BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c89282_g1_i1 len=613 path=[6:0-612]

Length=613
                                                                      Score     E

emb|CDP21955.1|  unnamed protein product                                180   1e-53   
ref|XP_011101484.1|  PREDICTED: uncharacterized protein LOC105179529    178   5e-53   
emb|CDP18616.1|  unnamed protein product                                168   4e-49   
ref|XP_010069014.1|  PREDICTED: uncharacterized protein LOC104456016    160   6e-46   
gb|KDP42762.1|  hypothetical protein JCGZ_23702                         147   6e-41   
gb|KCW89265.1|  hypothetical protein EUGRSUZ_A01560                     148   7e-41   
ref|XP_004303038.1|  PREDICTED: uncharacterized protein LOC101308886    147   7e-41   
ref|XP_007202711.1|  hypothetical protein PRUPE_ppa012775mg             145   6e-40   
ref|XP_010112524.1|  hypothetical protein L484_012802                   144   9e-40   
ref|XP_007162845.1|  hypothetical protein PHAVU_001G185700g             144   1e-39   
ref|XP_008241313.1|  PREDICTED: uncharacterized protein LOC103339746    144   2e-39   
ref|XP_006430318.1|  hypothetical protein CICLE_v10013017mg             143   2e-39   
gb|KEH24108.1|  plant/T22K18-16 protein, putative                       141   9e-39   
ref|XP_009365312.1|  PREDICTED: uncharacterized protein LOC103955161    141   3e-38   
ref|XP_010037096.1|  PREDICTED: uncharacterized protein LOC104425921    139   8e-38   
ref|XP_010037102.1|  PREDICTED: uncharacterized protein LOC104425926    139   1e-37   
ref|XP_003553580.1|  PREDICTED: uncharacterized protein LOC100808941    139   1e-37   
ref|XP_004137866.1|  PREDICTED: uncharacterized protein LOC101207081    139   1e-37   
ref|XP_010037098.1|  PREDICTED: uncharacterized protein LOC104425922    137   4e-37   
ref|XP_004170537.1|  PREDICTED: uncharacterized LOC101207081            137   4e-37   
ref|XP_010037100.1|  PREDICTED: uncharacterized protein LOC104425924    137   4e-37   
ref|XP_008386924.1|  PREDICTED: uncharacterized protein LOC103449381    139   8e-37   
ref|XP_003520678.1|  PREDICTED: uncharacterized protein LOC100785774    135   4e-36   
ref|XP_004494135.1|  PREDICTED: uncharacterized protein LOC101495759    134   1e-35   
ref|XP_010278252.1|  PREDICTED: uncharacterized protein LOC104612513    133   3e-35   
ref|XP_008442790.1|  PREDICTED: uncharacterized protein LOC103486565    129   3e-34   
emb|CDY60157.1|  BnaAnng16530D                                          128   1e-33   
emb|CDY00899.1|  BnaC05g43010D                                          126   1e-32   
ref|XP_009146878.1|  PREDICTED: uncharacterized protein LOC103870496    125   2e-32   
emb|CDP15349.1|  unnamed protein product                                125   4e-32   
ref|XP_002318984.2|  hypothetical protein POPTR_0013s01580g             120   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002884771.1|  hypothetical protein ARALYDRAFT_897178             119   5e-30   
ref|XP_011023711.1|  PREDICTED: uncharacterized protein LOC105125104    119   6e-30   
ref|XP_002283685.1|  PREDICTED: uncharacterized protein LOC100254632    118   9e-30   Vitis vinifera
ref|XP_010486584.1|  PREDICTED: uncharacterized protein LOC104764699    118   1e-29   
ref|XP_006299999.1|  hypothetical protein CARUB_v10016222mg             117   2e-29   
ref|XP_010479942.1|  PREDICTED: uncharacterized protein LOC104758690    117   2e-29   
ref|NP_566365.1|  uncharacterized protein                               117   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464662.1|  PREDICTED: uncharacterized protein LOC104745180    116   5e-29   
ref|NP_001118609.1|  uncharacterized protein                            115   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009353178.1|  PREDICTED: uncharacterized protein LOC103944436    113   6e-28   
ref|XP_010543478.1|  PREDICTED: uncharacterized protein LOC104816380    113   7e-28   
ref|XP_009773683.1|  PREDICTED: uncharacterized protein LOC104223863    111   2e-27   
ref|XP_010912218.1|  PREDICTED: uncharacterized protein LOC105038195    111   5e-27   
ref|XP_006407615.1|  hypothetical protein EUTSA_v10021699mg             110   8e-27   
ref|XP_011094428.1|  PREDICTED: uncharacterized protein LOC105174128    110   9e-27   
emb|CDX74003.1|  BnaA03g30440D                                          107   2e-25   
ref|XP_009135032.1|  PREDICTED: uncharacterized protein LOC103859273    107   2e-25   
ref|XP_008804382.1|  PREDICTED: uncharacterized protein LOC103717683    107   2e-25   
ref|XP_009601860.1|  PREDICTED: uncharacterized protein LOC104097057    104   1e-24   
gb|KFK38384.1|  hypothetical protein AALP_AA3G106600                    104   2e-24   
gb|KHN18722.1|  hypothetical protein glysoja_021473                     102   5e-24   
ref|XP_010683892.1|  PREDICTED: uncharacterized protein LOC104898501    103   6e-24   
ref|XP_006341175.1|  PREDICTED: uncharacterized protein LOC102596945    102   1e-23   
emb|CDY66900.1|  BnaC03g73280D                                          102   2e-23   
ref|XP_010248412.1|  PREDICTED: uncharacterized protein LOC104591302  94.4    1e-20   
ref|XP_003578916.2|  PREDICTED: uncharacterized protein LOC100822693  93.6    6e-20   
gb|EMT07145.1|  hypothetical protein F775_08244                       86.7    9e-18   
dbj|BAK05668.1|  predicted protein                                    85.9    1e-17   
ref|XP_007027599.1|  Uncharacterized protein TCM_022422               86.7    4e-17   
ref|XP_004977523.1|  PREDICTED: uncharacterized protein LOC101763194  84.7    5e-17   
ref|NP_001145601.1|  uncharacterized protein LOC100279079             84.3    7e-17   Zea mays [maize]
ref|NP_001066153.1|  Os12g0147200                                     84.0    7e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CBX24461.1|  hypothetical_protein                                 84.0    8e-17   
ref|NP_001145418.1|  uncharacterized protein LOC100278780             83.6    1e-16   Zea mays [maize]
ref|XP_002441825.1|  hypothetical protein SORBIDRAFT_08g002950        82.8    2e-16   Sorghum bicolor [broomcorn]
gb|ACG25635.1|  hypothetical protein                                  82.8    2e-16   Zea mays [maize]
emb|CBX25316.1|  hypothetical_protein                                 82.0    4e-16   
ref|XP_004246568.1|  PREDICTED: uncharacterized protein LOC101245195  81.3    6e-16   
ref|XP_004978666.1|  PREDICTED: uncharacterized protein LOC101777396  81.6    7e-16   
emb|CBX25514.1|  hypothetical_protein                                 79.0    6e-15   
ref|NP_001065754.1|  Os11g0149200                                     79.0    6e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007202841.1|  hypothetical protein PRUPE_ppa014598mg           69.7    8e-12   
gb|ADE77124.1|  unknown                                               68.9    2e-11   
ref|XP_010552987.1|  PREDICTED: uncharacterized protein LOC104823222  67.4    3e-11   
ref|XP_009353179.1|  PREDICTED: uncharacterized protein LOC103944437  66.6    7e-11   
ref|XP_006663208.1|  PREDICTED: uncharacterized protein LOC102706422  65.9    2e-10   
ref|XP_002982408.1|  hypothetical protein SELMODRAFT_421764           63.5    1e-09   
ref|XP_002966570.1|  hypothetical protein SELMODRAFT_407590           60.8    1e-08   
gb|ABK20936.1|  unknown                                               59.3    2e-08   Picea sitchensis
ref|XP_002963484.1|  hypothetical protein SELMODRAFT_405387           58.5    6e-08   
gb|ABK20932.1|  unknown                                               57.0    9e-08   Picea sitchensis
ref|XP_001753773.1|  predicted protein                                57.4    3e-07   
ref|XP_002988193.1|  hypothetical protein SELMODRAFT_426948           56.6    3e-07   
emb|CDX71716.1|  BnaC08g31580D                                        55.8    3e-07   
emb|CDX91281.1|  BnaC02g26920D                                        55.1    7e-07   
ref|XP_001760726.1|  predicted protein                                54.3    2e-06   
emb|CDX91279.1|  BnaC02g26900D                                        53.1    3e-06   
ref|XP_003633116.1|  PREDICTED: programmed cell death protein 4-like  49.7    5e-05   
ref|XP_006853737.1|  hypothetical protein AMTR_s00056p00175000        48.5    1e-04   
gb|ADR71293.1|  hypothetical protein 17                               48.1    2e-04   
ref|XP_003620790.1|  hypothetical protein MTR_6g090490                48.1    2e-04   
ref|XP_006451323.1|  hypothetical protein CICLE_v10010071mg           46.6    6e-04   
gb|KHN40368.1|  hypothetical protein glysoja_000866                   46.2    8e-04   
ref|XP_003516452.1|  PREDICTED: programmed cell death protein 4-l...  46.2    9e-04   



