BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8929_g2_i1 len=577 path=[1473:0-576]

Length=577
                                                                      Score     E

emb|CDO99590.1|  unnamed protein product                                208   6e-61   
ref|XP_009586985.1|  PREDICTED: protein MOR1                            213   9e-60   
ref|XP_009803680.1|  PREDICTED: protein MOR1                            213   1e-59   
dbj|BAB88648.1|  microtubule bundling polypeptide TMBP200               213   1e-59   Nicotiana tabacum [American tobacco]
emb|CBI29531.3|  unnamed protein product                                209   3e-59   
ref|XP_004232834.1|  PREDICTED: protein MOR1 isoform X1                 209   4e-58   
ref|XP_010316724.1|  PREDICTED: protein MOR1 isoform X2                 209   4e-58   
ref|XP_006347082.1|  PREDICTED: protein MOR1-like                       208   8e-58   
gb|KDP34897.1|  hypothetical protein JCGZ_09185                         205   2e-57   
ref|XP_010647268.1|  PREDICTED: protein MOR1-like                       207   2e-57   
ref|XP_002534264.1|  microtubule associated protein xmap215, puta...    205   1e-56   Ricinus communis
ref|XP_009351870.1|  PREDICTED: LOW QUALITY PROTEIN: protein MOR1...    203   3e-56   
ref|XP_009361226.1|  PREDICTED: protein MOR1-like                       202   6e-56   
ref|XP_008381720.1|  PREDICTED: LOW QUALITY PROTEIN: protein MOR1...    201   1e-55   
gb|KDO77520.1|  hypothetical protein CISIN_1g000146mg                   201   3e-55   
ref|XP_007225657.1|  hypothetical protein PRUPE_ppa000058mg             198   3e-54   
ref|XP_006468404.1|  PREDICTED: protein MOR1-like isoform X1            197   4e-54   
ref|XP_011096260.1|  PREDICTED: protein MOR1 isoform X1                 197   6e-54   
ref|XP_004496233.1|  PREDICTED: protein MOR1-like                       196   8e-54   
gb|KDO77519.1|  hypothetical protein CISIN_1g000146mg                   196   2e-53   
ref|XP_006448785.1|  hypothetical protein CICLE_v10014013mg             195   2e-53   
gb|KDO77522.1|  hypothetical protein CISIN_1g000146mg                   194   2e-53   
ref|XP_007143760.1|  hypothetical protein PHAVU_007G099200g             195   2e-53   
gb|KDO77521.1|  hypothetical protein CISIN_1g000146mg                   195   2e-53   
ref|XP_008223766.1|  PREDICTED: protein MOR1                            194   4e-53   
ref|XP_007023097.1|  ARM repeat superfamily protein                     194   6e-53   
ref|XP_006606268.1|  PREDICTED: protein MOR1-like                       193   1e-52   
gb|KHN00874.1|  Protein MOR1                                            193   1e-52   
ref|XP_002300496.1|  MICROTUBULE ORGANIZATION 1 family protein          192   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_011096261.1|  PREDICTED: protein MOR1 isoform X2                 192   2e-52   
ref|XP_006468405.1|  PREDICTED: protein MOR1-like isoform X2            192   2e-52   
ref|XP_004307880.1|  PREDICTED: protein MOR1-like                       191   4e-52   
gb|KEH43480.1|  microtubule organization protein                        189   3e-51   
ref|XP_004162854.1|  PREDICTED: LOW QUALITY PROTEIN: protein MOR1...    188   4e-51   
ref|XP_006589399.1|  PREDICTED: protein MOR1-like isoform X1            188   6e-51   
ref|XP_004134886.1|  PREDICTED: protein MOR1-like                       188   7e-51   
gb|KGN49501.1|  hypothetical protein Csa_6G526350                       188   7e-51   
ref|XP_011010439.1|  PREDICTED: protein MOR1-like                       187   1e-50   
gb|KHN37797.1|  Protein MOR1                                            187   1e-50   
ref|XP_008439496.1|  PREDICTED: protein MOR1 isoform X1                 187   2e-50   
ref|XP_008439497.1|  PREDICTED: protein MOR1 isoform X2                 186   2e-50   
gb|KHG14713.1|  Protein MOR1                                            176   1e-49   
ref|XP_010686559.1|  PREDICTED: protein MOR1 isoform X1                 183   3e-49   
ref|XP_010686561.1|  PREDICTED: protein MOR1 isoform X2                 183   4e-49   
ref|XP_010110460.1|  hypothetical protein L484_001859                   182   8e-49   
ref|XP_010052351.1|  PREDICTED: protein MOR1                            182   1e-48   
gb|EYU27937.1|  hypothetical protein MIMGU_mgv1a000055mg                179   9e-48   
ref|XP_002317062.2|  MICROTUBULE ORGANIZATION 1 family protein          177   3e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011040587.1|  PREDICTED: protein MOR1-like                       177   7e-47   
ref|XP_010245318.1|  PREDICTED: protein MOR1                            170   1e-44   
ref|XP_010922855.1|  PREDICTED: protein MOR1-like                       167   1e-43   
gb|AFK36921.1|  unknown                                                 150   6e-42   
ref|XP_008788006.1|  PREDICTED: protein MOR1-like isoform X1            159   1e-40   
ref|XP_008788007.1|  PREDICTED: protein MOR1-like isoform X2            159   1e-40   
ref|XP_008804673.1|  PREDICTED: LOW QUALITY PROTEIN: protein MOR1...    155   1e-39   
ref|XP_010931515.1|  PREDICTED: protein MOR1-like                       150   7e-38   
ref|XP_009383850.1|  PREDICTED: protein MOR1-like                       150   7e-38   
ref|XP_009387377.1|  PREDICTED: protein MOR1-like isoform X3            149   2e-37   
ref|XP_009387376.1|  PREDICTED: protein MOR1-like isoform X2            149   2e-37   
ref|XP_009387375.1|  PREDICTED: protein MOR1-like isoform X1            149   2e-37   
ref|XP_006468406.1|  PREDICTED: protein MOR1-like isoform X3            140   2e-34   
gb|KDO77518.1|  hypothetical protein CISIN_1g000146mg                   140   2e-34   
gb|KDO77517.1|  hypothetical protein CISIN_1g000146mg                   135   1e-32   
ref|XP_010518980.1|  PREDICTED: protein MOR1                            128   4e-30   
gb|EPS57221.1|  hypothetical protein M569_17599                         120   9e-30   
emb|CDM84719.1|  unnamed protein product                                125   3e-29   
ref|XP_003564477.1|  PREDICTED: protein MOR1                            123   2e-28   
gb|KFK36460.1|  hypothetical protein AALP_AA4G127500                    120   2e-27   
ref|XP_010645357.1|  PREDICTED: protein MOR1-like                       116   6e-26   
dbj|BAD93861.1|  similar to ch-TOG protein from Homo sapiens            112   9e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646429.1|  PREDICTED: protein MOR1-like                       115   9e-26   
tpg|DAA57118.1|  TPA: hypothetical protein ZEAMMB73_106408              112   7e-25   
ref|XP_008673322.1|  PREDICTED: uncharacterized protein LOC100501...    112   1e-24   
tpg|DAA57119.1|  TPA: hypothetical protein ZEAMMB73_106408              112   1e-24   
ref|XP_004970364.1|  PREDICTED: protein MOR1-like isoform X1            112   1e-24   
ref|XP_004970366.1|  PREDICTED: protein MOR1-like isoform X3            111   2e-24   
ref|NP_001146767.1|  uncharacterized protein LOC100280369               108   2e-24   Zea mays [maize]
ref|NP_001044618.1|  Os01g0816400                                       111   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970365.1|  PREDICTED: protein MOR1-like isoform X2            111   2e-24   
gb|EEC71701.1|  hypothetical protein OsI_04204                          111   2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_004970367.1|  PREDICTED: protein MOR1-like isoform X4            111   3e-24   
ref|NP_565811.2|  protein MICROTUBULE ORGANIZATION 1                    110   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAD15450.2|  similar to ch-TOG protein from Homo sapiens             110   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AFW84772.1|  hypothetical protein ZEAMMB73_280693                    110   5e-24   
ref|XP_010516754.1|  PREDICTED: protein MOR1 isoform X4                 110   5e-24   
ref|XP_010516750.1|  PREDICTED: protein MOR1 isoform X1                 110   6e-24   
ref|XP_010516753.1|  PREDICTED: protein MOR1 isoform X3                 110   6e-24   
gb|AFW84774.1|  hypothetical protein ZEAMMB73_280693                    109   1e-23   
ref|XP_006842655.1|  hypothetical protein AMTR_s00077p00193670          108   3e-23   
ref|XP_010505079.1|  PREDICTED: protein MOR1-like isoform X2            107   3e-23   
ref|XP_010505078.1|  PREDICTED: protein MOR1-like isoform X1            107   3e-23   
ref|XP_006296349.1|  hypothetical protein CARUB_v10025521mg             108   4e-23   
emb|CDY31709.1|  BnaA05g08380D                                          106   1e-22   
gb|EMT05314.1|  Cytoskeleton-associated protein 5                       106   2e-22   
ref|XP_002879562.1|  hypothetical protein ARALYDRAFT_482523             105   2e-22   
emb|CDX84183.1|  BnaC04g09450D                                          100   1e-20   
ref|XP_009143640.1|  PREDICTED: protein MOR1-like isoform X1            100   2e-20   
ref|XP_009143641.1|  PREDICTED: protein MOR1-like isoform X2            100   2e-20   
ref|XP_006410727.1|  hypothetical protein EUTSA_v10016124mg           99.0    5e-20   
ref|XP_009133029.1|  PREDICTED: LOW QUALITY PROTEIN: protein MOR1     97.8    1e-19   
emb|CDX79612.1|  BnaC03g19480D                                        94.7    1e-18   
ref|XP_002983313.1|  hypothetical protein SELMODRAFT_234185           78.6    3e-13   
ref|XP_002987634.1|  hypothetical protein SELMODRAFT_269295           78.2    3e-13   
ref|XP_001764142.1|  predicted protein                                77.0    9e-13   
ref|XP_006857815.1|  hypothetical protein AMTR_s00069p00019330        71.2    1e-12   
gb|AEW08832.1|  hypothetical protein CL1870Contig1_01                 67.8    2e-11   
ref|XP_003627437.1|  Microtubule organization protein                 70.5    1e-10   
gb|AFG71205.1|  hypothetical protein CL1870Contig1_01                 64.7    2e-10   
gb|KDO77523.1|  hypothetical protein CISIN_1g000146mg                 68.2    6e-10   
ref|XP_006836452.1|  hypothetical protein AMTR_s00092p00177270        61.2    1e-08   
gb|EMS63356.1|  Protein MOR1                                          53.1    4e-05   



>emb|CDO99590.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 151/203 (74%), Gaps = 13/203 (6%)
 Frame = -2

Query  576  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
            IFAQLQNASEAFRTYIRDGLAQMEK  AAGRTPSSVP+STPPPA LNLSSPKF  + PVN
Sbjct  267  IFAQLQNASEAFRTYIRDGLAQMEKTTAAGRTPSSVPLSTPPPAALNLSSPKFGALSPVN  326

Query  396  TNPLGDSKSINSKSEPTNFSLPLSYAE-ERTNNVVLP-------SELHLQPGEHRVEKFP  241
            TNPL ++KS+N+K EPTNF+LP SYAE +R ++  L        S+   Q G+ R ++ P
Sbjct  327  TNPLSEAKSMNTKLEPTNFNLPPSYAEDDRGSDPALSRGPRFDQSDSRHQSGDQRNDRLP  386

Query  240  SAVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGN  70
            S V+SG LDAIRERMKSIQLAAAAGN +    P++A NGN+ H   NQ P A EH    N
Sbjct  387  SGVTSGALDAIRERMKSIQLAAAAGNQEPANKPVIAVNGNLGHPLPNQFPLATEHASIEN  446

Query  69   PYPQQSGVLPMDEKALSGLQARM  1
              P   GVLPMDEKALSGLQARM
Sbjct  447  SMP--GGVLPMDEKALSGLQARM  467



>ref|XP_009586985.1| PREDICTED: protein MOR1 [Nicotiana tomentosiformis]
Length=2029

 Score =   213 bits (543),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 152/203 (75%), Gaps = 14/203 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP+STPPP+ LNLSSPKF  + PVN
Sbjct  1820  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPSSLNLSSPKFGKLSPVN  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAE-ERTNNVVLPS-------ELHLQPGEHRVEKFP  241
             TNPL D+KS+N+K EP+ FSLP SY E +R  N +L         EL  Q GE R ++ P
Sbjct  1880  TNPLNDAKSVNNKVEPSQFSLPPSYGEDDRGGNALLSRGLSSEHLELRHQLGEQRNDRLP  1939

Query  240   SAVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGN  70
             S V+SGTL+AIRERMKS+ LAA  GNPD     LM+ NGNVSH  S+Q P   EH+   N
Sbjct  1940  SGVTSGTLEAIRERMKSMSLAATGGNPDPSSRTLMSMNGNVSHMVSSQAP-GMEHSSVEN  1998

Query  69    PYPQQSGVLPMDEKALSGLQARM  1
                 QSGVLPMDEKALSGLQARM
Sbjct  1999  SI--QSGVLPMDEKALSGLQARM  2019



>ref|XP_009803680.1| PREDICTED: protein MOR1 [Nicotiana sylvestris]
Length=2029

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 151/203 (74%), Gaps = 14/203 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP+STPPP+ LNLSSPKF  + PVN
Sbjct  1820  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPSSLNLSSPKFGTLSPVN  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAE-ERTNNVVLPS-------ELHLQPGEHRVEKFP  241
             TNPL D+KS+N+K EP+ FSLP SY E +R  N +L         EL  Q GE R ++ P
Sbjct  1880  TNPLNDAKSVNNKVEPSQFSLPPSYGEDDRGGNALLSRGLSSEHLELRHQLGEQRNDRLP  1939

Query  240   SAVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGN  70
             S V+SGTL+AIRERMKS+ LAA  GNPD     LM+ NGNVSH  S Q P   EH+   N
Sbjct  1940  SGVTSGTLEAIRERMKSMSLAATGGNPDPSSRTLMSMNGNVSHMVSTQAP-GIEHSSIEN  1998

Query  69    PYPQQSGVLPMDEKALSGLQARM  1
                 QSGVLPMDEKALSGLQARM
Sbjct  1999  SI--QSGVLPMDEKALSGLQARM  2019



>dbj|BAB88648.1| microtubule bundling polypeptide TMBP200 [Nicotiana tabacum]
Length=2029

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 151/203 (74%), Gaps = 14/203 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP+STPPP+ LNLSSPKF  + PVN
Sbjct  1820  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPSSLNLSSPKFGKLSPVN  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAE-ERTNNVVLPS-------ELHLQPGEHRVEKFP  241
             TNPL D+KS+N+K EP+ FSLP SY E +R  N +L         EL  Q GE R ++ P
Sbjct  1880  TNPLNDAKSVNNKVEPSQFSLPPSYGEDDRGGNALLSRGLSSEHLELRHQLGEQRNDRLP  1939

Query  240   SAVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGN  70
             S V+SGTL+AIRERMKS+ LAA  GNPD     LM+ NGNVSH  S Q P   EH+   N
Sbjct  1940  SGVTSGTLEAIRERMKSMSLAATGGNPDPSSRTLMSMNGNVSHMVSTQAP-GIEHSSIEN  1998

Query  69    PYPQQSGVLPMDEKALSGLQARM  1
                 QSGVLPMDEKALSGLQARM
Sbjct  1999  SI--QSGVLPMDEKALSGLQARM  2019



>emb|CBI29531.3| unnamed protein product [Vitis vinifera]
Length=991

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 154/203 (76%), Gaps = 13/203 (6%)
 Frame = -2

Query  576  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
            IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+STPPP+ L+LSSPKF+P+ P++
Sbjct  780  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPSSLSLSSPKFAPLSPLH  839

Query  396  TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPS--------ELHLQPGEHRVEKFP  241
            TN L DSKS+N K+EPTNF+LP SY E+      LPS        E     G+ R E+FP
Sbjct  840  TNSLNDSKSLNVKAEPTNFNLPPSYGEDDRALNALPSRGLTSDHPEFRQHLGDQRNERFP  899

Query  240  SAVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGN  70
            S V+SGTLDAIRERMKSIQLA A GN D    PLM  NG +SHG ++QL  A++  ++ N
Sbjct  900  SGVTSGTLDAIRERMKSIQLATAGGNHDSGNRPLMYVNGGLSHGIASQLTHASDRAVAEN  959

Query  69   PYPQQSGVLPMDEKALSGLQARM  1
            P   Q GVLPMDEKALSGLQARM
Sbjct  960  PV--QGGVLPMDEKALSGLQARM  980



>ref|XP_004232834.1| PREDICTED: protein MOR1 isoform X1 [Solanum lycopersicum]
Length=2023

 Score =   209 bits (531),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 148/201 (74%), Gaps = 16/201 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP+ TPPP+ LNLSSPKF P+ PVN
Sbjct  1820  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMPTPPPSSLNLSSPKFGPLSPVN  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSE------LHLQPGEHRVEKFPSA  235
             TNPL D+KS+N+K EP++FSLP SY E+      LPS       L LQ    R ++ PS 
Sbjct  1880  TNPLNDAKSVNNKIEPSHFSLPPSYGEDDRGGNALPSRGLSSEHLELQ----RNDRLPSG  1935

