BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c89349_g1_i1 len=726 path=[704:0-725]

Length=726
                                                                      Score     E

ref|XP_009619288.1|  PREDICTED: uncharacterized protein LOC104111317    156   2e-44   
ref|XP_009797966.1|  PREDICTED: uncharacterized protein LOC104244276    155   2e-44   
ref|XP_010676308.1|  PREDICTED: uncharacterized protein LOC104892166    152   3e-43   
gb|EYU23372.1|  hypothetical protein MIMGU_mgv1a017048mg                151   9e-43   
ref|XP_010261529.1|  PREDICTED: uncharacterized protein LOC104600337    150   2e-42   
emb|CDP12143.1|  unnamed protein product                                150   2e-42   
ref|XP_009767929.1|  PREDICTED: uncharacterized protein LOC104219001    150   4e-42   
ref|XP_006439369.1|  hypothetical protein CICLE_v10024283mg             150   4e-42   
gb|EPS62431.1|  hypothetical protein M569_12360                         149   6e-42   
gb|KDO76499.1|  hypothetical protein CISIN_1g038903mg                   149   9e-42   
ref|XP_007209796.1|  hypothetical protein PRUPE_ppa013941mg             148   1e-41   
ref|XP_011101029.1|  PREDICTED: uncharacterized protein LOC105179129    148   1e-41   
ref|XP_002272604.1|  PREDICTED: uncharacterized protein LOC100258722    147   3e-41   Vitis vinifera
ref|XP_009603674.1|  PREDICTED: uncharacterized protein LOC104098595    147   3e-41   
gb|KHG05362.1|  Phosphoribosylformylglycinamidine synthase 2            146   7e-41   
ref|XP_007040493.1|  PA-domain containing subtilase family protein      145   1e-40   
ref|XP_010266477.1|  PREDICTED: uncharacterized protein LOC104603981    144   5e-40   
ref|XP_009352396.1|  PREDICTED: uncharacterized protein LOC103943773    144   5e-40   
ref|XP_007160156.1|  hypothetical protein PHAVU_002G297500g             143   1e-39   
gb|KDP25312.1|  hypothetical protein JCGZ_20468                         143   2e-39   
gb|KHG11910.1|  Diaminopimelate epimerase                               143   2e-39   
ref|XP_008381197.1|  PREDICTED: uncharacterized protein LOC103444...    140   2e-38   
ref|XP_010053123.1|  PREDICTED: uncharacterized protein LOC104441653    140   2e-38   
ref|XP_010096818.1|  hypothetical protein L484_003879                   139   4e-38   
ref|XP_006584760.1|  PREDICTED: uncharacterized protein LOC102660809    137   2e-37   
ref|XP_008790344.1|  PREDICTED: uncharacterized protein LOC103707555    137   4e-37   
ref|XP_011026907.1|  PREDICTED: uncharacterized protein LOC105127346    137   5e-37   
ref|XP_002297981.2|  hypothetical protein POPTR_0001s10510g             136   6e-37   Populus trichocarpa [western balsam poplar]
ref|XP_006580530.1|  PREDICTED: uncharacterized protein LOC102669617    135   2e-36   
ref|XP_010913865.1|  PREDICTED: uncharacterized protein LOC105039427    135   2e-36   
ref|XP_002509946.1|  conserved hypothetical protein                     135   2e-36   Ricinus communis
gb|EMS55908.1|  hypothetical protein TRIUR3_32635                       132   4e-35   
ref|XP_008791432.1|  PREDICTED: uncharacterized protein LOC103708333    131   5e-35   
ref|XP_010925753.1|  PREDICTED: uncharacterized protein LOC105048...    131   5e-35   
ref|XP_008783835.1|  PREDICTED: uncharacterized protein LOC103702...    131   7e-35   
ref|XP_010924846.1|  PREDICTED: uncharacterized protein LOC105047568    131   9e-35   
emb|CDM82285.1|  unnamed protein product                                130   2e-34   
gb|AFK46690.1|  unknown                                                 129   5e-34   
ref|XP_011022516.1|  PREDICTED: uncharacterized protein LOC105124272    129   5e-34   
ref|XP_002304550.2|  hypothetical protein POPTR_0003s13860g             129   5e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004967495.1|  PREDICTED: uncharacterized protein LOC101770708    128   1e-33   
ref|XP_004503630.1|  PREDICTED: uncharacterized protein LOC101501081    127   1e-33   
gb|KEH21211.1|  peptidase inhibitor I9                                  127   3e-33   
ref|XP_010915672.1|  PREDICTED: uncharacterized protein LOC105040712    127   3e-33   
ref|NP_001042427.1|  Os01g0220500                                       126   7e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454929.1|  hypothetical protein SORBIDRAFT_03g001530          125   8e-33   Sorghum bicolor [broomcorn]
ref|XP_008783834.1|  PREDICTED: uncharacterized protein LOC103702...    125   9e-33   
ref|XP_010541539.1|  PREDICTED: uncharacterized protein LOC104814970    125   1e-32   
ref|XP_009399831.1|  PREDICTED: uncharacterized protein LOC103984123    124   4e-32   
ref|XP_003565674.1|  PREDICTED: uncharacterized protein LOC100842221    122   1e-31   
ref|NP_001143717.1|  hypothetical protein                               122   1e-31   Zea mays [maize]
ref|XP_009389890.1|  PREDICTED: uncharacterized protein LOC103976423    120   7e-31   
ref|XP_009409424.1|  PREDICTED: uncharacterized protein LOC103991...    120   9e-31   
emb|CDY03517.1|  BnaC01g15650D                                          118   8e-30   
ref|XP_009137427.1|  PREDICTED: uncharacterized protein LOC103861...    118   1e-29   
ref|XP_008451935.1|  PREDICTED: uncharacterized protein LOC103493088    117   4e-29   
ref|XP_009409423.1|  PREDICTED: uncharacterized protein LOC103991...    115   1e-28   
gb|EAZ11067.1|  hypothetical protein OsJ_00912                          114   1e-28   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD81363.1|  unknown protein                                        114   5e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009349052.1|  PREDICTED: uncharacterized protein LOC103940...    110   5e-27   
ref|XP_006837470.1|  hypothetical protein AMTR_s00107p00154700          110   6e-27   
ref|XP_008381198.1|  PREDICTED: uncharacterized protein LOC103444...    106   2e-25   
gb|ADE75799.1|  unknown                                                 100   5e-23   
ref|XP_010925752.1|  PREDICTED: uncharacterized protein LOC105048...    100   1e-22   
ref|XP_009137418.1|  PREDICTED: uncharacterized protein LOC103861...  97.1    1e-21   
gb|ABK22015.1|  unknown                                               95.5    3e-21   Picea sitchensis
gb|KGN53396.1|  hypothetical protein Csa_4G051480                     91.3    1e-19   
ref|XP_006413511.1|  hypothetical protein EUTSA_v10027148mg           80.1    8e-16   
ref|XP_002267221.2|  PREDICTED: subtilisin-like protease SBT3.5       54.7    3e-05   Vitis vinifera
ref|XP_010099159.1|  Subtilisin-like protease                         54.3    3e-05   
ref|XP_010054605.1|  PREDICTED: subtilisin-like protease              52.0    2e-04   
ref|XP_009799224.1|  PREDICTED: subtilisin-like protease              51.6    3e-04   
ref|XP_007153989.1|  hypothetical protein PHAVU_003G081700g           51.2    4e-04   
dbj|BAB70678.1|  subtilisin-like serine protease                      50.4    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473453.1|  PREDICTED: subtilisin-like protease SBT3.5       50.1    0.001   



