKSPKVN  185



>ref|NP_001236302.1| uncharacterized protein LOC100500319 precursor [Glycine max]
 gb|ACU15358.1| unknown [Glycine max]
Length=213

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER++EE+KKGDHWHR ER +GKFWR+FRLP+N DLDSVKA++ENGVLT+
Sbjct  99   VEENRVLRVSGERKKEEEKKGDHWHRVERSYGKFWRQFRLPQNVDLDSVKAKMENGVLTL  158

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEIN  261
            +  KL+PD++K P++VSI GE   + N
Sbjct  159  TLDKLSPDKIKGPRLVSIAGEDQQQSN  185



>emb|CAH67235.1| OSIGBa0140O07.3 [Oryza sativa Indica Group]
Length=215

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 4/82 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VE+NRVLR+SGERRREE  +    GDHWHREER +G+FWR+ RLP+NADLDS+ A L+NG
Sbjct  105  VEDNRVLRISGERRREETTEQKGGGDHWHREERSYGRFWRQLRLPDNADLDSIAASLDNG  164

Query  169  VLTISFAKLAPDRVKVPKVVSI  234
            VLT+ F KLAPD++K P+VV I
Sbjct  165  VLTVRFRKLAPDQIKGPRVVGI  186



>ref|NP_001052899.1| Os04g0445100 [Oryza sativa Japonica Group]
 sp|Q7XUW5.2|HS232_ORYSJ RecName: Full=23.2 kDa heat shock protein; Short=OsHsp23.2; Flags: 
Precursor [Oryza sativa Japonica Group]
 emb|CAD40969.2| OSJNBa0027P08.9 [Oryza sativa Japonica Group]
 dbj|BAF14813.1| Os04g0445100 [Oryza sativa Japonica Group]
 gb|EAY94281.1| hypothetical protein OsI_16051 [Oryza sativa Indica Group]
 gb|EAZ30866.1| hypothetical protein OsJ_14939 [Oryza sativa Japonica Group]
 gb|ABY66168.1| HM700 protein [Oryza sativa Indica Group]
 dbj|BAG88832.1| unnamed protein product [Oryza sativa Japonica Group]
Length=215

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 4/82 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VE+NRVLR+SGERRREE  +    GDHWHREER +G+FWR+ RLP+NADLDS+ A L+NG
Sbjct  105  VEDNRVLRISGERRREETTEQKGGGDHWHREERSYGRFWRQLRLPDNADLDSIAASLDNG  164

Query  169  VLTISFAKLAPDRVKVPKVVSI  234
            VLT+ F KLAPD++K P+VV I
Sbjct  165  VLTVRFRKLAPDQIKGPRVVGI  186



>ref|XP_002319884.2| hypothetical protein POPTR_0013s09600g [Populus trichocarpa]
 gb|EEE95807.2| hypothetical protein POPTR_0013s09600g [Populus trichocarpa]
Length=228

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 83/96 (86%), Gaps = 2/96 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +++NRVLRVSGER+REE+KKGDHWHR ER +GKF R+F+LPEN DLDSVKA+LENGVL +
Sbjct  133  IDQNRVLRVSGERKREEEKKGDHWHRVERSYGKFIRQFKLPENVDLDSVKAKLENGVLIL  192

Query  181  SFAKLAPDRVKVPKVVSIE-GEKPAEI-NEAAKQEL  282
            S + L+ D++K P VVSIE GE+PA++ ++ AKQEL
Sbjct  193  SLSNLSLDKIKGPTVVSIEGGEEPAKLKSDEAKQEL  228



>ref|XP_010912722.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Elaeis 
guineensis]
Length=193

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENR+LRVSGER++EE+KKGDHWHR ER +GKFWR+FRLPEN DLD V A+LE+GVLT+
Sbjct  94   VEENRILRVSGERKKEEEKKGDHWHRVERSYGKFWRQFRLPENVDLDKVSAKLEDGVLTV  153

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            + AKLAPD++K P+VVSI G
Sbjct  154  TLAKLAPDQIKGPRVVSIAG  173



>gb|ADU55793.1| HSP20.3 [Citrullus lanatus]
Length=177

 Score =   115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +1

Query  4    EENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTIS  183
            EENR+L+V GER+REE+K+ +HWHR ER +GKFWR+FRLP NAD++SVKA+L+NGVL ++
Sbjct  92   EENRILKVIGERKREEEKQSEHWHRLERSYGKFWRQFRLPSNADMESVKAQLQNGVLKVT  151

Query  184  FAKLAPDRVKVPKVVSIEGEKP  249
             +KL+P+++K P+VV I  E+P
Sbjct  152  LSKLSPEKIKGPRVVGILDEQP  173



>ref|XP_009589993.1| PREDICTED: 22.0 kDa class IV heat shock protein [Nicotiana tomentosiformis]
Length=196

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
            NRVLRVSGER++EE+KK DHWH  ER +GKFWR+FRLPENAD+D++KA+LENGVLTISFA
Sbjct  105  NRVLRVSGERKKEEEKKDDHWHCVERSYGKFWRQFRLPENADIDTLKAKLENGVLTISFA  164

Query  190  KLAPDRVKVPKVVSIE  237
            KL+PD++K PKVV+IE
Sbjct  165  KLSPDKIKGPKVVAIE  180



>ref|XP_010063746.1| PREDICTED: 22.0 kDa class IV heat shock protein [Eucalyptus grandis]
 gb|KCW71003.1| hypothetical protein EUGRSUZ_F04109 [Eucalyptus grandis]
Length=210

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 77/86 (90%), Gaps = 1/86 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK-GDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEENRVLRVSGER+REE+++ GDHWHR ER +G+FWR+FRLPEN DLDSV+A+LE+GVLT
Sbjct  105  VEENRVLRVSGERKREEEEREGDHWHRVERSYGRFWRQFRLPENVDLDSVRAKLEDGVLT  164

Query  178  ISFAKLAPDRVKVPKVVSIEGEKPAE  255
            ++ AKLAP+++K P+VV IEGE  AE
Sbjct  165  VTMAKLAPEKIKGPRVVGIEGEARAE  190



>ref|NP_001234600.1| small heat shock protein precursor [Solanum lycopersicum]
 dbj|BAA97658.1| small heat shock protein [Solanum lycopersicum]
Length=190

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 2/84 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGD--HWHREERVHGKFWRRFRLPENADLDSVKARLENGVL  174
            +EENRVLRVSGER++EE+K  +  HWH  ER HGKFWR+FRLPENAD+D++KA+LENGVL
Sbjct  96   IEENRVLRVSGERKKEEEKNDEENHWHCVERSHGKFWRQFRLPENADIDTMKAKLENGVL  155

Query  175  TISFAKLAPDRVKVPKVVSIEGEK  246
            TISFAKL+ DR+K PKVVSIE ++
Sbjct  156  TISFAKLSADRIKGPKVVSIESKQ  179



>ref|XP_006653451.1| PREDICTED: 23.2 kDa heat shock protein-like [Oryza brachyantha]
Length=190

 Score =   113 bits (282),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGERRREE++KGDHWHREER +G+FWR+ RLP+NADLDS+ A L+NGVLT+
Sbjct  81   VEENRVLRVSGERRREEERKGDHWHREERSYGRFWRQLRLPDNADLDSIAATLDNGVLTV  140

Query  181  SFAKLAPDRVKVPKVVSI  234
             F KLAPD++K P+VV I
Sbjct  141  RFRKLAPDQIKGPRVVGI  158



>ref|XP_002263376.1| PREDICTED: 22.0 kDa class IV heat shock protein [Vitis vinifera]
Length=186

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 75/97 (77%), Gaps = 4/97 (4%)
 Frame = +1

Query  4    EENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTIS  183
            E  RVLRVSGER++EE+KKGDHWHR ER +GKFWR+FRLP N DL+ VKA+LENGVLT+S
Sbjct  90   ESQRVLRVSGERKKEEEKKGDHWHRMERSYGKFWRQFRLPNNVDLEGVKAKLENGVLTLS  149

Query  184  FAKLAPDRVKVPKVVSIEG----EKPAEINEAAKQEL  282
               L+ DR+K PKVVSI G    E P   +E +KQEL
Sbjct  150  LPNLSSDRIKGPKVVSIAGGDEEENPKLKSETSKQEL  186



>gb|KHN36477.1| 22.7 kDa class IV heat shock protein [Glycine soja]
Length=214

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE NRVLRVSGER+R+E+K+GDHWHR ER +GKFWR+F++P+N DLD VKA++EN VLT+
Sbjct  118  VEGNRVLRVSGERKRKEEKEGDHWHRVERSYGKFWRQFKVPDNVDLDFVKAKMENRVLTL  177

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +   L+P++VK P++VSI G+
Sbjct  178  TMNNLSPNKVKGPRLVSIAGD  198



>ref|XP_006606825.1| PREDICTED: uncharacterized protein LOC100807920 [Glycine max]
Length=376

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE NRVLRVSGER+R+E+K+GDHWHR ER +GKFWR+F++P+N DLD VKA++EN VLT+
Sbjct  280  VEGNRVLRVSGERKRKEEKEGDHWHRVERSYGKFWRQFKVPDNVDLDFVKAKMENRVLTL  339

Query  181  SFAKLAPDRVKVPKVVSIEGEK---PAEINEAAKQEL  282
            +   L+P++VK P++VSI G+    P       KQEL
Sbjct  340  TMNNLSPNKVKGPRLVSIAGDDEQAPKLKGNEDKQEL  376



>ref|XP_004495437.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Cicer arietinum]
Length=196

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRVLRVSGER++EE+KKGDHWHR ER +GKFWR+FRLPEN DLDSVKA++ENGVLT+
Sbjct  103  VEQNRVLRVSGERKKEEEKKGDHWHRVERSYGKFWRQFRLPENVDLDSVKAKMENGVLTL  162

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEINEAAKQEL  282
            +  KL+ D++K P++V+I  +         KQEL
Sbjct  163  TLDKLSRDKIKGPRLVTIANDGENHQPSKFKQEL  196



>ref|XP_010252436.1| PREDICTED: 22.0 kDa class IV heat shock protein [Nelumbo nucifera]
Length=199

 Score =   110 bits (275),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER++EE+KKG+HWHR +R HGKFWR+FRLP+N DL+SVKA+LE+GVLTI
Sbjct  96   VEENRVLRVSGERKKEEEKKGEHWHRVKRSHGKFWRQFRLPKNVDLESVKAKLEDGVLTI  155

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEINEAA  270
            S AKL+PD++K P+VV IEG++  + N+ +
Sbjct  156  SLAKLSPDQIKGPRVVGIEGDEGEQANKLS  185



>ref|XP_009594185.1| PREDICTED: 22.0 kDa heat shock protein-like [Nicotiana tomentosiformis]
Length=188

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLR+SGER+ EE+ +G+ WHR ER  GKFWR+FRLP+NADL+ +KA LENGVL I
Sbjct  91   VEENRVLRISGERKTEEEVEGEKWHRAERTSGKFWRQFRLPKNADLEQIKAHLENGVLNI  150

Query  181  SFAKLAPDRVKVPKVVSIEGEKPA  252
            +  KLA +  K PKV+SI  ++ A
Sbjct  151  TVPKLAEEEKKQPKVISISEQRNA  174



>gb|KHN24436.1| 22.0 kDa heat shock protein [Glycine soja]
Length=112

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE NRVLRVSGER+REE+K+GDHWHR ER +GKFWR+F++P+N DLDSVKA++ENGVLT+
Sbjct  16   VEGNRVLRVSGERKREEEKEGDHWHRVERSYGKFWRQFKVPDNVDLDSVKAKMENGVLTL  75

Query  181  SFAKLAPDRVKVPKVVSIEGEK---PAEINEAAKQEL  282
            +  KL+PD+VK P++VSI G+    P    +  KQEL
Sbjct  76   TMNKLSPDKVKGPRLVSIAGDDEQAPKLKGKEDKQEL  112



>ref|XP_003579829.1| PREDICTED: 23.2 kDa heat shock protein-like [Brachypodium distachyon]
Length=218

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 3/83 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQK---KGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGV  171
            VE+NRVLR+SGERRRE      KGDHWHREER +GKFWR+ RLP+NADLDS+ A LENGV
Sbjct  113  VEDNRVLRISGERRRETTTEERKGDHWHREERSYGKFWRQMRLPDNADLDSIAASLENGV  172

Query  172  LTISFAKLAPDRVKVPKVVSIEG  240
            LT+ F KLAPD++K P+VV I G
Sbjct  173  LTVRFRKLAPDQIKGPRVVGITG  195



>gb|EMS51510.1| hypothetical protein TRIUR3_31593 [Triticum urartu]
Length=174

 Score =   107 bits (267),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 76/95 (80%), Gaps = 4/95 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQK-KGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            +EENRVLR+SGERRRE ++ KGDHWHREER +GKFWR+ RLP+NADLDS+ A L+ GVLT
Sbjct  65   IEENRVLRISGERRREVEERKGDHWHREERSYGKFWRQMRLPDNADLDSIAASLDAGVLT  124

Query  178  ISFAKLAPDRVKVPKVVSIEGEKPAEINEAAKQEL  282
            + F KLAP+++K P+VV I G    + + AAK+ +
Sbjct  125  VRFRKLAPEQIKGPRVVGIAG---GDDSSAAKKTI  156



>ref|XP_010478759.1| PREDICTED: 22.0 kDa heat shock protein-like [Camelina sativa]
Length=191