Query  234   VSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPY  64
             V+SGTL+AIRERMKSI LA   GN D    PLM+ NGN+SH  SN  P   EH+   N  
Sbjct  1936  VTSGTLEAIRERMKSISLATTVGNADPSNRPLMSMNGNISHVVSNHGP-GTEHSSVENTI  1994

Query  63    PQQSGVLPMDEKALSGLQARM  1
               QSGVLPMDEKALSGLQARM
Sbjct  1995  --QSGVLPMDEKALSGLQARM  2013



>ref|XP_010316724.1| PREDICTED: protein MOR1 isoform X2 [Solanum lycopersicum]
Length=2022

 Score =   209 bits (531),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 148/201 (74%), Gaps = 16/201 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP+ TPPP+ LNLSSPKF P+ PVN
Sbjct  1819  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMPTPPPSSLNLSSPKFGPLSPVN  1878

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSE------LHLQPGEHRVEKFPSA  235
             TNPL D+KS+N+K EP++FSLP SY E+      LPS       L LQ    R ++ PS 
Sbjct  1879  TNPLNDAKSVNNKIEPSHFSLPPSYGEDDRGGNALPSRGLSSEHLELQ----RNDRLPSG  1934

Query  234   VSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPY  64
             V+SGTL+AIRERMKSI LA   GN D    PLM+ NGN+SH  SN  P   EH+   N  
Sbjct  1935  VTSGTLEAIRERMKSISLATTVGNADPSNRPLMSMNGNISHVVSNHGP-GTEHSSVENTI  1993

Query  63    PQQSGVLPMDEKALSGLQARM  1
               QSGVLPMDEKALSGLQARM
Sbjct  1994  --QSGVLPMDEKALSGLQARM  2012



>ref|XP_006347082.1| PREDICTED: protein MOR1-like [Solanum tuberosum]
Length=2023

 Score =   208 bits (529),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 148/201 (74%), Gaps = 16/201 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP+ TPPP+ LNLSSPKF P+ PVN
Sbjct  1820  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMPTPPPSSLNLSSPKFGPLSPVN  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSE------LHLQPGEHRVEKFPSA  235
             TNPL D+KS+N+K EP++FSLP SY E+      LPS       L LQ    R ++ PS 
Sbjct  1880  TNPLNDAKSVNNKIEPSHFSLPPSYGEDDRGGNALPSRGLSSEHLELQ----RNDRLPSG  1935

Query  234   VSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPY  64
             V+SGTL+AIRERMKSI LA   GN D    PLM+ NGN+SH  SN  P   EH+   N  
Sbjct  1936  VTSGTLEAIRERMKSISLATTVGNVDPSNRPLMSMNGNISHVVSNHAP-GTEHSSVENTI  1994

Query  63    PQQSGVLPMDEKALSGLQARM  1
               Q+GVLPMDEKALSGLQARM
Sbjct  1995  --QNGVLPMDEKALSGLQARM  2013



>gb|KDP34897.1| hypothetical protein JCGZ_09185 [Jatropha curcas]
Length=1044

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 152/198 (77%), Gaps = 8/198 (4%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+STPPP+ LN+SSP+F+P+ PV+
Sbjct  838   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPLSTPPPSSLNVSSPEFAPLSPVH  897

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQ--PGEHRVEKFPSAVSS  226
             TN L D+KS+N KSEPTNF LP SYAE+ RT N ++   L      G+ R EKF S V+S
Sbjct  898   TNSLTDAKSLNVKSEPTNFHLPPSYAEDNRTVNSLMSRGLMSDNSLGDQRNEKFISGVTS  957

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERMKS+QLAA+ GNPD    PL A N NV++G S Q    ++    G   P Q
Sbjct  958   GTLDAIRERMKSMQLAASTGNPDSLNRPLTAVNDNVNNGFSGQNLGGSDPV--GIQNPIQ  1015

Query  54    SGVLPMDEKALSGLQARM  1
              GVLPMDEKALSGLQARM
Sbjct  1016  GGVLPMDEKALSGLQARM  1033



>ref|XP_010647268.1| PREDICTED: protein MOR1-like [Vitis vinifera]
Length=2034

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 155/206 (75%), Gaps = 16/206 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+STPPP+ L+LSSPKF+P+ P++
Sbjct  1820  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPSSLSLSSPKFAPLSPLH  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPS--------ELHLQPGEHRVEKFP  241
             TN L DSKS+N K+EPTNF+LP SY E+      LPS        E     G+ R E+FP
Sbjct  1880  TNSLNDSKSLNVKAEPTNFNLPPSYGEDDRALNALPSRGLTSDHPEFRQHLGDQRNERFP  1939

Query  240   ---SAVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTI  79
                SAV+SGTLDAIRERMKSIQLA A GN D    PLM  NG +SHG ++QL  A++  +
Sbjct  1940  SGASAVTSGTLDAIRERMKSIQLATAGGNHDSGNRPLMYVNGGLSHGIASQLTHASDRAV  1999

Query  78    SGNPYPQQSGVLPMDEKALSGLQARM  1
             + NP   Q GVLPMDEKALSGLQARM
Sbjct  2000  AENPV--QGGVLPMDEKALSGLQARM  2023



>ref|XP_002534264.1| microtubule associated protein xmap215, putative [Ricinus communis]
 gb|EEF28119.1| microtubule associated protein xmap215, putative [Ricinus communis]
Length=1992

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 153/200 (77%), Gaps = 12/200 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+STPPP+ L  SSP+++P+ PV+
Sbjct  1786  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPSALTASSPEYAPLSPVH  1845

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVV----LPSELHLQPGEHRVEKFPSAV  232
             TN + D+KS+N+KSEP NF LP +Y+E+ RT N +    L SE  L   + R EKF S V
Sbjct  1846  TNSINDAKSMNTKSEPANFHLPPAYSEDNRTVNTITSRGLISENSL--ADQRNEKFLSGV  1903

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             ++GTLDAIRERMKS+QLAAAAGNPD    PL   N N+S+G S Q+P A +    G   P
Sbjct  1904  TTGTLDAIRERMKSMQLAAAAGNPDSGNRPLTIVNDNLSNGLSGQVPRAPDSV--GFENP  1961

Query  60    QQSGVLPMDEKALSGLQARM  1
              Q GVLPMDEKALSGLQARM
Sbjct  1962  VQGGVLPMDEKALSGLQARM  1981



>ref|XP_009351870.1| PREDICTED: LOW QUALITY PROTEIN: protein MOR1-like [Pyrus x bretschneideri]
Length=2014

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 148/197 (75%), Gaps = 12/197 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+ TPPPA LN SSP+F+P+ PV+
Sbjct  1814  IFSQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMPTPPPATLNASSPEFAPLSPVH  1873

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQP-GEHRVEKFPSAVSSG  223
             TN L DSKS+N KSEPT+F+LP SY EE R NN +    L      + R E++   V++G
Sbjct  1874  TNSLVDSKSLNVKSEPTSFNLPPSYDEENRLNNAITSRGLTENSLVDQRNERYIGGVTNG  1933

Query  222   TLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQS  52
             TLDAIRERMKS+QLAAAAGNPD    PLM  N NV    S Q+P A+E+       P Q 
Sbjct  1934  TLDAIRERMKSMQLAAAAGNPDQETRPLMYVNDNVHQSLSGQIPRASEN-------PLQG  1986

Query  51    GVLPMDEKALSGLQARM  1
             GVLPMDE+ALSGLQARM
Sbjct  1987  GVLPMDERALSGLQARM  2003



>ref|XP_009361226.1| PREDICTED: protein MOR1-like [Pyrus x bretschneideri]
Length=2013

 Score =   202 bits (515),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 150/196 (77%), Gaps = 13/196 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQMEKNAAAGRTPS++P+ TPPPA LN SSP+F+P+ PV+
Sbjct  1816  IFSQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSNLPMPTPPPATLNASSPEFAPLSPVH  1875

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
             TN L DSKS+N KSEPT+F+LP SY EE R NN    +E  L   + R E++   V++GT
Sbjct  1876  TNSLVDSKSLNVKSEPTSFNLPPSYTEEYRLNNARGLTENSLV--DQRNERYIGGVTNGT  1933

Query  219   LDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSG  49
             LDAIRERMKS+QLAAAAGNPD    PLM  N NV+   S Q+P A+E+       P QSG
Sbjct  1934  LDAIRERMKSMQLAAAAGNPDQETRPLMYVNDNVNQSLSGQIPRASEN-------PLQSG  1986

Query  48    VLPMDEKALSGLQARM  1
             V PMDE+ALSGLQARM
Sbjct  1987  VHPMDERALSGLQARM  2002



>ref|XP_008381720.1| PREDICTED: LOW QUALITY PROTEIN: protein MOR1-like [Malus domestica]
Length=2016

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 148/197 (75%), Gaps = 12/197 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+ TPPPA LN SSP+F+P+ PV+
Sbjct  1816  IFSQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMPTPPPATLNASSPEFAPLSPVH  1875

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQP-GEHRVEKFPSAVSSG  223
             TN L DSKS+N KSEPT+F+LP SY EE R NN +    L      + R E++   V++G
Sbjct  1876  TNSLLDSKSLNVKSEPTSFNLPPSYDEENRLNNAITSRGLTENSLVDQRNERYIGGVTNG  1935

Query  222   TLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQS  52
             TLDAIRERMKS+QLAAAAGNPD    PL+  N NV+   S Q+P A+E        P Q 
Sbjct  1936  TLDAIRERMKSMQLAAAAGNPDQETRPLIYVNDNVNQSLSGQIPRASE-------IPLQG  1988

Query  51    GVLPMDEKALSGLQARM  1
             GVLPMDE+ALSGLQARM
Sbjct  1989  GVLPMDERALSGLQARM  2005



>gb|KDO77520.1| hypothetical protein CISIN_1g000146mg [Citrus sinensis]
Length=2015

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 152/200 (76%), Gaps = 13/200 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP++TPPPA L +SSP+F+P+ PV+
Sbjct  1810  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVH  1869

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEER-----TNNVVLPSELHLQPGEHRVEKFPSAV  232
             TN + D+KS+N KSEPTNF+LP SY E+        + VLP E  L   + R E+F  AV
Sbjct  1870  TNSMNDAKSMNVKSEPTNFNLPPSYTEDNRIGGAIASKVLPPENPL--SDQRNERFGVAV  1927

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             +SGTLDAIRERMKS+QLAAAAGNPD    PL+  N NV++G S+Q  S+   ++     P
Sbjct  1928  TSGTLDAIRERMKSMQLAAAAGNPDPGNRPLINMNDNVNNGLSSQSRSSDRASVEN---P  1984

Query  60    QQSGVLPMDEKALSGLQARM  1
              Q  VLPMDEKALSGLQARM
Sbjct  1985  AQGSVLPMDEKALSGLQARM  2004



>ref|XP_007225657.1| hypothetical protein PRUPE_ppa000058mg [Prunus persica]
 gb|EMJ26856.1| hypothetical protein PRUPE_ppa000058mg [Prunus persica]
Length=2061

 Score =   198 bits (503),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 146/195 (75%), Gaps = 10/195 (5%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGL QMEKNAAAGRTPSS+P+ TPPPA LN+SSP+F+P+ PV+
Sbjct  1863  IFSQLQNASEAFRTYIRDGLMQMEKNAAAGRTPSSLPMPTPPPASLNVSSPEFAPLSPVH  1922

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             TN L DSKS+N KSEPT+F+LP SY EE   N            + R E++ S V+SGTL
Sbjct  1923  TNSLVDSKSLNVKSEPTSFNLPPSYTEENRLNNATRGLTENSMVDQRNERYISGVTSGTL  1982

Query  216   DAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGV  46
             DAIRERMKS+QLAA+AGN D    PLM  + NV+   S Q+P A+E+       P QSGV
Sbjct  1983  DAIRERMKSMQLAASAGNLDQETRPLMYVSDNVNQAVSGQIPRASEN-------PLQSGV  2035

Query  45    LPMDEKALSGLQARM  1
             LPMDE+ALSGLQARM
Sbjct  2036  LPMDERALSGLQARM  2050



>ref|XP_006468404.1| PREDICTED: protein MOR1-like isoform X1 [Citrus sinensis]
Length=2015

 Score =   197 bits (501),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 151/200 (76%), Gaps = 13/200 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP++TPPPA L +SSP+F+P+ PV+
Sbjct  1810  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVH  1869

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEER-----TNNVVLPSELHLQPGEHRVEKFPSAV  232
             TN + D+KS+N KSE TNF+LP SY E+        + VLP E  L   + R E+F  AV
Sbjct  1870  TNSMNDAKSMNVKSESTNFNLPPSYTEDNRIGGAIASKVLPPENPL--SDQRNERFGVAV  1927

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             +SGTLDAIRERMKS+QLAAAAGNPD    PL+  N NV++G S+Q  S+   ++     P
Sbjct  1928  TSGTLDAIRERMKSMQLAAAAGNPDPGNRPLINMNDNVNNGLSSQSRSSDRASVEN---P  1984

Query  60    QQSGVLPMDEKALSGLQARM  1
              Q  VLPMDEKALSGLQARM
Sbjct  1985  AQGSVLPMDEKALSGLQARM  2004



>ref|XP_011096260.1| PREDICTED: protein MOR1 isoform X1 [Sesamum indicum]
Length=2028

 Score =   197 bits (500),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 150/203 (74%), Gaps = 20/203 (10%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNAS+AFRTYIRDGLAQME+NAAAGRTPSSVP++TPPPA LNL SP++ P+ PVN
Sbjct  1824  IFAQLQNASDAFRTYIRDGLAQMERNAAAGRTPSSVPLATPPPAALNL-SPRYGPLSPVN  1882

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAE-ERTNNVVLP-------SELHLQPGEHRVEKFP  241
             TNPL DS+++N++ EPTNFSLP SYAE +R  N   P       + L     E R ++ P
Sbjct  1883  TNPLSDSRNMNTRVEPTNFSLPPSYAEDDRHVNASSPRVSSYEQAGLQQNMEESRNDRLP  1942

Query  240   SAVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGN  70
             S VS+GTLDAIRERMKSIQLAA+AGNP+    PL+  NGN++H      P   E   SGN
Sbjct  1943  SGVSNGTLDAIRERMKSIQLAASAGNPESRSRPLIQVNGNLNH------PPVTEGHGSGN  1996

Query  69    PYPQQSGVLPMDEKALSGLQARM  1
             P     G+LPMDEKALSGLQARM
Sbjct  1997  PV--HGGILPMDEKALSGLQARM  2017



>ref|XP_004496233.1| PREDICTED: protein MOR1-like [Cicer arietinum]
Length=2021

 Score =   196 bits (499),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 150/201 (75%), Gaps = 14/201 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF QL NASEAFRTYIRDGLAQM KNAAAGRTPSS+P+ TPPPA LN+SSP F+P+ PVN
Sbjct  1815  IFDQLTNASEAFRTYIRDGLAQMAKNAAAGRTPSSMPMPTPPPASLNISSPDFAPLSPVN  1874

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNV----VLPSELHLQPGEHRVEKFPSAV  232
             TNPL D+K +N KSEPTNF+LP SY+EE R  N     VL S+ +   G+ R +KF + V
Sbjct  1875  TNPLSDAK-MNVKSEPTNFNLPPSYSEENRAANALTSRVLSSDYNF--GDQRNDKFMTGV  1931

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGR-SNQLPSAAEHTISGNPY  64
             +SGTLDAIRERMKS+QLAAAAG+ +    PL   N N++HG   + +P A EH  + N  
Sbjct  1932  TSGTLDAIRERMKSMQLAAAAGSTESGTRPLTNVNDNLNHGFPHSHIPLAPEHVGAENAL  1991

Query  63    PQQSGVLPMDEKALSGLQARM  1
               Q GVLPMDEKALSGLQARM
Sbjct  1992  --QGGVLPMDEKALSGLQARM  2010



>gb|KDO77519.1| hypothetical protein CISIN_1g000146mg [Citrus sinensis]
Length=2013

 Score =   196 bits (497),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 151/200 (76%), Gaps = 15/200 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP++TPPPA L +SSP+F+P+ PV+
Sbjct  1810  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVH  1869

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEER-----TNNVVLPSELHLQPGEHRVEKFPSAV  232
             TN + D+KS+N KSEPTNF+LP SY E+        + VLP E  L   + R E+F   V
Sbjct  1870  TNSMNDAKSMNVKSEPTNFNLPPSYTEDNRIGGAIASKVLPPENPL--SDQRNERF--GV  1925

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             +SGTLDAIRERMKS+QLAAAAGNPD    PL+  N NV++G S+Q  S+   ++     P
Sbjct  1926  TSGTLDAIRERMKSMQLAAAAGNPDPGNRPLINMNDNVNNGLSSQSRSSDRASVEN---P  1982