>ref|XP_009619288.1| PREDICTED: uncharacterized protein LOC104111317 [Nicotiana tomentosiformis]
Length=94

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +1

Query  118  MTTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSL  297
            M +  E+YFVFMN DPEYERL+SN TKKG+ ELDLYL KKHDE L  TLEPG+YNKT+SL
Sbjct  1    MASRREVYFVFMNYDPEYERLKSNRTKKGTQELDLYLCKKHDELLENTLEPGSYNKTMSL  60

Query  298  AIVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
             IVD FAV++TDHQAN+LRSAK+VRVVEKNQELA
Sbjct  61   VIVDGFAVEMTDHQANLLRSAKDVRVVEKNQELA  94



>ref|XP_009797966.1| PREDICTED: uncharacterized protein LOC104244276 [Nicotiana sylvestris]
Length=94

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +1

Query  118  MTTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSL  297
            M +  E+YFVFMN DPEYERL+SN TKKG+ ELDLYL KKHDE L  TLEPG+YNKT+SL
Sbjct  1    MESRREVYFVFMNYDPEYERLKSNRTKKGTQELDLYLCKKHDELLENTLEPGSYNKTMSL  60

Query  298  AIVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
             IVD FAV+ITD+QANVLRSAK+VRVVEKNQELA
Sbjct  61   VIVDGFAVEITDNQANVLRSAKDVRVVEKNQELA  94



>ref|XP_010676308.1| PREDICTED: uncharacterized protein LOC104892166 [Beta vulgaris 
subsp. vulgaris]
Length=95

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 4/99 (4%)
 Frame = +1

Query  103  MASKEMTTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYN  282
            MASK+     ELYFVFMN DPEYERLRS+ +K+G++ELD+YLS+KHDE LA T +PGTYN
Sbjct  1    MASKQ----KELYFVFMNFDPEYERLRSDRSKRGAYELDMYLSRKHDELLARTFQPGTYN  56

Query  283  KTLSLAIVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            KTLSL IVD FAVQITD QA +LRSA EVRVVEKNQELA
Sbjct  57   KTLSLVIVDGFAVQITDDQAKLLRSAMEVRVVEKNQELA  95



>gb|EYU23372.1| hypothetical protein MIMGU_mgv1a017048mg [Erythranthe guttata]
Length=96

 Score =   151 bits (382),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            E +FVFMN DPEYERLRS+ TK+G HELDLYLS+KHDE L+  L PGTY KTLSL IVDA
Sbjct  8    EQHFVFMNYDPEYERLRSSKTKRGVHELDLYLSRKHDEVLSNNLRPGTYCKTLSLVIVDA  67

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            FAVQI+DHQANVLRSAKEVR+VEKNQELA
Sbjct  68   FAVQISDHQANVLRSAKEVRIVEKNQELA  96



>ref|XP_010261529.1| PREDICTED: uncharacterized protein LOC104600337 [Nelumbo nucifera]
Length=95

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            + A+ELYFVFMN DPEYERLR++ TK+G++ELDLYLS KHD+ LA+TLEPGTYNK  SL 
Sbjct  3    SRASELYFVFMNFDPEYERLRADRTKQGAYELDLYLSNKHDQLLASTLEPGTYNKRFSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            IVD FAV+ITD QAN+LRSAK VRVVEKNQELA
Sbjct  63   IVDGFAVEITDDQANMLRSAKGVRVVEKNQELA  95



>emb|CDP12143.1| unnamed protein product [Coffea canephora]
Length=95

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T  EL+FVFMN DPEYERLRS+ TK+G+HEL LYLSKKHD+ LA TLEPG+Y KTLSL 
Sbjct  3    STNNELHFVFMNYDPEYERLRSSRTKRGAHELHLYLSKKHDDLLANTLEPGSYKKTLSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            IVD FAV+ITD QANVLRSAK+VR+VEKNQELA
Sbjct  63   IVDGFAVEITDDQANVLRSAKDVRLVEKNQELA  95



>ref|XP_009767929.1| PREDICTED: uncharacterized protein LOC104219001 [Nicotiana sylvestris]
Length=95

 Score =   150 bits (378),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 80/99 (81%), Gaps = 4/99 (4%)
 Frame = +1

Query  103  MASKEMTTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYN  282
            MAS E     ELYFVFMN DPEYERL S  TKKGS+ELDLY+SKKHDE LA T EPG+Y 
Sbjct  1    MASGE----TELYFVFMNYDPEYERLLSKRTKKGSYELDLYISKKHDELLANTFEPGSYK  56

Query  283  KTLSLAIVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            K LSL IVD FAV+ITD QANVLRSA EVRVVEKNQELA
Sbjct  57   KRLSLVIVDGFAVEITDDQANVLRSAPEVRVVEKNQELA  95



>ref|XP_006439369.1| hypothetical protein CICLE_v10024283mg [Citrus clementina]
 gb|ESR52609.1| hypothetical protein CICLE_v10024283mg [Citrus clementina]
Length=95

 Score =   150 bits (378),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            T  AELYFVFMN DPEY+RLR++ TK+G+ ELDLYLSKKHDE LA+TLEPG+Y KTLSL 
Sbjct  3    TQNAELYFVFMNYDPEYQRLRADRTKQGADELDLYLSKKHDELLASTLEPGSYRKTLSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            IVD FAV+IT+ QANVLRSAK VRVVEKNQEL
Sbjct  63   IVDGFAVEITEDQANVLRSAKGVRVVEKNQEL  94



>gb|EPS62431.1| hypothetical protein M569_12360 [Genlisea aurea]
Length=94

 Score =   149 bits (377),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  118  MTTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSL  297
            MT  +EL+FVFMN DPEYERLR++ TKKG++ELD YLSKKHDE LA  L+PGTYNKTLSL
Sbjct  1    MTRRSELHFVFMNYDPEYERLRADKTKKGAYELDSYLSKKHDEILAKNLQPGTYNKTLSL  60

Query  298  AIVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
             IVD FAV+I++ QANVLR+AKEVR+VEKNQEL
Sbjct  61   VIVDGFAVEISEDQANVLRAAKEVRIVEKNQEL  93



>gb|KDO76499.1| hypothetical protein CISIN_1g038903mg [Citrus sinensis]
Length=95

 Score =   149 bits (376),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            T  AELYFVFMN DPEY+RLR++ T++G+ ELDLYLSKKHDE LA+TLEPG+Y KTLSL 
Sbjct  3    TQNAELYFVFMNYDPEYQRLRADRTRQGADELDLYLSKKHDELLASTLEPGSYRKTLSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            IVD FAV+IT+ QANVLRSAK VRVVEKNQEL
Sbjct  63   IVDGFAVEITEDQANVLRSAKGVRVVEKNQEL  94



>ref|XP_007209796.1| hypothetical protein PRUPE_ppa013941mg [Prunus persica]
 ref|XP_008239047.1| PREDICTED: uncharacterized protein LOC103337657 [Prunus mume]
 gb|EMJ10995.1| hypothetical protein PRUPE_ppa013941mg [Prunus persica]
Length=95