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRV+RVSGER+REE+K+GDHWHR ER HGKFWR+FR+P+N DLDSVKA+L+NGVLTI
Sbjct  101  VEENRVVRVSGERKREEEKEGDHWHRVERSHGKFWRQFRMPDNVDLDSVKAKLDNGVLTI  160

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +  KL+PD+VK P+VV I  E
Sbjct  161  TINKLSPDKVKGPRVVDIAFE  181



>ref|XP_010499882.1| PREDICTED: 22.0 kDa heat shock protein-like [Camelina sativa]
 ref|XP_010499883.1| PREDICTED: 22.0 kDa heat shock protein-like [Camelina sativa]
Length=191

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 79/91 (87%), Gaps = 2/91 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRV+RVSGER+REE+K+GDHWHR ER HGKFWR+FR+P+N DLDSVKA+L+NGVLTI
Sbjct  101  VEENRVVRVSGERKREEEKEGDHWHRVERSHGKFWRQFRMPDNVDLDSVKAKLDNGVLTI  160

Query  181  SFAKLAPDRVKVPKVVSI--EGEKPAEINEA  267
            +  KL+P++VK P+VV I  +G++  +++ A
Sbjct  161  TINKLSPEKVKGPRVVDIAFQGDQTGKLSSA  191



>emb|CDX93767.1| BnaA09g23670D [Brassica napus]
Length=172

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRV+R+SGER++EE+K+GD WHR ER +GKFWR+FR+P+N DLD++KA+LENGVLTI
Sbjct  82   VEENRVVRISGERKKEEEKEGDQWHRVERSYGKFWRQFRMPDNVDLDTIKAKLENGVLTI  141

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +  K + D+VK P+VV IE E
Sbjct  142  TINKFSTDKVKGPRVVDIEFE  162



>ref|XP_007023156.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
 gb|EOY25778.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
Length=172

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRV+RVSGER+ EEQ +GD WHR ER++GKFWR+FRLP NADLD +KA LE+GVL I
Sbjct  76   VEENRVVRVSGERKDEEQAEGDKWHRAERINGKFWRQFRLPGNADLDHIKAHLEDGVLRI  135

Query  181  SFAKLAPDRVKVPKVVSIEGEK  246
               K A +  + PKV+ I GE+
Sbjct  136  VVPKFAEEIKRQPKVIDIVGEE  157



>ref|XP_010099736.1| hypothetical protein L484_025169 [Morus notabilis]
 gb|EXB80313.1| hypothetical protein L484_025169 [Morus notabilis]
Length=86

 Score =   103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 9/85 (11%)
 Frame = +1

Query  55   KKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFAKLAPDRVKVPKVVSI  234
            +K DHWHR ER HGKFWR+FRLPEN DL+S+KA+LENGVLT++  KL+PD++K P+VV+I
Sbjct  2    RKDDHWHRAERCHGKFWRQFRLPENVDLNSIKAKLENGVLTLTLYKLSPDKIKGPRVVNI  61

Query  235  EG-----EKPAEIN----EAAKQEL  282
             G     ++   IN    + AKQEL
Sbjct  62   AGSSDNHDQHGNINVNARDQAKQEL  86



>ref|XP_010065221.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Eucalyptus 
grandis]
 gb|KCW62567.1| hypothetical protein EUGRSUZ_G00061 [Eucalyptus grandis]
Length=197

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRV+R+SGER+ E+ K+GD WHR ER  GKFWR+FRLP NADLDS+KARLE+GVL I
Sbjct  104  VEDNRVVRISGERKVED-KEGDKWHRAERASGKFWRQFRLPANADLDSIKARLEDGVLRI  162

Query  181  SFAKLAPDRVKVPKVVSI  234
            +  KL  DR + PKV+ I
Sbjct  163  TIPKLGDDRKRQPKVIQI  180



>emb|CDO97663.1| unnamed protein product [Coffea canephora]
Length=193

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRVLRVSGER+ EE+ +GD WHR ER  GKFWR+FRLP NADLD V+A LENGVL I
Sbjct  97   VEDNRVLRVSGERKTEEEVEGDKWHRAERTVGKFWRQFRLPGNADLDKVQAHLENGVLEI  156

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
               KLA ++ K PKV++I  E
Sbjct  157  VVPKLAEEKKKQPKVINIAEE  177



>ref|XP_007223469.1| hypothetical protein PRUPE_ppa011656mg [Prunus persica]
 gb|EMJ24668.1| hypothetical protein PRUPE_ppa011656mg [Prunus persica]
Length=202

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLR+SGER+ EEQ +GD WHR ER +GKFWR+FRLP NAD+D +KA LE+GVL I
Sbjct  105  VEENRVLRISGERKTEEQVEGDKWHRAERTNGKFWRQFRLPGNADVDQIKAHLEDGVLRI  164

Query  181  SFAKLAPDRVKVPKVVSI  234
            +  K A ++ + PK++ I
Sbjct  165  TVPKFAAEKKRQPKLIDI  182



>ref|XP_010912721.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Elaeis 
guineensis]
Length=191

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRVLR++GER+ EE+ +G+ WHR ER  GKFWR+FRLP +AD+DS+KA LENGVLT+
Sbjct  97   VEDNRVLRITGERKSEEEVEGEKWHRAERTAGKFWRQFRLPASADMDSIKAHLENGVLTV  156

Query  181  SFAKLAPDRVKVPKVVSI  234
            +  KLA ++ + P+VV+I
Sbjct  157  TVPKLAEEKKRQPRVVNI  174



>tpg|DAA41888.1| TPA: class IV heat shock protein [Zea mays]
Length=213

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +1

Query  1    VEEN-RVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEEN RVLRVSGERR +E+K+GD WHR ER  G+FWRRFR+P  AD+D V ARLENGVLT
Sbjct  115  VEENSRVLRVSGERRADEEKEGDRWHRAERAAGRFWRRFRMPAGADVDRVSARLENGVLT  174

Query  178  ISFAKLAPDRVKVPKVVSIEG  240
            ++  K+A  R + P+V+SI G
Sbjct  175  VTVPKVAGHRGREPRVISIAG  195



>ref|XP_010657906.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Vitis vinifera]
Length=189

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +EENRVLR+SGER  E + +G+ WHR ER  GKFWR+FRLP NADLD +KA LENGVL I
Sbjct  95   IEENRVLRISGERTAEGEAEGEKWHRSERATGKFWRQFRLPANADLDRIKAHLENGVLRI  154

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +  KLA DR K  KVV+I  E
Sbjct  155  TIPKLAEDRKKQAKVVNIAEE  175



>ref|XP_008218631.1| PREDICTED: 16.9 kDa class I heat shock protein 1-like [Prunus 
mume]
Length=199

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLR+SGER+ E+Q +GD WHR ER +GKFWR+FRLP NAD+D +KA LE+GVL I
Sbjct  104  VEENRVLRISGERKMEKQGEGDKWHRAERTNGKFWRQFRLPANADVDQIKAHLEDGVLRI  163

Query  181  SFAKLAPDRVKVPKVVSI  234
            +  K A ++ + PK++ I
Sbjct  164  TVPKFAAEKKRQPKLIDI  181



>ref|XP_006415096.1| hypothetical protein EUTSA_v10009865mg, partial [Eutrema salsugineum]
 gb|ESQ33449.1| hypothetical protein EUTSA_v10009865mg, partial [Eutrema salsugineum]
Length=178

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLR+SGER+REE+K+GDHWHR ER HGKFWR+FR+P+N DLD+VKA+LENGVLTI
Sbjct  88   VEENRVLRISGERKREEEKEGDHWHRVERSHGKFWRQFRMPDNVDLDTVKAKLENGVLTI  147

Query  181  SFAKLAPDRVKVPKVVSI  234
            +  KL+ D+VK P+VV I
Sbjct  148  TIKKLSADKVKGPRVVDI  165



>gb|EMT15210.1| hypothetical protein F775_26258 [Aegilops tauschii]
Length=203

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+ +E+K+G+ WHR ER  G+FWRRFR+P  AD+D V ARLE+GVLT+
Sbjct  103  VEENRVLRVSGERKADEEKEGERWHRAERAAGRFWRRFRMPAGADVDRVTARLEDGVLTV  162

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEINEAAKQEL  282
            +  K+A  + + P+V++I GE      + A  E+
Sbjct  163  TVPKIAEHQRREPRVINIAGEDANSGGKGADAEV  196



>ref|XP_010461162.1| PREDICTED: 22.0 kDa heat shock protein-like [Camelina sativa]
Length=191

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEE RV+RVSGER+REE+K+GDHWHR ER HGKFWR+FR+P+N DLDSVKA+L+NGVLTI
Sbjct  101  VEEKRVVRVSGERKREEEKEGDHWHRVERSHGKFWRQFRMPDNVDLDSVKAKLDNGVLTI  160

Query  181  SFAKLAPDRVKVPKVVSI  234
            +  KL+PD+VK P+VV I
Sbjct  161  TINKLSPDKVKGPRVVDI  178



>gb|EMS61250.1| hypothetical protein TRIUR3_23889 [Triticum urartu]
Length=219

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+ +E+K+G+ WHR ER  G+FWRRFR+P  AD+D V ARLE+GVLT+
Sbjct  103  VEENRVLRVSGERKADEEKEGERWHRAERAAGRFWRRFRMPAGADVDRVAARLEDGVLTV  162

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEINEAAKQEL  282
            +  K+A  + + P+V++I GE      + A  E+
Sbjct  163  TVPKIAEHQRREPRVINIAGEDANSGGKGADAEV  196



>gb|KFK45072.1| hypothetical protein AALP_AA1G339700 [Arabis alpina]
Length=186

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 76/91 (84%), Gaps = 4/91 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRV+RVSGER+REE+K+GDHWHR ER +GKFWR+FR+P+N DLDSVKA+LENGVLTI
Sbjct  96   VEDNRVVRVSGERKREEEKEGDHWHRVERSYGKFWRQFRMPDNVDLDSVKAKLENGVLTI  155

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEINEAAK  273
            +  KL+ D+VK P+VV I  E+    N+A K
Sbjct  156  NIKKLSSDKVKGPRVVDILAEE----NQAGK  182



>emb|CDX86006.1| BnaC06g21280D [Brassica napus]
Length=172

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRV+R+SGER+REE+K+GD WHR ER +GKFWR+FR+P+N DLD++KA+LENGVLTI
Sbjct  82   VEENRVVRISGERKREEEKEGDQWHRVERSYGKFWRQFRMPDNVDLDTIKAKLENGVLTI  141

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +  KLA D+VK P+VV IE E
Sbjct  142  TINKLATDKVKGPRVVDIEFE  162



>gb|KDP40897.1| hypothetical protein JCGZ_24896 [Jatropha curcas]
Length=191

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLR+SGER+ EE+ +G+ WHR ER  GKFWR+FRLP NADLD +KA LENGVL I
Sbjct  97   VEENRVLRISGERKLEEEVQGEKWHRAERTSGKFWRQFRLPHNADLDHIKAHLENGVLKI  156

Query  181  SFAKLAPDRVKVPKVVSI  234
               K A ++ + PKV++I
Sbjct  157  IVPKFAEEQKRQPKVINI  174



>ref|XP_002893762.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70021.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=191

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRV+RVSGER+REE+K+GDHWHR ER HGKFWR+FR+P+N DLDSVKA+L+NGVLTI
Sbjct  101  VEENRVVRVSGERKREEEKEGDHWHRVERSHGKFWRQFRMPDNVDLDSVKAKLDNGVLTI  160

Query  181  SFAKLAPDRVKVPKVVSIEGEK  246
            +  KL+ D+VK P+VV I  E+
Sbjct  161  TINKLSQDKVKGPRVVDIAFEE  182



>ref|XP_004236141.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Solanum 
lycopersicum]
Length=188

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+ EE+ +G+ WHR ER  GKFWR+FRLP NADL+ +KA LENGVL I
Sbjct  95   VEENRVLRVSGERKTEEEIEGEKWHRAERTCGKFWRQFRLPGNADLEHIKAHLENGVLKI  154

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEINEAAKQEL  282
            +  KLA ++ K  KV+SI      E  +A K E+
Sbjct  155  TVPKLAEEKKKQSKVISIAEAVGGEDIKANKAEM  188



>ref|XP_008452205.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Cucumis 
melo]
Length=193

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQ-----KKGDHWHREERVHGKFWRRFRLPENADLDSVKARLEN  165
            +EENRVLR+SGER+ E +     ++G+ WHR ERV+GKFWR+FR+P NADLD +KA LE+
Sbjct  92   LEENRVLRISGERKAETEAAMVTEEGEKWHRAERVNGKFWRQFRIPGNADLDGIKASLED  151

Query  166  GVLTISFAKLAPDRVKVPKVVSIEGEKPA  252
            GVL I   KL  +R K PK++S+ GE+P+
Sbjct  152  GVLIIRVPKLVEERRKQPKIISVVGERPS  180



>ref|XP_006345019.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Solanum 
tuberosum]
Length=191

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+ EE+ +G+ WHR ER  GKFWR+FRLP NADL+ +K  LENGVL I
Sbjct  95   VEENRVLRVSGERKTEEEIEGEKWHRAERTCGKFWRQFRLPGNADLEHIKVNLENGVLKI  154

Query  181  SFAKLAPDRVKVPKVVSIEGEKPA  252
            +  KLA ++ K  KV+SI  E+ A
Sbjct  155  TVPKLAEEKKKQSKVISIAEERKA  178



>ref|XP_009114798.1| PREDICTED: 22.0 kDa heat shock protein-like [Brassica rapa]
Length=172