Query  60    QQSGVLPMDEKALSGLQARM  1
              Q  VLPMDEKALSGLQARM
Sbjct  1983  AQGSVLPMDEKALSGLQARM  2002



>ref|XP_006448785.1| hypothetical protein CICLE_v10014013mg [Citrus clementina]
 gb|ESR62025.1| hypothetical protein CICLE_v10014013mg [Citrus clementina]
Length=2013

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 151/200 (76%), Gaps = 15/200 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP++TPPPA L +SSP+F+P+ PV+
Sbjct  1810  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVH  1869

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEER-----TNNVVLPSELHLQPGEHRVEKFPSAV  232
             TN + D+KS+N KSEPTNF+LP SY E+        + VLP E  L   + R E+F   V
Sbjct  1870  TNSMNDAKSMNVKSEPTNFNLPPSYTEDNRIGGAIASKVLPPENPL--SDQRNERF--GV  1925

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             +SGTLDAIRERMKS+QLAAAAGNPD    PL+  N NV++G S+Q  S+   ++     P
Sbjct  1926  TSGTLDAIRERMKSMQLAAAAGNPDPGNRPLINMNDNVNNGLSSQSRSSDRASVEN---P  1982

Query  60    QQSGVLPMDEKALSGLQARM  1
              Q  VLPMDEKALSGLQARM
Sbjct  1983  AQGSVLPMDEKALSGLQARM  2002



>gb|KDO77522.1| hypothetical protein CISIN_1g000146mg [Citrus sinensis]
Length=1263

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 151/200 (76%), Gaps = 15/200 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP++TPPPA L +SSP+F+P+ PV+
Sbjct  1060  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVH  1119

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEER-----TNNVVLPSELHLQPGEHRVEKFPSAV  232
             TN + D+KS+N KSEPTNF+LP SY E+        + VLP E  L   + R E+F   V
Sbjct  1120  TNSMNDAKSMNVKSEPTNFNLPPSYTEDNRIGGAIASKVLPPENPL--SDQRNERF--GV  1175

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             +SGTLDAIRERMKS+QLAAAAGNPD    PL+  N NV++G S+Q  S+   ++     P
Sbjct  1176  TSGTLDAIRERMKSMQLAAAAGNPDPGNRPLINMNDNVNNGLSSQSRSSDRASVEN---P  1232

Query  60    QQSGVLPMDEKALSGLQARM  1
              Q  VLPMDEKALSGLQARM
Sbjct  1233  AQGSVLPMDEKALSGLQARM  1252



>ref|XP_007143760.1| hypothetical protein PHAVU_007G099200g [Phaseolus vulgaris]
 gb|ESW15754.1| hypothetical protein PHAVU_007G099200g [Phaseolus vulgaris]
Length=2023

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 150/199 (75%), Gaps = 10/199 (5%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+ TPPPA LN+SSP F+P+ PVN
Sbjct  1817  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMPTPPPASLNISSPDFAPLSPVN  1876

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELH--LQPGEHRVEKFPSAVSS  226
              NPLGD+K +N K +PTNF+LP SY+EE R  N +    L+     G+ R ++F + V+S
Sbjct  1877  ANPLGDAK-LNVKPDPTNFNLPPSYSEENRPVNAITSRALNSDYTLGDQRNDRFMTGVTS  1935

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGR-SNQLPSAAEHTISGNPYPQ  58
             GTLDAIRERMKS+QLAAAAG+ +     L + N N++HG   +Q+P  +EH   G     
Sbjct  1936  GTLDAIRERMKSMQLAAAAGSTESVGRHLASANDNLNHGLPPSQIPRTSEHV--GTENTL  1993

Query  57    QSGVLPMDEKALSGLQARM  1
             Q GVLPMDEKALSGLQARM
Sbjct  1994  QGGVLPMDEKALSGLQARM  2012



>gb|KDO77521.1| hypothetical protein CISIN_1g000146mg [Citrus sinensis]
Length=2052

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 151/200 (76%), Gaps = 15/200 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP++TPPPA L +SSP+F+P+ PV+
Sbjct  1849  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVH  1908

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEER-----TNNVVLPSELHLQPGEHRVEKFPSAV  232
             TN + D+KS+N KSEPTNF+LP SY E+        + VLP E  L   + R E+F   V
Sbjct  1909  TNSMNDAKSMNVKSEPTNFNLPPSYTEDNRIGGAIASKVLPPENPL--SDQRNERF--GV  1964

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             +SGTLDAIRERMKS+QLAAAAGNPD    PL+  N NV++G S+Q  S+   ++     P
Sbjct  1965  TSGTLDAIRERMKSMQLAAAAGNPDPGNRPLINMNDNVNNGLSSQSRSSDRASVEN---P  2021

Query  60    QQSGVLPMDEKALSGLQARM  1
              Q  VLPMDEKALSGLQARM
Sbjct  2022  AQGSVLPMDEKALSGLQARM  2041



>ref|XP_008223766.1| PREDICTED: protein MOR1 [Prunus mume]
Length=2014

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 150/198 (76%), Gaps = 16/198 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGL QMEKNAAAGRTPSS+P+ TPPPA L++SSP+F+P+ PV+
Sbjct  1816  IFSQLQNASEAFRTYIRDGLMQMEKNAAAGRTPSSLPMPTPPPASLSVSSPEFAPLSPVH  1875

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVV--LPSELHLQPGEHRVEKFPSAVSS  226
             TN L DSKS+N KSEPT+F+LP SY EE R NN    L     +   + R E++ S V+S
Sbjct  1876  TNSLVDSKSLNVKSEPTSFNLPPSYTEENRLNNATRGLAENSMV---DQRNERYISGVTS  1932

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERMKS+QLAA+AGN D    PLM  + NV+   S Q+P A+E+       P Q
Sbjct  1933  GTLDAIRERMKSMQLAASAGNLDQETRPLMYVSDNVNQVVSGQIPRASEN-------PLQ  1985

Query  54    SGVLPMDEKALSGLQARM  1
             SGVLPMDE+ALSGLQARM
Sbjct  1986  SGVLPMDERALSGLQARM  2003



>ref|XP_007023097.1| ARM repeat superfamily protein [Theobroma cacao]
 gb|EOY25719.1| ARM repeat superfamily protein [Theobroma cacao]
Length=2025

 Score =   194 bits (492),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 148/200 (74%), Gaps = 13/200 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+STPPPA L  SSP+F+P+ PV+
Sbjct  1820  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPASLTASSPEFAPLSPVH  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEER-----TNNVVLPSELHLQPGEHRVEKFPSAV  232
             TN   DSKS+N+KS+PTNF+LP SY E+       N  VL SE  L   + R E+  S V
Sbjct  1880  TNSANDSKSLNTKSDPTNFTLPPSYTEDNRAGNAINTRVLGSENAL--ADQRNERVMSGV  1937

Query  231   SSGTLDAIRERMKSIQLAAAAGNPDL---PLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             +SGTLDAIRERMKS+QLAAAAGN D    PLM+ N +++ G S Q     +H    N  P
Sbjct  1938  TSGTLDAIRERMKSMQLAAAAGNIDYGTRPLMSVNDSLNLGLSTQ-TRPLDHPAIEN--P  1994

Query  60    QQSGVLPMDEKALSGLQARM  1
              Q GVLPMDEKALSGLQARM
Sbjct  1995  AQGGVLPMDEKALSGLQARM  2014



>ref|XP_006606268.1| PREDICTED: protein MOR1-like [Glycine max]
Length=2026

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 150/201 (75%), Gaps = 12/201 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+ TPPPA LN+SSP F+P+ PVN
Sbjct  1818  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMPTPPPASLNISSPDFAPLSPVN  1877

Query  396   TNPLGDSKSINSKSEPTNFSL-PLSYAEE-RTNNVVLPSELH--LQPGEHRVEKFPSAVS  229
             TNPLGD+K +N K +PTNF+L P SY EE R  N +    L+     G+ R ++F + V+
Sbjct  1878  TNPLGDAK-LNVKPDPTNFNLPPSSYNEENRAVNAITSRALNSDYTLGDQRNDRFMTGVT  1936

Query  228   SGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGR--SNQLPSAAEHTISGNPY  64
             SGTLDAIRERMKS+QLAAAAG+ +     L + N N++HG    +Q+P A+EH   G   
Sbjct  1937  SGTLDAIRERMKSMQLAAAAGSTESGGRHLTSANDNLNHGLPPPSQIPHASEHV--GTEN  1994

Query  63    PQQSGVLPMDEKALSGLQARM  1
                 GVLPMDEKALSGLQARM
Sbjct  1995  TMHGGVLPMDEKALSGLQARM  2015



>gb|KHN00874.1| Protein MOR1 [Glycine soja]
Length=2057

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 150/201 (75%), Gaps = 12/201 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+ TPPPA LN+SSP F+P+ PVN
Sbjct  1849  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMPTPPPASLNISSPDFAPLSPVN  1908

Query  396   TNPLGDSKSINSKSEPTNFSL-PLSYAEE-RTNNVVLPSELH--LQPGEHRVEKFPSAVS  229
             TNPLGD+K +N K +PTNF+L P SY EE R  N +    L+     G+ R ++F + V+
Sbjct  1909  TNPLGDAK-LNVKPDPTNFNLPPSSYNEENRAVNAITSRALNSDYTLGDQRNDRFMTGVT  1967

Query  228   SGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGR--SNQLPSAAEHTISGNPY  64
             SGTLDAIRERMKS+QLAAAAG+ +     L + N N++HG    +Q+P A+EH   G   
Sbjct  1968  SGTLDAIRERMKSMQLAAAAGSTESGGRHLTSANDNLNHGLPPPSQIPHASEHV--GTEN  2025

Query  63    PQQSGVLPMDEKALSGLQARM  1
                 GVLPMDEKALSGLQARM
Sbjct  2026  TMHGGVLPMDEKALSGLQARM  2046



>ref|XP_002300496.1| MICROTUBULE ORGANIZATION 1 family protein [Populus trichocarpa]
 gb|EEE85301.1| MICROTUBULE ORGANIZATION 1 family protein [Populus trichocarpa]
Length=2036

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 147/202 (73%), Gaps = 16/202 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKN AAGRTPSS+PISTPPP+ LN+SSP   P+ PV+
Sbjct  1830  IFAQLQNASEAFRTYIRDGLAQMEKNTAAGRTPSSLPISTPPPSALNVSSPDLQPLSPVH  1889

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVV-------LPSELHLQPGEHRVEKFPS  238
             TN L D+K ++ K E TNF LP SYAE+  N  V       L SE  L  G+ R EK   
Sbjct  1890  TNSLNDAKPLHVKPETTNFHLPPSYAED--NRAVSAFLSRGLVSENSL--GDQRNEKLIG  1945

Query  237   AVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNP  67
              V+SGTLDAIRERMKS+QLAAA GNPD    PLM+ N N+++G S+Q+  A + T  G  
Sbjct  1946  GVTSGTLDAIRERMKSMQLAAATGNPDSGSRPLMSMNENLNNGLSSQILRAPDST--GME  2003

Query  66    YPQQSGVLPMDEKALSGLQARM  1
              P  SGVLPMDEKALSGLQARM
Sbjct  2004  NPLHSGVLPMDEKALSGLQARM  2025



>ref|XP_011096261.1| PREDICTED: protein MOR1 isoform X2 [Sesamum indicum]
Length=2027

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 150/203 (74%), Gaps = 21/203 (10%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNAS+AFRTYIRDGLAQME+NAAAGRTPSSVP++TPPPA LNL SP++ P+ PVN
Sbjct  1824  IFAQLQNASDAFRTYIRDGLAQMERNAAAGRTPSSVPLATPPPAALNL-SPRYGPLSPVN  1882

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAE-ERTNNVVLP-------SELHLQPGEHRVEKFP  241
             TNPL DS+++N++ EPTNFSLP SYAE +R  N   P       + L     E R ++ P
Sbjct  1883  TNPLSDSRNMNTRVEPTNFSLPPSYAEDDRHVNASSPRVSSYEQAGLQQNMEESRNDRLP  1942

Query  240   SAVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGN  70
             S VS+GTLDAIRERMKSIQLAA+AGNP+    PL+  NGN++H      P   E   SGN
Sbjct  1943  S-VSNGTLDAIRERMKSIQLAASAGNPESRSRPLIQVNGNLNH------PPVTEGHGSGN  1995

Query  69    PYPQQSGVLPMDEKALSGLQARM  1
             P     G+LPMDEKALSGLQARM
Sbjct  1996  PV--HGGILPMDEKALSGLQARM  2016



>ref|XP_006468405.1| PREDICTED: protein MOR1-like isoform X2 [Citrus sinensis]
Length=2013

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 150/200 (75%), Gaps = 15/200 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP++TPPPA L +SSP+F+P+ PV+
Sbjct  1810  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMATPPPAALGVSSPEFAPLSPVH  1869

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEER-----TNNVVLPSELHLQPGEHRVEKFPSAV  232
             TN + D+KS+N KSE TNF+LP SY E+        + VLP E  L   + R E+F   V
Sbjct  1870  TNSMNDAKSMNVKSESTNFNLPPSYTEDNRIGGAIASKVLPPENPL--SDQRNERF--GV  1925

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             +SGTLDAIRERMKS+QLAAAAGNPD    PL+  N NV++G S+Q  S+   ++     P
Sbjct  1926  TSGTLDAIRERMKSMQLAAAAGNPDPGNRPLINMNDNVNNGLSSQSRSSDRASVEN---P  1982

Query  60    QQSGVLPMDEKALSGLQARM  1
              Q  VLPMDEKALSGLQARM
Sbjct  1983  AQGSVLPMDEKALSGLQARM  2002



>ref|XP_004307880.1| PREDICTED: protein MOR1-like [Fragaria vesca subsp. vesca]
Length=2013

 Score =   191 bits (486),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 150/200 (75%), Gaps = 18/200 (9%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGL QMEKNAAAGRTPSSVP+ TPPPA L++SSP+F+P+ PV+
Sbjct  1813  IFSQLQNASEAFRTYIRDGLTQMEKNAAAGRTPSSVPMPTPPPASLSVSSPEFAPLSPVH  1872

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSEL----HLQPGEHRVEKFPSAV  232
             TN L DSKS N KSEPT+F+LP +YAE+ R +N   P  L     + P   R E++   V
Sbjct  1873  TNSLMDSKSFNVKSEPTSFNLPPAYAEDNRLHNANTPRGLVENSMVDP---RNERYMGGV  1929

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             +SGTLDAIRERMKS+QLAAA+GN D    PLM  N N + G S+Q+   +E+T+      
Sbjct  1930  TSGTLDAIRERMKSMQLAAASGNLDSEARPLMYVNDNQNLGLSDQINRVSENTL------  1983

Query  60    QQSGVLPMDEKALSGLQARM  1
              QSGVLPMDEKALSGLQARM
Sbjct  1984  -QSGVLPMDEKALSGLQARM  2002



>gb|KEH43480.1| microtubule organization protein [Medicago truncatula]
Length=2024

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 150/202 (74%), Gaps = 15/202 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF QLQNASEAFRTYIRDGLAQM KNAAAGRTPSS+P+ TPPPA LN+SSP F+P+ PVN
Sbjct  1817  IFDQLQNASEAFRTYIRDGLAQMAKNAAAGRTPSSMPMPTPPPASLNISSPDFAPLSPVN  1876

Query  396   TNPLGDSKSINSKSEPTNFSL-PLSYAEE-RTNNV----VLPSELHLQPGEHRVEKFPSA  235
              N L D++ +N KSEPTNF+L P SY+EE R  N     VL S+  L  G+ R +KF + 
Sbjct  1877  ANSLNDAR-LNVKSEPTNFNLPPSSYSEENRAVNAFASRVLSSDYTL--GDQRNDKFMTG  1933

Query  234   VSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGR-SNQLPSAAEHTISGNP  67
             V+SGTLDAIRERMKS+QLAAAAG+ +    PL + N N +HG   +Q+P A+EH  + N 
Sbjct  1934  VTSGTLDAIRERMKSMQLAAAAGSTESGTRPLTSVNDNFNHGLPHSQIPLASEHVGAENT  1993

Query  66    YPQQSGVLPMDEKALSGLQARM  1
                Q GV P+DEKALSGLQARM
Sbjct  1994  L--QGGVHPVDEKALSGLQARM  2013



>ref|XP_004162854.1| PREDICTED: LOW QUALITY PROTEIN: protein MOR1-like [Cucumis sativus]
Length=1289

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 147/198 (74%), Gaps = 12/198 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQME+NAAAGRTPSS+P+STPPPA +N SSP F+P+ PV+
Sbjct  1087  IFAQLQNASEAFRTYIRDGLAQMERNAAAGRTPSSLPLSTPPPASMN-SSPDFAPLSPVH  1145

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSEL---HLQPGEHRVEKFPSAVSS  226
             TN L ++KS+N K EPTNF+LP SY E   +N ++ S         G+ R +K+ S V+S
Sbjct  1146  TNSLTEAKSLNVKPEPTNFTLPPSYTE---DNRIITSRGPGPDYSLGDQRNDKYISGVTS  1202

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERMKS+QLAAAAGN +    PLM+ N N+  G   Q+   +EH   G     Q
Sbjct  1203  GTLDAIRERMKSMQLAAAAGNHESGSKPLMSVNDNLHPGMIAQMSQPSEHI--GVENSAQ  1260