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  124  TAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAI  303
            T  E YFVFMN DP+YERLR+N TK+G++ELDLYLS+KHD+ LA TLEPG+Y KTLSL I
Sbjct  4    TKIESYFVFMNYDPQYERLRANRTKRGTNELDLYLSRKHDQLLARTLEPGSYKKTLSLVI  63

Query  304  VDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            VD FAV+ITD QA+VLRSAKEVR+VEKNQELA
Sbjct  64   VDGFAVEITDDQASVLRSAKEVRLVEKNQELA  95



>ref|XP_011101029.1| PREDICTED: uncharacterized protein LOC105179129 [Sesamum indicum]
Length=95

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +1

Query  124  TAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAI  303
            T  EL+FVFMN DPEYERLRSN TK+G+HELDLYLS+KH+E LA  L+ GTY KTLSL I
Sbjct  4    TRPELHFVFMNYDPEYERLRSNKTKRGAHELDLYLSRKHEEVLAKNLQAGTYRKTLSLVI  63

Query  304  VDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            VD FAV+ITD QANVLRSA+EVR+VEKNQELA
Sbjct  64   VDGFAVEITDDQANVLRSAEEVRIVEKNQELA  95



>ref|XP_002272604.1| PREDICTED: uncharacterized protein LOC100258722 [Vitis vinifera]
 emb|CAN82078.1| hypothetical protein VITISV_042760 [Vitis vinifera]
 emb|CBI34468.3| unnamed protein product [Vitis vinifera]
Length=95

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            ++  ELYFVFMN DPEYERLR++ TK+G+HELDLYLS+KHD+ LA+ LEPG+Y KT SL 
Sbjct  3    SSNTELYFVFMNFDPEYERLRADRTKRGAHELDLYLSRKHDQLLASVLEPGSYKKTSSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            IVD FAV+I+D QANVLRSAK VRVVEKNQELA
Sbjct  63   IVDGFAVEISDDQANVLRSAKGVRVVEKNQELA  95



>ref|XP_009603674.1| PREDICTED: uncharacterized protein LOC104098595 [Nicotiana tomentosiformis]
Length=95

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            ELYFVFMN DPEYERL+S   KKGS+ELDLY+SKKHDE LA T EPG+Y K LSL IVD 
Sbjct  7    ELYFVFMNYDPEYERLQSKRKKKGSYELDLYISKKHDELLANTFEPGSYKKRLSLVIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            FAV+ITD QA+VLRSAKEVRVVEKNQELA
Sbjct  67   FAVEITDDQADVLRSAKEVRVVEKNQELA  95



>gb|KHG05362.1| Phosphoribosylformylglycinamidine synthase 2 [Gossypium arboreum]
Length=95

 Score =   146 bits (369),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T  ELYFVFMN DPEY+RLR++ TKKG++ELDLYLSKKHDE LA+TL+ GTY KTLSL 
Sbjct  3    STRTELYFVFMNYDPEYQRLRADQTKKGAYELDLYLSKKHDELLASTLQAGTYKKTLSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            IVD FAV+IT+ QANVLRSA  VRVVEKNQEL
Sbjct  63   IVDGFAVEITETQANVLRSANGVRVVEKNQEL  94



>ref|XP_007040493.1| PA-domain containing subtilase family protein [Theobroma cacao]
 gb|EOY24994.1| PA-domain containing subtilase family protein [Theobroma cacao]
Length=95

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T  ELYFVFMN DPEY+RLR++ TKKG++ELDLYLS+KHDE LA TL+ G+Y KTLSL 
Sbjct  3    STKTELYFVFMNYDPEYQRLRADRTKKGAYELDLYLSRKHDELLAGTLQAGSYKKTLSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            IVD FAV+IT+ QANVLRSA  VRVVEKNQELA
Sbjct  63   IVDGFAVEITEAQANVLRSANGVRVVEKNQELA  95



>ref|XP_010266477.1| PREDICTED: uncharacterized protein LOC104603981 [Nelumbo nucifera]
Length=95

 Score =   144 bits (364),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            ELYFVFMN DPEYERLR++ TK+G++ELD+YLS KHD+ LA+TLEPGTYNK  SL IVD 
Sbjct  7    ELYFVFMNFDPEYERLRADRTKQGAYELDVYLSNKHDQLLASTLEPGTYNKRFSLVIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            FAV+I+D QAN+LRSAK VRVV+KNQELA
Sbjct  67   FAVEISDDQANMLRSAKGVRVVDKNQELA  95



>ref|XP_009352396.1| PREDICTED: uncharacterized protein LOC103943773 [Pyrus x bretschneideri]
 ref|XP_009349051.1| PREDICTED: uncharacterized protein LOC103940627 isoform X1 [Pyrus 
x bretschneideri]
Length=95

 Score =   144 bits (364),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  124  TAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAI  303
            T +E YFVFMN DP+YERLR++ TK+G++ELDLYLS+KHD+ LA TLEPG+Y KTLSL I
Sbjct  4    TKSESYFVFMNYDPQYERLRADRTKRGANELDLYLSRKHDQLLARTLEPGSYKKTLSLVI  63

Query  304  VDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            VD F+V+IT+ QA+VLRSAKEVR+VEKNQELA
Sbjct  64   VDGFSVEITEDQASVLRSAKEVRLVEKNQELA  95



>ref|XP_007160156.1| hypothetical protein PHAVU_002G297500g [Phaseolus vulgaris]
 gb|ESW32150.1| hypothetical protein PHAVU_002G297500g [Phaseolus vulgaris]
Length=95

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T  E YFVFM+ DPEYERLR++ TK+G+HELDLYLS KHDE LATTLEPG+YNKT SL 
Sbjct  3    STKMESYFVFMSYDPEYERLRADRTKRGTHELDLYLSTKHDELLATTLEPGSYNKTSSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            IVD FAV+IT  QAN LRSAK VRVVEKN+EL
Sbjct  63   IVDGFAVEITQDQANELRSAKGVRVVEKNEEL  94



>gb|KDP25312.1| hypothetical protein JCGZ_20468 [Jatropha curcas]
Length=95

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T  ELYFVFMN DPEYERLR++ TKKG++ELDLYLS+KHDE LA  L+ GTY KTLSL 
Sbjct  3    STRTELYFVFMNYDPEYERLRADRTKKGAYELDLYLSRKHDELLANNLDRGTYRKTLSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            IVD FAV+IT+ QANVLRSA  VRVVEKNQE+A
Sbjct  63   IVDGFAVEITEVQANVLRSANGVRVVEKNQEVA  95



>gb|KHG11910.1| Diaminopimelate epimerase [Gossypium arboreum]
Length=95

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T  + YFVFMN DPEY RL ++ TKKG++ELDLYLS+KHDE LA+TL+PGTY KTLSL 
Sbjct  3    STKTQSYFVFMNYDPEYHRLHADRTKKGAYELDLYLSRKHDELLASTLQPGTYRKTLSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            IVD FAV+IT+ QANVLRSA  VRVVEKNQELA
Sbjct  63   IVDGFAVEITEAQANVLRSANGVRVVEKNQELA  95



>ref|XP_008381197.1| PREDICTED: uncharacterized protein LOC103444066 isoform X1 [Malus 
domestica]
Length=95