>emb|CDP21955.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +1

Query  85   DNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPL  264
            D+TKETVTFRAV  DEEG KRV K EV++HN DTLK+ EKKL+DKG+ R+DRRP  GIPL
Sbjct  6    DDTKETVTFRAVSGDEEGRKRVEKVEVDSHNADTLKYKEKKLIDKGVQRQDRRPIDGIPL  65

Query  265  GKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgvegmv  444
            G+Q KSGHGGK+TWEGP D AE EL   P AIDE DPNYVDEEAE  ILRGEVSGV G+V
Sbjct  66   GRQHKSGHGGKYTWEGPRDTAENELGAAPPAIDENDPNYVDEEAEDRILRGEVSGVAGLV  125

Query  445  vgevdvPKVAAEGVARVDVHHQLQPN  522
            VGE+++PK+A EGVAR+DV  QLQ N
Sbjct  126  VGELELPKLAEEGVARIDVDPQLQTN  151



>ref|XP_011101484.1| PREDICTED: uncharacterized protein LOC105179529 [Sesamum indicum]
Length=152

 Score =   178 bits (452),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   KPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASG  255
            + ID+ KETVTFRA+  DE G KRV K EV THNIDTLKH++KKL+DKGI R+DR P  G
Sbjct  3    QTIDDKKETVTFRAMSHDEAGMKRVEKVEVATHNIDTLKHVQKKLIDKGIQRQDRHPIDG  62

Query  256  IPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgve  435
            +P G+Q KSGHGGK+TWEGPAD+A  EL++ PAAIDEKDPNYVDEEAE  ILRGEVSGV 
Sbjct  63   LPRGRQPKSGHGGKYTWEGPADDAANELEEAPAAIDEKDPNYVDEEAEGRILRGEVSGVA  122

Query  436  gmvvgevdvPKVAAEGVARVDVHHQLQPN  522
            G+VVGE+DV K+A EGV RVDV  +LQ N
Sbjct  123  GLVVGEIDVAKLAEEGVTRVDVDPKLQAN  151



>emb|CDP18616.1| unnamed protein product [Coffea canephora]
Length=150

 Score =   168 bits (426),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 117/146 (80%), Gaps = 2/146 (1%)
 Frame = +1

Query  85   DNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPL  264
            D+TKETVTFRAV RDEEG KR  K EV+++N+DTLK+I KKL+DKG+ R+DRRP  GIPL
Sbjct  6    DDTKETVTFRAVSRDEEGRKRAEKAEVDSYNVDTLKYIGKKLIDKGVQRQDRRPIDGIPL  65

Query  265  GKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgvegmv  444
            G+Q KSGHGGK TWEGP+    Y     P AIDE DPNYVDEEAE  ILRGEVSGV G+V
Sbjct  66   GRQHKSGHGGKRTWEGPS--PCYLSPMAPPAIDENDPNYVDEEAEDRILRGEVSGVAGLV  123

Query  445  vgevdvPKVAAEGVARVDVHHQLQPN  522
            VGE+++PK+A EGVAR+DV  QLQ N
Sbjct  124  VGELELPKLAEEGVARIDVDPQLQTN  149



>ref|XP_010069014.1| PREDICTED: uncharacterized protein LOC104456016 [Eucalyptus grandis]
Length=153

 Score =   160 bits (405),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 112/151 (74%), Gaps = 1/151 (1%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            M+PID+ +ETV  RAV  DEEG K+V K EV THN+DTL++IEKKLMDKG+ R +R P  
Sbjct  1    MQPIDDKEETVVIRAVSHDEEGKKKVEKTEVNTHNVDTLRYIEKKLMDKGVIRMERHPVD  60

Query  253  GIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsg  429
            GI +G+   KSGHGGK+TWEGP    E EL+ VP AIDE+DPNYVDEEAE  ILRGEVS 
Sbjct  61   GIGIGRPPPKSGHGGKYTWEGPVSMVEAELEPVPPAIDERDPNYVDEEAEGRILRGEVSD  120

Query  430  vegmvvgevdvPKVAAEGVARVDVHHQLQPN  522
            V   V G+V+VPK    GVAR+DV  +LQ N
Sbjct  121  VAAYVAGDVEVPKAEEVGVARIDVDPKLQVN  151



>gb|KDP42762.1| hypothetical protein JCGZ_23702 [Jatropha curcas]
Length=148

 Score =   147 bits (371),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 102/150 (68%), Gaps = 5/150 (3%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID  K+ V  RAV  DEEG KRV K E+ THN DT+K++EKKLMDKG+HR DR P  
Sbjct  1    MKPIDEKKDKVVIRAVSHDEEGRKRVEKTELHTHNKDTIKYVEKKLMDKGVHRMDRHPVD  60

Query  253  GIPLGKQ--SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs  426
            GI   ++   KSGHGGK+TWEGP D AE ELD  P AIDEKDPNYVDEE E+ +LRGE  
Sbjct  61   GIGGIRKPPPKSGHGGKYTWEGPEDMAESELDAAPPAIDEKDPNYVDEEKEEKLLRGEEG  120

Query  427  gvegmvvgevdvPKVAAEGVARVDVHHQLQ  516
             +    V      K A EGVAR++V   L+
Sbjct  121  ELVVGEVEVA---KEAKEGVARIEVDPHLK  147



>gb|KCW89265.1| hypothetical protein EUGRSUZ_A01560 [Eucalyptus grandis]
Length=175

 Score =   148 bits (373),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            M+PID+ +ETV  RAV  DEEG K+V K EV THN+DTL++IEKKLMDKG+ R +R P  
Sbjct  1    MQPIDDKEETVVIRAVSHDEEGKKKVEKTEVNTHNVDTLRYIEKKLMDKGVIRMERHPVD  60

Query  253  GIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILR  414
            GI +G+   KSGHGGK+TWEGP    E EL+ VP AIDE+DPNYVDEEAE  ILR
Sbjct  61   GIGIGRPPPKSGHGGKYTWEGPVSMVEAELEPVPPAIDERDPNYVDEEAEGRILR  115



>ref|XP_004303038.1| PREDICTED: uncharacterized protein LOC101308886 [Fragaria vesca 
subsp. vesca]
Length=155

 Score =   147 bits (371),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 115/152 (76%), Gaps = 4/152 (3%)
 Frame = +1

Query  73   MKPIDNTK-ETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPA  249
            MKPIDN K +TVT RAV  +EEG K V K E+ THN+DT+K++EKKL+DKG+  +DR P 
Sbjct  1    MKPIDNKKKDTVTIRAVSHNEEGRKIVEKAELNTHNVDTIKYVEKKLIDKGVLGQDRHPI  60

Query  250  SGIPLGKQS-KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs  426
             GI +GK   KSGHGGK+TWEGP D AEYE++ VPAAID+ DPNYVDEE E  I++G+ +
Sbjct  61   DGIGIGKPPPKSGHGGKYTWEGPGDAAEYEMEPVPAAIDKGDPNYVDEEVEDKIVKGKEA  120

Query  427  gvegmvvgevdvPKVAA--EGVARVDVHHQLQ  516
             V G+VVGEV+V K A   EGVARV+V  +L 
Sbjct  121  EVSGLVVGEVEVAKAAENREGVARVEVDPRLN  152



>ref|XP_007202711.1| hypothetical protein PRUPE_ppa012775mg [Prunus persica]
 gb|EMJ03910.1| hypothetical protein PRUPE_ppa012775mg [Prunus persica]
Length=155

 Score =   145 bits (365),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 115/154 (75%), Gaps = 6/154 (4%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID  K+TVT RAV  DEEG KR  K E+ THN+DT+K+IEKKL+DKG+ R +R P  
Sbjct  1    MKPIDAKKDTVTIRAVSHDEEGRKREEKTELHTHNVDTIKYIEKKLVDKGVQRLERHPRD  60

Query  253  GIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsg  429
            G  +G+ Q KSGHGGK+TWEGP D AE E+D VP AIDE DPNYVDE AE+ I++GE + 
Sbjct  61   GTGIGQPQPKSGHGGKYTWEGPDDVAENEMDPVPPAIDEGDPNYVDEVAEERIVKGEDAD  120