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRV+R+SGER++EE+K+ D WHR ER +GKFWR+FR+P+N DLD++KA+LENGVLT+
Sbjct  82   VEENRVVRISGERKKEEEKERDQWHRVERSYGKFWRQFRMPDNVDLDTIKAKLENGVLTV  141

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +  K + D+VK P+VV IE E
Sbjct  142  TINKFSTDKVKGPRVVDIEFE  162



>gb|AES61059.2| 22.0 kDa class IV heat shock protein [Medicago truncatula]
Length=170

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEEN VLRV GER++EE+KKGD WHR ER +GKFWR+FRLPENADLDSVKA++ENGVLT+
Sbjct  70   VEENSVLRVIGERKKEEEKKGDRWHRAERSYGKFWRQFRLPENADLDSVKAKMENGVLTL  129

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +  KL+  ++K  ++VSIE E
Sbjct  130  TLRKLSHGKIKSTRLVSIEEE  150



>emb|CBI29627.3| unnamed protein product [Vitis vinifera]
Length=284

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +EENRVLR+SGER  E + +G+ WHR ER  GKFWR+FRLP NADLD +KA LENGVL I
Sbjct  162  IEENRVLRISGERTAEGEAEGEKWHRSERATGKFWRQFRLPANADLDRIKAHLENGVLRI  221

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +  KLA DR K  KVV+I  E
Sbjct  222  TIPKLAEDRKKQAKVVNIAEE  242



>ref|XP_003590808.1| Heat shock protein 17a.17 [Medicago truncatula]
Length=167

 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 4/98 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEEN VLRV GER++EE+KKGD WHR ER +GKFWR+FRLPENADLDSVKA++ENGVLT+
Sbjct  67   VEENSVLRVIGERKKEEEKKGDRWHRAERSYGKFWRQFRLPENADLDSVKAKMENGVLTL  126

Query  181  SFAKLAPDRVKVPKVVSI--EGEKPAEI--NEAAKQEL  282
            +  KL+  ++K  ++VSI  E EK +++  +EA   EL
Sbjct  127  TLRKLSHGKIKSTRLVSIEEENEKASKLSDDEANNNEL  164



>ref|XP_004978986.1| PREDICTED: 21.9 kDa heat shock protein-like [Setaria italica]
Length=213

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +1

Query  1    VEEN-RVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEEN RVLR+SGERR +E+K G+ WHR ER  G+FWRRFR+P  AD+D V ARLE+GVLT
Sbjct  114  VEENSRVLRISGERRADEEKDGERWHRAERAAGRFWRRFRMPAGADVDRVSARLESGVLT  173

Query  178  ISFAKLAPDRVKVPKVVSIEGEKPAEINEAAK  273
            ++  K+A  R + P+V+SI G       EAA+
Sbjct  174  VTVPKVAGHRGREPRVISIAGGDDGGAEEAAE  205



>ref|NP_001148473.1| 22.0 kDa class IV heat shock protein [Zea mays]
 gb|ACG31638.1| 22.0 kDa class IV heat shock protein precursor [Zea mays]
Length=213

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = +1

Query  1    VEEN-RVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEEN RVLRVSGERR +E+K+GD WH  ER  G+FWRRFR+P  AD+D V ARLENGVLT
Sbjct  115  VEENSRVLRVSGERRADEEKEGDRWHXAERAAGRFWRRFRMPAGADVDRVSARLENGVLT  174

Query  178  ISFAKLAPDRVKVPKVVSIEG  240
            ++  K+A  R + P+V+SI G
Sbjct  175  VTVPKVAGHRGREPRVISIAG  195



>ref|XP_002449275.1| hypothetical protein SORBIDRAFT_05g007030 [Sorghum bicolor]
 gb|EES08263.1| hypothetical protein SORBIDRAFT_05g007030 [Sorghum bicolor]
Length=207

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  1    VEEN-RVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEEN RVLRVSGERR +E+K+G+ WHR ER  G+FWRRFR+P  AD+D V ARLE+GVLT
Sbjct  109  VEENSRVLRVSGERRADEEKEGERWHRAERAAGRFWRRFRMPAGADVDRVSARLEDGVLT  168

Query  178  ISFAKLAPDRVKVPKVVSIEG  240
            ++  K+A  R + P+V+SI+G
Sbjct  169  VTMPKVAGHRGREPRVISIDG  189



>ref|NP_001236784.1| low molecular weight heat shock protein Hsp22.5 precursor [Glycine 
max]
 gb|AAB03098.1| Hsp22.5 [Glycine max]
Length=197

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE NRVLRVSGER+REE+K+GDHWHR ER +GK WR+F++P+N DLDSVKA++ENGVLT+
Sbjct  101  VEGNRVLRVSGERKREEEKEGDHWHRVERSYGKSWRQFKVPDNVDLDSVKAKMENGVLTL  160

Query  181  SFAKLAPDRVKVPKVVSIEGEK---PAEINEAAKQEL  282
            +  KL+PD+VK P++VSI G+    P       KQEL
Sbjct  161  TMNKLSPDKVKGPRLVSIAGDDEQAPKLKGNEDKQEL  197



>ref|XP_009758848.1| PREDICTED: 16.9 kDa class I heat shock protein 1-like [Nicotiana 
sylvestris]
Length=190

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLR+SGER+ EE+ +G+ WHR ER  GKFWR+FRLP+NADL+ +KA +ENGVL I
Sbjct  97   VEENRVLRISGERKTEEEVEGEKWHRAERTSGKFWRQFRLPKNADLEHIKAHMENGVLKI  156

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +  KLA ++ K  KV+SI  E
Sbjct  157  TVPKLAEEK-KEAKVISISEE  176



>ref|XP_008781974.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Phoenix 
dactylifera]
Length=186

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLR++GER+  E+ +G+ WHR ER  GKFWR+FRLP +AD+DS+KA LE+GVLT+
Sbjct  92   VEENRVLRITGERKGGEEVEGEKWHRAERTSGKFWRQFRLPASADMDSIKAHLEDGVLTV  151

Query  181  SFAKLAPDRVKVPKVVSI  234
            +  KLA ++ + P+VV+I
Sbjct  152  AVPKLAGEKKRQPRVVNI  169



>dbj|BAK06101.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05345.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=205

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLRVSGER+ +E+K+G+ WHR ER  G+FWRRFR+P  AD++ V ARLE+GVLT+
Sbjct  103  VEENRVLRVSGERKADEEKEGERWHRAERAAGRFWRRFRMPAGADVERVTARLEDGVLTV  162

Query  181  SFAKLAPDRVKVPKVVSIEGE  243
            +  K+A  + + P+V++I GE
Sbjct  163  TVPKIAEHQRREPRVINIAGE  183



>ref|XP_003622353.1| class I heat shock protein [Medicago truncatula]
 gb|KEH42836.1| 22.0 kDa class IV heat shock protein [Medicago truncatula]
Length=165

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            V EN +LR+ GER++E +KKGD WH+ ERV+GKFWR+ RLPENADLDS+KA  ENGVLT+
Sbjct  92   VAENGMLRIIGERKKEAEKKGDRWHKVERVYGKFWRQLRLPENADLDSIKANKENGVLTL  151

Query  181  SFAKLAPDRVK  213
            +F KL+  ++K
Sbjct  152  TFNKLSHGKIK  162



>ref|XP_008781973.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Phoenix 
dactylifera]
Length=194

 Score =   100 bits (248),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 76/99 (77%), Gaps = 5/99 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            V ENRVLRVSGER++EE+KKG+ WH  ER +GKFWR+FRLPENAD+D V A+LE+GVLT+
Sbjct  96   VVENRVLRVSGERKKEEEKKGEQWHYVERSYGKFWRQFRLPENADVDKVSAKLEDGVLTV  155

Query  181  SFAKLAPDRVKVPKVVSIEG-----EKPAEINEAAKQEL  282
            +  KLAPD++K P+VVSI G     EK     EA K EL
Sbjct  156  TLPKLAPDQIKGPRVVSIAGGEAEKEKLGGAPEAKKVEL  194



>ref|XP_004133737.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Cucumis 
sativus]
 ref|XP_004155223.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Cucumis 
sativus]
 gb|KGN56287.1| Heat-shock protein [Cucumis sativus]
Length=193

 Score =   100 bits (248),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 67/89 (75%), Gaps = 5/89 (6%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQ-----KKGDHWHREERVHGKFWRRFRLPENADLDSVKARLEN  165
            VEENRVLR+SGER+ E +     ++G+ WHR ERV+GKFWR+FR+P N +LD +KA LE+
Sbjct  92   VEENRVLRISGERKAETEVAMATEEGEKWHRAERVNGKFWRQFRMPGNVNLDGIKASLED  151

Query  166  GVLTISFAKLAPDRVKVPKVVSIEGEKPA  252
            GVL I   KL  +R + PK++S+ GE+P+
Sbjct  152  GVLIIRVPKLVEERRRQPKIISVVGERPS  180



>ref|XP_010529902.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Tarenaya 
hassleriana]
Length=199

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  1    VEENRVLRVSGERRRE--EQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVL  174
            VEE+RVLR+SGER+RE  E+++G+ WHR ER  GKFWR+FRLP  +DLDSV+ARLE+GVL
Sbjct  104  VEEHRVLRISGERKREYKEEREGERWHRMERASGKFWRQFRLPATSDLDSVEARLEDGVL  163

Query  175  TISFAKLAPDRVKVPKVVSI  234
             ++  KL  D+ + PKVV I
Sbjct  164  KVTVPKLPEDKKRQPKVVQI  183



>gb|EMT19819.1| hypothetical protein F775_30396 [Aegilops tauschii]
Length=119

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  49   EQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFAKLAPDRVKVPKVV  228
            E++KGDHWHREER +GKFWR+ RLP+NADLDS+ A L+ GVLT+ F KLAP+++K P+VV
Sbjct  27   EERKGDHWHREERSYGKFWRQMRLPDNADLDSIAASLDAGVLTVRFRKLAPEQIKGPRVV  86

Query  229  SIEG  240
             I G
Sbjct  87   RIAG  90



>ref|XP_003622352.1| class IV heat shock protein [Medicago truncatula]
 gb|KEH42835.1| 22.0 kDa class IV heat shock protein [Medicago truncatula]
Length=195

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
            N VL V GER++E +KKGD WHR ER++GKFWR+ RLPENAD DSVKA++ENGVL ++  
Sbjct  100  NSVLSVIGERKKEVEKKGDRWHRAERMYGKFWRQLRLPENADFDSVKAKVENGVLILTLN  159

Query  190  KLAPD-RVKVPKVVSI--EGEKPAEIN  261
            KL+ + ++K  +VVSI  E EK  ++N
Sbjct  160  KLSHEYQIKSIRVVSIDKENEKSGKLN  186



>gb|KDO37796.1| hypothetical protein CISIN_1g044197mg [Citrus sinensis]
Length=202

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 70/101 (69%), Gaps = 7/101 (7%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLRVSGER+  +  K    G+ WHR ER  GKFWR+FR+P +ADLD +KA +ENG
Sbjct  102  VEENRVLRVSGERKSNDYYKEGVEGEKWHRAERTFGKFWRQFRMPMSADLDHIKAHMENG  161

Query  169  VLTISFAKLAPDRVKVPKVVSIE---GEKPAEINEAAKQEL  282
            +L ++  KLA ++ + PKV++I+   G  P E  +A K ++
Sbjct  162  ILRVTEPKLAEEKKRQPKVINIDEESGNSPNEDIKATKAQM  202



>ref|XP_010252299.1| PREDICTED: 17.6 kDa class I heat shock protein-like [Nelumbo 
nucifera]
Length=190

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENR++R+S ER+ EE+ +G++WHR ER  GKFWR+FRLP NAD+D+VKA LENGVL I
Sbjct  95   VEENRLIRISFERKSEEEVEGENWHRAERTTGKFWRQFRLPGNADMDAVKAHLENGVLRI  154

Query  181  SFAKLAPDRVKVPKVVSI--EGEKPAEINEAAKQE  279
               KLA ++ +  KV+ I  EG    E  +A+K +
Sbjct  155  MVPKLAEEKRRQRKVIDIVEEGSSSGEDIKASKAD  189



>ref|XP_008352881.1| PREDICTED: 22.0 kDa heat shock protein-like [Malus domestica]
Length=207

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 5/83 (6%)
 Frame = +1

Query  1    VEENRVLRVSGERR---REEQKKGDH--WHREERVHGKFWRRFRLPENADLDSVKARLEN  165
            VEENRVLR+SGER+   RE + +GD+  WHR ER  GKFWR+FRLP NADLD +KA LE+
Sbjct  106  VEENRVLRISGERKADDREGELQGDNYKWHRAERTBGKFWRQFRLPGNADLDQIKAHLED  165

Query  166  GVLTISFAKLAPDRVKVPKVVSI  234
            GVL I+  KLA ++ + PK+++I
Sbjct  166  GVLKITVPKLAAEKKRQPKLINI  188



>ref|XP_002521274.1| heat-shock protein, putative [Ricinus communis]
 gb|EEF41130.1| heat-shock protein, putative [Ricinus communis]
Length=190

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENR+LR+SGER+ +E+ +G+ WHR ER +GKFWR+FRLP N DLD +KA LE+GVL +
Sbjct  96   VEENRMLRISGERKGDEEIEGEKWHRVERTNGKFWRQFRLPNNVDLDHIKAHLEDGVLRV  155