Query  54    SGVLPMDEKALSGLQARM  1
             +GVLPMDEKALSGLQARM
Sbjct  1261  AGVLPMDEKALSGLQARM  1278



>ref|XP_006589399.1| PREDICTED: protein MOR1-like isoform X1 [Glycine max]
Length=2026

 Score =   188 bits (478),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 147/201 (73%), Gaps = 12/201 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+ TPPPA LN+SSP F+P+ PVN
Sbjct  1818  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMPTPPPASLNISSPDFAPLSPVN  1877

Query  396   TNPLGDSKSINSKSEPTNFSL-PLSYAEE-RTNNVVLPSELH--LQPGEHRVEKFPSAVS  229
              NPLGD+K +N K EPTNF+L P SY EE R  N +    L+     G+ R ++F + V+
Sbjct  1878  ANPLGDAK-LNVKPEPTNFNLPPSSYNEENRAVNAITSRALNSDYTLGDQRNDRFMTGVT  1936

Query  228   SGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGR--SNQLPSAAEHTISGNPY  64
             SGTLDAIRERMKS+QLAAAAG+ +     L + N N + G    +Q+P A+EH   G   
Sbjct  1937  SGTLDAIRERMKSMQLAAAAGSTESGGRHLTSANDNFNQGLPPPSQIPHASEHV--GTEN  1994

Query  63    PQQSGVLPMDEKALSGLQARM  1
                 GVLPMDEKALSGLQARM
Sbjct  1995  TMHGGVLPMDEKALSGLQARM  2015



>ref|XP_004134886.1| PREDICTED: protein MOR1-like [Cucumis sativus]
Length=2005

 Score =   188 bits (477),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 147/198 (74%), Gaps = 12/198 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQME+NAAAGRTPSS+P+STPPPA +N SSP F+P+ PV+
Sbjct  1803  IFAQLQNASEAFRTYIRDGLAQMERNAAAGRTPSSLPLSTPPPASMN-SSPDFAPLSPVH  1861

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSEL---HLQPGEHRVEKFPSAVSS  226
             TN L ++KS+N K EPTNF+LP SY E   +N ++ S         G+ R +K+ S V+S
Sbjct  1862  TNSLTEAKSLNVKPEPTNFTLPPSYTE---DNRIITSRGPGPDYSLGDQRNDKYISGVTS  1918

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERMKS+QLAAAAGN +    PLM+ N N+  G   Q+   +EH   G     Q
Sbjct  1919  GTLDAIRERMKSMQLAAAAGNHESGSKPLMSVNDNLHPGMIAQMSQPSEHI--GVENSAQ  1976

Query  54    SGVLPMDEKALSGLQARM  1
             +GVLPMDEKALSGLQARM
Sbjct  1977  AGVLPMDEKALSGLQARM  1994



>gb|KGN49501.1| hypothetical protein Csa_6G526350 [Cucumis sativus]
Length=2026

 Score =   188 bits (477),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 147/198 (74%), Gaps = 12/198 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQME+NAAAGRTPSS+P+STPPPA +N SSP F+P+ PV+
Sbjct  1824  IFAQLQNASEAFRTYIRDGLAQMERNAAAGRTPSSLPLSTPPPASMN-SSPDFAPLSPVH  1882

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSEL---HLQPGEHRVEKFPSAVSS  226
             TN L ++KS+N K EPTNF+LP SY E   +N ++ S         G+ R +K+ S V+S
Sbjct  1883  TNSLTEAKSLNVKPEPTNFTLPPSYTE---DNRIITSRGPGPDYSLGDQRNDKYISGVTS  1939

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERMKS+QLAAAAGN +    PLM+ N N+  G   Q+   +EH   G     Q
Sbjct  1940  GTLDAIRERMKSMQLAAAAGNHESGSKPLMSVNDNLHPGMIAQMSQPSEHI--GVENSAQ  1997

Query  54    SGVLPMDEKALSGLQARM  1
             +GVLPMDEKALSGLQARM
Sbjct  1998  AGVLPMDEKALSGLQARM  2015



>ref|XP_011010439.1| PREDICTED: protein MOR1-like [Populus euphratica]
Length=2027

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 145/202 (72%), Gaps = 16/202 (8%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKN AAGRTPSS+PISTPPP+ LN+SSP   P+ PV+
Sbjct  1821  IFAQLQNASEAFRTYIRDGLAQMEKNTAAGRTPSSLPISTPPPSALNVSSPDLQPLSPVH  1880

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVV-------LPSELHLQPGEHRVEKFPS  238
             TN L D+K ++ K E TNF LP SYAE+  N  V       L SE  L  G+ R EK   
Sbjct  1881  TNSLNDAKPLHVKPETTNFHLPSSYAED--NRAVSAFLSRGLVSENSL--GDQRNEKLIG  1936

Query  237   AVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNP  67
              V+SGTLDAIRERMKS+QLAAA GNPD    PLM+ N N+++G  +Q+  A +    G  
Sbjct  1937  GVTSGTLDAIRERMKSMQLAAATGNPDSGSRPLMSVNENLNNGLPSQILRAPDAM--GME  1994

Query  66    YPQQSGVLPMDEKALSGLQARM  1
              P  SGVLPMDEKALSGLQARM
Sbjct  1995  NPLHSGVLPMDEKALSGLQARM  2016



>gb|KHN37797.1| Protein MOR1 [Glycine soja]
Length=2136

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 147/201 (73%), Gaps = 12/201 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+ TPPPA LN+SSP F+P+ PVN
Sbjct  1928  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMPTPPPASLNISSPDFAPLSPVN  1987

Query  396   TNPLGDSKSINSKSEPTNFSL-PLSYAEE-RTNNVVLPSELH--LQPGEHRVEKFPSAVS  229
              NPLGD+K +N K EPTNF+L P SY EE R  N +    L+     G+ R ++F + V+
Sbjct  1988  ANPLGDAK-LNVKPEPTNFNLPPSSYNEENRAVNAITSRALNSDYTLGDERNDRFMTGVT  2046

Query  228   SGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGR--SNQLPSAAEHTISGNPY  64
             SGTLDAIRERMKS+QLAAAAG+ +     L + N N + G    +Q+P A+EH   G   
Sbjct  2047  SGTLDAIRERMKSMQLAAAAGSTESGGRHLTSANDNFNQGLPPPSQIPHASEHV--GTEN  2104

Query  63    PQQSGVLPMDEKALSGLQARM  1
                 GVLPMDEKALSGLQARM
Sbjct  2105  TMHGGVLPMDEKALSGLQARM  2125



>ref|XP_008439496.1| PREDICTED: protein MOR1 isoform X1 [Cucumis melo]
Length=2026

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 146/198 (74%), Gaps = 12/198 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQME+NAAAGRTPSS+P+STPPPA +N SSP F+P+ PV+
Sbjct  1824  IFAQLQNASEAFRTYIRDGLAQMERNAAAGRTPSSLPLSTPPPASMN-SSPDFAPLSPVH  1882

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSEL---HLQPGEHRVEKFPSAVSS  226
             TN L ++KS+N K EPTNF+LP SY E   +N ++ S         G+ R +K+   V+S
Sbjct  1883  TNSLTEAKSLNVKPEPTNFTLPPSYTE---DNRIITSRGPAPDYSLGDQRNDKYIGGVTS  1939

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERMKS+QLAAAAGN +    PLM+ N N+  G   Q+   +EH   G     Q
Sbjct  1940  GTLDAIRERMKSMQLAAAAGNHESGSKPLMSVNDNLHPGMLAQMSQPSEHI--GVENSAQ  1997

Query  54    SGVLPMDEKALSGLQARM  1
             +GVLPMDEKALSGLQARM
Sbjct  1998  TGVLPMDEKALSGLQARM  2015



>ref|XP_008439497.1| PREDICTED: protein MOR1 isoform X2 [Cucumis melo]
Length=2025

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 146/198 (74%), Gaps = 12/198 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQME+NAAAGRTPSS+P+STPPPA +N SSP F+P+ PV+
Sbjct  1823  IFAQLQNASEAFRTYIRDGLAQMERNAAAGRTPSSLPLSTPPPASMN-SSPDFAPLSPVH  1881

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSEL---HLQPGEHRVEKFPSAVSS  226
             TN L ++KS+N K EPTNF+LP SY E   +N ++ S         G+ R +K+   V+S
Sbjct  1882  TNSLTEAKSLNVKPEPTNFTLPPSYTE---DNRIITSRGPAPDYSLGDQRNDKYIGGVTS  1938

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERMKS+QLAAAAGN +    PLM+ N N+  G   Q+   +EH   G     Q
Sbjct  1939  GTLDAIRERMKSMQLAAAAGNHESGSKPLMSVNDNLHPGMLAQMSQPSEHI--GVENSAQ  1996

Query  54    SGVLPMDEKALSGLQARM  1
             +GVLPMDEKALSGLQARM
Sbjct  1997  TGVLPMDEKALSGLQARM  2014



>gb|KHG14713.1| Protein MOR1 [Gossypium arboreum]
Length=366

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 145/201 (72%), Gaps = 11/201 (5%)
 Frame = -2

Query  576  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
            IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP+STPPPA L+ SSP+F P+ PV 
Sbjct  156  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPMSTPPPASLSSSSPEFGPLSPVQ  215

Query  396  TNPLGDSKSINSKSEPTNFSLPLSYAEER--TNNVVLPSELHLQP---GEHRVEKFPSAV  232
            TN L DSK  ++K EPT+F+LP SY E+   + N V  + +        + R E+F S V
Sbjct  216  TNSLNDSKLSSTKPEPTSFNLPPSYTEDNRGSGNAVNTARVRAPENALADQRNERFISGV  275

Query  231  SSGTLDAIRERMKSIQLAAAAGNPD----LPLMARNGNVSHGRSNQLPSAAEHTISGNPY  64
            +SGTLDAIRERMKS+QLAAA GN D     PLM+ N N++ G S+Q  +   H   G   
Sbjct  276  TSGTLDAIRERMKSMQLAAAGGNIDDYGTRPLMSVNDNLNLGLSSQTRTLDPH--PGMEN  333

Query  63   PQQSGVLPMDEKALSGLQARM  1
            P Q GVLPMDEKALSGLQARM
Sbjct  334  PAQGGVLPMDEKALSGLQARM  354



>ref|XP_010686559.1| PREDICTED: protein MOR1 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=2021

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 143/198 (72%), Gaps = 14/198 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP+STPPP+ L LSSPK +P+ PV+
Sbjct  1821  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPLSTPPPSSLTLSSPKLAPLSPVH  1880

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVV--LPSELHLQ-PGEHRVEKFPSAVSS  226
             TN L DSKS N++ EPT FS   S  +ERT N     P+  H Q  G+ R ++    V++
Sbjct  1881  TNSLNDSKSQNTRVEPTTFSSSFS-DDERTGNATPRGPTFDHQQFLGDQRSDRL--GVTT  1937

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERMKSIQL+AA  NPD    PLM  NGNV+H   NQ     + + + NP    
Sbjct  1938  GTLDAIRERMKSIQLSAAGVNPDSGTRPLMPMNGNVTH---NQAQHVLDDSTAENPV--H  1992

Query  54    SGVLPMDEKALSGLQARM  1
              GVLPMDEKALSGLQARM
Sbjct  1993  GGVLPMDEKALSGLQARM  2010



>ref|XP_010686561.1| PREDICTED: protein MOR1 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1968

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 143/198 (72%), Gaps = 14/198 (7%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVP+STPPP+ L LSSPK +P+ PV+
Sbjct  1768  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSVPLSTPPPSSLTLSSPKLAPLSPVH  1827

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVV--LPSELHLQ-PGEHRVEKFPSAVSS  226
             TN L DSKS N++ EPT FS   S  +ERT N     P+  H Q  G+ R ++    V++
Sbjct  1828  TNSLNDSKSQNTRVEPTTFSSSFS-DDERTGNATPRGPTFDHQQFLGDQRSDRL--GVTT  1884

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERMKSIQL+AA  NPD    PLM  NGNV+H   NQ     + + + NP    
Sbjct  1885  GTLDAIRERMKSIQLSAAGVNPDSGTRPLMPMNGNVTH---NQAQHVLDDSTAENPV--H  1939

Query  54    SGVLPMDEKALSGLQARM  1
              GVLPMDEKALSGLQARM
Sbjct  1940  GGVLPMDEKALSGLQARM  1957



>ref|XP_010110460.1| hypothetical protein L484_001859 [Morus notabilis]
 gb|EXC26458.1| hypothetical protein L484_001859 [Morus notabilis]
Length=2077

 Score =   182 bits (462),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 152/226 (67%), Gaps = 36/226 (16%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+STPPP+ L+LSSP+ +P+ PV+
Sbjct  1843  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPLSTPPPSSLSLSSPELAPLSPVH  1902

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQ--PGEHRVEKFPS-----  238
              N L D+KS+N KSEPTNF+LP SY E+   N  +P  L      G+ R E++ S     
Sbjct  1903  ANSLNDAKSLNMKSEPTNFNLPPSYTEDARANNSIPRGLTTDNSLGDQRSERYISGGNCF  1962

Query  237   ------------------------AVSSGTLDAIRERMKSIQLAAAAGNPDL---PLMAR  139
                                     AV+SGTLDAIRERMKS+QLAAAAGNPD    P +  
Sbjct  1963  HNAFNTMCVLIGEERLTMELSMETAVTSGTLDAIRERMKSMQLAAAAGNPDTESRPNIYV  2022

Query  138   NGNVSHGRSNQLPSAAEHTISGNPYPQQSGVLPMDEKALSGLQARM  1
             N  V+ G S+Q+  A EH  S   +P +SGVLPMDEKALSGLQARM
Sbjct  2023  NDMVNQGFSDQVHHAPEH--SNLEHPVRSGVLPMDEKALSGLQARM  2066



>ref|XP_010052351.1| PREDICTED: protein MOR1 [Eucalyptus grandis]
 gb|KCW76286.1| hypothetical protein EUGRSUZ_D00655 [Eucalyptus grandis]
Length=2019

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 142/198 (72%), Gaps = 11/198 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEK AAAGRTPS++ ++TPPPAVLNLSSPK +P+ PV+
Sbjct  1816  IFAQLQNASEAFRTYIRDGLAQMEKTAAAGRTPSTLLMATPPPAVLNLSSPKLTPLSPVH  1875

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAE-ERTNNVVLPSELHLQP--GEHRVEKFPSAVSS  226
             TN   D K+IN+K EPT+FSLP SY+E +R  + +     H      E R E+  + VS 
Sbjct  1876  TNSTADVKTINAKPEPTSFSLPPSYSEDDRVVSAMSSRGPHTDALFAEQRNERLLTGVSG  1935

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERM+SIQLAAA+GN D    P    NGNV +G   Q P+  ++    +    Q
Sbjct  1936  GTLDAIRERMRSIQLAAASGNLDSGNKPPFYTNGNVPYG---QNPNTTDNLSMDD--AGQ  1990

Query  54    SGVLPMDEKALSGLQARM  1
             +GV PMDEKALSGLQARM
Sbjct  1991  AGVRPMDEKALSGLQARM  2008



>gb|EYU27937.1| hypothetical protein MIMGU_mgv1a000055mg [Erythranthe guttata]
Length=2016

 Score =   179 bits (454),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 146/203 (72%), Gaps = 22/203 (11%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNAS+AFRTYIRDGLAQMEKNAAAGRTPSSVP+STPPPA LNLS    +P+ PVN
Sbjct  1814  IFSQLQNASDAFRTYIRDGLAQMEKNAAAGRTPSSVPLSTPPPAALNLSP---NPLSPVN  1870

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAE-ERTNNVVLP-------SELHLQPGEHRVEKFP  241
              N L DS+++N+++EPTNFSLP SYAE ++  NV+ P       S L     + R E+ P
Sbjct  1871  ANTLNDSRNLNARAEPTNFSLPPSYAEHDQGFNVISPRVSSYSQSALQHNLDDSRNERLP  1930

Query  240   SAVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGN  70
             S VS+GTLDAIRERMKSIQL ++A NPD    PL+  NGNV     N  P    H  +GN
Sbjct  1931  SGVSNGTLDAIRERMKSIQLGSSAVNPDPRNRPLIQVNGNV-----NNHPVPEVHG-AGN  1984

Query  69    PYPQQSGVLPMDEKALSGLQARM  1
                 Q G+LPMDEKALSGLQARM
Sbjct  1985  RV--QGGILPMDEKALSGLQARM  2005



>ref|XP_002317062.2| MICROTUBULE ORGANIZATION 1 family protein [Populus trichocarpa]
 gb|EEE97674.2| MICROTUBULE ORGANIZATION 1 family protein [Populus trichocarpa]
Length=2025

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 143/198 (72%), Gaps = 12/198 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKN AAGRTPSS+P+STPPP+  N+SSP   P+ PV+
Sbjct  1823  IFAQLQNASEAFRTYIRDGLAQMEKNTAAGRTPSSLPMSTPPPSAPNVSSPDLQPLSPVH  1882