Query  430  vegmvvgevdvPKVAA--EGVARVDV---HHQLQ  516
            V G+VVG+V+V K A   EGVARV+V   H+ L+
Sbjct  121  VAGLVVGKVEVAKAAENREGVARVEVVPPHNHLE  154



>ref|XP_010112524.1| hypothetical protein L484_012802 [Morus notabilis]
 gb|EXC33912.1| hypothetical protein L484_012802 [Morus notabilis]
Length=154

 Score =   144 bits (364),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID+ K+TV  RAV RDEEG KRV K  ++TH++DT+K++EKKL+DKG+ R DR PA 
Sbjct  1    MKPIDDKKDTVVIRAVSRDEEGRKRVEKTGLKTHDVDTIKYVEKKLIDKGVQRLDRHPAD  60

Query  253  GI-PLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs  426
            GI  +GK   KSGHGGK+TWEGP + AE  L   PAAIDE+DPNYVDE+AE+ I+RGE  
Sbjct  61   GIGGIGKPPPKSGHGGKYTWEGPGEVAENLLAPAPAAIDERDPNYVDEDAEERIVRGEDK  120

Query  427  gvegmvvgevdvPKVAA--EGVARVDVHHQLQ  516
             V  +VVGEV+V K A   EGVARV+V   L+
Sbjct  121  DVGELVVGEVEVAKAAEGREGVARVEVDPHLK  152



>ref|XP_007162845.1| hypothetical protein PHAVU_001G185700g [Phaseolus vulgaris]
 gb|ESW34839.1| hypothetical protein PHAVU_001G185700g [Phaseolus vulgaris]
Length=146

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID+ +E VT RAV RDEEG KRV K EV THN++TLK++EKKL++KGI R+DR PA 
Sbjct  1    MKPIDDKQEKVTIRAVSRDEEGRKRVEKIEVGTHNVETLKYVEKKLINKGIQRQDRHPAG  60

Query  253  GIPLGKQ-SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNY  381
            GI +G+Q  KSGHGGKFTWEGPAD AE EL   PAAIDE DPNY
Sbjct  61   GIGIGRQPPKSGHGGKFTWEGPADMAENELMAAPAAIDEGDPNY  104



>ref|XP_008241313.1| PREDICTED: uncharacterized protein LOC103339746 [Prunus mume]
Length=155

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 114/154 (74%), Gaps = 6/154 (4%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID  K+TVT RAV  DEEG KR  K E+ THN+DT+K+IEKKL+DKG+ R +R P  
Sbjct  1    MKPIDAKKDTVTIRAVSHDEEGQKRAEKTELHTHNVDTIKYIEKKLVDKGVQRLERHPRD  60

Query  253  GIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsg  429
            G  +G+   KSGHGGK+TWEGP D AE E+D VP AIDE DPNYVDE AE+ I++GE + 
Sbjct  61   GTGIGQPPPKSGHGGKYTWEGPDDVAENEMDPVPPAIDEGDPNYVDEVAEERIVKGEDAD  120

Query  430  vegmvvgevdvPKVAA--EGVARVDV---HHQLQ  516
            V G+VVG+V+V K A   EGVARV+V   H+ L+
Sbjct  121  VAGLVVGKVEVAKAAENREGVARVEVVPPHNHLE  154



>ref|XP_006430318.1| hypothetical protein CICLE_v10013017mg [Citrus clementina]
 gb|ESR43558.1| hypothetical protein CICLE_v10013017mg [Citrus clementina]
Length=152

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID+ K+TVT RAV R+EEG KRV K E++THNIDTLK++EKKL DKG+ R +R PA+
Sbjct  1    MKPIDDKKDTVTIRAVSRNEEGRKRVEKMELDTHNIDTLKYVEKKLEDKGVQRMERHPAN  60

Query  253  GIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEA  396
            G+ +G+   KSG GGK+TWEGP D  E EL+  P AIDEKDPNYVDEEA
Sbjct  61   GLGIGQPPPKSGRGGKYTWEGPGDLVESELNPAPPAIDEKDPNYVDEEA  109



>gb|KEH24108.1| plant/T22K18-16 protein, putative [Medicago truncatula]
Length=146

 Score =   141 bits (356),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 104/157 (66%), Gaps = 18/157 (11%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID  +ETVT RAV  DEEG KRV K E+ THNIDT+KH+EKKL++ G+ R DR P  
Sbjct  1    MKPIDEKQETVTIRAVSHDEEGKKRVEKTELNTHNIDTIKHVEKKLINNGVQRLDRHPVD  60

Query  253  GIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEE----AEKSILRg  417
            GI +G+   KSG GGKFTWEGPAD  +  LD  PAA+DE DPNYVDEE    A K ++  
Sbjct  61   GIGIGRGPPKSGRGGKFTWEGPADMVDNMLDPAPAAMDENDPNYVDEEDGEDAAKELI--  118

Query  418  evsgvegmvvgevdvPKVAAE--GVARVDVHHQLQPN  522
                     VG+VDV KV  E  GVARVDV  +L  N
Sbjct  119  ---------VGDVDVAKVGGERDGVARVDVDPRLVAN  146



>ref|XP_009365312.1| PREDICTED: uncharacterized protein LOC103955161 [Pyrus x bretschneideri]
Length=189

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 108/148 (73%), Gaps = 3/148 (2%)
 Frame = +1

Query  67   KKMKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRP  246
            KKMKPID  K+TVT RAV  DEEG KRV K E+ THNIDT+K++EKKL+DKG+ R DR P
Sbjct  34   KKMKPIDGKKDTVTIRAVSHDEEGRKRVEKMELHTHNIDTVKYVEKKLIDKGVQRLDRHP  93

Query  247  ASGIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgev  423
              G  +GK   KSGHGGK+TWEGP    +   D VP AIDE DPNYVDEE E+ I++GE 
Sbjct  94   KDGTRIGKPPPKSGHGGKYTWEGPGGVVDDVTDPVPVAIDEGDPNYVDEETEERIVKGED  153

Query  424  sgvegmvvgevdvPKVA--AEGVARVDV  501
              V G+VVGEV+V K A   EGV+RV+V
Sbjct  154  VDVAGLVVGEVEVAKAAEDKEGVSRVEV  181



>ref|XP_010037096.1| PREDICTED: uncharacterized protein LOC104425921 [Eucalyptus grandis]
 gb|KCW48745.1| hypothetical protein EUGRSUZ_K02384 [Eucalyptus grandis]
Length=157

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MK +D  K+T T   V RDEEG KRV K EVE H +DT+K++E+KLMDKG+ R +R PA 
Sbjct  2    MKRVDRRKDTTTLPVVTRDEEGKKRVAKIEVEAHKVDTVKYLERKLMDKGVQRMERHPAD  61

Query  253  GI-PLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs  426
            G+  +G+   KSG GGK+TWEGP D AE EL   P AIDEKDPNYVDEEAE+ ++RGE  
Sbjct  62   GLGGIGRPPPKSGRGGKYTWEGPEDPAESELAPTPPAIDEKDPNYVDEEAEEKVIRGEDG  121

Query  427  gvegmvvgevdvPKVAAEGVARVDVHHQLQ  516
             V G+VVGEV+VPK    GVAR++V   L+
Sbjct  122  EVAGLVVGEVEVPKAHEVGVARIEVDPNLK  151



>ref|XP_010037102.1| PREDICTED: uncharacterized protein LOC104425926 [Eucalyptus grandis]
 gb|KCW48766.1| hypothetical protein EUGRSUZ_K02410 [Eucalyptus grandis]
Length=157

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MK +D  K+T T   V RDEEG KRV K EVE H +DT+K++E+KLMDKG+ R +R PA 
Sbjct  2    MKRVDRRKDTTTLPVVTRDEEGKKRVAKIEVEAHKVDTVKYLERKLMDKGVQRMERHPAD  61

Query  253  GI-PLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs  426
            G+  +G+   K+G GGK+TWEGP D AE EL   P AIDEKDPNYVDEEAE+ ++RGE  
Sbjct  62   GLGGIGRPPPKAGRGGKYTWEGPEDPAESELAPTPPAIDEKDPNYVDEEAEEKVIRGEDG  121

Query  427  gvegmvvgevdvPKVAAEGVARVDVHHQLQ  516
             V G+VVGEV+VPK    GVAR++V   L+
Sbjct  122  EVAGLVVGEVEVPKAREVGVARIEVDPNLK  151



>ref|XP_003553580.1| PREDICTED: uncharacterized protein LOC100808941 [Glycine max]
 gb|KHN02267.1| hypothetical protein glysoja_002291 [Glycine soja]
Length=146

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 106/158 (67%), Gaps = 20/158 (13%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID+ +ETVT R V  DEEG KRV K E+ THNIDT++++EKKL++KG+ R+DR PA 
Sbjct  1    MKPIDDKQETVTIRTVSHDEEGKKRVEKTELSTHNIDTIRYVEKKLINKGVQRQDRHPAD  60