Query  181  SFAKLAPDRVKVPKVVSI  234
            +  K A ++ + PKV++I
Sbjct  156  NVPKFAEEQKRQPKVINI  173



>gb|AGZ80569.1| heat shock protein, partial [Phaseolus vulgaris]
Length=87

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARL  159
            VEENRVLRVSGER+REE+KKGDHWHR ER +GKFWR+FRLP+N DLDSVKA+L
Sbjct  35   VEENRVLRVSGERKREEEKKGDHWHRVERSYGKFWRQFRLPQNVDLDSVKAKL  87



>ref|XP_010682100.1| PREDICTED: 17.6 kDa class I heat shock protein-like [Beta vulgaris 
subsp. vulgaris]
Length=190

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVL+VSGE++ EE+ +GD WHR ER  GKF RRFRLP NADLD +KA LE+GVL I
Sbjct  96   VEENRVLKVSGEKKAEEENEGDKWHRVERTTGKFSRRFRLPVNADLDRIKAHLEDGVLKI  155

Query  181  SFAKLAPDRVKVPKVVSIEGEK  246
               KLA ++ K  KV+ I  +K
Sbjct  156  IVPKLAEEKKKQSKVIDIAVDK  177



>gb|AGZ80567.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80568.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80570.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80571.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80572.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80573.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80574.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80575.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80576.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80577.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80578.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80579.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80580.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80581.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80582.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80583.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80584.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80585.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80586.1| heat shock protein, partial [Phaseolus vulgaris]
Length=87

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARL  159
            VEENRVLRVSGER+REE+KKGDHWHR ER +GKFWR+FRLP+N DLDSVKA+L
Sbjct  35   VEENRVLRVSGERKREEEKKGDHWHRVERSYGKFWRQFRLPQNVDLDSVKAKL  87



>gb|AGZ80566.1| heat shock protein, partial [Phaseolus vulgaris]
 gb|AGZ80587.1| heat shock protein, partial [Phaseolus vulgaris]
Length=87

 Score = 93.6 bits (231),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARL  159
            VEENRVLRVSGER+REE+KKGDHWHR ER +GKFWR+FRLP+N DLDSVKA+L
Sbjct  35   VEENRVLRVSGERKREEEKKGDHWHRVERSYGKFWRQFRLPQNVDLDSVKAKL  87



>gb|KDO36121.1| hypothetical protein CISIN_1g037002mg, partial [Citrus sinensis]
Length=177

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLRVSGER+ ++  K    GD WHR ER  GK WR+FR+P +ADLD VKA LENG
Sbjct  77   VEENRVLRVSGERKSDDYYKEEVEGDKWHRAERPFGKVWRQFRMPMSADLDHVKAHLENG  136

Query  169  VLTISFAKLAPDRVKVPKVVSIE---GEKPAEINEAAKQEL  282
            VL I+  KL  ++ + PKV++I+   G    E  +AAK ++
Sbjct  137  VLRITVPKLVEEKKRQPKVINIDEEPGNSSDEDVKAAKAQM  177



>ref|XP_010911644.1| PREDICTED: 22.7 kDa class IV heat shock protein-like, partial 
[Elaeis guineensis]
Length=102

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENR+LRV+GE++ EE+ +G+ WHR ER  GKF R+FRLP +AD+DS+KA LE+GVL +
Sbjct  10   VEENRMLRVTGEKKTEEEVEGEIWHRAERSSGKFCRQFRLPTSADMDSIKAHLEDGVLRV  69

Query  181  SFAKLAPDRVKVPKVVSI  234
            +  KLA ++ + P+V +I
Sbjct  70   TVPKLAEEKKRQPRVANI  87



>ref|XP_006349271.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Solanum 
tuberosum]
Length=191

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRRE-EQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEENRVLR+SGER+ E E  +G+ WHR ER  GKFWR+F+LP N DL+ +KA LENGVL 
Sbjct  97   VEENRVLRISGERKTEMENIEGEKWHRVERTSGKFWRQFKLPRNVDLEHIKANLENGVLK  156

Query  178  ISFAKLAPDRVKVPKVVSI  234
            I+  KLA +  K  KV+SI
Sbjct  157  ITVPKLAEEEKKQSKVISI  175



>ref|XP_011087610.1| PREDICTED: 22.0 kDa heat shock protein-like [Sesamum indicum]
Length=196

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            V+++RVLRVSGER+ EE+ + + WHR ER  GKFWR+FRLP NAD++ V ARLENGVL I
Sbjct  98   VDDHRVLRVSGERKTEEKVEDERWHRVERTVGKFWRQFRLPANADMEKVTARLENGVLRI  157

Query  181  SFAKLA-PDRVKVPKVVSI----EGEKPAEINEAAKQEL  282
            S  KLA  ++ + PKV+SI    E     ++ +  KQEL
Sbjct  158  SVGKLAEGEKKREPKVISIVSDEEKSSGGDVVKPTKQEL  196



>ref|XP_009794744.1| PREDICTED: class I heat shock protein, partial [Nicotiana sylvestris]
Length=89

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +EE+RVL++SGER  E+++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  11   IEEDRVLQISGERNVEKEEKNDTWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  70

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  71   TVPK---EEVKKPDVKSIE  86



>gb|AEM97868.1| heat shock protein 22 [Corylus heterophylla]
Length=193

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQK-KGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEENRVLR+SGER  + Q+ +G+ WHR ER +GKFWR+FRLP NADLD VKARLE+GVL 
Sbjct  99   VEENRVLRISGERVGKNQEVEGERWHRAERTNGKFWRQFRLPGNADLDHVKARLEDGVLR  158

Query  178  ISFAKLAPDRVKVPKVVSIEGE  243
            I+  K A ++ + PKV++I  E
Sbjct  159  ITVPKFAEEK-RQPKVINIAEE  179



>ref|XP_006431415.1| hypothetical protein CICLE_v10003697mg [Citrus clementina]
 gb|ESR44655.1| hypothetical protein CICLE_v10003697mg [Citrus clementina]
Length=125

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 4/95 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLRVSGER+  +  K    G+ WHR ER  GKFWR+FR+  +ADLD +KA +ENG
Sbjct  25   VEENRVLRVSGERKSNDYYKEGVEGEKWHRAERTFGKFWRQFRMHMSADLDHIKAHMENG  84

Query  169  VLTISFAKLAPDRVKVPKVVSIEGEKPAEINEAAK  273
            +L ++   LA ++ + PKV++I+ E     NE  K
Sbjct  85   ILRVTVPTLAEEKKRQPKVINIDEESGNSSNEDIK  119



>ref|XP_010501751.1| PREDICTED: 22.0 kDa heat shock protein-like [Camelina sativa]
Length=233

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRV+RVSGER+REE+K+GDHWHR ER HGKFWR+FR+P+N DLDSVKA+L+NGVLTI
Sbjct  101  VEENRVVRVSGERKREEEKEGDHWHRVERSHGKFWRQFRMPDNVDLDSVKAKLDNGVLTI  160

Query  181  SFAKLAPD  204
            +  KL+P+
Sbjct  161  TINKLSPE  168



>gb|AFG60826.1| hypothetical protein CL3601Contig1_03, partial [Pinus taeda]
 gb|AFG60827.1| hypothetical protein CL3601Contig1_03, partial [Pinus taeda]
 gb|AFG60828.1| hypothetical protein CL3601Contig1_03, partial [Pinus taeda]
Length=68

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+NRVL++SGER++EE++K D WHR ER +GKF RRFRLPEN  +D VKA +ENGVLT+
Sbjct  6    VEDNRVLKISGERKKEEEQKNDQWHRIERSYGKFLRRFRLPENTKVDEVKASMENGVLTV  65

Query  181  S  183
            +
Sbjct  66   T  66



>ref|XP_004230409.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Solanum 
lycopersicum]
Length=189

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQK-KGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEENRVLR+SGER+ EE+  + + WHR ER  GKFWR+F+LP N DL+ +KA L+NGVL 
Sbjct  98   VEENRVLRISGERKTEEENIESEKWHRVERTSGKFWRQFKLPRNVDLEHIKANLDNGVLK  157

Query  178  ISFAKLAPDRVKVPKVVSI  234
            I+  KLA +  K  KV+SI
Sbjct  158  ITVPKLAEEEKKQSKVISI  176



>ref|XP_006431410.1| hypothetical protein CICLE_v10003210mg, partial [Citrus clementina]
 gb|ESR44650.1| hypothetical protein CICLE_v10003210mg, partial [Citrus clementina]
Length=177

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLRVSGER+ ++  K    G+ WHR ER  GK WR+FR+P +ADLD VKA LENG
Sbjct  77   VEENRVLRVSGERKSDDYYKEEVEGEKWHRVERPFGKVWRQFRMPMSADLDHVKAHLENG  136

Query  169  VLTISFAKLAPDRVKVPKVVSIE---GEKPAEINEAAKQEL  282
            VL I+  KL  ++ + PKV++I+   G    E  +AAK ++
Sbjct  137  VLRITVPKLVEEKKRPPKVINIDEEPGNSSDEDVKAAKAQM  177



>gb|EYU35046.1| hypothetical protein MIMGU_mgv1a018909mg, partial [Erythranthe 
guttata]
Length=208

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  4    EENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTIS  183
            EE RVLRVSGERR EE+ K + WHR ER  GKFWR+FR+P NAD++ V ARLE+GVL I+
Sbjct  107  EEGRVLRVSGERRTEEEVKDERWHRVERTAGKFWRQFRMPANADVEKVSARLEDGVLRIT  166

Query  184  FAKLAPDRV-KVPKVVSI  234
              KLA D++ K  KV+ I
Sbjct  167  VPKLAGDKLRKEAKVIDI  184



>ref|XP_006306010.1| hypothetical protein CARUB_v10011304mg [Capsella rubella]
 gb|EOA38908.1| hypothetical protein CARUB_v10011304mg [Capsella rubella]
Length=191

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   GDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFAKLAPDRVKVPKVVSI  234
            GDHWHR ER+HGKFWR+FR+P+N DLDS+KA+++NGVLTI+  KL+PD+VK P+VV I
Sbjct  121  GDHWHRVERLHGKFWRQFRMPDNVDLDSIKAKVDNGVLTITINKLSPDKVKGPRVVDI  178



>ref|XP_008378954.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Malus domestica]
 ref|XP_008347946.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Malus domestica]
Length=205

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQK--KGDH--WHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLR+SGER+ ++Q+  +GD+  WHR ER +GKFWR+FRLP NADLD +KA LE+G
Sbjct  104  VEENRVLRISGERKADDQEGDQGDNYKWHRAERTNGKFWRQFRLPGNADLDQIKAHLEDG  163

Query  169  VLTISFAKLAPDRVKVPKV  225
            VL I+  K A ++ + PK+
Sbjct  164  VLRITVPKFAAEKKRQPKL  182



>ref|XP_008357666.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Malus domestica]
Length=205

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQK--KGDH--WHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLR+SGER+ ++Q+  +GD+  WHR ER +GKFWR+FRLP NADLD +KA LE+G
Sbjct  104  VEENRVLRISGERKADDQEGDQGDNYKWHRAERTNGKFWRQFRLPGNADLDQIKAHLEDG  163

Query  169  VLTISFAKLAPDRVKVPKV  225
            VL I+  K A ++ + PK+
Sbjct  164  VLRITVPKFAAEKKRQPKL  182



>ref|XP_006494583.1| PREDICTED: 22.7 kDa class IV heat shock protein-like, partial 
[Citrus sinensis]
Length=117

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 69/99 (70%), Gaps = 5/99 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRRE--EQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVL  174
            VEENRVL+VSGER+ +  E+ +G+ WHR  R   KFWR FR+P +ADL+ VKA LENGVL
Sbjct  19   VEENRVLKVSGERKSDDDEEVEGEKWHRAVRTFSKFWRLFRMPMSADLEHVKAHLENGVL  78

Query  175  TISFAKLAPDRVKVPKVVSIE---GEKPAEINEAAKQEL  282
             I+  KLA ++ + PKV++I+   G    E ++A K ++
Sbjct  79   RITVPKLAGEQKRQPKVINIDEESGNSSGEDSKATKAQM  117



>gb|AAP33014.1| HSP22 [Citrus x paradisi]
Length=60

 Score = 89.0 bits (219),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSV  147
            VEENRVLRVSGER+REE+KKGDHWHR ER HGKFWR+F+LP+NADLDSV
Sbjct  12   VEENRVLRVSGERKREEEKKGDHWHRVERSHGKFWRQFKLPDNADLDSV  60



>gb|KDO39514.1| hypothetical protein CISIN_1g042495mg [Citrus sinensis]
Length=180

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 65/95 (68%), Gaps = 4/95 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLRVSGER+  +  K    G+ WH+ ER  GKFWR+FR+P + DL+ VKA ++NG
Sbjct  80   VEENRVLRVSGERKSNDYYKEGVEGEKWHKAERTFGKFWRQFRMPMSVDLEHVKAHMKNG  139

Query  169  VLTISFAKLAPDRVKVPKVVSIEGEKPAEINEAAK  273
            +L ++  KLA ++ + PKV++I+ E     NE  K
Sbjct  140  ILRVTVPKLAEEKKRQPKVINIDEESGNSSNEDIK  174



>ref|XP_009763486.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Nicotiana 
sylvestris]
Length=192