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  124  TAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAI  303
            T +E YFVFMN DP+Y+RLR++ TK+G++ELDL+LS+KHD+ LA TL+PG+Y KTLSL I
Sbjct  4    TKSESYFVFMNYDPQYQRLRADRTKRGANELDLFLSRKHDQLLARTLDPGSYKKTLSLVI  63

Query  304  VDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            VD F+V+IT+ QA+VLRSAKEVR+VEKNQELA
Sbjct  64   VDGFSVEITEDQASVLRSAKEVRLVEKNQELA  95



>ref|XP_010053123.1| PREDICTED: uncharacterized protein LOC104441653 [Eucalyptus grandis]
 gb|KCW77372.1| hypothetical protein EUGRSUZ_D01727 [Eucalyptus grandis]
Length=95

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 79/99 (80%), Gaps = 4/99 (4%)
 Frame = +1

Query  103  MASKEMTTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYN  282
            M S+E    +E+YFVFMN DPEYERLR++ +K+G++ELD YLS KHD  LA TLEPGTY 
Sbjct  1    MGSRE----SEMYFVFMNYDPEYERLRTDRSKRGAYELDSYLSAKHDGLLAATLEPGTYK  56

Query  283  KTLSLAIVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            KT SL IVD F V+I++ QAN LRSAK VRVVEKNQELA
Sbjct  57   KTFSLVIVDGFGVEISEDQANALRSAKGVRVVEKNQELA  95



>ref|XP_010096818.1| hypothetical protein L484_003879 [Morus notabilis]
 gb|EXB66078.1| hypothetical protein L484_003879 [Morus notabilis]
Length=95

 Score =   139 bits (351),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T  E YFVFMN DPEYERLR++  KK ++ELD YLS+KHDE LA+ LEPG+YNKTLSL 
Sbjct  3    STKKESYFVFMNYDPEYERLRADKAKKATNELDSYLSRKHDELLASALEPGSYNKTLSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            IVD F+V+ITD QA +LRSAK VR+VEKNQEL+
Sbjct  63   IVDGFSVEITDEQAKMLRSAKGVRLVEKNQELS  95



>ref|XP_006584760.1| PREDICTED: uncharacterized protein LOC102660809 [Glycine max]
 gb|KHN16747.1| hypothetical protein glysoja_002844 [Glycine soja]
Length=95

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T  E YFVFMN DPEY RLR++ T++G+HELDLYL +KHDE LA+ LEPGTY KT SL 
Sbjct  3    STKMESYFVFMNYDPEYGRLRADRTERGTHELDLYLDRKHDELLASALEPGTYKKTSSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQ  390
            IVDAFAV+IT+ QANVLRSAK VRVVEKN+
Sbjct  63   IVDAFAVEITEDQANVLRSAKGVRVVEKNE  92



>ref|XP_008790344.1| PREDICTED: uncharacterized protein LOC103707555 [Phoenix dactylifera]
Length=95

 Score =   137 bits (344),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  130  AELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVD  309
            AE+YFVF+N DPEYERLR+N + KGS ELD YLS KHD+ LA  L+P TYNK  SLAIVD
Sbjct  6    AEVYFVFLNFDPEYERLRANQSTKGSSELDAYLSNKHDQLLAKLLQPNTYNKRSSLAIVD  65

Query  310  AFAVQITDHQANVLRSAKEVRVVEKNQELA  399
             FAV+IT+ QA +LRSAKEVRVVEKNQELA
Sbjct  66   GFAVEITEKQAAILRSAKEVRVVEKNQELA  95



>ref|XP_011026907.1| PREDICTED: uncharacterized protein LOC105127346 [Populus euphratica]
Length=96

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T +E YFVFMN DPEYERLR++ TK+G++ELD+YLS+KHDE LA TLE G+Y K +SL 
Sbjct  3    STKSERYFVFMNYDPEYERLRADRTKRGAYELDMYLSRKHDELLANTLEHGSYEKKMSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            IVD FAV+IT+ QA+VLRSA  VRVVEKNQEL
Sbjct  63   IVDGFAVEITEDQASVLRSASGVRVVEKNQEL  94



>ref|XP_002297981.2| hypothetical protein POPTR_0001s10510g [Populus trichocarpa]
 gb|EEE82786.2| hypothetical protein POPTR_0001s10510g [Populus trichocarpa]
Length=96

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T +E YFVFMN DPEYERLR++ TK+G++ELD+YLS+KHDE LA TLE G+Y K +SL 
Sbjct  3    STKSERYFVFMNYDPEYERLRADRTKRGAYELDMYLSRKHDELLANTLEHGSYEKKISLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            IVD FAV+IT+ QA+VLRSA  VRVVEKNQEL
Sbjct  63   IVDGFAVEITEDQASVLRSASGVRVVEKNQEL  94



>ref|XP_006580530.1| PREDICTED: uncharacterized protein LOC102669617 [Glycine max]
 gb|KHM99904.1| hypothetical protein glysoja_017602 [Glycine soja]
Length=95

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T  E YFVFM+ DPEY RL+++ TK+G HELDLYL +KHDE LA+TLEPG+Y KT SL 
Sbjct  3    STKVESYFVFMSYDPEYGRLQADRTKRGVHELDLYLDRKHDELLASTLEPGSYKKTSSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQ  390
            IVDAFAV+IT+ QANVLRSAK VRVVEKN+
Sbjct  63   IVDAFAVEITEDQANVLRSAKGVRVVEKNE  92



>ref|XP_010913865.1| PREDICTED: uncharacterized protein LOC105039427 [Elaeis guineensis]
Length=95

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            ++AA++YFVFMN DPEYERLRS+ TK+G+ ELD Y+S+KHD+ LA  L P TY K  SL 
Sbjct  3    SSAADVYFVFMNFDPEYERLRSDRTKQGAMELDRYVSRKHDQLLAKMLRPNTYRKRSSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            IVD FAV+ITD QA +LRSAKEVRVVEKNQEL
Sbjct  63   IVDGFAVEITDVQAAILRSAKEVRVVEKNQEL  94



>ref|XP_002509946.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51333.1| conserved hypothetical protein [Ricinus communis]
Length=95

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            E +FVFMN DPEYERLR++ TK+G++ELDLYLS+KHDE LA TLE G+Y KTLSL IVD 
Sbjct  7    ETFFVFMNYDPEYERLRADRTKRGANELDLYLSRKHDELLANTLEHGSYKKTLSLVIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            FAV+IT+ QA+VLRSA  VRVVEKN+E+A
Sbjct  67   FAVEITEEQADVLRSANGVRVVEKNEEVA  95



>gb|EMS55908.1| hypothetical protein TRIUR3_32635 [Triticum urartu]
 gb|EMT04800.1| hypothetical protein F775_27202 [Aegilops tauschii]
Length=95

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            E+YFVFMN DP YERLR++ TK+GS  LD YLS+KHD+ LA  L+P TY K  SLAIVD 
Sbjct  7    EVYFVFMNFDPVYERLRADRTKQGSATLDAYLSQKHDKLLAKLLQPDTYWKKSSLAIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            FAV+ITD QA+VLRSAKEVRVVEKNQELA
Sbjct  67   FAVEITDAQASVLRSAKEVRVVEKNQELA  95



>ref|XP_008791432.1| PREDICTED: uncharacterized protein LOC103708333 [Phoenix dactylifera]
Length=95