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE---RTNNVVLPSELHLQPGEHRVEKFPSAVSS  226
             TN L DSK +++K E TNF LP SY+E+    +   V  + L    G+ R EK  S V+S
Sbjct  1883  TNSLNDSKPLHAKPEATNFHLPPSYSEDGAILSRGFVSENSL----GDQRNEKLISGVTS  1938

Query  225   GTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQ  55
             GTLDAIRERMKS+QLAA AG PD    PLM+ N N+++G S+ +  A +   +G   P  
Sbjct  1939  GTLDAIRERMKSMQLAATAGLPDSGSRPLMSVNDNLNNGLSSLILHAPDS--AGMENPVL  1996

Query  54    SGVLPMDEKALSGLQARM  1
              GVLP+DEKALSGLQARM
Sbjct  1997  GGVLPLDEKALSGLQARM  2014



>ref|XP_011040587.1| PREDICTED: protein MOR1-like [Populus euphratica]
Length=2027

 Score =   177 bits (448),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 143/200 (72%), Gaps = 12/200 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKN AAGRTPSS+P+STPPP+  N+SSP   P+ PV+
Sbjct  1821  IFAQLQNASEAFRTYIRDGLAQMEKNTAAGRTPSSLPMSTPPPSAPNVSSPDLQPLSPVH  1880

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAE-ERTNNVVLP----SELHLQPGEHRVEKFPSAV  232
             TN L DSK +++K E TNF LP SY+E  R    VL     SE  L  G+ R EK  S V
Sbjct  1881  TNSLNDSKPLHAKPEVTNFHLPPSYSENNREVGAVLSRGFVSENSL--GDQRNEKLISGV  1938

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYP  61
             +SGTLDAIRERMKS+QLAA AG PD    PLM+ N N+++G S+ +  A +   +G   P
Sbjct  1939  TSGTLDAIRERMKSMQLAATAGLPDSGSRPLMSVNDNLNNGLSSLILQAPDS--AGTENP  1996

Query  60    QQSGVLPMDEKALSGLQARM  1
                GV P+DEKALSGLQARM
Sbjct  1997  MLGGVHPLDEKALSGLQARM  2016



>ref|XP_010245318.1| PREDICTED: protein MOR1 [Nelumbo nucifera]
Length=2036

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 146/208 (70%), Gaps = 20/208 (10%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+STPPP    LSSPKF+P+ PV+
Sbjct  1822  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPVA--LSSPKFAPLSPVH  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEER--TNNVVLP------SELHLQPGEHRVEKFP  241
             TN L D+K +N K E  N +LP SY+++    N + L       SEL     + R +++ 
Sbjct  1880  TNSLNDAKPLNVKLESANSNLPPSYSDDDRAVNAISLRGPISDNSELRQNMADERNDRYS  1939

Query  240   S---AVSSGTLDAIRERMKSIQLAAAAGNPDL---PLMARNGNV-SHG-RSNQLPSAAEH  85
             S   A++SGTLDAIRERMKSIQLAAA  NP+     LM  NGNV +HG   +Q+P  +  
Sbjct  1940  SATTAITSGTLDAIRERMKSIQLAAATVNPEAGNRALMFMNGNVLAHGPPPSQIPQGSVR  1999

Query  84    TISGNPYPQQSGVLPMDEKALSGLQARM  1
               S  P   Q+GVLPMDEKALSGLQARM
Sbjct  2000  VDSEAPV--QTGVLPMDEKALSGLQARM  2025



>ref|XP_010922855.1| PREDICTED: protein MOR1-like [Elaeis guineensis]
Length=2022

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 133/205 (65%), Gaps = 30/205 (15%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR   S    + PP +  + SPKF+P+ PV+
Sbjct  1824  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR-TPSNLPMSTPPPLATIPSPKFTPISPVH  1882

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLP-------SELHLQPGEHRVEKFPS  238
             T      KS+N K+E  N ++ +SY+E+       P       S++  Q G+ R ++FPS
Sbjct  1883  T------KSLNVKTETINSNVAVSYSEDAAVGATAPVRGQNDSSDIRSQLGDDRSDRFPS  1936

Query  237   ---AVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTIS  76
                A+ SGTLDAIRERMKSIQ AAAAGN D    PL   NGNV HG ++++   A     
Sbjct  1937  GAPAIISGTLDAIRERMKSIQAAAAAGNMDSGARPLAYANGNVLHG-TDRMDGEA-----  1990

Query  75    GNPYPQQSGVLPMDEKALSGLQARM  1
                 P Q+ VLPMDEKALSGLQARM
Sbjct  1991  ----PDQTTVLPMDEKALSGLQARM  2011



>gb|AFK36921.1| unknown [Lotus japonicus]
Length=178

 Score =   150 bits (379),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 128/174 (74%), Gaps = 11/174 (6%)
 Frame = -2

Query  510  MEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVNTNPLGDSKSINSKSEPTNFSLP  331
            MEKNAAAGRTPSS+P+ TPPPA LN SSP F+P+ P+N NPLGD+K +N K++ TNF+LP
Sbjct  1    MEKNAAAGRTPSSLPMPTPPPASLNNSSPDFAPLSPINANPLGDAK-LNVKTDLTNFNLP  59

Query  330  LSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTLDAIRERMKSIQLAAAAGNPD--  157
             SY EE  N   L S+  L  G+ R +K+ + V++GTLDAIRERMKS+QLAAAAG+ D  
Sbjct  60   PSYNEE--NRRALNSDYTL--GDQRNDKYMTGVTTGTLDAIRERMKSMQLAAAAGSTDSA  115

Query  156  -LPLMARNGNVSHGR-SNQLPSAAEHTISGNPYPQQSGVLPMDEKALSGLQARM  1
              PL + N N++HG   +Q+P A+EH    N    Q GVLPMDEKALSGLQARM
Sbjct  116  ARPLTSINDNMNHGHPHSQIPHASEHVAMENAL--QGGVLPMDEKALSGLQARM  167



>ref|XP_008788006.1| PREDICTED: protein MOR1-like isoform X1 [Phoenix dactylifera]
Length=2026

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 130/205 (63%), Gaps = 30/205 (15%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR   S    + PP +    SPKF+P+ PV 
Sbjct  1827  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR-IPSSLPMSTPPPLATAPSPKFAPLSPVQ  1885

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVL-------PSELHLQPGEHRVEKFPS  238
             T      KS++ K+E  N ++ +SY+E+               S+   Q G  R +++PS
Sbjct  1886  T------KSLHVKTESINSNVAVSYSEDDAVGTTTSLRGQSDSSDFRSQLGGDRNDRYPS  1939

Query  237   ---AVSSGTLDAIRERMKSIQLAAAAGNPDL---PLMARNGNVSHGRSNQLPSAAEHTIS  76
                A+++GTLDAIRERMKSIQ AAAAGN D    PL   NGN  H R++++         
Sbjct  1940  GAPAITTGTLDAIRERMKSIQAAAAAGNVDCGARPLAYVNGNALH-RTDRM--------D  1990

Query  75    GNPYPQQSGVLPMDEKALSGLQARM  1
             G P P Q+GVLPMDEKALSGLQARM
Sbjct  1991  GEP-PSQTGVLPMDEKALSGLQARM  2014



>ref|XP_008788007.1| PREDICTED: protein MOR1-like isoform X2 [Phoenix dactylifera]
Length=2025

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 130/205 (63%), Gaps = 30/205 (15%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR   S    + PP +    SPKF+P+ PV 
Sbjct  1826  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR-IPSSLPMSTPPPLATAPSPKFAPLSPVQ  1884

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVL-------PSELHLQPGEHRVEKFPS  238
             T      KS++ K+E  N ++ +SY+E+               S+   Q G  R +++PS
Sbjct  1885  T------KSLHVKTESINSNVAVSYSEDDAVGTTTSLRGQSDSSDFRSQLGGDRNDRYPS  1938

Query  237   ---AVSSGTLDAIRERMKSIQLAAAAGNPDL---PLMARNGNVSHGRSNQLPSAAEHTIS  76
                A+++GTLDAIRERMKSIQ AAAAGN D    PL   NGN  H R++++         
Sbjct  1939  GAPAITTGTLDAIRERMKSIQAAAAAGNVDCGARPLAYVNGNALH-RTDRM--------D  1989

Query  75    GNPYPQQSGVLPMDEKALSGLQARM  1
             G P P Q+GVLPMDEKALSGLQARM
Sbjct  1990  GEP-PSQTGVLPMDEKALSGLQARM  2013



>ref|XP_008804673.1| PREDICTED: LOW QUALITY PROTEIN: protein MOR1-like [Phoenix dactylifera]
Length=2021

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 131/205 (64%), Gaps = 31/205 (15%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR   S    + PP +  + SPKF+P+ PV 
Sbjct  1824  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR-TPSSLPMSTPPPLATIPSPKFAPLSPVX  1882

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVL-------PSELHLQPGEHRVEKFPS  238
             T      KS+N K+E  N S+ +SY+E+               S++  Q G+ R ++FPS
Sbjct  1883  T------KSLNVKTENIN-SVAVSYSEDVAVGTTASLRGQSDSSDIRSQLGDDRNDRFPS  1935

Query  237   A---VSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTIS  76
                 ++SGTLDAIRERMKSIQ AAAAGN D    PL   NGNV HG +++L    E T  
Sbjct  1936  GAPTITSGTLDAIRERMKSIQAAAAAGNMDSGARPLAYANGNVLHG-TDRLD--GETT--  1990

Query  75    GNPYPQQSGVLPMDEKALSGLQARM  1
                   Q+ VLPMDEKALSGLQARM
Sbjct  1991  -----GQTNVLPMDEKALSGLQARM  2010



>ref|XP_010931515.1| PREDICTED: protein MOR1-like [Elaeis guineensis]
Length=2025

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 136/207 (66%), Gaps = 34/207 (16%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+STPPP  +   SPKF+P+ PV+
Sbjct  1826  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPLAIA-PSPKFAPLSPVH  1884

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE---------RTNNVVLPSELHLQPGEHRVEKF  244
             T      KS+N K+E  N ++ +SY+E+         R  N     +   Q G  R +++
Sbjct  1885  T------KSLNVKTESMNSNVAVSYSEDDAVGGTTTLRGQND--SYDFRSQLGGERNDRY  1936

Query  243   PS---AVSSGTLDAIRERMKSIQLAAAAGNPDL---PLMARNGNVSHGRSNQLPSAAEHT  82
             PS   A+++GTLDAIRERMKSIQ AAAAGN D+    L   NGN  H R++ +       
Sbjct  1937  PSGAPAITTGTLDAIRERMKSIQAAAAAGNMDIGARSLAYVNGNALH-RTDCMDGET---  1992

Query  81    ISGNPYPQQSGVLPMDEKALSGLQARM  1
                   P Q+ VLPMDEKALSGLQARM
Sbjct  1993  ------PSQTSVLPMDEKALSGLQARM  2013



>ref|XP_009383850.1| PREDICTED: protein MOR1-like [Musa acuminata subsp. malaccensis]
Length=2018

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 125/204 (61%), Gaps = 29/204 (14%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR   S    + PP +  L SPKF  + PV 
Sbjct  1821  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR-TPSSLPMSTPPPLATLPSPKFGALSPVR  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVL-------PSELHLQPGEHRVEKFPS  238
             T      KSI++KSE    ++ + YAE+              PSE     G+ R++++P+
Sbjct  1880  T------KSISAKSESIYSNVAVPYAEDDAGGTTAALRGQTDPSEFRSHLGDDRMDRYPA  1933

Query  237   --AVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISG  73
               AV+ GTLDAIRERMKSIQ AAAAG+ D    PL   N NV HG         +H I G
Sbjct  1934  APAVTMGTLDAIRERMKSIQAAAAAGSLDGSARPLAHINSNVLHG--------VDH-IDG  1984

Query  72    NPYPQQSGVLPMDEKALSGLQARM  1
                 Q + VLPMDEKALSGLQARM
Sbjct  1985  ETLAQIN-VLPMDEKALSGLQARM  2007



>ref|XP_009387377.1| PREDICTED: protein MOR1-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=2016

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 125/205 (61%), Gaps = 35/205 (17%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNA AGR   S    + PP +  L SPKF P+ PV+
Sbjct  1823  IFAQLQNASEAFRTYIRDGLAQMEKNAVAGR-TPSSLPMSTPPPIATLPSPKFGPLSPVH  1881

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVV----------LPSELHLQPGEHRVEK  247
             T      K IN+K+E  + ++  SY +   N+ V            SE     G+ R+++
Sbjct  1882  T------KLINAKNESIHPNVAASYVD---NDAVGSTASLRGQTDASEFRPHLGDDRMDR  1932

Query  246   FPSAVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTIS  76
             +P AV+ GTLDAIRERMKSIQ AAAAG+ D    PL   NGNV HG            + 
Sbjct  1933  YP-AVTMGTLDAIRERMKSIQAAAAAGSLDGSGRPLAHINGNVLHG----------ERVD  1981

Query  75    GNPYPQQSGVLPMDEKALSGLQARM  1
             G   P Q+ +LPMDEKALSGLQARM
Sbjct  1982  GET-PTQTNILPMDEKALSGLQARM  2005



>ref|XP_009387376.1| PREDICTED: protein MOR1-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=2017

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 126/207 (61%), Gaps = 36/207 (17%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNA AGR   S    + PP +  L SPKF P+ PV+
Sbjct  1821  IFAQLQNASEAFRTYIRDGLAQMEKNAVAGR-TPSSLPMSTPPPIATLPSPKFGPLSPVH  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVV----------LPSELHLQPGEHRVEK  247
             T      K IN+K+E  + ++  SY +   N+ V            SE     G+ R+++
Sbjct  1880  T------KLINAKNESIHPNVAASYVD---NDAVGSTASLRGQTDASEFRPHLGDDRMDR  1930

Query  246   FPS--AVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHT  82
             +P+  AV+ GTLDAIRERMKSIQ AAAAG+ D    PL   NGNV HG            
Sbjct  1931  YPAAPAVTMGTLDAIRERMKSIQAAAAAGSLDGSGRPLAHINGNVLHG----------ER  1980

Query  81    ISGNPYPQQSGVLPMDEKALSGLQARM  1
             + G   P Q+ +LPMDEKALSGLQARM
Sbjct  1981  VDGET-PTQTNILPMDEKALSGLQARM  2006



>ref|XP_009387375.1| PREDICTED: protein MOR1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=2019

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 126/207 (61%), Gaps = 36/207 (17%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNA AGR   S    + PP +  L SPKF P+ PV+
Sbjct  1823  IFAQLQNASEAFRTYIRDGLAQMEKNAVAGR-TPSSLPMSTPPPIATLPSPKFGPLSPVH  1881

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVV----------LPSELHLQPGEHRVEK  247
             T      K IN+K+E  + ++  SY +   N+ V            SE     G+ R+++
Sbjct  1882  T------KLINAKNESIHPNVAASYVD---NDAVGSTASLRGQTDASEFRPHLGDDRMDR  1932

Query  246   FPS--AVSSGTLDAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHT  82
             +P+  AV+ GTLDAIRERMKSIQ AAAAG+ D    PL   NGNV HG            
Sbjct  1933  YPAAPAVTMGTLDAIRERMKSIQAAAAAGSLDGSGRPLAHINGNVLHG----------ER  1982

Query  81    ISGNPYPQQSGVLPMDEKALSGLQARM  1
             + G   P Q+ +LPMDEKALSGLQARM
Sbjct  1983  VDGET-PTQTNILPMDEKALSGLQARM  2008



>ref|XP_006468406.1| PREDICTED: protein MOR1-like isoform X3 [Citrus sinensis]
Length=1974

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 116/195 (59%), Gaps = 44/195 (23%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPS              S P  +P     
Sbjct  1810  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPS--------------SVPMATPPPAAL  1855

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
              N +G +  I SK                    VLP E  L   + R E+F  AV+SGTL
Sbjct  1856  DNRIGGA--IASK--------------------VLPPENPL--SDQRNERFGVAVTSGTL  1891

Query  216   DAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGV  46
             DAIRERMKS+QLAAAAGNPD    PL+  N NV++G S+Q  S+   ++     P Q  V
Sbjct  1892  DAIRERMKSMQLAAAAGNPDPGNRPLINMNDNVNNGLSSQSRSSDRASVEN---PAQGSV  1948

Query  45    LPMDEKALSGLQARM  1
             LPMDEKALSGLQARM
Sbjct  1949  LPMDEKALSGLQARM  1963



>gb|KDO77518.1| hypothetical protein CISIN_1g000146mg [Citrus sinensis]
Length=1974

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 116/195 (59%), Gaps = 44/195 (23%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPS              S P  +P     
Sbjct  1810  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPS--------------SVPMATPPPAAL  1855

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
              N +G +  I SK                    VLP E  L   + R E+F  AV+SGTL
Sbjct  1856  DNRIGGA--IASK--------------------VLPPENPL--SDQRNERFGVAVTSGTL  1891

Query  216   DAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGV  46
             DAIRERMKS+QLAAAAGNPD    PL+  N NV++G S+Q  S+   ++     P Q  V
Sbjct  1892  DAIRERMKSMQLAAAAGNPDPGNRPLINMNDNVNNGLSSQSRSSDRASVEN---PAQGSV  1948