Query  253  GIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVD-----EEAEKSILR  414
            GI + +   KSGHGGKFTWEGPA     EL   PAA+DE DPNYVD     EEA + ++ 
Sbjct  61   GIGISRPPPKSGHGGKFTWEGPATVENSELMAAPAAMDEGDPNYVDWEENGEEASELVV-  119

Query  415  gevsgvegmvvgevdvPKVAAE--GVARVDVHHQLQPN  522
                       GEV+V KVA E  G+ARVDV  +LQ N
Sbjct  120  -----------GEVEVSKVAQEHDGLARVDVDPRLQVN  146



>ref|XP_004137866.1| PREDICTED: uncharacterized protein LOC101207081 [Cucumis sativus]
 gb|KGN59049.1| hypothetical protein Csa_3G748780 [Cucumis sativus]
Length=144

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 106/150 (71%), Gaps = 10/150 (7%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID+ K+ VT RAV RDEEG K V K E+E+HNIDT+K+IEKKL+DKGI R +R P  
Sbjct  1    MKPIDDKKDKVTIRAVSRDEEGKKHVEKAEIESHNIDTIKYIEKKLIDKGIQRLERHPVH  60

Query  253  G-IPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs  426
            G   +G+   KSG GGKFTWEGP D  E EL   P AIDEKDPNYVDEE E+ +      
Sbjct  61   GHTGIGQPPPKSGRGGKFTWEGPGDAIENELSPAPPAIDEKDPNYVDEEEEEEV------  114

Query  427  gvegmvvgevdvPKVAAEGVARVDVHHQLQ  516
               G+VVGEV+VP  A EGV+RV+V  QLQ
Sbjct  115  --AGLVVGEVEVPAAAPEGVSRVEVDPQLQ  142



>ref|XP_010037098.1| PREDICTED: uncharacterized protein LOC104425922 [Eucalyptus grandis]
 gb|KCW48750.1| hypothetical protein EUGRSUZ_K02389 [Eucalyptus grandis]
Length=156

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MK +D  K+T T   V RDEEG KRV K EVE H +DT++++E+KLMDKG+ R +R PA+
Sbjct  1    MKRVDRRKDTTTLPVVTRDEEGRKRVEKIEVEAHKVDTVEYLERKLMDKGVQRMERHPAN  60

Query  253  GI-PLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs  426
            G+  +G+   KSG GGK+TWEGP D AE EL  +P AIDEKDPNYVDEEAE+ ++RGE  
Sbjct  61   GLGGIGRPPPKSGRGGKYTWEGPEDPAESELAPMPPAIDEKDPNYVDEEAEEKVIRGEDG  120

Query  427  gvegmvvgevdvPKVAAEGVARVDVHHQLQ  516
             V G+VVGEV+VPK    GVAR+ V   L+
Sbjct  121  EVAGLVVGEVEVPKAHEVGVARIKVDPNLK  150



>ref|XP_004170537.1| PREDICTED: uncharacterized LOC101207081 [Cucumis sativus]
Length=145

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 106/150 (71%), Gaps = 9/150 (6%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID+ K+ VT RAV RDEEG K V K E+E+HNIDT+K+IEKKL+DKG+ R +R P  
Sbjct  1    MKPIDDKKDKVTIRAVSRDEEGKKHVEKAEIESHNIDTIKYIEKKLIDKGVQRLERHPVH  60

Query  253  G-IPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs  426
            G   +G+   KSG GGKFTWEGP D  E EL   P AIDEKDPNYVDEE E+  +     
Sbjct  61   GHTGIGQPPPKSGRGGKFTWEGPGDAIENELSPAPPAIDEKDPNYVDEEEEEEEV-----  115

Query  427  gvegmvvgevdvPKVAAEGVARVDVHHQLQ  516
               G+VVGEV+VP  A EGV+RV+V  QLQ
Sbjct  116  --AGLVVGEVEVPAAAPEGVSRVEVDPQLQ  143



>ref|XP_010037100.1| PREDICTED: uncharacterized protein LOC104425924 [Eucalyptus grandis]
 gb|KCW48758.1| hypothetical protein EUGRSUZ_K02399 [Eucalyptus grandis]
Length=156

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MK +D  K+T T   V RDEEG KRV K EVE H +DT++++E+KLMDKG+ R +R PA 
Sbjct  1    MKRVDRRKDTTTLPVVTRDEEGRKRVEKIEVEAHKVDTVEYLERKLMDKGVQRMERHPAD  60

Query  253  GI-PLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs  426
            G+  +G+   KSG GGK+TWEGP D AE EL  +P AIDEKDPNYVDEEAE+ ++RGE  
Sbjct  61   GLGGIGRPPPKSGRGGKYTWEGPEDPAESELAPMPPAIDEKDPNYVDEEAEEKVIRGEDG  120

Query  427  gvegmvvgevdvPKVAAEGVARVDVHHQLQ  516
             V G+VVGEV+VPK    GVAR++V   L+
Sbjct  121  EVAGLVVGEVEVPKAHEVGVARIEVDPNLK  150



>ref|XP_008386924.1| PREDICTED: uncharacterized protein LOC103449381 [Malus domestica]
Length=235

 Score =   139 bits (350),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  67   KKMKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRP  246
            KKMKPID  K+TVT RAV  DE+G KRV K ++ THNIDT+K++EKKL+DKG+ R DR P
Sbjct  80   KKMKPIDGKKDTVTIRAVSHDEDGRKRVEKMKLHTHNIDTVKYVEKKLIDKGVQRLDRHP  139

Query  247  ASGIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILR  414
              G  +G+   KSGHGGK+TWEGP   A+   D VP AIDE+DPNYVDEE E+ I++
Sbjct  140  KDGTGIGRPPPKSGHGGKYTWEGPGGVADDVTDPVPVAIDERDPNYVDEEKEEMIVK  196



>ref|XP_003520678.1| PREDICTED: uncharacterized protein LOC100785774 [Glycine max]
Length=151

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID+ +ETVT RAV  DEEG KRV K E+ THNI T+K++EKKL++KG+ RKDR PA 
Sbjct  1    MKPIDDKQETVTIRAVSHDEEGRKRVEKIELNTHNIHTIKYVEKKLINKGVQRKDRHPAD  60

Query  253  GIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEE  393
            GI +G+   KSGHGGKFTWEGPA   + EL   PAA+DE DPNY+D E
Sbjct  61   GIRIGRPPPKSGHGGKFTWEGPASVEDNELMTEPAAMDEGDPNYLDWE  108



>ref|XP_004494135.1| PREDICTED: uncharacterized protein LOC101495759 [Cicer arietinum]
Length=147

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID  +E VT RAV  DEEG KRV K E+ THNIDT+K++EKKL++KG+ R+DR P  
Sbjct  1    MKPIDEKQEKVTIRAVSHDEEGKKRVEKTELNTHNIDTIKYVEKKLINKGVQRQDRHPVD  60

Query  253  GIPLGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYV  384
             I + +   KSGHGGKFTWEGP D A  EL+  PAAIDEKDPNYV
Sbjct  61   NIGISRPPPKSGHGGKFTWEGPDDVAYNELNAAPAAIDEKDPNYV  105



>ref|XP_010278252.1| PREDICTED: uncharacterized protein LOC104612513 [Nelumbo nucifera]
Length=161

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 102/143 (71%), Gaps = 3/143 (2%)
 Frame = +1

Query  94   KETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPL-GK  270
            KETV+FR V RDEEG KRV K EV T N +TLK+IEKKL DKG+ R DRRP  G  L   
Sbjct  17   KETVSFRLVSRDEEGKKRVEKAEVNTSNPETLKYIEKKLRDKGVQRMDRRPVDGNALHHT  76

Query  271  QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgvegmvvg  450
              KSGHGGKFTWEG  D A+ EL  VP AIDE DPNYVDEE E+ IL+GE   V+G+VVG
Sbjct  77   PPKSGHGGKFTWEGSGDIADTELSPVPPAIDEGDPNYVDEEVEERILKGEEPDVDGLVVG  136

Query  451  evdvPKVAAE--GVARVDVHHQL  513
            EV+V K A +  G+ARV+V   L
Sbjct  137  EVEVAKAAGDRVGLARVEVEPAL  159



>ref|XP_008442790.1| PREDICTED: uncharacterized protein LOC103486565 [Cucumis melo]
Length=146

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 102/150 (68%), Gaps = 8/150 (5%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID  K+ VT RAV RDEEG K + K E+E+HNIDT+K+IEKKL+DKG+ R +R P  
Sbjct  1    MKPIDEKKDKVTIRAVTRDEEGKKHIEKAEIESHNIDTIKYIEKKLIDKGVQRLERHPVH  60