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRR-EEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEENRVLR+S ER+  EE+ +G+ WHR ER  GKFWR+FRLP NADL+ +KA LENGVL 
Sbjct  95   VEENRVLRISEERKIIEEEVEGEKWHRAERTSGKFWRQFRLPGNADLEQIKAHLENGVLK  154

Query  178  ISFAKLAPDRVKVPKVVSIEGE  243
            I+  KLA +  +  KV++I  E
Sbjct  155  ITVPKLAEETKQQTKVINIAEE  176



>gb|AHI18142.1| 22.7 kDa class IV small heat shock protein [Solanum tuberosum]
Length=191

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRRE-EQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEENRVLR+SGER+ E +  +G+ WHR ER  GKFWR+F+LP N D++ +KA LENGVL 
Sbjct  97   VEENRVLRISGERKTEMDNIEGEKWHRVERTSGKFWRQFKLPRNVDMEHIKANLENGVLK  156

Query  178  ISFAKLAPDRVKVPKVVSI  234
            I+  KLA +  K  +V+SI
Sbjct  157  ITVPKLAEEEKKQSRVISI  175



>ref|XP_006431414.1| hypothetical protein CICLE_v10003244mg [Citrus clementina]
 gb|ESR44654.1| hypothetical protein CICLE_v10003244mg [Citrus clementina]
Length=214

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 65/95 (68%), Gaps = 4/95 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLRVSGER+  +  K    G+ WH+ ER  GKFWR+FR+P + DL+ VKA ++NG
Sbjct  102  VEENRVLRVSGERKSNDYYKEGVEGEKWHKAERTFGKFWRQFRMPMSVDLEHVKAHMKNG  161

Query  169  VLTISFAKLAPDRVKVPKVVSIEGEKPAEINEAAK  273
            +L ++  KLA ++ + PKV++I+ E     NE  K
Sbjct  162  ILRVTVPKLAEEKKRQPKVINIDEESGNSSNEDIK  196



>sp|P27879.1|HSP11_MEDSA RecName: Full=18.1 kDa class I heat shock protein, partial [Medicago 
sativa]
 emb|CAA41546.1| heat shock protein [Medicago sativa]
Length=143

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  65   IEDDRVLQISGERNVEKEDKNDQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  124

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P+V SIE
Sbjct  125  TVPK---EEIKKPEVKSIE  140



>gb|KDO38867.1| hypothetical protein CISIN_1g042820mg, partial [Citrus sinensis]
Length=120

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 64/88 (73%), Gaps = 5/88 (6%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEEN+VLRVSGE++ ++  K    G+ WHR ER  GKFWR+FR+P +A+L+ VKA LENG
Sbjct  19   VEENKVLRVSGEKKSDDYYKEGVEGEKWHRAERTFGKFWRQFRMPMSANLEHVKAHLENG  78

Query  169  VLTISFAKLAPDRVKVPKVVSIEGEKPA  252
             L I   +LA ++ + PKV+SI  E+PA
Sbjct  79   ALRIKVPELAEEKRRQPKVISI-NEEPA  105



>ref|XP_006431523.1| hypothetical protein CICLE_v10003649mg [Citrus clementina]
 gb|ESR44763.1| hypothetical protein CICLE_v10003649mg [Citrus clementina]
Length=180

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 64/88 (73%), Gaps = 5/88 (6%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLRVSGE++ ++  K    G+ WHR ER  GKFWR+FR+P +A+L+ VKA LENG
Sbjct  79   VEENRVLRVSGEKKSDDYYKEGVEGEKWHRVERTFGKFWRQFRMPMSANLEHVKAHLENG  138

Query  169  VLTISFAKLAPDRVKVPKVVSIEGEKPA  252
             L I   +LA ++ + PKV+SI  E+PA
Sbjct  139  ALRIKVPELAEEKRRQPKVISI-NEEPA  165



>ref|XP_010273704.1| PREDICTED: 17.3 kDa class I heat shock protein-like [Nelumbo 
nucifera]
Length=159

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 3/76 (4%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
             RVL++SGER RE ++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++ A
Sbjct  84   GRVLQISGERSREHEEKNDKWHRMERSSGKFLRRFRLPENAKMDQVKASMENGVLTVTVA  143

Query  190  KLAPDRVKVPKVVSIE  237
            K   + VK P+V +IE
Sbjct  144  K---EEVKKPEVKAIE  156



>gb|AFG50263.1| hypothetical protein CL428Contig1_02, partial [Pinus taeda]
 gb|AFG50266.1| hypothetical protein CL428Contig1_02, partial [Pinus taeda]
 gb|AFG50267.1| hypothetical protein CL428Contig1_02, partial [Pinus taeda]
 gb|AFG50268.1| hypothetical protein CL428Contig1_02, partial [Pinus taeda]
 gb|AFG50269.1| hypothetical protein CL428Contig1_02, partial [Pinus taeda]
 gb|AFG50270.1| hypothetical protein CL428Contig1_02, partial [Pinus taeda]
 gb|AFG50271.1| hypothetical protein CL428Contig1_02, partial [Pinus taeda]
Length=83

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+ RVL++SGER++EE++K D WHR ER HGKF RRFRLPENA ++ VKA +++GVL I
Sbjct  5    VEDGRVLQISGERKKEEEQKNDRWHRIERSHGKFLRRFRLPENAKVEEVKATMDSGVLMI  64

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            +  K A  + +V K + I G
Sbjct  65   TVPKQAQPKPEV-KAIEISG  83



>gb|KDP46549.1| hypothetical protein JCGZ_08521 [Jatropha curcas]
Length=125

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  47   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTV  106

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V +IE
Sbjct  107  TVPK---EEVKKPDVKAIE  122



>gb|AFK41064.1| unknown [Medicago truncatula]
Length=161

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  83   IEDDRVLQISGERNFEKEDKNDQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  142

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  143  TVPK---EEVKKPDVKSIE  158



>ref|XP_003576111.1| PREDICTED: 21.9 kDa heat shock protein [Brachypodium distachyon]
Length=204

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 4/86 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDH----WHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLR+SGERR E ++K +     WHR ER  G+FWRRFRLP  AD+DSV ARLE+G
Sbjct  100  VEENRVLRISGERRPEPEEKREEGGERWHRAERAAGRFWRRFRLPAGADMDSVAARLEDG  159

Query  169  VLTISFAKLAPDRVKVPKVVSIEGEK  246
            VLT++  K+A  R K P+V+SI GE+
Sbjct  160  VLTVTVPKVAGHRGKEPRVISIAGEE  185



>gb|ABP35941.1| small heat shock protein [Cyclamen persicum]
Length=193

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            E+RVLR+SGER+ E+++  + WHR ER  G+FWR+FR+P NADL+ VKA +ENGVL ++ 
Sbjct  97   EDRVLRISGERKVEKEEDKESWHRVERAVGRFWRQFRMPGNADLERVKAHMENGVLVVTV  156

Query  187  AKLAPDRVKVPKVVSIE  237
             KLA ++   PKV+ IE
Sbjct  157  PKLAEEKKTGPKVIGIE  173



>ref|XP_006431361.1| hypothetical protein CICLE_v10003876mg [Citrus clementina]
 gb|ESR44601.1| hypothetical protein CICLE_v10003876mg [Citrus clementina]
 gb|KDO40229.1| hypothetical protein CISIN_1g041192mg [Citrus sinensis]
Length=161

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 4/95 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKG----DHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            +EEN+VLRVSGER+ ++  K     + WHR ER+ GKFWR+F++P +ADL+ VKA  ENG
Sbjct  61   IEENKVLRVSGERKSDDYYKEGVQREKWHRAERISGKFWRQFKMPMSADLEHVKAHQENG  120

Query  169  VLTISFAKLAPDRVKVPKVVSIEGEKPAEINEAAK  273
            VL I+  KLA ++ + P V++I+ E      E  K
Sbjct  121  VLRITVPKLAEEKKRQPNVINIDEESGTSYGEGTK  155



>emb|CDP19641.1| unnamed protein product [Coffea canephora]
Length=157

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 3/77 (4%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            + RVL++SGER RE+++K D WHR ER  GKF RRFRLPENA LD VKA +ENGVLTI+ 
Sbjct  81   DGRVLQISGERSREQEEKNDKWHRIERSSGKFLRRFRLPENAKLDQVKAGMENGVLTITV  140

Query  187  AKLAPDRVKVPKVVSIE  237
             K   ++VK P V +IE
Sbjct  141  PK---EQVKKPGVKAIE  154



>gb|AES97913.2| 22.0 kDa class IV heat shock protein [Medicago truncatula]
Length=136

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            EN VLRV GER++E++ K D WHR ER+ GKFWR+ RLPEN DLDS+K ++E+GVLT++F
Sbjct  74   ENSVLRVIGERKKEQENKSDRWHRVERMCGKFWRQLRLPENVDLDSIKTKMEDGVLTLTF  133



>gb|AAR01521.1| cytosolic class I small heat shock protein 3A, partial [Nicotiana 
tabacum]
 gb|AAR01522.1| cytosolic class I small heat shock protein 3A, partial [Nicotiana 
tabacum]
 gb|AAR01528.1| cytosolic class I small heat shock protein 3D, partial [Nicotiana 
tabacum]
Length=124

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SG+R  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  46   IEDDRVLQISGDRNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  105

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  106  TVPK---EEVKKPDVKSIE  121



>ref|XP_009594301.1| PREDICTED: 17.6 kDa class I heat shock protein-like [Nicotiana 
tomentosiformis]
Length=153

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  75   IEDDRVLQISGERNVEKENKNDTWHRVERSSGKFMRRFRLPENAKIDQVKAAMENGVLTV  134

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  135  TVPK---EDVKKPDVKSIE  150



>gb|AAR01523.1| cytosolic class I small heat shock protein 3B, partial [Nicotiana 
tabacum]
 gb|AAR01524.1| cytosolic class I small heat shock protein 3B, partial [Nicotiana 
tabacum]
 gb|AAR01525.1| cytosolic class I small heat shock protein 3B, partial [Nicotiana 
tabacum]
 gb|AAR01526.1| cytosolic class I small heat shock protein 3B, partial [Nicotiana 
tabacum]
Length=124

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  46   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  105

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SI+
Sbjct  106  TVPK---EEVKKPDVKSID  121



>ref|XP_011084972.1| PREDICTED: 17.3 kDa class I heat shock protein-like [Sesamum 
indicum]
Length=161

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+ R+L++SGER +E+++K D WHR ER  GKF RRFRLPENA LD +KA +ENGVLT+
Sbjct  83   VEDGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPENAKLDQIKAAMENGVLTV  142

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P+V +I+
Sbjct  143  TVPK---EEVKKPEVKAID  158



>ref|XP_011036031.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Populus 
euphratica]
Length=162

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            ++E RVL++SGER +E ++K D WHR ER  GKF RRFRLPENA LD VKA +ENGVLT+
Sbjct  84   LDEGRVLQISGERSKEREEKNDKWHRVERSSGKFLRRFRLPENAKLDQVKANMENGVLTV  143

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V +IE
Sbjct  144  TVPK---EEVKKPDVKAIE  159



>gb|AGV54294.1| class I heat shock protein [Phaseolus vulgaris]
 gb|AGV54775.1| 18.5 kDa class I heat shock protein [Phaseolus vulgaris]
Length=160

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER+ E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  82   IEDDRVLQISGERKVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVDQVKASVENGVLTV  141

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  142  TVPK---EEVKKPDVKSIE  157



>gb|AAR01527.1| cytosolic class I small heat shock protein 3C, partial [Nicotiana 
tabacum]
Length=124

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  46   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  105

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SI+
Sbjct  106  TVPK---EEVKKPDVKSID  121



>ref|XP_006350804.1| PREDICTED: 17.7 kDa class I heat shock protein-like [Solanum 
tuberosum]
Length=154

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 3/77 (4%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            E+RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++ 
Sbjct  78   EDRVLQISGERNVEKEDKNDKWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTV  137

Query  187  AKLAPDRVKVPKVVSIE  237
             K   ++VK P V SIE
Sbjct  138  PK---EQVKKPDVKSIE  151



>ref|XP_008808960.1| PREDICTED: 22.0 kDa class IV heat shock protein-like [Phoenix 
dactylifera]
Length=181

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 70/95 (74%), Gaps = 3/95 (3%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEENRVLR++GER+ EE + G+ WHR ER  GKF R+FRLP +AD+DS+KA LE+GVL +
Sbjct  89   VEENRVLRITGERKTEEVE-GEKWHRAERTSGKFCRQFRLPASADVDSIKAHLEDGVLRV  147

Query  181  SFAKLAPDRVKVPKVVSI-EGEKPAEINEAAKQEL  282
            +  KLA  + + P+VV+I EG    E  +A+K ++
Sbjct  148  TVPKLAEKKTQ-PRVVNIVEGSNWGEQIKASKVDI  181



>ref|XP_007159360.1| hypothetical protein PHAVU_002G231600g [Phaseolus vulgaris]
 gb|ESW31354.1| hypothetical protein PHAVU_002G231600g [Phaseolus vulgaris]
Length=160

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER+ E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  82   IEDDRVLQISGERKVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVDEVKASVENGVLTV  141

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  142  TVPK---EEVKKPDVKSIE  157



>ref|XP_003614955.1| class I heat shock protein [Medicago truncatula]
Length=176

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            EN VLRV GER++E++ K D WHR ER+ GKFWR+ RLPEN DLDS+K ++E+GVLT++F
Sbjct  114  ENSVLRVIGERKKEQENKSDRWHRVERMCGKFWRQLRLPENVDLDSIKTKMEDGVLTLTF  173