 Score =   131 bits (330),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            ++AA++YFVFMN DPEYERLR++  K+G+ ELD Y+S +HD+ LA  L P TY K  SLA
Sbjct  3    SSAADVYFVFMNFDPEYERLRADRKKQGAMELDRYVSNRHDQLLAKLLRPNTYRKRSSLA  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            IVD FAV+ITD QA +LRSAKEVRVVEKNQEL
Sbjct  63   IVDGFAVEITDDQAAILRSAKEVRVVEKNQEL  94



>ref|XP_010925753.1| PREDICTED: uncharacterized protein LOC105048214 isoform X2 [Elaeis 
guineensis]
Length=95

 Score =   131 bits (330),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +1

Query  130  AELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVD  309
            AE+YFVF+N DPEYERLR+N   KGS ELD YLS KHD+ L   LEP TY K  SLAIVD
Sbjct  6    AEVYFVFLNFDPEYERLRANQLTKGSAELDAYLSNKHDQLLERLLEPNTYKKRSSLAIVD  65

Query  310  AFAVQITDHQANVLRSAKEVRVVEKNQELA  399
             FAV+IT+ QA +LRSAKEVRVVEKNQELA
Sbjct  66   GFAVEITEKQAAILRSAKEVRVVEKNQELA  95



>ref|XP_008783835.1| PREDICTED: uncharacterized protein LOC103702955 isoform X2 [Phoenix 
dactylifera]
Length=95

 Score =   131 bits (329),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  130  AELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVD  309
            AE+YFVFMN DPEYERLR+N + K S ELD YLS KHD+ LA  L P +Y K  SLAIVD
Sbjct  6    AEVYFVFMNFDPEYERLRANQSTKCSAELDAYLSNKHDQLLAKLLRPNSYKKKSSLAIVD  65

Query  310  AFAVQITDHQANVLRSAKEVRVVEKNQELA  399
             FAV+IT++QA +LRSAKEVRVVEKNQELA
Sbjct  66   GFAVEITENQAAILRSAKEVRVVEKNQELA  95



>ref|XP_010924846.1| PREDICTED: uncharacterized protein LOC105047568 [Elaeis guineensis]
Length=95

 Score =   131 bits (329),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            ++AA++YFVFMN DPEYERL+++ TK+G+ ELD Y+S KHD+ LA  L P TY K  SL 
Sbjct  3    SSAADVYFVFMNFDPEYERLQADRTKQGAMELDRYVSNKHDQLLAKMLGPNTYRKRSSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            IVD FAV+ITD QA +LRSAKEVRVVEKNQEL
Sbjct  63   IVDGFAVEITDDQAAILRSAKEVRVVEKNQEL  94



>emb|CDM82285.1| unnamed protein product [Triticum aestivum]
Length=95

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            E+YFVFMN DP YERLR++ TK+GS  LD YLS+KHD+ LA  L+P TY K  SLAIVD 
Sbjct  7    EVYFVFMNFDPVYERLRADRTKQGSATLDAYLSQKHDKLLAKLLQPDTYWKKSSLAIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQEL  396
            FAV+ITD QA+VLRSAKEVRVVEKNQEL
Sbjct  67   FAVEITDAQASVLRSAKEVRVVEKNQEL  94



>gb|AFK46690.1| unknown [Lotus japonicus]
Length=94

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T  E YFVFMN DPEY RL+++  KKG++ELDLYLS+KHDE LA TLEPG+Y K  SL 
Sbjct  3    STKGESYFVFMNYDPEYLRLQADRAKKGTNELDLYLSRKHDELLANTLEPGSYKKESSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQ  390
            IVD FAV+IT+ QANVLRS + VRVVEKN+
Sbjct  63   IVDGFAVEITEDQANVLRSVEGVRVVEKNE  92



>ref|XP_011022516.1| PREDICTED: uncharacterized protein LOC105124272 [Populus euphratica]
Length=96

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +1

Query  103  MASKEMTTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYN  282
            M  KE     E YFVFM+ DPEYER+R++ TK+G++ELD+YLS+KHDE LA TLE G+Y 
Sbjct  1    MGGKE----RERYFVFMDYDPEYERIRNDRTKRGAYELDMYLSRKHDELLANTLEHGSYK  56

Query  283  KTLSLAIVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            KT+SL IVD FAV+IT+ QAN LRS   VRVVEKNQE 
Sbjct  57   KTISLIIVDGFAVEITEDQANALRSTNGVRVVEKNQEF  94



>ref|XP_002304550.2| hypothetical protein POPTR_0003s13860g [Populus trichocarpa]
 gb|EEE79529.2| hypothetical protein POPTR_0003s13860g [Populus trichocarpa]
Length=96

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +1

Query  103  MASKEMTTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYN  282
            M SKE     E YFVFM+ DPEYER+R++ TK+G++ELD+YLS+KHDE LA TL  G+Y 
Sbjct  1    MGSKE----RERYFVFMDYDPEYERIRNDRTKRGAYELDMYLSRKHDELLANTLAHGSYK  56

Query  283  KTLSLAIVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            KT+SL IVD FAV+IT+ QAN LRS   VRVVEKNQE 
Sbjct  57   KTISLIIVDGFAVEITEDQANALRSTNGVRVVEKNQEF  94



>ref|XP_004967495.1| PREDICTED: uncharacterized protein LOC101770708 [Setaria italica]
Length=95

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            E+YFVFMN DP YERLR++ +K+GS  LD YLS KHD+ LA  L+P +Y K  SLAIVD 
Sbjct  7    EVYFVFMNFDPVYERLRADRSKEGSATLDAYLSHKHDKLLAKLLQPDSYRKRSSLAIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            FAV+IT+ QANVLRSAKEVRVVEKNQELA
Sbjct  67   FAVEITEDQANVLRSAKEVRVVEKNQELA  95



>ref|XP_004503630.1| PREDICTED: uncharacterized protein LOC101501081 [Cicer arietinum]
Length=93

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLR-SNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSL  297
            +T +E YFVFMN D EYERLR SN T KG++ELDLYLS+KHDE LA+TLE G+Y K  SL
Sbjct  3    STKSESYFVFMNYDKEYERLRTSNRTTKGAYELDLYLSRKHDEVLASTLEQGSYKKISSL  62

Query  298  AIVDAFAVQITDHQANVLRSAKEVRVVEKNQ  390
             IVD F V+IT+ QANVLRSAK VR+VEKN+
Sbjct  63   VIVDGFTVEITEDQANVLRSAKGVRIVEKNE  93



>gb|KEH21211.1| peptidase inhibitor I9 [Medicago truncatula]
Length=96

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +T +ELYFVF+  D EYERLR+N TK G+++LDLYLS+KHDE LA+TLEPG+Y K  S A
Sbjct  3    STKSELYFVFLIYDQEYERLRTNRTKSGANKLDLYLSRKHDELLASTLEPGSYKKISSFA  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            IVD F V+IT+ Q NVLRSAK VR+VEK ++  
Sbjct  63   IVDGFTVEITEDQVNVLRSAKRVRIVEKEEKFV  95



>ref|XP_010915672.1| PREDICTED: uncharacterized protein LOC105040712 [Elaeis guineensis]
Length=96

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +1

Query  130  AELYFVFMNRDPEYERLRSN-STKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIV  306
            AE+YFVFMN DPEYERLR+N  + K S ELD YLS KHD+ LA  L P TY K  SLAIV
Sbjct  6    AEVYFVFMNFDPEYERLRANHRSTKCSAELDAYLSNKHDQLLAKLLRPNTYKKRSSLAIV  65