Query  253  GIPLGKQ--SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs  426
            G     Q   KSG GGKFTWEGP D  E EL   P AIDEKDPNYVDE  E+        
Sbjct  61   GHTGIAQPPPKSGRGGKFTWEGPGDAIENELSPAPPAIDEKDPNYVDEVKEEE------E  114

Query  427  gvegmvvgevdvPKVAAEGVARVDVHHQLQ  516
             V G+VVGEV+VP  A EGV+RV+V  QLQ
Sbjct  115  EVAGLVVGEVEVPAAAPEGVSRVEVDPQLQ  144



>emb|CDY60157.1| BnaAnng16530D [Brassica napus]
Length=153

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  RDEEG K V K E++T N +T+K +EKKLM+KG+ R +R PA GIP
Sbjct  6    VDETKNTVVLRAEHRDEEGRKAVDKFELKTRNPETIKQVEKKLMEKGVQRMERHPADGIP  65

Query  262  LGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgvegm  441
            L KQ KSGHGGK+TWEGP    +YE+   P A+DE DPNY +E+A+K+   G       +
Sbjct  66   LKKQPKSGHGGKYTWEGPDRVEDYEMQPDPPAMDEGDPNYDEEQAKKNTGGGGDDVAVEL  125

Query  442  vvgevdvPKVAAEGVARVDVHHQL  513
            V GEV+V K A  GVARV+V  +L
Sbjct  126  VKGEVEVAKEAPTGVARVEVDPRL  149



>emb|CDY00899.1| BnaC05g43010D [Brassica napus]
Length=152

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  RDEEG K V K E++T N +T+K +EKKLM+KG+ R +R PA GIP
Sbjct  6    VDETKNTVVLRAEHRDEEGRKVVDKFELKTRNPETIKQVEKKLMEKGVQRMERHPADGIP  65

Query  262  LGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKS  405
            L KQ KSGHGGK+TWEGP    +YE+   P AIDE DPNY +E+A K+
Sbjct  66   LKKQPKSGHGGKYTWEGPDRVEDYEMQPDPPAIDEGDPNYDEEQANKN  113



>ref|XP_009146878.1| PREDICTED: uncharacterized protein LOC103870496 [Brassica rapa]
Length=152

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  RDEEG K V K E++T N +T+K +EKKLM+KG+ R +R PA GIP
Sbjct  6    VDETKNTVVLRAEHRDEEGRKAVDKFELKTRNPETIKQVEKKLMEKGVQRMERHPADGIP  65

Query  262  LGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKS  405
            L KQ KSGHGGK+TWEGP    +YE+   P A+DE DPNY +E+A+K+
Sbjct  66   LKKQPKSGHGGKYTWEGPDRVEDYEMQPDPPAMDEGDPNYDEEQAKKN  113



>emb|CDP15349.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   125 bits (313),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 96/138 (70%), Gaps = 6/138 (4%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPLGKQSKSGH  288
             RA  R EEG K V + +V+T ++DTLK+IE+KL+DKG+ R +R PA G+PL    K GH
Sbjct  17   IRADCRAEEGRKHVERVQVKTRDVDTLKYIERKLIDKGVQRMERHPADGLPLKHDPKKGH  76

Query  289  GGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevs------gvegmvvg  450
            GGK++WEGP +E   EL   P AIDEKDPNYVDEEAE  +++   S         G+VVG
Sbjct  77   GGKYSWEGPDEEFMNELQAAPPAIDEKDPNYVDEEAEARLVKQGESAAGDDDDEGGVVVG  136

Query  451  evdvPKVAAEGVARVDVH  504
            EV+ PK+A EGVAR++VH
Sbjct  137  EVEAPKLAEEGVARIEVH  154



>ref|XP_002318984.2| hypothetical protein POPTR_0013s01580g [Populus trichocarpa]
 gb|EEE94907.2| hypothetical protein POPTR_0013s01580g [Populus trichocarpa]
Length=162

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 104/153 (68%), Gaps = 5/153 (3%)
 Frame = +1

Query  70   KMKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPA  249
            KMK ID+ K+TV  + V RD EG K+V K E++THNIDT+K++EKKLMDKG+ R +R P 
Sbjct  6    KMKAIDDKKDTVVIKTVSRDAEGKKKVEKAELKTHNIDTIKYVEKKLMDKGVMRMERHPV  65

Query  250  SGI-PLGK-QSKSGHGGKFTWEGPAD-EAEYELDDVPAAIDEKDPNYVDEEAEKSILRge  420
             G   +G+   KSGHGGKFTWEGP D          P AIDEKDPNYVDE  E+ I++GE
Sbjct  66   DGKGGIGRPPPKSGHGGKFTWEGPYDEAEIELEAAAPPAIDEKDPNYVDEVVEEKIVKGE  125

Query  421  vsgvegmvvgevdvPKVAA--EGVARVDVHHQL  513
               V G+VVGE++V K      GVARV+V  +L
Sbjct  126  EKDVAGVVVGEIEVAKAVEGRHGVARVEVDPRL  158



>ref|XP_002884771.1| hypothetical protein ARALYDRAFT_897178 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61030.1| hypothetical protein ARALYDRAFT_897178 [Arabidopsis lyrata subsp. 
lyrata]
Length=149

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 5/145 (3%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RAV ++EEG K V K E++T N +T+K +E+KLM+KG+ R DR P+ GIP
Sbjct  6    VDETKNTVVIRAVHKNEEGRKSVDKFELKTRNPETIKSVERKLMEKGVQRMDRHPSDGIP  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgveg  438
            L +   KSGHGGK+TWEGP    +YE+   P AIDE DPNY +E+A+K     +      
Sbjct  66   LRRPPPKSGHGGKYTWEGPDRMEDYEMQPDPPAIDEGDPNYDEEQAKK----IDDDVAVE  121

Query  439  mvvgevdvPKVAAEGVARVDVHHQL  513
            +V GEV+V K A  GVARVDV  +L
Sbjct  122  LVKGEVEVAKEAPAGVARVDVDPRL  146



>ref|XP_011023711.1| PREDICTED: uncharacterized protein LOC105125104 [Populus euphratica]
Length=156

 Score =   119 bits (298),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 103/152 (68%), Gaps = 5/152 (3%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            M  ID+ K+TV  + V RDEEG K+V K E++THNIDT K++EKKLMDKG+ R +R P  
Sbjct  1    MNVIDDKKDTVVIKTVSRDEEGKKKVEKAELKTHNIDTTKYVEKKLMDKGVMRMERHPVD  60

Query  253  GI-PLGK-QSKSGHGGKFTWEGPAD-EAEYELDDVPAAIDEKDPNYVDEEAEKSILRgev  423
            G   +G+   KSGHGGKFTWEGP D          P AIDEKDPNYVDE  E+ I++GE 
Sbjct  61   GKGGIGRPPPKSGHGGKFTWEGPYDEAEIELEAAAPPAIDEKDPNYVDEVVEEKIVKGEE  120

Query  424  sgvegmvvgevdvPKVAA--EGVARVDVHHQL  513
              V G+VVGE++V K A    GVARV+V  +L
Sbjct  121  KDVAGVVVGEIEVAKAAEGRHGVARVEVDPRL  152



>ref|XP_002283685.1| PREDICTED: uncharacterized protein LOC100254632 [Vitis vinifera]
Length=152

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 101/144 (70%), Gaps = 8/144 (6%)
 Frame = +1

Query  94   KETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPLGK-  270
            KETVTFRA   DEEG KRV K EV     DTLK+IEKKL +KG+ R +R PA G+ L + 
Sbjct  10   KETVTFRAPSHDEEGRKRVEKVEV-----DTLKYIEKKLENKGVLRMERHPADGLSLKRG  64

Query  271  QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgvegmvvg  450
              KSGHGGK+TWEGP D    EL+  P A+DEKDPN+VDEE E+ I++GE   V G+VVG
Sbjct  65   PPKSGHGGKYTWEGPKDSVHNELEGAPPALDEKDPNFVDEEEEERIVKGEEEDVAGLVVG  124

Query  451  evdvPKVA--AEGVARVDVHHQLQ  516
            EV+V K A   EGVARV+V   L+
Sbjct  125  EVEVAKAAEVKEGVARVEVDPGLK  148



>ref|XP_010486584.1| PREDICTED: uncharacterized protein LOC104764699 [Camelina sativa]
Length=150

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 99/145 (68%), Gaps = 4/145 (3%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  ++EEG K V K E++T N +T+K +E+KLM+KG+ R DR P+ GIP
Sbjct  6    VDETKNTVVLRAQHQNEEGRKAVDKFELKTRNPETIKSVERKLMEKGVQRMDRHPSDGIP  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgveg  438
            L +  SKSGHGGK+TWEGP    +YE+   PAA+DE DPNY +E+ +K++   +      
Sbjct  66   LRRPPSKSGHGGKYTWEGPDRMEDYEMQPDPAAMDEGDPNYDEEQVKKNL---DDDVAVD  122