Query  45    LPMDEKALSGLQARM  1
             LPMDEKALSGLQARM
Sbjct  1949  LPMDEKALSGLQARM  1963



>gb|KDO77517.1| hypothetical protein CISIN_1g000146mg [Citrus sinensis]
Length=1972

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 115/195 (59%), Gaps = 46/195 (24%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPS              S P  +P     
Sbjct  1810  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPS--------------SVPMATPPPAAL  1855

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
              N +G +  I SK                    VLP E  L   + R E+F   V+SGTL
Sbjct  1856  DNRIGGA--IASK--------------------VLPPENPL--SDQRNERF--GVTSGTL  1889

Query  216   DAIRERMKSIQLAAAAGNPD---LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGV  46
             DAIRERMKS+QLAAAAGNPD    PL+  N NV++G S+Q  S+   ++     P Q  V
Sbjct  1890  DAIRERMKSMQLAAAAGNPDPGNRPLINMNDNVNNGLSSQSRSSDRASVEN---PAQGSV  1946

Query  45    LPMDEKALSGLQARM  1
             LPMDEKALSGLQARM
Sbjct  1947  LPMDEKALSGLQARM  1961



>ref|XP_010518980.1| PREDICTED: protein MOR1 [Tarenaya hassleriana]
Length=1988

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 123/194 (63%), Gaps = 36/194 (19%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP+        
Sbjct  1818  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLTLPSPEIP------  1871

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
                L + K +N K EP NF++P +Y E+     +  S   + PG          V+SGTL
Sbjct  1872  --SLNEVKPLNPKPEPANFTVPPAYTED-----IRASNKRMIPG----------VTSGTL  1914

Query  216   DAIRERMKSIQLAAAAGNPDLPLMARNGNVSH--GRSNQLPSAAEHTISGNPYPQQSGVL  43
             DAIRERMKS+QLAA+ G  +      +G++ H  G  NQ  S  +      P   Q+ VL
Sbjct  1915  DAIRERMKSMQLAASGGTLE------SGSIPHDDGILNQTGSPNQSV----PEAPQT-VL  1963

Query  42    PMDEKALSGLQARM  1
             PMDEKALSGLQARM
Sbjct  1964  PMDEKALSGLQARM  1977



>gb|EPS57221.1| hypothetical protein M569_17599 [Genlisea aurea]
Length=226

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 130/194 (67%), Gaps = 26/194 (13%)
 Frame = -2

Query  576  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
            IFAQLQNAS++FRTYIRDGLAQMEKNAAAGRTPSSVP+STPPP  LNL   K+ P+ PV+
Sbjct  45   IFAQLQNASDSFRTYIRDGLAQMEKNAAAGRTPSSVPLSTPPPPALNLLP-KYGPLSPVS  103

Query  396  TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
                 D+K   ++ +PT+FSLP SY+E   ++   P +    P + + ++FPS VS GTL
Sbjct  104  AT---DTK---NRVDPTSFSLPPSYSENDQHHHHRPLQ---NPEDAQNDRFPS-VSHGTL  153

Query  216  DAIRERMKSIQLAAAAGNPDLPLMAR--NGNVSHGRSNQLPSAAEHTISGNPYPQQSGVL  43
            DAIRERMKS+Q+++AAG        R  NG+           A E + +G       G+L
Sbjct  154  DAIRERMKSMQISSAAGGGGGGSEGRVMNGD----------EAGEQSGTGII---GMGML  200

Query  42   PMDEKALSGLQARM  1
            PMDEKALSGLQARM
Sbjct  201  PMDEKALSGLQARM  214



>emb|CDM84719.1| unnamed protein product [Triticum aestivum]
Length=1991

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 126/196 (64%), Gaps = 35/196 (18%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP   ++ SPKF+P  PV+
Sbjct  1816  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-SIPSPKFAPS-PVH  1873

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T      KSI+SK++           E+    V   S+L LQ  + + + F    SSGTL
Sbjct  1874  T------KSISSKTDCN---------EDGAFRVQGDSDLRLQ-SDQQTDSFQ---SSGTL  1914

Query  216   DAIRERMKSIQLAAAAGNPDL----PLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSG  49
             DA+RERMKSIQ AA  GN D+    PL + NGN  HG +          + G P   QS 
Sbjct  1915  DALRERMKSIQAAAVGGNFDVAQTRPLSSMNGNALHGGAR---------VDGEPQ-TQSN  1964

Query  48    VLPMDEKALSGLQARM  1
             + PMDE+ALSGLQARM
Sbjct  1965  IPPMDERALSGLQARM  1980



>ref|XP_003564477.1| PREDICTED: protein MOR1 [Brachypodium distachyon]
Length=1993

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 123/196 (63%), Gaps = 34/196 (17%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPKF+P  PV+
Sbjct  1817  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-AIPSPKFAPS-PVH  1874

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T      KSINSK++           E+    V   S+  L   + + +++    SSGTL
Sbjct  1875  T------KSINSKTDSN---------EDDPFRVQGDSDFRLPSTDQQTDRYQ---SSGTL  1916

Query  216   DAIRERMKSIQLAAAAGNPD----LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSG  49
             DA+RERMKSIQ AA  GN D     PL + NGN+ HG            + G P   QS 
Sbjct  1917  DALRERMKSIQAAAVGGNFDGAHTRPLASMNGNMLHGGPR---------LDGEPQ-TQSN  1966

Query  48    VLPMDEKALSGLQARM  1
             + PMDE+ALSGLQARM
Sbjct  1967  IPPMDERALSGLQARM  1982



>gb|KFK36460.1| hypothetical protein AALP_AA4G127500 [Arabis alpina]
Length=1978

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 122/195 (63%), Gaps = 42/195 (22%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L+SP    + P++
Sbjct  1811  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLALTSPDIPSLSPLD  1870

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N+KSE        SYA++ R +N                      ++ GT
Sbjct  1871  AKPL-----MNTKSE--------SYADDIRASN----------------------INPGT  1895

Query  219   LDAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGV  46
             LDAIRERM+++QLA++     +  PLM  N N+S  + +  PS  E  I   P+P    V
Sbjct  1896  LDAIRERMRTMQLASSGTLESVSKPLMPTNENISMNQQSIPPSQMEPEIP-QPHPM---V  1951

Query  45    LPMDEKALSGLQARM  1
             LPMDEKALSGLQARM
Sbjct  1952  LPMDEKALSGLQARM  1966



>ref|XP_010645357.1| PREDICTED: protein MOR1-like [Vitis vinifera]
Length=1949

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 95/127 (75%), Gaps = 8/127 (6%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSS+P+STPPP+ L+LSSPKF+P+ P++
Sbjct  1820  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRTPSSLPMSTPPPSSLSLSSPKFAPLSPLH  1879

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPS--------ELHLQPGEHRVEKFP  241
             TN L DSKS+N K+EPTNF+LP SY E+      LPS        E     G+ R E+FP
Sbjct  1880  TNSLNDSKSLNVKAEPTNFNLPPSYGEDDRALNALPSRGLTSDHPEFRQHLGDQRNERFP  1939

Query  240   SAVSSGT  220
             S  + G 
Sbjct  1940  SGGNFGC  1946



>dbj|BAD93861.1| similar to ch-TOG protein from Homo sapiens [Arabidopsis thaliana]
Length=434

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 118/193 (61%), Gaps = 37/193 (19%)
 Frame = -2

Query  576  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
            IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP    +  ++
Sbjct  267  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLALPSPDIPSLSSLD  326

Query  396  TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
              PL     +N +S+       L   + R +N        + PG          V +GTL
Sbjct  327  VKPL-----MNPRSD-------LYTDDIRASN--------MNPG----------VMTGTL  356

Query  216  DAIRERMKSIQLAAAAGNPDLPLMARNGNVSHGRSNQLPS-AAEHTISGNPYPQQSGVLP  40
            DAIRERMK++QLA++      PLM  N N+S  + +  PS   + T+  +P      VLP
Sbjct  357  DAIRERMKNMQLASSEPVSK-PLMPTNDNLSMNQQSVPPSQMGQETVHTHPV-----VLP  410

Query  39   MDEKALSGLQARM  1
            MDEKALSGLQARM
Sbjct  411  MDEKALSGLQARM  423



>ref|XP_006646429.1| PREDICTED: protein MOR1-like [Oryza brachyantha]
Length=2001

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 124/203 (61%), Gaps = 40/203 (20%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPKF+P  PV+
Sbjct  1817  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-PIPSPKFAPS-PVH  1874

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLP------SELHLQPGEHRVEKFPSA  235
             T      KSINSK++           E+       P      ++  LQ  + + +++  +
Sbjct  1875  T------KSINSKTDSN---------EDDAGGDTHPFRGQGETDSRLQTADLQTDRYHQS  1919

Query  234   VSSGTLDAIRERMKSIQLAAAAGNPDL----PLMARNGNVSHGRSNQLPSAAEHTISGNP  67
              S+GTLDA+RERMKSIQ AA   N D+    PL + NGN  HG +             + 
Sbjct  1920  -SAGTLDALRERMKSIQAAAVGANFDVVQTRPLPSMNGNTLHGGTRL-----------DA  1967

Query  66    YPQQSGVL-PMDEKALSGLQARM  1
              PQ   ++ PMDE+ALSGLQARM
Sbjct  1968  DPQTQNIIPPMDERALSGLQARM  1990



>tpg|DAA57118.1| TPA: hypothetical protein ZEAMMB73_106408 [Zea mays]
Length=1293

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 124/197 (63%), Gaps = 35/197 (18%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPK +P  PV+
Sbjct  1116  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-AIPSPKLAPS-PVH  1173

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T      KSI SK++         Y E+  +    P        + + +++ +  S+GTL
Sbjct  1174  T------KSIGSKTD---------YNEDNASGETQPFRGQGDATDQQTDRYQT--SAGTL  1216

Query  216   DAIRERMKSIQLAAAAGNPD----LPLMARNG-NVSHGRSNQLPSAAEHTISGNPYPQQS  52
             DA+RERMKSIQ AAA G+ D     PL + NG N+ HG +          + G P  QQS
Sbjct  1217  DALRERMKSIQ-AAAIGHFDGAQARPLASMNGSNMLHGGTR---------LDGEP-QQQS  1265

Query  51    GVLPMDEKALSGLQARM  1
              + PMDE+ALSGLQARM
Sbjct  1266  NIPPMDERALSGLQARM  1282



>ref|XP_008673322.1| PREDICTED: uncharacterized protein LOC100501495 isoform X1 [Zea 
mays]
Length=2051

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 123/197 (62%), Gaps = 36/197 (18%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPK +P  PV+
Sbjct  1875  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-AIPSPKLAPS-PVH  1932

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T      KSI SK++         Y E+  +    P        + + +++    +SGTL
Sbjct  1933  T------KSIGSKTD---------YNEDNASGETQPFRGQGDATDQQTDRYQ---TSGTL  1974

Query  216   DAIRERMKSIQLAAAAGNPD----LPLMARNG-NVSHGRSNQLPSAAEHTISGNPYPQQS  52
             DA+RERMKSIQ AAA G+ D     PL + NG N+ HG +          + G P  QQS
Sbjct  1975  DALRERMKSIQ-AAAIGHFDGAQARPLASMNGSNMLHGGTR---------LDGEP-QQQS  2023

Query  51    GVLPMDEKALSGLQARM  1
              + PMDE+ALSGLQARM
Sbjct  2024  NIPPMDERALSGLQARM  2040



>tpg|DAA57119.1| TPA: hypothetical protein ZEAMMB73_106408 [Zea mays]
Length=1292

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 123/197 (62%), Gaps = 36/197 (18%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPK +P  PV+
Sbjct  1116  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-AIPSPKLAPS-PVH  1173

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T      KSI SK++         Y E+  +    P        + + +++    +SGTL
Sbjct  1174  T------KSIGSKTD---------YNEDNASGETQPFRGQGDATDQQTDRYQ---TSGTL  1215

Query  216   DAIRERMKSIQLAAAAGNPD----LPLMARNG-NVSHGRSNQLPSAAEHTISGNPYPQQS  52
             DA+RERMKSIQ AAA G+ D     PL + NG N+ HG +          + G P  QQS
Sbjct  1216  DALRERMKSIQ-AAAIGHFDGAQARPLASMNGSNMLHGGTR---------LDGEP-QQQS  1264

Query  51    GVLPMDEKALSGLQARM  1
              + PMDE+ALSGLQARM
Sbjct  1265  NIPPMDERALSGLQARM  1281



>ref|XP_004970364.1| PREDICTED: protein MOR1-like isoform X1 [Setaria italica]
Length=2029

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 123/196 (63%), Gaps = 29/196 (15%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPKF+P  PV+
Sbjct  1848  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-AIPSPKFAPS-PVH  1905

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T      KSI+ K+E          A           +  L   + + +++ +  S+GTL
Sbjct  1906  T------KSISGKTESNE-----DDASAEAQQAFRGDDSRLHSMDQQTDRYQT--SAGTL  1952

Query  216   DAIRERMKSIQLAAAAGNPD----LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSG  49
             DA+RERMKSIQ AAA G+ D     PL + NG      SN L +  +  + G P  QQS 
Sbjct  1953  DALRERMKSIQ-AAAVGHFDGSQARPLASMNG------SNMLHAGTQ--LDGEPQ-QQSN  2002

Query  48    VLPMDEKALSGLQARM  1
             + PMDE+ALSGLQARM
Sbjct  2003  IPPMDERALSGLQARM  2018



>ref|XP_004970366.1| PREDICTED: protein MOR1-like isoform X3 [Setaria italica]
Length=2001

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 123/196 (63%), Gaps = 29/196 (15%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPKF+P  PV+
Sbjct  1820  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-AIPSPKFAPS-PVH  1877

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T      KSI+ K+E          A           +  L   + + +++ +  S+GTL
Sbjct  1878  T------KSISGKTESNE-----DDASAEAQQAFRGDDSRLHSMDQQTDRYQT--SAGTL  1924

Query  216   DAIRERMKSIQLAAAAGNPD----LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSG  49
             DA+RERMKSIQ AAA G+ D     PL + NG      SN L +  +  + G P  QQS 
Sbjct  1925  DALRERMKSIQ-AAAVGHFDGSQARPLASMNG------SNMLHAGTQ--LDGEPQ-QQSN  1974

Query  48    VLPMDEKALSGLQARM  1
             + PMDE+ALSGLQARM
Sbjct  1975  IPPMDERALSGLQARM  1990



>ref|NP_001146767.1| uncharacterized protein LOC100280369 [Zea mays]
 gb|ACL54707.1| unknown [Zea mays]
Length=467

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 119/197 (60%), Gaps = 37/197 (19%)
 Frame = -2

Query  576  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
            IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGR PSS+P+STPPP    + +PKF+P  PV+
Sbjct  292  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRMPSSLPLSTPPPIA-AIPNPKFAPS-PVH  349

Query  396  TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
            T  +G +                 Y E+  +    P        + + +++    +SGTL
Sbjct  350  TKSIGKT----------------DYNEDNASGETQPFRGQGAITDQQTDRYH---TSGTL  390

Query  216  DAIRERMKSIQLAAAAGNPD----LPLMARNG-NVSHGRSNQLPSAAEHTISGNPYPQQS  52
            DA+RERMKSIQ AAA G+ D     PL + NG N+ HG +          + G P  Q+S
Sbjct  391  DALRERMKSIQ-AAAIGHFDGAQARPLASMNGSNMVHGGTR---------LDGEPQ-QRS  439

Query  51   GVLPMDEKALSGLQARM  1
             + PMDE+ALSGLQARM
Sbjct  440  NIPPMDERALSGLQARM  456



>ref|NP_001044618.1| Os01g0816400 [Oryza sativa Japonica Group]
 sp|Q5N749.1|MOR1_ORYSJ RecName: Full=Protein MOR1; AltName: Full=Protein GEM1; AltName: 
Full=Protein MICROTUBULE ORGANIZATION 1 [Oryza sativa Japonica 
Group]
 dbj|BAD82707.1| putative microtubule bundling polypeptide TMBP200 [Oryza sativa 
Japonica Group]
 dbj|BAD82281.1| putative microtubule bundling polypeptide TMBP200 [Oryza sativa 
Japonica Group]
 dbj|BAF06532.1| Os01g0816400 [Oryza sativa Japonica Group]
 gb|EEE55578.1| hypothetical protein OsJ_03864 [Oryza sativa Japonica Group]
Length=1997

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 120/202 (59%), Gaps = 40/202 (20%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPKF+P  PV+
Sbjct  1815  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-PIPSPKFAPS-PVH  1872

Query  396   TNPLGDSKSINSKSEPTN-----FSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAV  232
             T      KSIN+K++         + P     E  N         LQ    + +++    
Sbjct  1873  T------KSINNKTDCNEDDAGGDTHPFRGQGEIDN--------RLQTTNLQTDRYQ---  1915

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD----LPLMARNGNVSHGRSNQLPSAAEHTISGNPY  64
             SSGTLDA+RERMKSIQ AA   N D     PL + NGN  HG +             +  
Sbjct  1916  SSGTLDALRERMKSIQAAAVGANFDGVQARPLPSMNGNTLHGGTRL-----------DAD  1964