Query  307  DAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            D FAV+IT++QA +LRSAKEVRVVEKNQELA
Sbjct  66   DGFAVEITENQAAILRSAKEVRVVEKNQELA  96



>ref|NP_001042427.1| Os01g0220500 [Oryza sativa Japonica Group]
 dbj|BAF04341.1| Os01g0220500 [Oryza sativa Japonica Group]
 gb|EAY73056.1| hypothetical protein OsI_00932 [Oryza sativa Indica Group]
Length=95

 Score =   126 bits (316),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            E+YFVFMN DP YERLR++ +K+GS  LD YLS KHD+ LA  L+P TY K  SLAIVD 
Sbjct  7    EVYFVFMNFDPVYERLRADRSKEGSATLDAYLSHKHDKLLAKLLQPDTYRKKSSLAIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            FAV+ITD QA++LR AKEVRVVEKNQELA
Sbjct  67   FAVEITDAQASILRLAKEVRVVEKNQELA  95



>ref|XP_002454929.1| hypothetical protein SORBIDRAFT_03g001530 [Sorghum bicolor]
 gb|EES00049.1| hypothetical protein SORBIDRAFT_03g001530 [Sorghum bicolor]
Length=95

 Score =   125 bits (315),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            E+YFVFMN DP YERLR++ +K+GS  LD YLS KHD+ LA  L+P +Y K  SLAIVD 
Sbjct  7    EVYFVFMNFDPVYERLRADRSKEGSATLDAYLSHKHDKLLAKLLQPDSYCKRSSLAIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            FAV+IT+ QA+VLRSAKEVRVVEKNQELA
Sbjct  67   FAVEITEDQASVLRSAKEVRVVEKNQELA  95



>ref|XP_008783834.1| PREDICTED: uncharacterized protein LOC103702955 isoform X1 [Phoenix 
dactylifera]
Length=96

 Score =   125 bits (315),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +1

Query  130  AELYFVFMNRDPEYERLRSN-STKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIV  306
            AE+YFVFMN DPEYERLR+N  + K S ELD YLS KHD+ LA  L P +Y K  SLAIV
Sbjct  6    AEVYFVFMNFDPEYERLRANHRSTKCSAELDAYLSNKHDQLLAKLLRPNSYKKKSSLAIV  65

Query  307  DAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            D FAV+IT++QA +LRSAKEVRVVEKNQELA
Sbjct  66   DGFAVEITENQAAILRSAKEVRVVEKNQELA  96



>ref|XP_010541539.1| PREDICTED: uncharacterized protein LOC104814970 [Tarenaya hassleriana]
Length=97

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = +1

Query  136  LYFVFMNRDPEYERLRSNSTKKG--SHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVD  309
            LYFVFMN DPEY RLR   T +G  S ELD+YLS+KH+E L+  LEPG+Y KTLSL IVD
Sbjct  8    LYFVFMNYDPEYNRLRLERTMRGRKSEELDMYLSRKHEEVLSRNLEPGSYTKTLSLLIVD  67

Query  310  AFAVQITDHQANVLRSAKEVRVVEKNQELA  399
             FAV+IT+ QANVLRSA+ VR+VEKNQE+A
Sbjct  68   GFAVEITEDQANVLRSAEGVRLVEKNQEVA  97



>ref|XP_009399831.1| PREDICTED: uncharacterized protein LOC103984123 [Musa acuminata 
subsp. malaccensis]
Length=95

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            ELYFVFMN DPEYE LR++ +K+G  ELD YLS KHD+ LA  L P +Y K  SLAIVD 
Sbjct  7    ELYFVFMNFDPEYESLRADRSKEGVEELDTYLSHKHDQLLAKLLPPNSYRKKSSLAIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            F+V+IT  QA +LRSAKEVRVVEKNQELA
Sbjct  67   FSVEITKKQAAILRSAKEVRVVEKNQELA  95



>ref|XP_003565674.1| PREDICTED: uncharacterized protein LOC100842221 [Brachypodium 
distachyon]
Length=96

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTL-EPGTYNKTLSLAIVD  309
            E+YFVFMN DP YERLR++ +K+GS  LD YLS KHD+ LA  L  P TY K  SLAIVD
Sbjct  7    EVYFVFMNFDPVYERLRADRSKQGSATLDAYLSDKHDKLLAKLLGPPDTYRKKSSLAIVD  66

Query  310  AFAVQITDHQANVLRSAKEVRVVEKNQELA  399
             FA +ITD QA+VLRSAKEVRVVEKNQELA
Sbjct  67   GFAAEITDAQASVLRSAKEVRVVEKNQELA  96



>ref|NP_001143717.1| hypothetical protein [Zea mays]
 gb|ACG34522.1| hypothetical protein [Zea mays]
 gb|AFW80428.1| hypothetical protein ZEAMMB73_379679 [Zea mays]
Length=96

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRS-NSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVD  309
            E+YFVFMN DP YERLR+  S+K+GS  LD YLS KHD+ LA  L+P +Y K  SLAIVD
Sbjct  7    EVYFVFMNFDPVYERLRAERSSKEGSATLDAYLSHKHDKLLAKLLQPDSYRKRSSLAIVD  66

Query  310  AFAVQITDHQANVLRSAKEVRVVEKNQELA  399
             FAV+IT+ QA+VLRSAKEVRVVEKNQELA
Sbjct  67   GFAVEITEDQASVLRSAKEVRVVEKNQELA  96



>ref|XP_009389890.1| PREDICTED: uncharacterized protein LOC103976423 [Musa acuminata 
subsp. malaccensis]
Length=95

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            ELYFVFMN DP YE LR++ +K+G  ELD YLS KHD+ LA  L P TY K  SLAIVD 
Sbjct  7    ELYFVFMNFDPVYEHLRADRSKEGMKELDTYLSSKHDQLLAKFLPPSTYKKKSSLAIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            F+V+ T  QA +LRSAKEVRVVEKNQELA
Sbjct  67   FSVETTKEQAAILRSAKEVRVVEKNQELA  95



>ref|XP_009409424.1| PREDICTED: uncharacterized protein LOC103991638 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=95

 Score =   120 bits (301),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            E+YFVFMN DP+YERL ++ +K+G  ELD YLSKKHD  L    +P TY K  SLAIVD 
Sbjct  7    EVYFVFMNFDPKYERLHADRSKEGVEELDTYLSKKHDRLLEKLFQPNTYKKKSSLAIVDG  66

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQELA  399
            F+V+IT  QA  LRSAKEVRVVEKNQELA
Sbjct  67   FSVEITKEQAATLRSAKEVRVVEKNQELA  95



>emb|CDY03517.1| BnaC01g15650D [Brassica napus]
Length=99

 Score =   118 bits (295),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +++ ELY+VF+ RDPEYERL+   TKKG  ELD YL K+H+E L + LEPG+Y +T+SL 
Sbjct  3    SSSTELYYVFLKRDPEYERLKEIRTKKGEEELDRYLEKRHEEILESNLEPGSYKRTVSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            +V  F V+IT HQA VLRSA  V  VEKN+E+
Sbjct  63   VVHGFGVEITKHQAQVLRSADGVYTVEKNEEI  94