Query  439  mvvgevdvPKVAAEGVARVDVHHQL  513
            +V GEV+V K A  GVARV+V  +L
Sbjct  123  LVKGEVEVAKKAPAGVARVEVDPRL  147



>ref|XP_006299999.1| hypothetical protein CARUB_v10016222mg [Capsella rubella]
 gb|EOA32897.1| hypothetical protein CARUB_v10016222mg [Capsella rubella]
Length=150

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 99/145 (68%), Gaps = 4/145 (3%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  ++EEG K V K E++T N +T+K +E+KLM+KG+ R DR P+ GIP
Sbjct  6    VDETKNTVVLRAEHQNEEGRKAVDKFELKTRNPETIKSVERKLMEKGVQRMDRHPSDGIP  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgveg  438
            L +  SKSGHGGK+TWEGP    +YE+   PAA+DE DPNY +E+ +K++   +      
Sbjct  66   LRRPPSKSGHGGKYTWEGPDRMEDYEMQPDPAAMDEGDPNYDEEQVKKNL---DDDVAVD  122

Query  439  mvvgevdvPKVAAEGVARVDVHHQL  513
            +V GEV+V K A  GVARV+V  +L
Sbjct  123  LVKGEVEVAKEAPAGVARVEVDPRL  147



>ref|XP_010479942.1| PREDICTED: uncharacterized protein LOC104758690 [Camelina sativa]
Length=150

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 98/145 (68%), Gaps = 4/145 (3%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  ++EEG K V K E++T N +T+K +E+KLM+KG+ R DR P+ GIP
Sbjct  6    VDETKNTVVLRAQHQNEEGRKAVDKFELKTRNPETIKSVERKLMEKGVQRMDRHPSDGIP  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgveg  438
            L +  SKSGHGGK+TWEGP    +YE+   PAA+DE DPNY +E+ +K++   +      
Sbjct  66   LRRPPSKSGHGGKYTWEGPDRMEDYEMQPDPAAMDEGDPNYDEEQVKKNL---DDDVAVD  122

Query  439  mvvgevdvPKVAAEGVARVDVHHQL  513
            +V GEV V K A  GVARV+V  +L
Sbjct  123  LVKGEVAVAKKAPGGVARVEVDPRL  147



>ref|NP_566365.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF04421.1|AC010927_14 unknown protein [Arabidopsis thaliana]
 gb|AAK82485.1| AT3g10020/T22K18_16 [Arabidopsis thaliana]
 gb|AAK97732.1| AT3g10020/T22K18_16 [Arabidopsis thaliana]
 gb|AAL06834.1| AT3g10020/T22K18_16 [Arabidopsis thaliana]
 gb|AAM10307.1| AT3g10020/T22K18_16 [Arabidopsis thaliana]
 gb|AAM66017.1| unknown [Arabidopsis thaliana]
 gb|AEE74849.1| uncharacterized protein AT3G10020 [Arabidopsis thaliana]
Length=149

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 5/145 (3%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  ++EEG K V K EV+T N +T+K +E+KLM+KG+ R DR P+ GIP
Sbjct  6    VDETKNTVVLRAEHKNEEGRKSVDKFEVKTRNPETIKSVERKLMEKGVQRMDRHPSDGIP  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgveg  438
            L +  SKSGHGGK+TWEGP    +YE+   P A+DE DPNY +E+ +KS           
Sbjct  66   LRRPPSKSGHGGKYTWEGPDRMEDYEMQPDPPAMDEGDPNYDEEQVKKS----GDDVAVE  121

Query  439  mvvgevdvPKVAAEGVARVDVHHQL  513
            +V GEV+V K A  GVARV+V  +L
Sbjct  122  LVKGEVEVAKEAPAGVARVEVDPRL  146



>ref|XP_010464662.1| PREDICTED: uncharacterized protein LOC104745180 [Camelina sativa]
Length=150

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 99/145 (68%), Gaps = 4/145 (3%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  ++EEG K V K E++T N +T+K +E+KLM+KG+ R DR P+ G+P
Sbjct  6    VDETKNTVVLRAQHQNEEGRKAVDKFELKTRNPETIKSVERKLMEKGVQRMDRHPSDGVP  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgveg  438
            L +  SKSGHGGK+TWEGP    +YE+   PAA+DE DPNY +E+ +K++   +      
Sbjct  66   LRRPPSKSGHGGKYTWEGPDRMEDYEMQPDPAAMDEGDPNYDEEQFKKNL---DDDVAVD  122

Query  439  mvvgevdvPKVAAEGVARVDVHHQL  513
            +V GEV+V K A  GVARV+V  +L
Sbjct  123  LVKGEVEVAKEAPAGVARVEVDPRL  147



>ref|NP_001118609.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE74850.1| uncharacterized protein AT3G10020 [Arabidopsis thaliana]
Length=142

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  ++EEG K V K EV+T N +T+K +E+KLM+KG+ R DR P+ GIP
Sbjct  6    VDETKNTVVLRAEHKNEEGRKSVDKFEVKTRNPETIKSVERKLMEKGVQRMDRHPSDGIP  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKS  405
            L +  SKSGHGGK+TWEGP    +YE+   P A+DE DPNY +E+ +KS
Sbjct  66   LRRPPSKSGHGGKYTWEGPDRMEDYEMQPDPPAMDEGDPNYDEEQVKKS  114



>ref|XP_009353178.1| PREDICTED: uncharacterized protein LOC103944436 [Pyrus x bretschneideri]
Length=128

 Score =   113 bits (282),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 93/145 (64%), Gaps = 27/145 (19%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID+ K+ VT RAV  DEEG KRV K E+ THNID++K                    
Sbjct  1    MKPIDDKKDKVTIRAVTHDEEGRKRVEKMELHTHNIDSIK--------------------  40

Query  253  GIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgv  432
                    KSGHGGK+TWEGP DE E E+D VP AIDE+DPNYVDEE EK+I++GE +  
Sbjct  41   -----PPPKSGHGGKYTWEGPGDEVEAEMDPVPPAIDERDPNYVDEETEKNIVKGEDADA  95

Query  433  egmvvgevdvPKVAA--EGVARVDV  501
             G+VVGEV+V K A   EGVARV+V
Sbjct  96   AGLVVGEVEVAKAAEDREGVARVEV  120



>ref|XP_010543478.1| PREDICTED: uncharacterized protein LOC104816380 [Tarenaya hassleriana]
Length=135

 Score =   113 bits (282),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +   K TV  +A  R E+G KR+ + E++T N +T+KH+E+KLMD+G+ R +R P  GIP
Sbjct  6    VYENKNTVVLKAEHRGEDGAKRIERFELKTRNPETIKHMERKLMDQGVQRMERHPVDGIP  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILR  414
            L +   KSGHGGKFTWEGP   A+YEL   P A+D+ DPNY DEE E +  R
Sbjct  66   LKRPPPKSGHGGKFTWEGPGGVADYELYPDPPAMDKGDPNYYDEEEEVTAKR  117



>ref|XP_009773683.1| PREDICTED: uncharacterized protein LOC104223863 [Nicotiana sylvestris]
Length=129

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 85/124 (69%), Gaps = 2/124 (2%)
 Frame = +1

Query  151  TKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAE  330
             K +V+T N+D +K+IE+KL +KG+ R +R PA G+PL    K GHGGKFTWEGP  EAE
Sbjct  8    NKEKVDTKNVDKIKYIERKLTEKGVQRLERHPADGLPLKHDPKKGHGGKFTWEGPDKEAE  67

Query  331  YELDDVPAAIDEKDPNYVDEEAEKSILRgevsgvegmvvgevdvPKVAAEGVARVDVHHQ  510
             E++  P A+DEKDPNYVDE AE+ +++ E  G   +   EV   KVA EGVARV++   
Sbjct  68   NEMEPAPPALDEKDPNYVDEIAEEKLMKEEEIGGVVVGKVEVA--KVAEEGVARVEIDPN  125

Query  511  LQPN  522
            L+ N
Sbjct  126  LKVN  129



>ref|XP_010912218.1| PREDICTED: uncharacterized protein LOC105038195 [Elaeis guineensis]
Length=155

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 91/151 (60%), Gaps = 17/151 (11%)
 Frame = +1

Query  115  AVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP-LGKQSKSGH  288
             V RDEEG K+V K EV  T   DT+++ E+KL+DKGIHR DR PA G+  L +  KSGH
Sbjct  6    GVSRDEEGKKKVEKVEVPRTRRPDTIRYFERKLVDKGIHRMDRHPADGLGGLHQVPKSGH  65