>gb|KDP40796.1| hypothetical protein JCGZ_24795 [Jatropha curcas]
Length=101

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
             R+L++SGER +E+++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++  
Sbjct  26   GRILQISGERSKEQEEKNDKWHRIERSSGKFLRRFRLPENAKMDQVKATMENGVLTVTIP  85

Query  190  KLAPDRVKVPKVVSIE  237
            K   +  K P+V SIE
Sbjct  86   K---EEEKKPQVKSIE  98



>ref|XP_003619703.1| 18.2 kDa class I heat shock protein [Medicago truncatula]
 gb|AES75921.1| 17.6 kDa class I heat shock protein [Medicago truncatula]
Length=159

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENG+LT+
Sbjct  81   IEDDRVLQISGERNVEKEDKNDQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGILTV  140

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P+V +I+
Sbjct  141  TVPK---EEVKKPQVKTID  156



>ref|XP_003619696.1| 18.2 kDa class I heat shock protein [Medicago truncatula]
 gb|AES75914.1| 17.6 kDa class I heat shock protein [Medicago truncatula]
Length=159

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E +RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  81   IEGDRVLQISGERNVEKEDKNDQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  140

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  141  TVPK---EEVKKPDVKSIE  156



>gb|AFG50264.1| hypothetical protein CL428Contig1_02, partial [Pinus taeda]
Length=83

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+ RVL++SGER++EE++K D WHR ER H KF RRFRLPENA ++ VKA +++GVLTI
Sbjct  5    VEDGRVLQISGERKKEEEQKNDRWHRIERSHRKFLRRFRLPENAKVEEVKATMDSGVLTI  64

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            +  K A  + +V K + I G
Sbjct  65   TVPKQAQPKPEV-KAIEISG  83



>gb|KDO37787.1| hypothetical protein CISIN_1g043940mg, partial [Citrus sinensis]
Length=123

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 4/85 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKK----GDHWHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLR+SGER+ ++  K    G+ W R ER  GKFWR+F++P +ADL+ VKA LENG
Sbjct  22   VEENRVLRMSGERKSDDYYKEGVEGEKWQRAERTFGKFWRQFKMPMSADLEHVKAHLENG  81

Query  169  VLTISFAKLAPDRVKVPKVVSIEGE  243
             L I   +LA ++ + PKV+SI  E
Sbjct  82   ALRIKVPELAEEKRRQPKVISINEE  106



>ref|XP_009599505.1| PREDICTED: 17.6 kDa class I heat shock protein-like [Nicotiana 
tomentosiformis]
 ref|XP_009623870.1| PREDICTED: 17.6 kDa class I heat shock protein-like [Nicotiana 
tomentosiformis]
 gb|ADK36667.1| cytosolic class I small heat shock protein 3A [Nicotiana tabacum]
Length=153

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SG+R  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  75   IEDDRVLQISGDRNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  134

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  135  TVPK---EEVKKPDVKSIE  150



>gb|AIE47706.1| HSP17.4 [Nicotiana tabacum]
Length=153

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  75   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  134

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SI+
Sbjct  135  TVPK---EEVKKPDVKSID  150



>ref|XP_010930366.1| PREDICTED: 22.7 kDa class IV heat shock protein-like [Elaeis 
guineensis]
Length=182

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    VEENR-VLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLT  177
            VEENR VLR++GER+ EE  +G+ WHR ER  GKF R+FRLP +AD+DS+KA L++GVL 
Sbjct  89   VEENRPVLRITGERKIEEAVEGEKWHRAERSSGKFCRQFRLPTSADMDSIKAHLKDGVLR  148

Query  178  ISFAKLAPDRVKVPKVVSI  234
            ++  KLA ++ + P+VV+I
Sbjct  149  VTVPKLAEEKKRQPRVVNI  167



>ref|XP_009762901.1| PREDICTED: 17.6 kDa class I heat shock protein-like [Nicotiana 
sylvestris]
Length=153

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  75   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKAAIENGVLTV  134

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  135  TVPK---EEVKKPDVKSIE  150



>gb|ABR17924.1| unknown [Picea sitchensis]
Length=160

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE++RVL++SGER++EE++K D WHR ER HGKF RRFRLPENA ++ VKA +ENGVLT+
Sbjct  80   VEDDRVLKISGERKKEEEQKNDKWHRIERSHGKFLRRFRLPENAKVEEVKATMENGVLTV  139

Query  181  S  183
            +
Sbjct  140  T  140



>gb|ADK36668.1| cytosolic class I small heat shock protein 3B [Nicotiana tabacum]
Length=153

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  75   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  134

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SI+
Sbjct  135  TVPK---EEVKKPDVKSID  150



>gb|ABK22474.1| unknown [Picea sitchensis]
Length=160

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE++RVL++SGER++EE++K D WHR ER HGKF RRFRLPENA ++ VKA +ENGVLT+
Sbjct  80   VEDDRVLKISGERKKEEEQKNDKWHRIERSHGKFLRRFRLPENAKVEEVKATMENGVLTV  139

Query  181  S  183
            +
Sbjct  140  T  140



>gb|KDP46547.1| hypothetical protein JCGZ_08519 [Jatropha curcas]
Length=125

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E+++K D WHR ER  GKF R FRLPENA +D VKA +ENGVLT+
Sbjct  47   IEDDRVLQISGERNVEKEEKNDTWHRVERSSGKFLRSFRLPENAKMDQVKASMENGVLTV  106

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V +IE
Sbjct  107  TVPK---EEVKKPDVKAIE  122



>ref|XP_010273703.1| PREDICTED: 17.3 kDa class I heat shock protein-like [Nelumbo 
nucifera]
Length=159

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            V+E RVL++SGER RE ++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  81   VDEGRVLQISGERSREHEEKDDKWHRVERSSGKFLRRFRLPENAKVDQVKASMENGVLTV  140

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   +  K P+V +IE
Sbjct  141  TVPK---EEAKKPEVKAIE  156



>ref|XP_006494163.1| PREDICTED: 22.0 kDa heat shock protein-like [Citrus sinensis]
Length=195

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = +1

Query  1    VEENRVLRVSGERRRE--EQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVL  174
            VEEN VL+VSGER+ +  E+ +G+ WHR  R  GKFWR FR+P +ADL+ VKA LENGVL
Sbjct  95   VEENGVLKVSGERKSDDDEEVEGEKWHRAVRTFGKFWRLFRMPMSADLEHVKAHLENGVL  154

Query  175  TISFAKLAPDRVKVPKVVSIEGE  243
             I+  KLA ++ + PKV++I+ E
Sbjct  155  RITVPKLAGEQKRQPKVINIDEE  177



>gb|AAB63310.1| 18.6 kDa heat-shock protein [Helianthus annuus]
Length=163

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 3/77 (4%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            ++RVL++SGER +E ++KGD WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++ 
Sbjct  87   DDRVLQISGERNKESEEKGDTWHRVERSSGKFVRRFRLPENAKVDQVKAAMENGVLTVTV  146

Query  187  AKLAPDRVKVPKVVSIE  237
             K+    VK P V SI+
Sbjct  147  PKV---EVKKPDVKSIQ  160



>ref|XP_009355390.1| PREDICTED: 16.9 kDa class I heat shock protein 1-like [Pyrus 
x bretschneideri]
Length=207

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 61/79 (77%), Gaps = 4/79 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQK--KGDH--WHREERVHGKFWRRFRLPENADLDSVKARLENG  168
            VEENRVLR+SGER+ ++Q+  +GD+  WHR ER +GKFWR+FRLP NADLD +KA LE+ 
Sbjct  106  VEENRVLRISGERKADDQEGDQGDNYKWHRAERTNGKFWRQFRLPGNADLDQIKAHLEDR  165

Query  169  VLTISFAKLAPDRVKVPKV  225
            VL I+  K A ++ + PK+
Sbjct  166  VLRITVPKFAAEKKRQPKL  184



>ref|XP_008464642.1| PREDICTED: 17.8 kDa class I heat shock protein-like [Cucumis 
melo]
Length=159

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEE RVL++SGER +E+++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVL +
Sbjct  81   VEEGRVLQISGERSKEQEEKNDKWHRIERSSGKFMRRFRLPENAKVDEVKASMENGVLMV  140

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K+     K P++ SIE
Sbjct  141  TVPKM---EEKKPEIKSIE  156



>ref|XP_003608277.1| 18.2 kDa class I heat shock protein [Medicago truncatula]
 gb|ABD32352.1| Heat shock protein Hsp20 [Medicago truncatula]
 gb|AES90474.1| 17.6 kDa class I heat shock protein [Medicago truncatula]
 gb|AFK46004.1| unknown [Medicago truncatula]
 gb|AFK47613.1| unknown [Medicago truncatula]
Length=159

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K + WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  81   IEDDRVLQISGERNVEKEDKNNQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  140

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  141  TVPK---EEVKKPDVKSIE  156



>ref|XP_011005463.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Populus 
euphratica]
Length=158

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  80   IEDDRVLQISGERNVEKEDKNDTWHRVERSCGKFLRRFRLPENAKMDQVKASMENGVLTV  139

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V +IE
Sbjct  140  TVPK---EEVKKPDVKAIE  155



>sp|P27880.1|HSP12_MEDSA RecName: Full=18.2 kDa class I heat shock protein [Medicago sativa]
 emb|CAA41547.1| heat shock protein [Medicago sativa]
Length=158

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  80   IEDDRVLQISGERSVEKEDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  139

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P+V +I+
Sbjct  140  TVPK---EEVKKPEVKTID  155



>ref|XP_002520462.1| heat-shock protein, putative [Ricinus communis]
 gb|EEF41875.1| heat-shock protein, putative [Ricinus communis]
Length=160

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E+N VL++SGE+  E++ K D WHR ER  GKF RRFRLPENA +D +KA +ENGVLT+
Sbjct  82   IEDNNVLQISGEKHVEKEDKNDTWHRVERSSGKFLRRFRLPENAKMDQIKASMENGVLTV  141

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K+    VK P+V SIE
Sbjct  142  TVPKV---EVKKPEVKSIE  157



>ref|XP_010087898.1| hypothetical protein L484_006034 [Morus notabilis]
 gb|EXB30484.1| hypothetical protein L484_006034 [Morus notabilis]
Length=164

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE++RVL++SGER+ E + KGD WHR ER  GKF RRFRLPENA +D V A +ENGVLT+
Sbjct  85   VEDDRVLQISGERKTENEDKGDTWHRVERSSGKFLRRFRLPENAKIDRVSAAMENGVLTV  144

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V +IE
Sbjct  145  TVPK---EEVKRPDVRAIE  160



>ref|XP_004505085.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum]
Length=160

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA ++ VKA +ENGVLT+
Sbjct  82   IEDDRVLQISGERSVEKEDKNDQWHRVERSSGKFMRRFRLPENAKIEQVKAAMENGVLTV  141

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   +++K P V SIE
Sbjct  142  TVPK---EQIKKPDVKSIE  157



>ref|XP_003519372.1| PREDICTED: 18.2 kDa class I heat shock protein [Glycine max]
 gb|KHN13097.1| 18.2 kDa class I heat shock protein [Glycine soja]
Length=153

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+ RVL++SGE+ +E+++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  75   VEDGRVLQISGEKTKEQEQKDDRWHRIERSTGKFMRRFRLPENAKMDQVKAAMENGVLTV  134

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   +  K P+V SI+
Sbjct  135  TVPK---EEQKKPQVKSIQ  150



>ref|XP_006384657.1| 17.6 kDa class I small heat shock family protein [Populus trichocarpa]
 gb|ERP62454.1| 17.6 kDa class I small heat shock family protein [Populus trichocarpa]
Length=159

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  81   IEDDRVLQISGERNVEKEDKNDAWHRVERSSGKFLRRFRLPENAKMDQVKASMENGVLTV  140

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P V +IE
Sbjct  141  TVPK---EEIKKPDVKAIE  156



>ref|XP_008354272.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Malus domestica]
Length=153

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 4/77 (5%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            + RVL++SGER RE+++K D WHR ER  GKF RRFRLPENA LD VKA +ENGVLT++ 
Sbjct  78   DGRVLQISGERSREQEEKNDTWHRVERSSGKFMRRFRLPENAKLDQVKAAMENGVLTVT-  136

Query  187  AKLAPDRVKVPKVVSIE  237
                P  VK P V +I+
Sbjct  137  ---VPKEVKRPDVKAID  150



>gb|KDP20449.1| hypothetical protein JCGZ_05294 [Jatropha curcas]
Length=151

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  73   IEDDRVLQISGERNMEKEDKNDKWHRVERSSGKFLRRFRLPENAKMDQVKASMENGVLTV  132

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P + +IE
Sbjct  133  TVPK---EEIKKPNLKTIE  148



>ref|XP_008362807.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Malus domestica]
Length=153

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 4/77 (5%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            + RVL++SGER RE+++K D WHR ER  GKF RRFRLPENA LD VKA +ENGVLT++ 
Sbjct  78   DGRVLQISGERSREQEEKNDTWHRVERSSGKFMRRFRLPENAKLDQVKAAMENGVLTVT-  136

Query  187  AKLAPDRVKVPKVVSIE  237
                P  VK P V +I+
Sbjct  137  ---VPKEVKRPDVKAID  150



>emb|CAQ64473.1| cytosolic class I small heat shock protein type 1 [Rhododendron 
simsii]
Length=144