>ref|XP_009137427.1| PREDICTED: uncharacterized protein LOC103861460 isoform X2 [Brassica 
rapa]
 emb|CDY47620.1| BnaA01g13450D [Brassica napus]
Length=99

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +++ ELY+VF+ RDPEYERL+   TKKG  ELD YL K+H+E L + LEPG+Y +T+SL 
Sbjct  3    SSSTELYYVFLKRDPEYERLKEIRTKKGEEELDRYLEKRHEEILESNLEPGSYKRTVSLV  62

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            +V  F V+IT HQA VLRSA  V  VEKN+E+
Sbjct  63   VVHGFGVEITKHQAEVLRSADGVYTVEKNEEI  94



>ref|XP_008451935.1| PREDICTED: uncharacterized protein LOC103493088 [Cucumis melo]
Length=120

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDA  312
            E YFVFM  DPEYERLR++   +G+ E+D YLS+KHDE L   LEPG+Y K  S  IVD 
Sbjct  23   ECYFVFMKYDPEYERLRADRCGEGADEVDGYLSRKHDEVLRRWLEPGSYRKISSFLIVDG  82

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQE  393
            F+V+I +HQANVLRSA  VRVVEKNQ+
Sbjct  83   FSVEINEHQANVLRSADGVRVVEKNQD  109



>ref|XP_009409423.1| PREDICTED: uncharacterized protein LOC103991638 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=99

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNS----TKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            E+YFVFMN DP+YERL ++     +K+G  ELD YLSKKHD  L    +P TY K  SLA
Sbjct  7    EVYFVFMNFDPKYERLHADRWVELSKEGVEELDTYLSKKHDRLLEKLFQPNTYKKKSSLA  66

Query  301  IVDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            IVD F+V+IT  QA  LRSAKEVRVVEKNQELA
Sbjct  67   IVDGFSVEITKEQAATLRSAKEVRVVEKNQELA  99



>gb|EAZ11067.1| hypothetical protein OsJ_00912 [Oryza sativa Japonica Group]
Length=83

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +1

Query  151  MNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDAFAVQIT  330
            MN DP YERLR++ +K+GS  LD YLS KHD+ LA  L+P TY K  SLAIVD FAV+IT
Sbjct  1    MNFDPVYERLRADRSKEGSATLDAYLSHKHDKLLAKLLQPDTYRKKSSLAIVDGFAVEIT  60

Query  331  DHQANVLRSAKEVRVVEKNQELA  399
            D QA++LR AKEVRVVEKNQELA
Sbjct  61   DAQASILRLAKEVRVVEKNQELA  83



>dbj|BAD81363.1| unknown protein [Oryza sativa Japonica Group]
Length=107

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 72/101 (71%), Gaps = 12/101 (12%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNS--TKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIV  306
            E+YFVFMN DP YERLR++   +K+GS  LD YLS KHD+ LA  L+P TY K  SLAIV
Sbjct  7    EVYFVFMNFDPVYERLRADRCRSKEGSATLDAYLSHKHDKLLAKLLQPDTYRKKSSLAIV  66

Query  307  DAFAVQITD----------HQANVLRSAKEVRVVEKNQELA  399
            D FAV+ITD           QA++LR AKEVRVVEKNQELA
Sbjct  67   DGFAVEITDAQLADLVVMAMQASILRLAKEVRVVEKNQELA  107



>ref|XP_009349052.1| PREDICTED: uncharacterized protein LOC103940627 isoform X2 [Pyrus 
x bretschneideri]
Length=77

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  124  TAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAI  303
            T +E YFVFMN DP+YERLR++ TK+G++ELDLYLS+KHD+ LA TLEPG+Y KTLSL I
Sbjct  4    TKSESYFVFMNYDPQYERLRADRTKRGANELDLYLSRKHDQLLARTLEPGSYKKTLSLVI  63

Query  304  VDAFAVQITDHQA  342
            VD F+V+IT+ Q 
Sbjct  64   VDGFSVEITEDQC  76



>ref|XP_006837470.1| hypothetical protein AMTR_s00107p00154700 [Amborella trichopoda]
 gb|ERN00324.1| hypothetical protein AMTR_s00107p00154700 [Amborella trichopoda]
Length=101

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +1

Query  124  TAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAI  303
            + +ELYFVFM+ DP+YE LR+  + +G  ELD +LSKKHD  L    EPG+Y K  S AI
Sbjct  10   SCSELYFVFMDYDPQYELLRAIRSVQGEEELDSFLSKKHDMLLGRLFEPGSYQKRFSWAI  69

Query  304  VDAFAVQITDHQANVLRSAKEVRVVEKNQELA  399
            VD FA ++T  QA+ LR A  VRVVEKNQEL 
Sbjct  70   VDGFAAELTSDQADKLRCADGVRVVEKNQELG  101



>ref|XP_008381198.1| PREDICTED: uncharacterized protein LOC103444066 isoform X2 [Malus 
domestica]
Length=77

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  124  TAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAI  303
            T +E YFVFMN DP+Y+RLR++ TK+G++ELDL+LS+KHD+ LA TL+PG+Y KTLSL I
Sbjct  4    TKSESYFVFMNYDPQYQRLRADRTKRGANELDLFLSRKHDQLLARTLDPGSYKKTLSLVI  63

Query  304  VDAFAVQITDHQA  342
            VD F+V+IT+ Q 
Sbjct  64   VDGFSVEITEDQC  76



>gb|ADE75799.1| unknown [Picea sitchensis]
Length=108

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 2/90 (2%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSN--STKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIV  306
            E++ V M  D EYERL+++    ++ + EL++Y+S KHD  L  TLEPG+Y K  S  I+
Sbjct  11   EVFLVLMEFDEEYERLKADRSCCRRTARELEIYVSNKHDTLLQRTLEPGSYRKRFSWVII  70

Query  307  DAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
            D FAV+IT  QA+VLRSA  VRVVEK+QEL
Sbjct  71   DGFAVEITADQADVLRSADGVRVVEKDQEL  100



>ref|XP_010925752.1| PREDICTED: uncharacterized protein LOC105048214 isoform X1 [Elaeis 
guineensis]
Length=114

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  130  AELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVD  309
            AE+YFVF+N DPEYERLR+N   KGS ELD YLS KHD+ L   LEP TY K  SLAIVD
Sbjct  6    AEVYFVFLNFDPEYERLRANQLTKGSAELDAYLSNKHDQLLERLLEPNTYKKRSSLAIVD  65

Query  310  AFAVQITDHQANVL  351
             FAV+IT+ Q ++L
Sbjct  66   GFAVEITEKQVSLL  79



>ref|XP_009137418.1| PREDICTED: uncharacterized protein LOC103861460 isoform X1 [Brassica 
rapa]
Length=109

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +1

Query  121  TTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA  300
            +++ ELY+VF+ RDPEYERL+   TKKG  ELD YL K+H+E L + LEPG+Y +T+SL 
Sbjct  3    SSSTELYYVFLKRDPEYERLKEIRTKKGEEELDRYLEKRHEEILESNLEPGSYKRTVSLV  62

Query  301  IVDAFAVQITDHQA  342
            +V  F V+IT HQ 
Sbjct  63   VVHGFGVEITKHQV  76



>gb|ABK22015.1| unknown [Picea sitchensis]
 gb|ABK22276.1| unknown [Picea sitchensis]
Length=99