Query  63    PQQSGVL-PMDEKALSGLQARM  1
             PQ   ++ PMDE+ALSGLQARM
Sbjct  1965  PQTQNIIPPMDERALSGLQARM  1986



>ref|XP_004970365.1| PREDICTED: protein MOR1-like isoform X2 [Setaria italica]
Length=2028

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 122/196 (62%), Gaps = 30/196 (15%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPKF+P  PV+
Sbjct  1848  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-AIPSPKFAPS-PVH  1905

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T      KSI+ K+E          A           +  L   + + +++    +SGTL
Sbjct  1906  T------KSISGKTESNE-----DDASAEAQQAFRGDDSRLHSMDQQTDRYQ---TSGTL  1951

Query  216   DAIRERMKSIQLAAAAGNPD----LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSG  49
             DA+RERMKSIQ AAA G+ D     PL + NG      SN L +  +  + G P  QQS 
Sbjct  1952  DALRERMKSIQ-AAAVGHFDGSQARPLASMNG------SNMLHAGTQ--LDGEPQ-QQSN  2001

Query  48    VLPMDEKALSGLQARM  1
             + PMDE+ALSGLQARM
Sbjct  2002  IPPMDERALSGLQARM  2017



>gb|EEC71701.1| hypothetical protein OsI_04204 [Oryza sativa Indica Group]
Length=1941

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 120/202 (59%), Gaps = 40/202 (20%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPKF+P  PV+
Sbjct  1759  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-PIPSPKFAPS-PVH  1816

Query  396   TNPLGDSKSINSKSEPTN-----FSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAV  232
             T      KSIN+K++         + P     E  N         LQ    + +++    
Sbjct  1817  T------KSINNKTDCNEDDAGGDTHPFRGQGEIDN--------RLQTTNLQTDRYQ---  1859

Query  231   SSGTLDAIRERMKSIQLAAAAGNPD----LPLMARNGNVSHGRSNQLPSAAEHTISGNPY  64
             SSGTLDA+RERMKSIQ AA   N D     PL + NGN  HG +             +  
Sbjct  1860  SSGTLDALRERMKSIQAAAVGANFDGVQARPLPSMNGNTLHGGTRL-----------DAD  1908

Query  63    PQQSGVL-PMDEKALSGLQARM  1
             PQ   ++ PMDE+ALSGLQARM
Sbjct  1909  PQTQNIIPPMDERALSGLQARM  1930



>ref|XP_004970367.1| PREDICTED: protein MOR1-like isoform X4 [Setaria italica]
Length=2000

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 122/196 (62%), Gaps = 30/196 (15%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP    + SPKF+P  PV+
Sbjct  1820  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-AIPSPKFAPS-PVH  1877

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T      KSI+ K+E          A           +  L   + + +++    +SGTL
Sbjct  1878  T------KSISGKTESNE-----DDASAEAQQAFRGDDSRLHSMDQQTDRYQ---TSGTL  1923

Query  216   DAIRERMKSIQLAAAAGNPD----LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSG  49
             DA+RERMKSIQ AAA G+ D     PL + NG      SN L +  +  + G P  QQS 
Sbjct  1924  DALRERMKSIQ-AAAVGHFDGSQARPLASMNG------SNMLHAGTQ--LDGEPQ-QQSN  1973

Query  48    VLPMDEKALSGLQARM  1
             + PMDE+ALSGLQARM
Sbjct  1974  IPPMDERALSGLQARM  1989



>ref|NP_565811.2| protein MICROTUBULE ORGANIZATION 1 [Arabidopsis thaliana]
 sp|Q94FN2.1|MOR1_ARATH RecName: Full=Protein MOR1; AltName: Full=Protein GEM1; AltName: 
Full=Protein GEMINI POLLEN 1; AltName: Full=Protein MICROTUBULE 
ORGANIZATION 1; AltName: Full=Protein RID5; AltName: 
Full=Protein ROOT INITIATION DEFECTIVE 5 [Arabidopsis thaliana]
 gb|AAK59871.1|AF367246_1 microtubule organization 1 protein [Arabidopsis thaliana]
 gb|AAM94170.1| MOR1/GEM1 [Arabidopsis thaliana]
 gb|AEC09133.1| microtubule organization 1 protein [Arabidopsis thaliana]
Length=1978

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 118/193 (61%), Gaps = 37/193 (19%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP    +  ++
Sbjct  1811  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLALPSPDIPSLSSLD  1870

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
               PL     +N +S+       L   + R +N        + PG          V +GTL
Sbjct  1871  VKPL-----MNPRSD-------LYTDDIRASN--------MNPG----------VMTGTL  1900

Query  216   DAIRERMKSIQLAAAAGNPDLPLMARNGNVSHGRSNQLPS-AAEHTISGNPYPQQSGVLP  40
             DAIRERMK++QLA++      PLM  N N+S  + +  PS   + T+  +P      VLP
Sbjct  1901  DAIRERMKNMQLASSEPVSK-PLMPTNDNLSMNQQSVPPSQMGQETVHTHPV-----VLP  1954

Query  39    MDEKALSGLQARM  1
             MDEKALSGLQARM
Sbjct  1955  MDEKALSGLQARM  1967



>gb|AAD15450.2| similar to ch-TOG protein from Homo sapiens [Arabidopsis thaliana]
Length=1611

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 118/193 (61%), Gaps = 37/193 (19%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP    +  ++
Sbjct  1444  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLALPSPDIPSLSSLD  1503

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
               PL     +N +S+       L   + R +N        + PG          V +GTL
Sbjct  1504  VKPL-----MNPRSD-------LYTDDIRASN--------MNPG----------VMTGTL  1533

Query  216   DAIRERMKSIQLAAAAGNPDLPLMARNGNVSHGRSNQLPS-AAEHTISGNPYPQQSGVLP  40
             DAIRERMK++QLA++      PLM  N N+S  + +  PS   + T+  +P      VLP
Sbjct  1534  DAIRERMKNMQLASSEPVSK-PLMPTNDNLSMNQQSVPPSQMGQETVHTHPV-----VLP  1587

Query  39    MDEKALSGLQARM  1
             MDEKALSGLQARM
Sbjct  1588  MDEKALSGLQARM  1600



>gb|AFW84772.1| hypothetical protein ZEAMMB73_280693 [Zea mays]
Length=1996

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 120/197 (61%), Gaps = 36/197 (18%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGR PSS+P+STPPP    + +PKF+P  PV+
Sbjct  1820  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRMPSSLPLSTPPPIA-AIPNPKFAPS-PVH  1877

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T  +G +                 Y E+  +    P        + + +++ +  S+GTL
Sbjct  1878  TKSIGKT----------------DYNEDNASGETQPFRGQGAITDQQTDRYHT--SAGTL  1919

Query  216   DAIRERMKSIQLAAAAGNPD----LPLMARNG-NVSHGRSNQLPSAAEHTISGNPYPQQS  52
             DA+RERMKSIQ AAA G+ D     PL + NG N+ HG +          + G P  Q+S
Sbjct  1920  DALRERMKSIQ-AAAIGHFDGAQARPLASMNGSNMVHGGTR---------LDGEPQ-QRS  1968

Query  51    GVLPMDEKALSGLQARM  1
              + PMDE+ALSGLQARM
Sbjct  1969  NIPPMDERALSGLQARM  1985



>ref|XP_010516754.1| PREDICTED: protein MOR1 isoform X4 [Camelina sativa]
 ref|XP_010516755.1| PREDICTED: protein MOR1 isoform X5 [Camelina sativa]
Length=1981

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 118/195 (61%), Gaps = 38/195 (19%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAA GRTPSS+P+STPPP+ L L SP    +  ++
Sbjct  1811  IFSQLQNASEAFRTYIRDGLAQVEKNAALGRTPSSLPLSTPPPSSLALPSPDIPSLSSLD  1870

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N KSE        SY ++ R NN        + PG          V +GT
Sbjct  1871  VKPL-----MNPKSE--------SYTDDIRANN--------MNPG----------VMTGT  1899

Query  219   LDAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGV  46
             LDAIRERMK++QLA++     +  PLM  N N+S      +P +     S + +P    V
Sbjct  1900  LDAIRERMKNMQLASSGTLESVSKPLMPTNENLSMNHQT-IPQSQMGPESPHSHPV---V  1955

Query  45    LPMDEKALSGLQARM  1
             LPMDEKALSGLQARM
Sbjct  1956  LPMDEKALSGLQARM  1970



>ref|XP_010516750.1| PREDICTED: protein MOR1 isoform X1 [Camelina sativa]
 ref|XP_010516751.1| PREDICTED: protein MOR1 isoform X2 [Camelina sativa]
Length=1985

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 118/195 (61%), Gaps = 38/195 (19%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAA GRTPSS+P+STPPP+ L L SP    +  ++
Sbjct  1815  IFSQLQNASEAFRTYIRDGLAQVEKNAALGRTPSSLPLSTPPPSSLALPSPDIPSLSSLD  1874

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N KSE        SY ++ R NN        + PG          V +GT
Sbjct  1875  VKPL-----MNPKSE--------SYTDDIRANN--------MNPG----------VMTGT  1903

Query  219   LDAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGV  46
             LDAIRERMK++QLA++     +  PLM  N N+S      +P +     S + +P    V
Sbjct  1904  LDAIRERMKNMQLASSGTLESVSKPLMPTNENLSMNHQT-IPQSQMGPESPHSHPV---V  1959

Query  45    LPMDEKALSGLQARM  1
             LPMDEKALSGLQARM
Sbjct  1960  LPMDEKALSGLQARM  1974



>ref|XP_010516753.1| PREDICTED: protein MOR1 isoform X3 [Camelina sativa]
Length=1983

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 118/195 (61%), Gaps = 38/195 (19%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAA GRTPSS+P+STPPP+ L L SP    +  ++
Sbjct  1813  IFSQLQNASEAFRTYIRDGLAQVEKNAALGRTPSSLPLSTPPPSSLALPSPDIPSLSSLD  1872

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N KSE        SY ++ R NN        + PG          V +GT
Sbjct  1873  VKPL-----MNPKSE--------SYTDDIRANN--------MNPG----------VMTGT  1901

Query  219   LDAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGV  46
             LDAIRERMK++QLA++     +  PLM  N N+S      +P +     S + +P    V
Sbjct  1902  LDAIRERMKNMQLASSGTLESVSKPLMPTNENLSMNHQT-IPQSQMGPESPHSHPV---V  1957

Query  45    LPMDEKALSGLQARM  1
             LPMDEKALSGLQARM
Sbjct  1958  LPMDEKALSGLQARM  1972



>gb|AFW84774.1| hypothetical protein ZEAMMB73_280693 [Zea mays]
Length=1104

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 120/199 (60%), Gaps = 41/199 (21%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGR PSS+P+STPPP    + +PKF+P  PV+
Sbjct  929   IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRMPSSLPLSTPPPIA-AIPNPKFAPS-PVH  986

Query  396   TNPLG--DSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSG  223
             T  +G  D    N+  E   F    +  +++T+        H               +SG
Sbjct  987   TKSIGKTDYNEDNASGETQPFRGQGAITDQQTDRY------H---------------TSG  1025

Query  222   TLDAIRERMKSIQLAAAAGNPD----LPLMARNG-NVSHGRSNQLPSAAEHTISGNPYPQ  58
             TLDA+RERMKSIQ AAA G+ D     PL + NG N+ HG +          + G P  Q
Sbjct  1026  TLDALRERMKSIQ-AAAIGHFDGAQARPLASMNGSNMVHGGTR---------LDGEP-QQ  1074

Query  57    QSGVLPMDEKALSGLQARM  1
             +S + PMDE+ALSGLQARM
Sbjct  1075  RSNIPPMDERALSGLQARM  1093



>ref|XP_006842655.1| hypothetical protein AMTR_s00077p00193670 [Amborella trichopoda]
 gb|ERN04330.1| hypothetical protein AMTR_s00077p00193670 [Amborella trichopoda]
Length=2014

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 120/210 (57%), Gaps = 46/210 (22%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQME+N AAGRTPSSVP+STPPP  +NLSSPK +P+ PV+
Sbjct  1822  IFAQLQNASEAFRTYIRDGLAQMERNTAAGRTPSSVPMSTPPPVAMNLSSPKLAPMSPVH  1881

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPS-------------ELHLQ---PG  265
             T       ++    E TN SL +    E  +   +PS             EL  Q   P 
Sbjct  1882  TK---QQHNVIKHHELTNNSLGV----ELDDAATMPSGDVSPKRLMNAFPELRKQLPIPR  1934

Query  264   EHRVEK--FPSAVSSGTLDAIRERMKSIQLAAAAGNPDLPLMARNGNVSHGRSNQLPSAA  91
             E   EK  F +A  SGTLDAIRERMKS+Q AAAAGN         G   +     +P   
Sbjct  1935  EDHDEKYAFAAAPISGTLDAIRERMKSMQAAAAAGN------TEGGGGGNVEVTMMP---  1985

Query  90    EHTISGNPYPQQSGVLPMDEKALSGLQARM  1
                           VLPMDEKALSGLQARM
Sbjct  1986  ------------PNVLPMDEKALSGLQARM  2003



>ref|XP_010505079.1| PREDICTED: protein MOR1-like isoform X2 [Camelina sativa]
Length=705

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 116/194 (60%), Gaps = 36/194 (19%)
 Frame = -2

Query  576  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
            IF+QLQNASEAFRTYIRDGLAQ+EKNAA GRTPSS+P+STPPP+ L L SP    +  ++
Sbjct  535  IFSQLQNASEAFRTYIRDGLAQVEKNAALGRTPSSLPLSTPPPSSLALPSPDIPSLSSLD  594

Query  396  TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
              PL     +N KSE        SY    T+++             R     + V +GTL
Sbjct  595  VKPL-----MNPKSE--------SY----TDDI-------------RASNMNTGVMTGTL  624

Query  216  DAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGVL  43
            DAIRERMK++QLA++     +  PLM  N N+S      +P +     S + +P    VL
Sbjct  625  DAIRERMKNMQLASSGTLEPVSKPLMPTNENLSMNHQT-IPQSQMGPESPHSHPV---VL  680

Query  42   PMDEKALSGLQARM  1
            PMDEKALSGLQARM
Sbjct  681  PMDEKALSGLQARM  694



>ref|XP_010505078.1| PREDICTED: protein MOR1-like isoform X1 [Camelina sativa]
Length=709

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 116/194 (60%), Gaps = 36/194 (19%)
 Frame = -2

Query  576  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
            IF+QLQNASEAFRTYIRDGLAQ+EKNAA GRTPSS+P+STPPP+ L L SP    +  ++
Sbjct  539  IFSQLQNASEAFRTYIRDGLAQVEKNAALGRTPSSLPLSTPPPSSLALPSPDIPSLSSLD  598

Query  396  TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
              PL     +N KSE        SY    T+++             R     + V +GTL
Sbjct  599  VKPL-----MNPKSE--------SY----TDDI-------------RASNMNTGVMTGTL  628

Query  216  DAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGVL  43
            DAIRERMK++QLA++     +  PLM  N N+S      +P +     S + +P    VL
Sbjct  629  DAIRERMKNMQLASSGTLEPVSKPLMPTNENLSMNHQT-IPQSQMGPESPHSHPV---VL  684

Query  42   PMDEKALSGLQARM  1
            PMDEKALSGLQARM
Sbjct  685  PMDEKALSGLQARM  698



>ref|XP_006296349.1| hypothetical protein CARUB_v10025521mg [Capsella rubella]
 gb|EOA29247.1| hypothetical protein CARUB_v10025521mg [Capsella rubella]
Length=1981

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 118/197 (60%), Gaps = 42/197 (21%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP    +  ++
Sbjct  1811  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLALPSPDIPSLSSLD  1870

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N KS+        S+ ++ R +N        + PG          V +GT
Sbjct  1871  VKPL-----MNHKSD--------SFTDDIRASN--------MNPG----------VMTGT  1899

Query  219   LDAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGRSNQLPSAAEHTISGNPYP--QQS  52
             LDAIRERMK++QLA++     +  PLM  N N+S  + +       HT    P    Q  
Sbjct  1900  LDAIRERMKNMQLASSGTLEPVSKPLMPTNDNLSINQQSI------HTSQMGPESPHQHP  1953

Query  51    GVLPMDEKALSGLQARM  1
              VLPMDEKALSGLQARM
Sbjct  1954  VVLPMDEKALSGLQARM  1970



>emb|CDY31709.1| BnaA05g08380D [Brassica napus]
Length=1995

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 115/195 (59%), Gaps = 42/195 (22%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP       ++
Sbjct  1829  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLALPSPDIP---SLD  1885

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N KS+        SY +E R +N                      ++ GT
Sbjct  1886  VKPL-----MNPKSD--------SYTDEIRGSN----------------------INPGT  1910

Query  219   LDAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGV  46
             LDAIRERM+++QLA +     +  PLM  N N        +P +     + +P+PQQ  V
Sbjct  1911  LDAIRERMRTMQLAISGSLESVSKPLMPTNDNNIPVDEQNIPPSQMGEETPHPHPQQV-V  1969