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = +1

Query  13   RVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFAK  192
            R+L++SGER RE+++K D WHR ER  GKF+RRF+LPENA +D VKA +ENGVLT++  K
Sbjct  70   RILQISGERNREKEEKNDKWHRIERSSGKFFRRFQLPENAKMDQVKATMENGVLTVTVPK  129

Query  193  LAPDRVKVPKVVSIE  237
                 VK P+V +IE
Sbjct  130  A---EVKKPEVKAIE  141



>ref|XP_009761476.1| PREDICTED: 17.6 kDa class I heat shock protein-like [Nicotiana 
sylvestris]
 ref|XP_009762614.1| PREDICTED: 17.6 kDa class I heat shock protein-like [Nicotiana 
sylvestris]
Length=153

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  75   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  134

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SI+
Sbjct  135  TVPK---EEVKKPDVKSID  150



>ref|XP_009344304.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Pyrus x 
bretschneideri]
Length=154

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+ RVL++SGER RE+++K D WHR ER  GKF RRFRLPENA LD VKA +ENGVLT+
Sbjct  76   VEDGRVLQISGERSREQEEKNDKWHRVERSSGKFMRRFRLPENAKLDQVKAAMENGVLTV  135

Query  181  S  183
            +
Sbjct  136  T  136



>ref|XP_004504869.1| PREDICTED: 18.2 kDa class I heat shock protein-like [Cicer arietinum]
Length=156

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 3/78 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  78   IEDDRVLQISGERSVEKEDKNDKWHRVERSSGKFMRRFRLPENAKIDQVKANMENGVLTV  137

Query  181  SFAKLAPDRVKVPKVVSI  234
            +  K   + VK P+V SI
Sbjct  138  TVPK---EDVKKPEVKSI  152



>gb|AFG50265.1| hypothetical protein CL428Contig1_02, partial [Pinus taeda]
Length=83

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+ R+L++SGER++EE++K + WHR ER HGKF RRFRLPENA ++ VKA +++GVLTI
Sbjct  5    VEDGRILQISGERKKEEEQKNNRWHRIERSHGKFLRRFRLPENAKVEEVKATMDSGVLTI  64

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            +  K  P      K + I G
Sbjct  65   TVPK-QPQPKPEAKAIEISG  83



>gb|ACV93249.1| CI small heat shock protein 2 [Prunus salicina]
Length=154

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            V++ RVL++SGER RE+++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  76   VDDGRVLQISGERSREQEEKNDKWHRIERSTGKFSRRFRLPENAKIDQVKASMENGVLTV  135

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            +  K    R +V K + I G
Sbjct  136  TVPKEEEKRPQV-KAIDISG  154



>gb|KGN50609.1| hypothetical protein Csa_5G190530 [Cucumis sativus]
Length=159

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            V+E RVL++SGER +E+++K D WHR ER  G+F RRFRLPENA +D VKA +ENGVLT+
Sbjct  81   VQEGRVLQISGERSKEQEEKNDKWHRIERSSGQFMRRFRLPENAKVDEVKASMENGVLTV  140

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K+     K P++ SIE
Sbjct  141  TVPKV---EEKKPEIKSIE  156



>emb|CAQ64460.1| cytosolic class I small heat shock protein type 1 [Rhododendron 
hyperythrum]
Length=144

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = +1

Query  13   RVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFAK  192
            R+L++SGER RE+++K D WHR ER  GKF+RRF+LPENA +D VKA +ENGVLT++  K
Sbjct  70   RILQISGERSREKEEKNDKWHRIERSSGKFFRRFQLPENAKMDQVKATMENGVLTVTVPK  129

Query  193  LAPDRVKVPKVVSIE  237
                 VK P+V +IE
Sbjct  130  A---EVKKPEVKAIE  141



>gb|ABK24124.1| unknown [Picea sitchensis]
 gb|ACN40602.1| unknown [Picea sitchensis]
Length=158

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE++RVL++SGER++EE++K D WHR ER +GKF RRFRLPEN  ++ VKA +ENGVLT+
Sbjct  80   VEDDRVLKISGERKKEEEQKNDKWHRIERSYGKFLRRFRLPENTKVEEVKATMENGVLTV  139

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            +  K +  + +V + + I G
Sbjct  140  TVPKQSQPKSEV-RAIEISG  158



>gb|ABK21324.1| unknown [Picea sitchensis]
 gb|ABK22472.1| unknown [Picea sitchensis]
 gb|ACN40490.1| unknown [Picea sitchensis]
Length=151

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE++RVL++SGER++EE++K D WHR ER +GKF RRFRLPEN  ++ VKA +ENGVLT+
Sbjct  73   VEDDRVLKISGERKKEEEQKNDKWHRIERSYGKFLRRFRLPENTKVEEVKATMENGVLTV  132

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            +  K +  + +V + + I G
Sbjct  133  TVPKQSQPKPEV-RAIEISG  151



>gb|ABW89467.1| low molecular weight heat shock protein [Gossypium hirsutum]
Length=158

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            ++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D +KA +ENGVLT++ 
Sbjct  82   DDRVLQISGERNVEKEDKKDTWHRVERSSGKFMRRFRLPENAKMDQIKASMENGVLTVTI  141

Query  187  AKLAPDRVKVPKVVSIE  237
             KL    VK P V SIE
Sbjct  142  PKL---EVKKPDVKSIE  155



>ref|XP_004505963.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum]
Length=213

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA ++ VKA +ENGVLT+
Sbjct  135  IEDDRVLQISGERSIEKEDKNDQWHRVERSSGKFMRRFRLPENAKIEQVKAAMENGVLTV  194

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P V SIE
Sbjct  195  TIPK---EEIKKPDVKSIE  210



>ref|XP_009416183.1| PREDICTED: 17.3 kDa class I heat shock protein-like [Musa acuminata 
subsp. malaccensis]
Length=160

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VE+ RVLR+SGER RE ++K D WHR ER  GKF RRFRLPENA ++ V A +ENGVLT+
Sbjct  82   VEDGRVLRISGERSREHEEKTDTWHRVERSSGKFLRRFRLPENAKVEQVNAAMENGVLTV  141

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SIE
Sbjct  142  TVPK---EGVKKPDVKSIE  157



>ref|XP_009409760.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Musa acuminata 
subsp. malaccensis]
Length=227

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = +1

Query  13   RVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFAK  192
            RVL++SGER +E+++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++  K
Sbjct  153  RVLQISGERNKEQEEKNDKWHRVERSSGKFLRRFRLPENAKVDQVKASMENGVLTVTVPK  212

Query  193  LAPDRVKVPKVVSIE  237
               + VK P V SIE
Sbjct  213  ---EDVKKPDVKSIE  224



>gb|AFN89710.1| heat shock protein 21.4 [Primula forrestii]
Length=191

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            E+RVL++SGER+ + +++ D WHR ER  G+FWR+FR+P NA+L+ VKARLENGVL I+ 
Sbjct  88   EDRVLKISGERKVDREEERDSWHRAERAVGRFWRQFRMPGNANLEGVKARLENGVLIITV  147

Query  187  AKLAPDRVKVPKVVSIEGEKPAEINEAAKQ  276
             K+A ++ +  KV+ IE     E  +A+K 
Sbjct  148  PKVAEEKKRDAKVIGIEEGGAGEDVKASKS  177



>gb|ABC41131.1| 17.3 kDa class I heat shock protein [Arachis hypogaea]
Length=150

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E+N VL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  72   IEDNSVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDEVKASMENGVLTV  131

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K     VK P V SI+
Sbjct  132  TVPKA---EVKKPDVKSIQ  147



>ref|XP_009589718.1| PREDICTED: 17.6 kDa class I heat shock protein [Nicotiana tomentosiformis]
Length=153

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SG+R  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  75   IEDDRVLQISGDRNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  134

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V SI+
Sbjct  135  TVPK---EEVKKPDVKSID  150



>gb|AFK38102.1| unknown [Medicago truncatula]
Length=158

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E +RVL +SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  80   IEGDRVLPISGERNVEKEDKNDQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  139

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P V SIE
Sbjct  140  TVPK---EEIKKPDVKSIE  155



>ref|XP_002520459.1| heat-shock protein, putative [Ricinus communis]
 gb|EEF41872.1| heat-shock protein, putative [Ricinus communis]
Length=198

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  120  IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFLRRFRLPENAKMDQVKASMENGVLTV  179

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            S  K    R  V K + I G
Sbjct  180  SVPKQEAKRPDV-KAIEISG  198



>ref|XP_011099770.1| PREDICTED: 17.5 kDa class I heat shock protein-like [Sesamum 
indicum]
Length=150

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            ++ VL++SGER RE+++K D WHR ER  GKF+RRFRLPENA +D +KA +ENGVLT++ 
Sbjct  74   DDNVLQISGERTREKEEKNDTWHRLERSSGKFFRRFRLPENAKMDQIKASMENGVLTVTV  133

Query  187  AKLAPDRVKVPKVVSIE  237
             K   + VK P+V +IE
Sbjct  134  PK---EEVKKPEVKAIE  147



>ref|NP_001275610.1| 17.6 kDa class I heat shock protein-like [Solanum tuberosum]
 gb|AFW90595.1| 17.6 kDa class I small heat shock protein 20.1 [Solanum tuberosum]
 gb|AHI18143.1| 17.6 kDa class 1 small heat shock protein [Solanum tuberosum]
Length=154

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
            +RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++  
Sbjct  79   DRVLQISGERNVEKEDKNDKWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVP  138

Query  190  KLAPDRVKVPKVVSIE  237
            K   ++VK P V SIE
Sbjct  139  K---EQVKKPDVKSIE  151



>ref|XP_010271886.1| PREDICTED: 17.8 kDa class I heat shock protein-like [Nelumbo 
nucifera]
Length=158

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            + E R+L++SGER RE ++K D WHR ER  GKF RRFRLPENA  D VKA +ENGVLT+
Sbjct  80   LXEGRILQISGERSREHEEKNDKWHRMERSSGKFLRRFRLPENARADQVKAAMENGVLTV  139

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K+    VK P+V +IE
Sbjct  140  TVPKV---EVKKPEVKAIE  155



>gb|KDP42159.1| hypothetical protein JCGZ_02889 [Jatropha curcas]
Length=157

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++R+L++SGER  E+++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  79   IEDDRILQISGERNVEKEEKNDTWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTV  138

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P V +I+
Sbjct  139  TVPK---EEIKKPDVKAIQ  154



>ref|XP_010689968.1| PREDICTED: 17.8 kDa class I heat shock protein-like [Beta vulgaris 
subsp. vulgaris]
Length=149

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 3/77 (4%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            + +VL+VSGER RE+++K D WHR ER  GKF RRFRLPENA ++ +KA +ENGVLTI+ 
Sbjct  73   DGKVLQVSGERNREQEEKNDKWHRVERSSGKFLRRFRLPENAKMEEIKASMENGVLTITV  132

Query  187  AKLAPDRVKVPKVVSIE  237
             K+    VK P+V SI+
Sbjct  133  PKM---EVKKPEVKSID  146



>ref|XP_004505083.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum]
Length=160

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA ++ VKA +ENGVLT+
Sbjct  82   IEDDRVLQISGERSVEKEDKNDQWHRVERSSGKFMRRFRLPENAKMEQVKAAMENGVLTV  141

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P V SIE
Sbjct  142  TVPK---EEIKKPDVKSIE  157



>sp|P30221.1|HSP11_SOLLC RecName: Full=17.8 kDa class I heat shock protein [Solanum lycopersicum]
 emb|CAA39603.1| small heat shock protein (class I) [Solanum lycopersicum]
Length=154

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
            +RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++  
Sbjct  79   DRVLQISGERNVEKEDKNDKWHRMERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVP  138

Query  190  KLAPDRVKVPKVVSIE  237
            K   + VK P+V SIE
Sbjct  139  K---EEVKKPEVKSIE  151



>ref|NP_001266045.1| 17.8 kDa class I heat shock protein-like [Solanum lycopersicum]
 gb|AAD30452.1|AF123255_1 17.7 kD class I small heat shock protein [Solanum lycopersicum]
 gb|AAN64316.1| type I small heat shock protein 17.7 kDa I2I isoform [Solanum 
lycopersicum]
Length=154

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
            +RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++  
Sbjct  79   DRVLQISGERNVEKEDKNDKWHRMERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVP  138

Query  190  KLAPDRVKVPKVVSIE  237
            K   + VK P+V SIE
Sbjct  139  K---EEVKKPEVKSIE  151



>gb|KDP42161.1| hypothetical protein JCGZ_02891 [Jatropha curcas]
 gb|KDP46582.1| hypothetical protein JCGZ_08554 [Jatropha curcas]
Length=157

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++R+L++SGER  E+++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  79   IEDDRILQISGERNVEKEEKNDTWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTV  138

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P V +I+
Sbjct  139  TVPK---EEIKKPDVKAIQ  154



>emb|CAQ64462.1| cytosolic class I small heat shock protein type 1 [Rhododendron 
formosanum]
Length=144

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = +1

Query  13   RVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFAK  192
            R+L++SGER REE +K D WHR ER  GKF+RRF+LPENA +D VKA LENGVLT++  K
Sbjct  70   RILQISGERSREEVEKNDKWHRIERSSGKFFRRFQLPENAKMDQVKATLENGVLTVTVPK  129

Query  193  LAPDRVKVPKVVSIE  237
                 VK P+V +I+
Sbjct  130  A---EVKKPEVKAID  141



>ref|XP_011044573.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Populus 
euphratica]
Length=158