Query  289  GGKFTWEGPADEAEYELDDVPAAIDEKDPNYV--------------DEEAEKSILRgevs  426
            GGKFTWEGPADEA  ELD VP AID  DPNYV              ++EAE+ ++     
Sbjct  66   GGKFTWEGPADEAYNELDPVPPAIDPNDPNYVEEEEEEPTRSRGEQEDEAEEGVMTKPSD  125

Query  427  gvegmvvgevdvPKVAAEGVARVDVHHQLQP  519
             +    V    V + A EG++R++V   LQP
Sbjct  126  ALVVGEVEVAKVAE-AKEGISRIEVLPPLQP  155



>ref|XP_006407615.1| hypothetical protein EUTSA_v10021699mg [Eutrema salsugineum]
 gb|ESQ49068.1| hypothetical protein EUTSA_v10021699mg [Eutrema salsugineum]
Length=151

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 95/145 (66%), Gaps = 3/145 (2%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA   D+E  K V K EV+T N +T+K +E+KLM+KG+ R DR  + GIP
Sbjct  6    VDETKNTVVLRAEHPDKESRKSVEKFEVKTRNPETIKQVERKLMEKGVQRMDRHSSDGIP  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgveg  438
            L +  SKSGHGGK+TWEGP    +YE+   P A+DE DPNY +E+ +K I  G+      
Sbjct  66   LKRPPSKSGHGGKYTWEGPDRMEDYEMQPDPPAMDEGDPNYDEEQTKKKI--GDDDVAVA  123

Query  439  mvvgevdvPKVAAEGVARVDVHHQL  513
            +V GEV+V K A  GVARV+V  +L
Sbjct  124  LVRGEVEVAKEAPAGVARVEVDPRL  148



>ref|XP_011094428.1| PREDICTED: uncharacterized protein LOC105174128 [Sesamum indicum]
Length=144

 Score =   110 bits (275),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 101/147 (69%), Gaps = 8/147 (5%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D  K+ VT RA  R +EG K V K E++TH+++T+K++E+KL+DKG+ R +R PA G+P
Sbjct  6    LDEKKDKVTIRAECRADEGRKHVEKVELKTHDVETVKYVERKLVDKGVGRLERHPADGLP  65

Query  262  LGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgvegm  441
            L    K GHGGK+TWEGP  E E EL+  P AIDEKDPNYV+EE  +        G + +
Sbjct  66   LKHDPKKGHGGKYTWEGPEKEFEAELEAEP-AIDEKDPNYVEEEVGEE-------GTDEL  117

Query  442  vvgevdvPKVAAEGVARVDVHHQLQPN  522
            VVGEV+V K A EGVAR++V   L+ N
Sbjct  118  VVGEVEVAKAAEEGVARIEVDPHLKVN  144



>emb|CDX74003.1| BnaA03g30440D [Brassica napus]
Length=151

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 91/145 (63%), Gaps = 4/145 (3%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  RDEEG K V K E++T N DT+K +EKKLMDKG+ R +R P+ G  
Sbjct  6    VDETKNTVVLRAEHRDEEGRKAVDKLELKTRNPDTIKQVEKKLMDKGVQRMERHPSDGTQ  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgveg  438
            + +   KSGHGGK+TWEG     +YE+   PAA+DE DPNY   + EK    G       
Sbjct  66   IKRPPPKSGHGGKYTWEGSDRMEDYEMQPDPAAMDEGDPNY---DEEKIGGGGGDDVAVE  122

Query  439  mvvgevdvPKVAAEGVARVDVHHQL  513
            +V GEV+V K A  GVARV+V  +L
Sbjct  123  VVKGEVEVAKEAPGGVARVEVDPRL  147



>ref|XP_009135032.1| PREDICTED: uncharacterized protein LOC103859273 [Brassica rapa]
Length=151

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 91/145 (63%), Gaps = 4/145 (3%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  RDEEG K V K E++T N DT+K +EKKLMDKG+ R +R P+ G  
Sbjct  6    VDETKNTVVLRAEHRDEEGRKAVDKLELKTRNPDTIKQVEKKLMDKGVQRMERHPSDGTQ  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgveg  438
            + +   KSGHGGK+TWEG     +YE+   PAA+DE DPNY   + EK    G       
Sbjct  66   IKRPPPKSGHGGKYTWEGSDRMEDYEMQPDPAAMDEGDPNY---DEEKIGGGGGDDVAVE  122

Query  439  mvvgevdvPKVAAEGVARVDVHHQL  513
            +V GEV+V K A  GVARV+V  +L
Sbjct  123  VVKGEVEVAKEAPGGVARVEVDPRL  147



>ref|XP_008804382.1| PREDICTED: uncharacterized protein LOC103717683 [Phoenix dactylifera]
Length=155

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 91/155 (59%), Gaps = 17/155 (11%)
 Frame = +1

Query  103  VTFRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP-LGKQS  276
            +  R   RDEEG K+V K EV  T   DT+++ EKK++DKG+HR DR P  G+  L +  
Sbjct  2    MEIRGESRDEEGKKKVEKVEVPRTQRPDTIRYFEKKMVDKGVHRMDRHPVDGLGGLHQVP  61

Query  277  KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYV--------------DEEAEKSILR  414
            KSGHGGKFTWEGPADEA  EL+ +P AID  DPNYV              D+EAE+ ++ 
Sbjct  62   KSGHGGKFTWEGPADEAYNELEPLPPAIDPNDPNYVEEEEEEPTGGRGGQDDEAEEDVMT  121

Query  415  gevsgvegmvvgevdvPKVAAEGVARVDVHHQLQP  519
                 V    V    V + A +GV+RV+V   LQP
Sbjct  122  KPSDAVVVGEVEVAKVAE-AKQGVSRVEVLPPLQP  155



>ref|XP_009601860.1| PREDICTED: uncharacterized protein LOC104097057 [Nicotiana tomentosiformis]
Length=131

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  151  TKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAE  330
             K +V+T N+D +K+IE+KL +KG+ R +R PA G+PL    K GHGGK+TWEGP  EA 
Sbjct  8    NKEKVDTKNVDKIKYIERKLTEKGVQRLERHPADGLPLKHDPKKGHGGKYTWEGPDKEAV  67

Query  331  YELDDVPAAIDEKDPNYVDEEAEKSILRgevsgvegmvvgevdvPKVAAEGVARVDVHHQ  510
             EL+  P A+DEKDPNY+DEEAE+ +++ E  G  G+V+GEV+V K+A EGVARVDV   
Sbjct  68   NELEPAPPALDEKDPNYLDEEAEEKLIKEEELGGFGVVLGEVEVAKMAEEGVARVDVDPH  127

Query  511  LQPN  522
            L+ N
Sbjct  128  LKLN  131



>gb|KFK38384.1| hypothetical protein AALP_AA3G106600 [Arabis alpina]
Length=154

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA   +EEG K V K E++T N DT+K +EKKLM+KG+ R +R P+ G  
Sbjct  6    VDETKNTVVLRAAHSNEEGRKCVDKFELKTRNPDTIKQVEKKLMEKGVQRMERHPSDGNS  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEA  396
            L +   KSGHGGK+TWEGP    +YE+   P A+DE DPNY +E+ 
Sbjct  66   LKRPPPKSGHGGKYTWEGPDRMEDYEMHPYPPAMDEGDPNYDEEQT  111



>gb|KHN18722.1| hypothetical protein glysoja_021473 [Glycine soja]
Length=130

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 68/107 (64%), Gaps = 20/107 (19%)
 Frame = +1

Query  73   MKPIDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPAS  252
            MKPID+ +ETVT RAV  DEEG KRV K E+ THNI T+K++EKKL++KG+ R       
Sbjct  1    MKPIDDKQETVTIRAVSHDEEGRKRVEKTELNTHNIHTIKYVEKKLINKGVQR-------  53

Query  253  GIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEE  393
                         GKFTWEGPA   + EL   PAA+DE DPNY+D E
Sbjct  54   -------------GKFTWEGPASVEDNELMTEPAAMDEGDPNYLDWE  87



>ref|XP_010683892.1| PREDICTED: uncharacterized protein LOC104898501 [Beta vulgaris 
subsp. vulgaris]
Length=151

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TKETVT RA  RDEEG     K EV TH++D+LKH+EKKL+D G+HR +R  A    
Sbjct  5    VDETKETVTLRAKHRDEEGKIVTEKVEVHTHDVDSLKHVEKKLVDTGLHRLERHSADHKA  64

Query  262  LGKQ--SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAE  399
              K+   K G GGK+TWEGP  EA+ EL+     +DE DPN+VD+E E
Sbjct  65   SVKKPPPKKGRGGKYTWEGPMTEADVELEAGVPVLDEGDPNFVDDEKE  112



>ref|XP_006341175.1| PREDICTED: uncharacterized protein LOC102596945 [Solanum tuberosum]
Length=145