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = +1

Query  130  AELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVD  309
            +++Y V M  DPEY+RLR +  +  + EL+ Y+S KHD  L   LEPGTY K  S  IVD
Sbjct  11   SDVYLVMMEYDPEYDRLRRD--RNAASELEKYVSNKHDILLQRALEPGTYKKRFSWVIVD  68

Query  310  AFAVQITDHQANVLRSAKEVRVVEKNQELA  399
             FA +IT  QA +LRSA  VRVVEK+QE+ 
Sbjct  69   GFAAEITSDQAEMLRSADGVRVVEKDQEIG  98



>gb|KGN53396.1| hypothetical protein Csa_4G051480 [Cucumis sativus]
Length=96

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +1

Query  127  AAELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIV  306
              E YFVFM  DPEYERLR++   +G+ ELD YLS+KHDE L   LEPG+Y K  S  IV
Sbjct  16   GEECYFVFMKYDPEYERLRADRCGEGADELDGYLSRKHDEVLRRWLEPGSYRKISSFLIV  75

Query  307  DAFAVQITDHQA  342
            D F+V+I +HQ 
Sbjct  76   DGFSVEINEHQV  87



>ref|XP_006413511.1| hypothetical protein EUTSA_v10027148mg [Eutrema salsugineum]
 gb|ESQ54964.1| hypothetical protein EUTSA_v10027148mg [Eutrema salsugineum]
Length=74

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  193  TKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLAIVDAFAVQITDHQANVLRSAKEVR  372
            TKKG  ELD YL ++H+E L + LE G+Y +T+SL IV  F V+IT HQA VLRS  +V 
Sbjct  9    TKKGEEELDRYLERRHEEILGSNLEAGSYKRTVSLVIVHGFGVEITKHQAKVLRSVDDVY  68

Query  373  VVEKNQ  390
             VEKN+
Sbjct  69   SVEKNE  74



>ref|XP_002267221.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
 emb|CBI32993.3| unnamed protein product [Vitis vinifera]
Length=822

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 57/116 (49%), Gaps = 22/116 (19%)
 Frame = +1

Query  136  LYFVFMNRDP-----------EYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYN  282
            +Y V M  DP           E +R+  NS    +H    +L   HD+ L TTL+ G+YN
Sbjct  33   MYLVLMEGDPVAFHRGSGPLEEGKRVDPNSEVYKAHAK--HLVDSHDQLLQTTLDSGSYN  90

Query  283  KTLSLA-IVDAFAVQITDHQANVLRSAKEVRVVEKNQELA*SGRGGKIDLKLFVPE  447
            K  S   IV+ F+V  T  QAN L+ A  V +VE++       RG K+ +  + P+
Sbjct  91   KLYSFKHIVNGFSVHTTPSQANKLKHAPGVTLVERD-------RGAKL-MTTYTPQ  138



>ref|XP_010099159.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB77031.1| Subtilisin-like protease [Morus notabilis]
Length=830

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 37/104 (36%), Positives = 52/104 (50%), Gaps = 7/104 (7%)
 Frame = +1

Query  100  IMASKEMTTAAELYFVFMNRDPEYERLRSNSTKKGSHELDLY------LSKKHDEFLATT  261
            IM +  +     LY V M  +P      SN + KG    ++       L   HD+ L +T
Sbjct  21   IMTADCLAEERALYLVTMEDEPAAFLGGSNLSHKGHKHSEVSRAHAKRLVNSHDKLLQST  80

Query  262  LEPGTYNKTLSLA-IVDAFAVQITDHQANVLRSAKEVRVVEKNQ  390
            LE G+Y K  S   IV+ FAV  T  QA+ LR  + VR+VEK++
Sbjct  81   LETGSYTKLHSFKHIVNGFAVHTTPSQASKLRDVEGVRLVEKDR  124



>ref|XP_010054605.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=832

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 9/103 (9%)
 Frame = +1

Query  142  FVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA-IVDAFA  318
            F  ++  PE+   R N  +K S      L   HD+ L + LE G+Y K  S   +++ F+
Sbjct  44   FAGVSSSPEHGLSRHNLNRKVSRAHAKRLVNSHDQLLQSVLETGSYKKLYSFNHVINGFS  103

Query  319  VQITDHQANVLRSAKEVRVVEKNQELA*SGRGGKIDLKLFVPE  447
            V IT+ QA  L+    VR+VE++       RG K+ +  + P+
Sbjct  104  VHITESQAKRLKETPGVRLVERD-------RGAKL-MTTYTPQ  138



>ref|XP_009799224.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=809

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/95 (33%), Positives = 53/95 (56%), Gaps = 7/95 (7%)
 Frame = +1

Query  133  ELYFVFMNRDP-EYERLRSNSTK-----KGSHELDLYLSKKHDEFLATTLEPGTYNKTLS  294
            ++Y V M  DP  + +++++S K       S      L+K HDEFL + LE G+Y+K  S
Sbjct  24   KIYLVLMEGDPVAFHQVKTSSEKGNKLDPNSEAYANELTKSHDEFLQSNLERGSYHKLYS  83

Query  295  LA-IVDAFAVQITDHQANVLRSAKEVRVVEKNQEL  396
               IV+  A+  T  Q   L++A  V++VE+++ +
Sbjct  84   FKHIVNGVAIHTTPSQIENLKNAPRVKLVEEDRRV  118



>ref|XP_007153989.1| hypothetical protein PHAVU_003G081700g [Phaseolus vulgaris]
 gb|ESW25983.1| hypothetical protein PHAVU_003G081700g [Phaseolus vulgaris]
Length=824

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +1

Query  160  DPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA-IVDAFAVQITDH  336
            D     +  NS    +HE   +L   HD FL +TL+ G+YNK  S   I++ F+V  T  
Sbjct  55   DQHSSTMHINSEASKTHE---HLVSSHDLFLQSTLDTGSYNKLHSYKHIINGFSVHTTPS  111

Query  337  QANVLRSAKEVRVVEKNQ  390
            QA  LRS   +++VEK++
Sbjct  112  QAERLRSGAGIKLVEKDR  129



>dbj|BAB70678.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=832

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = +1

Query  133  ELYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA-IVD  309
            ++Y V +  +P   R  +N   K        + + H+E L +TLE G+Y K  S   +++
Sbjct  47   KIYSVLVEGEPLAFRASTNINSKAMALEAKKIEEIHEEILGSTLEKGSYTKLYSFKHVIN  106

Query  310  AFAVQITDHQANVLRSAKEVRVVEKNQ  390
            AFAV+ T  QA  LR  K V+ VE+++
Sbjct  107  AFAVRTTASQAKKLRKTKGVKAVEEDK  133



>ref|XP_010473453.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=837

 Score = 50.1 bits (118),  Expect = 0.001, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = +1

Query  136  LYFVFMNRDPEYERLRSNSTKKGSHELDLYLSKKHDEFLATTLEPGTYNKTLSLA-IVDA  312
            +Y V +  +P   R  +N   K        +   H+E L +TLE G+Y K  S   +++A
Sbjct  53   IYSVLVEGEPLAFRASTNINSKAMAYEAKKMEAIHEEILGSTLENGSYTKLYSFKHVINA  112

Query  313  FAVQITDHQANVLRSAKEVRVVEKNQ  390
            FAV+ T +QA  L  AK V+ VE+++
Sbjct  113  FAVRTTSYQAKKLTKAKGVKAVEEDK  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1226452362339