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVLR+SGER  E++ K D WHR ER  G+F RRFRLPENA +D VKA +ENGVLT+
Sbjct  80   IEDDRVLRISGERSVEKEDKNDTWHRVERSSGRFSRRFRLPENAKMDQVKASMENGVLTV  139

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P++ +IE
Sbjct  140  TVPK---EEVKKPELKAIE  155



>ref|XP_004505087.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum]
Length=160

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA ++ VKA +ENGVLT+
Sbjct  82   IEDDRVLQISGERSVEKEDKNDQWHRVERSSGKFMRRFRLPENAKMEQVKAAMENGVLTV  141

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P V SIE
Sbjct  142  TVPK---EEIKKPDVKSIE  157



>ref|XP_010033073.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Eucalyptus 
grandis]
 ref|XP_010033074.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Eucalyptus 
grandis]
 gb|KCW52607.1| hypothetical protein EUGRSUZ_J01978 [Eucalyptus grandis]
Length=162

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA LD VKA +ENGVLT+
Sbjct  84   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENARLDQVKASMENGVLTV  143

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            S  K+   + +V K + I G
Sbjct  144  SVPKVEEKKPEV-KAIEISG  162



>ref|XP_007016258.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
 gb|EOY33877.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
Length=157

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPEN  +D VKA +ENGVLT+
Sbjct  79   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENVKMDQVKASMENGVLTV  138

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V +IE
Sbjct  139  TIPK---EEVKKPDVKAIE  154



>gb|ABW89470.1| low molecular weight heat shock protein [Gossypium hirsutum]
Length=154

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            ++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D +KA +ENGVLT++ 
Sbjct  78   DDRVLQISGERNMEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQIKASMENGVLTVTV  137

Query  187  AKLAPDRVKVPKVVSIE  237
             KL    VK P V +I+
Sbjct  138  PKL---EVKKPDVKAID  151



>gb|AFK46274.1| unknown [Lotus japonicus]
Length=160

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFR PENA +D VKA +ENGVLT+
Sbjct  82   IEDDRVLQISGERNVEKEDKNDTWHRMERSSGKFQRRFRFPENAKMDQVKASMENGVLTV  141

Query  181  SFAKLAPDRVKVPKVVSIE  237
               K   + +K P+V SIE
Sbjct  142  PVPK---EEIKKPEVKSIE  157



>gb|AEA86322.1| class I heat shock protein [Solanum nigrum]
Length=155

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
            +RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++  
Sbjct  80   DRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVP  139

Query  190  KLAPDRVKVPKVVSIE  237
            K   + VK P+V SIE
Sbjct  140  K---EEVKKPEVKSIE  152



>ref|XP_008464901.1| PREDICTED: 17.6 kDa class I heat shock protein 3-like [Cucumis 
melo]
Length=153

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 4/79 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            VEE RVL++SGER +E+++K D WHR ER  GKF RRFRLPENA ++ VKA +ENGVLT+
Sbjct  76   VEEGRVLQISGERSKEQEEKNDKWHRIERSSGKFERRFRLPENAKVEEVKANMENGVLTV  135

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K+     K P+V SI+
Sbjct  136  TVPKME----KKPEVNSID  150



>ref|XP_004516546.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cicer arietinum]
Length=160

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA ++ VKA +ENGVLT+
Sbjct  82   IEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFMRRFRLPENAKMEQVKAAMENGVLTV  141

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P V SIE
Sbjct  142  TVPK---EHIKKPDVKSIE  157



>ref|XP_011003996.1| PREDICTED: 17.5 kDa class I heat shock protein-like [Populus 
euphratica]
Length=151

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  73   IEDDRVLQISGERNVEKEDKNDTWHRVERSRGKFLRRFRLPENAKVDQVKASMENGVLTV  132

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V +IE
Sbjct  133  TVPK---EEVKKPDVKAIE  148



>gb|ACJ85922.1| unknown [Medicago truncatula]
 gb|AFK46147.1| unknown [Medicago truncatula]
 gb|KEH31008.1| 17.6 kDa class I heat shock protein [Medicago truncatula]
Length=161

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVL +
Sbjct  83   IEDDRVLQISGERNFEKEDKNDQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLAV  142

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P+V +IE
Sbjct  143  TVPK---EEIKKPEVKAIE  158



>ref|XP_009344353.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Pyrus x 
bretschneideri]
Length=153

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 56/77 (73%), Gaps = 4/77 (5%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            + RVL++SGER RE+++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++ 
Sbjct  78   DGRVLQISGERSREQEEKNDTWHRVERSSGKFMRRFRLPENAKVDQVKAAMENGVLTVT-  136

Query  187  AKLAPDRVKVPKVVSIE  237
                P  VK P V +I+
Sbjct  137  ---VPKEVKRPDVKTID  150



>emb|CAQ64458.1| cytosolic class I small heat shock protein type 1 [Rhododendron 
breviperulatum]
Length=144

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = +1

Query  13   RVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFAK  192
            R+L++SGER RE+++K D WHR ER  GKF+RRF+LPENA +D VKA +ENGVLT++  K
Sbjct  70   RILQISGERNREKEEKNDKWHRIERSSGKFFRRFQLPENAKMDQVKATMENGVLTVTVPK  129

Query  193  LAPDRVKVPKVVSIE  237
                 VK P+V +IE
Sbjct  130  A---EVKKPEVKAIE  141



>ref|XP_002520464.1| heat-shock protein, putative [Ricinus communis]
 gb|EEF41877.1| heat-shock protein, putative [Ricinus communis]
Length=157

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  79   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFLRRFRLPENAKMDQVKASMENGVLTV  138

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P + ++E
Sbjct  139  TVPK---EEIKKPDIKAVE  154



>emb|CAQ64464.1| cytosolic class I small heat shock protein type 1 [Rhododendron 
morii]
 emb|CAQ64470.1| cytosolic class I small heat shock protein type 1 [Rhododendron 
pseudochrysanthum]
Length=144

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = +1

Query  13   RVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFAK  192
            R+L++SGER RE+++K D WHR ER  GKF+RRF+LPENA +D VKA +ENGVLT++  K
Sbjct  70   RILQISGERSREKEEKNDKWHRIERSSGKFFRRFQLPENAKMDQVKATMENGVLTVTVPK  129

Query  193  LAPDRVKVPKVVSIE  237
                 VK P+V +IE
Sbjct  130  A---EVKKPEVKAIE  141



>ref|XP_004294276.1| PREDICTED: 18.2 kDa class I heat shock protein-like [Fragaria 
vesca subsp. vesca]
Length=158

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER+ E++ K D WHR ER  GKF RRFRLPENA +D +KA +ENGVL++
Sbjct  80   IEDDRVLQISGERKIEKEDKNDTWHRVERSSGKFSRRFRLPENAKVDEIKAAMENGVLSV  139

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K+    VK P V SIE
Sbjct  140  TVPKV---DVKKPDVKSIE  155



>ref|XP_002313360.1| 17.5 kd heat shock family protein [Populus trichocarpa]
 gb|EEE87315.1| 17.5 kd heat shock family protein [Populus trichocarpa]
Length=155

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRF+LPENA +D VKA LENGVLT+
Sbjct  76   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFLRRFKLPENAKIDQVKAGLENGVLTV  135

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            +  K    +  V K + I G
Sbjct  136  TVPKEEVKKPDVKKAIEISG  155



>ref|XP_006387302.1| hypothetical protein POPTR_1310s00200g [Populus trichocarpa]
 gb|ERP46216.1| hypothetical protein POPTR_1310s00200g [Populus trichocarpa]
Length=159

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SG+R  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  81   IEDDRVLQISGDRNVEKEDKNDAWHRVERSSGKFLRRFRLPENAKMDQVKASMENGVLTV  140

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P V +IE
Sbjct  141  TVPK---EEIKKPDVKAIE  156



>ref|XP_002325979.2| 17.5 kd heat shock family protein [Populus trichocarpa]
 gb|EEF00361.2| 17.5 kd heat shock family protein [Populus trichocarpa]
Length=152

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E+ RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  74   IEDGRVLQISGERNVEKEDKNDTWHRVERSSGKFLRRFRLPENAKVDQVKASMENGVLTV  133

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V +IE
Sbjct  134  TVPK---EEVKKPDVKAIE  149



>gb|ADD21573.1| hypothetical protein [Carthamus tinctorius]
Length=137

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +1

Query  7    ENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISF  186
            ++R+L++SGER  E++ K D WHR ER  GKF RRFRLPENA LD VKA +ENGVLTI+ 
Sbjct  61   DDRILQISGERNVEKEDKNDTWHRVERSSGKFTRRFRLPENAKLDQVKASMENGVLTITV  120

Query  187  AKLAPDRVKVPKVVSIE  237
             K   + VK P V SI+
Sbjct  121  PK---EEVKKPDVKSIQ  134



>ref|XP_002520482.1| heat-shock protein, putative [Ricinus communis]
 gb|EEF41895.1| heat-shock protein, putative [Ricinus communis]
Length=153

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  75   IEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTV  134

Query  181  SFAKLAPDRVKVPKVVSIE  237
               K+    VK P+V +I+
Sbjct  135  IVPKV---EVKKPEVKAID  150



>ref|XP_008809153.1| PREDICTED: 17.8 kDa class I heat shock protein-like [Phoenix 
dactylifera]
Length=151

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 3/76 (4%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
             RVL++SGER +E+++K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++  
Sbjct  76   GRVLQISGERSKEKEEKNDKWHRVERSSGKFLRRFRLPENAKVDQVKASMENGVLTVTVP  135

Query  190  KLAPDRVKVPKVVSIE  237
            K A   VK P++ SIE
Sbjct  136  KEA---VKKPEMKSIE  148



>ref|NP_001234225.1| type I small heat shock protein 17.6 kDa isoform [Solanum lycopersicum]
 gb|AAD30454.1|AF123257_1 17.6 kD class I small heat shock protein [Solanum lycopersicum]
 gb|AAN64315.1| type I small heat shock protein 17.6 kDa isoform [Solanum lycopersicum]
 gb|AEP95306.1| class I small heat shock protein 17.6 [Solanum lycopersicum]
Length=154

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 3/76 (4%)
 Frame = +1

Query  10   NRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTISFA  189
            +RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT++  
Sbjct  79   DRVLQISGERNVEKEDKNDKWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVP  138

Query  190  KLAPDRVKVPKVVSIE  237
            K   + VK P+V SIE
Sbjct  139  K---EEVKKPEVKSIE  151



>ref|XP_002325980.2| 17.5 kd heat shock family protein [Populus trichocarpa]
 gb|EEF00362.2| 17.5 kd heat shock family protein [Populus trichocarpa]
Length=152

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  74   IEDDRVLQISGERNVEKEDKNDTWHRIERSSGKFVRRFRLPENAKVDQVKASMENGVLTV  133

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P V +IE
Sbjct  134  TVPK---EEVKKPDVKAIE  149



>ref|XP_010094785.1| hypothetical protein L484_000756 [Morus notabilis]
 gb|EXB56974.1| hypothetical protein L484_000756 [Morus notabilis]
Length=156

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E+++K D WHR ER  GKF RRFRLPENA ++ V+A +ENGVLT+
Sbjct  78   IEDDRVLQISGERNAEKEEKNDTWHRVERSSGKFLRRFRLPENAKMEEVRASMENGVLTV  137

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K+    VK P V SIE
Sbjct  138  TVPKV---EVKKPDVKSIE  153



>gb|KEH31005.1| 17.6 kDa class I heat shock protein [Medicago truncatula]
Length=231

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E +RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  153  IEGDRVLQISGERNVEKEDKNDQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  212

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + +K P V SIE
Sbjct  213  TVPK---EEIKKPDVKSIE  228


 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E +RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  80   IEGDRVLQISGERNVEKEDKNDQWHRVERSSGKFMRRFRLPENAKMDQVKAAMENGVLTV  139

Query  181  SFAKLAPDRVKVPKVVSIEGEKPAEIN  261
            +  K   + +K P  V IEG++  +I+
Sbjct  140  TVPK---EEIKKPD-VEIEGDRVLQIS  162



>ref|XP_008233691.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Prunus mume]
Length=154

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            V++ +VL++SGERRRE+++K D WHR ER  GKF R FRLPENA +D VKA +ENGVLT+
Sbjct  76   VDDGKVLQISGERRREQEEKNDKWHRIERSTGKFSRMFRLPENAKIDQVKASMENGVLTV  135

Query  181  SFAKLAPDRVKVPKVVSIEG  240
            +  K    R +V K + I G
Sbjct  136  TVPKEEEKRPQV-KAIDISG  154



>ref|XP_002312898.2| hypothetical protein POPTR_0009s15020g [Populus trichocarpa]
 gb|EEE86853.2| hypothetical protein POPTR_0009s15020g [Populus trichocarpa]
Length=159

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    VEENRVLRVSGERRREEQKKGDHWHREERVHGKFWRRFRLPENADLDSVKARLENGVLTI  180
            +E++RVL++SGER  E++ K D WHR ER  GKF RRFRLPENA +D VKA +ENGVLT+
Sbjct  81   IEDDRVLQISGERSVEKEDKNDTWHRVERRSGKFSRRFRLPENAKVDQVKASMENGVLTV  140

Query  181  SFAKLAPDRVKVPKVVSIE  237
            +  K   + VK P+V +IE
Sbjct  141  TVPK---EEVKKPEVKAIE  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527233275408