Query  45    LPMDEKALSGLQARM  1
             LPMDEKALSGLQARM
Sbjct  1970  LPMDEKALSGLQARM  1984



>gb|EMT05314.1| Cytoskeleton-associated protein 5 [Aegilops tauschii]
Length=1975

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 107/157 (68%), Gaps = 24/157 (15%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IFAQLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP   ++ SPKF+P  PV+
Sbjct  1784  IFAQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPIA-SIPSPKFAPS-PVH  1841

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
             T      KSI+SK++           E+    V   S+L LQ  + + ++F S  S+GTL
Sbjct  1842  T------KSISSKTDCN---------EDDAFRVQGDSDLRLQ-SDQQTDRFQS--SAGTL  1883

Query  216   DAIRERMKSIQLAAAAGNPDL----PLMARNGNVSHG  118
             DA+RERMKSIQ AA  GN D+    PL + NGN  HG
Sbjct  1884  DALRERMKSIQAAAVGGNFDVAQTRPLSSMNGNALHG  1920



>ref|XP_002879562.1| hypothetical protein ARALYDRAFT_482523 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55821.1| hypothetical protein ARALYDRAFT_482523 [Arabidopsis lyrata subsp. 
lyrata]
Length=1980

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 118/198 (60%), Gaps = 44/198 (22%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP    +  ++
Sbjct  1810  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLALPSPDIPSLSSLD  1869

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
               PL     +N +S+       L   + R +N        + PG          V +GTL
Sbjct  1870  AKPL-----MNPRSD-------LYTDDIRASN--------MNPG----------VMTGTL  1899

Query  216   DAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGR----SNQLPSAAEHTISGNPYPQQ  55
             DAIRERMK++QLA++     +  PLM  N N+S  +     +Q+     HT   +P    
Sbjct  1900  DAIRERMKNMQLASSGTLEPVSKPLMPTNDNLSMNQQSVPQSQMGQETPHT---HPV---  1953

Query  54    SGVLPMDEKALSGLQARM  1
               VLPMDEKALSGLQARM
Sbjct  1954  --VLPMDEKALSGLQARM  1969



>emb|CDX84183.1| BnaC04g09450D [Brassica napus]
Length=1988

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 112/195 (57%), Gaps = 42/195 (22%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+     S     +  ++
Sbjct  1822  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSS---LSLPSPDIPSLD  1878

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N KS+        SY +E R +N                      ++ GT
Sbjct  1879  VKPL-----MNPKSD--------SYTDEIRGSN----------------------INPGT  1903

Query  219   LDAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGV  46
             LDAIRERM+++QLA +     +  PLM  N N        +P       + +P+PQQ  V
Sbjct  1904  LDAIRERMRTMQLATSGSLESVSKPLMPTNDNNIPMDEQNIPPRQMGEETPHPHPQQV-V  1962

Query  45    LPMDEKALSGLQARM  1
             LPMDEKALSGLQARM
Sbjct  1963  LPMDEKALSGLQARM  1977



>ref|XP_009143640.1| PREDICTED: protein MOR1-like isoform X1 [Brassica rapa]
Length=1981

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 112/198 (57%), Gaps = 44/198 (22%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP       ++
Sbjct  1811  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLALPSPDIP---SLD  1867

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N KS+        SY +E R +N                      ++ GT
Sbjct  1868  VKPL-----MNPKSD--------SYTDEIRGSN----------------------INPGT  1892

Query  219   LDAIRERMKSIQLAAAAGNPDL--PLMARNG-NVSHGRSNQLPS--AAEHTISGNPYPQQ  55
             LDAIRERM+++QLA +     +  PLM  N  N+     N  PS    E   +      Q
Sbjct  1893  LDAIRERMRTMQLATSGSLESVSKPLMPTNDNNIPVDEQNIPPSQMGEEAPHAHPHPHPQ  1952

Query  54    SGVLPMDEKALSGLQARM  1
               VLPMDEKALSGLQARM
Sbjct  1953  QVVLPMDEKALSGLQARM  1970



>ref|XP_009143641.1| PREDICTED: protein MOR1-like isoform X2 [Brassica rapa]
Length=1979

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 112/198 (57%), Gaps = 44/198 (22%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP       ++
Sbjct  1809  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLALPSPDIP---SLD  1865

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N KS+        SY +E R +N                      ++ GT
Sbjct  1866  VKPL-----MNPKSD--------SYTDEIRGSN----------------------INPGT  1890

Query  219   LDAIRERMKSIQLAAAAGNPDL--PLMARNG-NVSHGRSNQLPS--AAEHTISGNPYPQQ  55
             LDAIRERM+++QLA +     +  PLM  N  N+     N  PS    E   +      Q
Sbjct  1891  LDAIRERMRTMQLATSGSLESVSKPLMPTNDNNIPVDEQNIPPSQMGEEAPHAHPHPHPQ  1950

Query  54    SGVLPMDEKALSGLQARM  1
               VLPMDEKALSGLQARM
Sbjct  1951  QVVLPMDEKALSGLQARM  1968



>ref|XP_006410727.1| hypothetical protein EUTSA_v10016124mg [Eutrema salsugineum]
 gb|ESQ52180.1| hypothetical protein EUTSA_v10016124mg [Eutrema salsugineum]
Length=1979

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 115/202 (57%), Gaps = 55/202 (27%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP       ++
Sbjct  1812  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLALPSPDIP---SLD  1868

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N KS+        SY ++ R +N                      ++ GT
Sbjct  1869  AKPL-----MNPKSD--------SYTDDLRASN----------------------INPGT  1893

Query  219   LDAIRERMKSIQLAAAAGNPDL--PLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSG-  49
             LDAIRERM+++QLA++     +  PLM  N N+S      +    + T+     P Q G 
Sbjct  1894  LDAIRERMRTMQLASSGTLEPVSKPLMQTNENISM---ENISMNQQQTVP----PSQMGP  1946

Query  48    ------VLPMDEKALSGLQARM  1
                   VLPMDEKALSGLQARM
Sbjct  1947  ETPHPVVLPMDEKALSGLQARM  1968



>ref|XP_009133029.1| PREDICTED: LOW QUALITY PROTEIN: protein MOR1 [Brassica rapa]
Length=1971

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 116/199 (58%), Gaps = 51/199 (26%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP       ++
Sbjct  1806  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLTLPSPDIP---SLD  1862

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N +S+        SY ++ R +N                      ++ GT
Sbjct  1863  VKPL-----MNPRSD--------SYTDDIRASN----------------------INPGT  1887

Query  219   LDAIRERMKSIQLAAAAGNPDLPLMARNGNVSHGRSNQLPSAAEHTI------SGNPYPQ  58
             LDAIRERM+++QLA+   +    +M  N N+S   ++ +P   +  I      +  P+P 
Sbjct  1888  LDAIRERMRTMQLASEPVSK--AMMPTNENLS---TDNIPPMNQQNIPPSQMEAETPHPH  1942

Query  57    QSGVLPMDEKALSGLQARM  1
               G LPMDEKALSGLQARM
Sbjct  1943  PVG-LPMDEKALSGLQARM  1960



>emb|CDX79612.1| BnaC03g19480D [Brassica napus]
Length=1524

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 115/199 (58%), Gaps = 51/199 (26%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIRDGLAQ+EKNAAAGRTPSS+P+STPPP+ L L SP       ++
Sbjct  1359  IFSQLQNASEAFRTYIRDGLAQVEKNAAAGRTPSSLPLSTPPPSSLTLPSPDIP---SLD  1415

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEE-RTNNVVLPSELHLQPGEHRVEKFPSAVSSGT  220
               PL     +N +S+        SY ++ R +N                      ++ GT
Sbjct  1416  VKPL-----MNPRSD--------SYTDDIRASN----------------------INPGT  1440

Query  219   LDAIRERMKSIQLAAAAGNPDLPLMARNGNVSHGRSNQLPSAAEHTI------SGNPYPQ  58
             LDAIRERM+++QLA+   +    +M  N N+S   ++ +P   +  I      +  P+P 
Sbjct  1441  LDAIRERMRTMQLASEPVSK--AMMPTNENLS---TDNIPPMNQQNIPSSQMEAETPHPH  1495

Query  57    QSGVLPMDEKALSGLQARM  1
               G  PMDEKALSGLQARM
Sbjct  1496  PVG-RPMDEKALSGLQARM  1513



>ref|XP_002983313.1| hypothetical protein SELMODRAFT_234185 [Selaginella moellendorffii]
 gb|EFJ15655.1| hypothetical protein SELMODRAFT_234185 [Selaginella moellendorffii]
Length=1992

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 79/209 (38%), Positives = 104/209 (50%), Gaps = 39/209 (19%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIR+GLAQMEK+ AAGR P+S+ + TPPPA     S     V    
Sbjct  1792  IFSQLQNASEAFRTYIRNGLAQMEKSVAAGRAPTSIAMVTPPPASPPSHSSPKMEVEAPA  1851

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
              +   + K +   + P ++  PL   +             +QP         S  SSGTL
Sbjct  1852  ESDTAELKKMVFINTPKSYESPLPSGD-------------VQP--------VSTPSSGTL  1890

Query  216   DAIRERMKSIQL---------------AAAAGNPD--LPLMARNGNVSHGRSNQLPSAAE  88
             DAIRERM+SIQ                AAA   P+   P  +R G  S    +Q     +
Sbjct  1891  DAIRERMRSIQAAATAAVGAGSIPSPTAAAITIPNGSSPSFSR-GYGSEVVVSQQQQQQQ  1949

Query  87    HTISGNPYPQQSGVLPMDEKALSGLQARM  1
             H ++       + V+ +D+ ALSGLQARM
Sbjct  1950  HEVAAESGEVSTAVVAVDDSALSGLQARM  1978



>ref|XP_002987634.1| hypothetical protein SELMODRAFT_269295 [Selaginella moellendorffii]
 gb|EFJ11209.1| hypothetical protein SELMODRAFT_269295 [Selaginella moellendorffii]
Length=1978

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 107/208 (51%), Gaps = 37/208 (18%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYIR+GLAQMEK+ AAGR P+S+ + TPPPA     S     V    
Sbjct  1780  IFSQLQNASEAFRTYIRNGLAQMEKSVAAGRAPTSIAMVTPPPASPPSHSSPKMEVEAPA  1839

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
              +   + K +   + P ++  PL   +             +QP         S  SSGTL
Sbjct  1840  ESDTAELKKMVFINTPKSYESPLPSGD-------------IQP--------VSTPSSGTL  1878

Query  216   DAIRERMKSIQ--LAAAAGNPDLP------LMARNG---NVSHGRSNQL-----PSAAEH  85
             DAIRERM+SIQ    AA G   +P      +   NG   + S G S+++         +H
Sbjct  1879  DAIRERMRSIQAAATAAVGAGSIPSPTAAAITISNGSSPSFSRGYSSEVLVSQQQQQQQH  1938

Query  84    TISGNPYPQQSGVLPMDEKALSGLQARM  1
              ++       + V+ +D+ ALSGLQARM
Sbjct  1939  EVAAESGEVSTAVVAVDDSALSGLQARM  1966



>ref|XP_001764142.1| predicted protein [Physcomitrella patens]
 gb|EDQ70983.1| predicted protein [Physcomitrella patens]
Length=1974

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 100/192 (52%), Gaps = 34/192 (18%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
             IF+QLQNASEAFRTYI DG+AQME+NAAAGR   S+P        +    P  SP    N
Sbjct  1806  IFSQLQNASEAFRTYISDGIAQMERNAAAGRAFGSMP--------IATPPPVSSPTVQHN  1857

Query  396   TNPLGDSKSINSKSEPTNFSLPLSYAEERTNNVVLPSELHLQPGEHRVEKFPSAVSSGTL  217
              +    S +++   + +N     + + E T  + L S        H V   P+A   GTL
Sbjct  1858  KSS-ASSHALHPYEDNSNTGYTDAKSTEYTEALPLKS-----SAGHNV--MPTA-QGGTL  1908

Query  216   DAIRERMKSIQLAAAAGNPDLPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSGVLPM  37
             DAIRERMKSIQ A AAG      +  + N S   SN   S +  + SG           +
Sbjct  1909  DAIRERMKSIQ-AGAAGTT----VTHSTNFS---SNGSVSLSRTSSSGE---------IV  1951

Query  36    DEKALSGLQARM  1
             +++ALSGLQARM
Sbjct  1952  EDRALSGLQARM  1963



>ref|XP_006857815.1| hypothetical protein AMTR_s00069p00019330 [Amborella trichopoda]
 gb|ERN19282.1| hypothetical protein AMTR_s00069p00019330 [Amborella trichopoda]
Length=107

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 61/90 (68%), Gaps = 3/90 (3%)
 Frame = -2

Query  576  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAVLNLSSPKFSPVFPVN  397
            IF QLQN SEAFRTYIR+GLAQM +N AAGRTPSS+ +STP P  +NLSSPK +P+ PV+
Sbjct  14   IFLQLQNVSEAFRTYIRNGLAQMGRNTAAGRTPSSMRMSTPLPVAINLSSPKLAPMSPVH  73

Query  396  TNPLGDSKSINSKSEPTNFSLPLSYAEERT  307
               L    ++    E TN SL +   +  T
Sbjct  74   ---LKQQHNVMKPHELTNNSLVVEVDDAAT  100



>gb|AEW08832.1| hypothetical protein CL1870Contig1_01, partial [Pinus radiata]
 gb|AFG71202.1| hypothetical protein CL1870Contig1_01, partial [Pinus taeda]
 gb|AFG71203.1| hypothetical protein CL1870Contig1_01, partial [Pinus taeda]
 gb|AFG71204.1| hypothetical protein CL1870Contig1_01, partial [Pinus taeda]
 gb|AFG71206.1| hypothetical protein CL1870Contig1_01, partial [Pinus taeda]
 gb|AFG71207.1| hypothetical protein CL1870Contig1_01, partial [Pinus taeda]
 gb|AFG71208.1| hypothetical protein CL1870Contig1_01, partial [Pinus taeda]
Length=92

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  225  GTLDAIRERMKSIQLAAAAGNPD-LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSG  49
            GTLDAIRERMKSIQ AAAAGN + +PLM+ +       S    S    ++     PQ  G
Sbjct  10   GTLDAIRERMKSIQAAAAAGNIESVPLMSYSNGSLPAFSRNFASQPAESLCPEMLPQSGG  69

Query  48   VLPMDEKALSGLQARM  1
            V  MDEKALSGLQAR+
Sbjct  70   VPAMDEKALSGLQARV  85



>ref|XP_003627437.1| Microtubule organization protein [Medicago truncatula]
Length=1368

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 55/69 (80%), Gaps = 3/69 (4%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAV-LNLSSPKFSPVFPV  400
             IF QLQN SEAFRTYIRDGL  M KNAAAGRTPSS+P+ T PP V LN+SSP F+P+ PV
Sbjct  1302  IFNQLQNVSEAFRTYIRDGL--MAKNAAAGRTPSSLPMPTTPPPVSLNISSPDFAPLSPV  1359

Query  399   NTNPLGDSK  373
             N N L D+K
Sbjct  1360  NANDLNDAK  1368



>gb|AFG71205.1| hypothetical protein CL1870Contig1_01, partial [Pinus taeda]
Length=92

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  225  GTLDAIRERMKSIQLAAAAGNPD-LPLMARNGNVSHGRSNQLPSAAEHTISGNPYPQQSG  49
            GTLDAIRERMKSIQ AAA GN + +PLM+ +       S    S    ++     PQ  G
Sbjct  10   GTLDAIRERMKSIQAAAAGGNIESVPLMSYSNGSLPAFSRNFASQPAESLCPEMLPQSGG  69

Query  48   VLPMDEKALSGLQARM  1
            V  +DEKALSGLQAR+
Sbjct  70   VPALDEKALSGLQARV  85



>gb|KDO77523.1| hypothetical protein CISIN_1g000146mg [Citrus sinensis]
Length=1871

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR  484
             IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR
Sbjct  1810  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGR  1840



>ref|XP_006836452.1| hypothetical protein AMTR_s00092p00177270, partial [Amborella 
trichopoda]
 gb|ERM99305.1| hypothetical protein AMTR_s00092p00177270, partial [Amborella 
trichopoda]
Length=208

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 58/82 (71%), Gaps = 4/82 (5%)
 Frame = -2

Query  576  IFAQLQNASEAFRTYIRDGLAQMEKNAAAGRtpssvpistppPAV-LNLSSPKFSPVFPV  400
            IF QL NASEAFRT+IR GL QME+N AAGRTPSS+P+ST PP V +NLSSPK + + PV
Sbjct  85   IFLQLHNASEAFRTFIRYGLEQMERNTAAGRTPSSMPMSTTPPPVAINLSSPKLALMSPV  144

Query  399  NTNPLGDSKSINSKSEPTNFSL  334
            +   L    ++    E TN SL
Sbjct  145  H---LKQQHNVMKPHELTNNSL  163



>gb|EMS63356.1| Protein MOR1 [Triticum urartu]
Length=1880

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -2

Query  576   IFAQLQNASEAFRTYIRDGLAQM  508
             IFAQLQNASEAFRTYIRDGLAQM
Sbjct  1760  IFAQLQNASEAFRTYIRDGLAQM  1782



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 657324745168