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 100/151 (66%), Gaps = 11/151 (7%)
 Frame = +1

Query  73   MKPI--DNTKETVTFRAVGR-DEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRR  243
            MKP+  + T   VT +   R +EEG K + K E++T N+DT+K++EKKL +KG+ R +R 
Sbjct  1    MKPVVEETTNGKVTIKTECRANEEGRKHIEKLELDTKNVDTVKYVEKKLTEKGVQRLERH  60

Query  244  PASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgev  423
            P+ G+PL    K G+GGK+TWEGP  + E ++  VP A+DEKDPNYV+EE  +       
Sbjct  61   PSDGLPLKHDPKKGYGGKYTWEGPDKDKELDM-VVPPALDEKDPNYVNEEETEE------  113

Query  424  sgvegmvvgevdvPKVAAEGVARVDVHHQLQ  516
                G++VGE++V K+A EGVAR++V   L+
Sbjct  114  -EEGGVIVGEIEVAKLAEEGVARIEVDPNLK  143



>emb|CDY66900.1| BnaC03g73280D [Brassica napus]
Length=151

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 2/105 (2%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D TK TV  RA  RDEEG K V K E++T N D +K +EKKLM+KG+ R +R P+ G  
Sbjct  6    VDETKNTVVLRAEHRDEEGRKAVDKLELKTRNPDMIKQVEKKLMEKGVQRMERHPSDGTQ  65

Query  262  LGK-QSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEE  393
            + +   KSGHGGK+TWEG     +YE+   P A+DE DPNY DEE
Sbjct  66   IKRPPPKSGHGGKYTWEGAGRMEDYEMQPDPPAMDEGDPNY-DEE  109



>ref|XP_010248412.1| PREDICTED: uncharacterized protein LOC104591302 [Nelumbo nucifera]
Length=151

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 78/113 (69%), Gaps = 5/113 (4%)
 Frame = +1

Query  91   TKETVTF-RAVGRDEEGG-KRVTKHEVE-THNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +K++V+F R V  D+EGG KR  + EV+  HN D +K+IEK+L DKG+ R +R P  G+ 
Sbjct  6    SKDSVSFDRVVDEDDEGGRKRAERKEVKKPHNPDRVKYIEKQLWDKGVQRMERHPVDGLG  65

Query  262  -LGKQS-KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILR  414
             LG+   KSGHGGK+TWE P D AE EL     AIDE DPNYV+EE EK +++
Sbjct  66   GLGQPPPKSGHGGKYTWEDPCDAAENELSPTLPAIDEGDPNYVEEEEEKGVVK  118



>ref|XP_003578916.2| PREDICTED: uncharacterized protein LOC100822693 [Brachypodium 
distachyon]
Length=182

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 85/154 (55%), Gaps = 11/154 (7%)
 Frame = +1

Query  55   ELKKKKMKPIDNTKETVTFRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHR  231
            EL++    P      T   R V RDEEG K   K  + +T  +DT KH E+K  DKG+HR
Sbjct  26   ELRRSSAPP------TAHMRVVHRDEEGHKVNEKVPIPDTRRLDTAKHFERKFEDKGLHR  79

Query  232  KDRRPASG---IPLG-KQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAE  399
             +R PA+    + +G    KSG GGKFTWEGP      ELD VPAAID  DPNYVD E E
Sbjct  80   LERHPANAPARVGIGAPPPKSGRGGKFTWEGPGGIVGNELDPVPAAIDRNDPNYVDPEEE  139

Query  400  KSILRgevsgvegmvvgevdvPKVAAEGVARVDV  501
            +   +GE   V    V    V ++   GVARVDV
Sbjct  140  EQQEQGEGEEVVVGEVEVAKVAQLGRAGVARVDV  173



>gb|EMT07145.1| hypothetical protein F775_08244 [Aegilops tauschii]
Length=145

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 65/103 (63%), Gaps = 5/103 (5%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPAS---GIPLGKQS  276
             R V RDEEG K   K  V ET   DT +H+E+KL ++G+HR +R PA+   G+ +G   
Sbjct  4    MRVVHRDEEGHKVAEKVPVPETRRPDTARHVERKLEEQGLHRLERHPANAPRGVGIGAPP  63

Query  277  -KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEK  402
             KSG GGK+TWEGP    + ELD  PAAID  DPNY +E  E+
Sbjct  64   PKSGRGGKYTWEGPEGLVDSELDPAPAAIDRNDPNYEEEGGEQ  106



>dbj|BAK05668.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=138

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 5/96 (5%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPAS---GIPLGKQS  276
             R V RDEEG K   K  V ET   DT KH+E+KL ++G+HR +R PA+   G+ +G   
Sbjct  4    MRVVHRDEEGHKVAEKVAVPETRRPDTAKHVERKLEEQGLHRLERHPANAPRGVGIGAPP  63

Query  277  -KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNY  381
             KSG GGK+TWEGP    + ELD  PAAID  DPNY
Sbjct  64   PKSGRGGKYTWEGPEGLVDSELDPAPAAIDRNDPNY  99



>ref|XP_007027599.1| Uncharacterized protein TCM_022422 [Theobroma cacao]
 gb|EOY08101.1| Uncharacterized protein TCM_022422 [Theobroma cacao]
Length=255

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 5/88 (6%)
 Frame = +1

Query  64   KKKMKPIDNTKE----TVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHR  231
            K +MKPI++ KE     V  +AV  DEE  K+V K EV + NIDT+K++EKKL DKG+ R
Sbjct  97   KVEMKPINDKKEDKKTPVVIQAVSHDEERKKKVEKTEVPSRNIDTIKYVEKKLEDKGVQR  156

Query  232  KDRRPASGIPLGK-QSKSGHGGKFTWEG  312
             +R PA+GI +G+   KSGHGGK+TWEG
Sbjct  157  MERHPANGIGIGRPPPKSGHGGKYTWEG  184



>ref|XP_004977523.1| PREDICTED: uncharacterized protein LOC101763194 [Setaria italica]
Length=149

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 60/101 (59%), Gaps = 5/101 (5%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPAS---GIPLG-KQ  273
             R   RDEEG K   K  + ET   DT KH E+KL ++G HR +R PA+   G+ +G   
Sbjct  4    MRVTHRDEEGKKVTEKMPIPETRRPDTAKHFERKLEEQGFHRLERHPANAPRGVGIGTPP  63

Query  274  SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEA  396
             KSG GGK+TWEGP    E ELD  P AID  DPNY +EE 
Sbjct  64   PKSGRGGKYTWEGPGGLVEDELDPAPPAIDPNDPNYEEEEG  104



>ref|NP_001145601.1| uncharacterized protein LOC100279079 [Zea mays]
 gb|ACG48804.1| hypothetical protein [Zea mays]
Length=144

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 62/102 (61%), Gaps = 7/102 (7%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPAS---GIPLG-KQ  273
             R   RDEEG K   K  V ET   DT KH E+KL ++G+HR +R PA+   G+ +G   
Sbjct  5    MRVTHRDEEGKKVTEKMPVPETRRPDTAKHFERKLEEQGLHRFERHPANAPRGVGIGAPP  64

Query  274  SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAE  399
             KSG GGK+TWEGP    E +LD  P AID  DPNY  EEAE
Sbjct  65   PKSGRGGKYTWEGPGSVVEDQLDPAPPAIDPNDPNY--EEAE  104



>ref|NP_001066153.1| Os12g0147200 [Oryza sativa Japonica Group]
 gb|ABA95789.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29172.1| Os12g0147200 [Oryza sativa Japonica Group]
 gb|EAY82256.1| hypothetical protein OsI_37462 [Oryza sativa Indica Group]
 dbj|BAG88821.1| unnamed protein product [Oryza sativa Japonica Group]
Length=147

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = +1

Query  103  VTFRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPASGI-PLGKQS  276
            +  RA  RDEEG K   K  V ET + DT +H E+KL  +G+HR +R PA+G   +G   
Sbjct  2    MYMRATHRDEEGKKVTEKVAVPETRHPDTARHFERKLDQQGLHRMERHPANGSRGIGAPP  61

Query  277  -KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNY  381
             KSG GGKFTWEGP    + +LD +PAAID  DPNY
Sbjct  62   PKSGRGGKFTWEGPDSIVDSQLDPLPAAIDRNDPNY  97



>emb|CBX24461.1| hypothetical_protein [Oryza glaberrima]
Length=147

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 61/96 (64%), Gaps = 3/96 (3%)
 Frame = +1

Query  103  VTFRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPASGI-PLGKQS  276
            +  RA  RDEEG K   K  V ET + DT +H E+KL  +G+HR +R PA+G   +G   
Sbjct  2    MYVRATHRDEEGKKVTEKVAVPETRHPDTARHFERKLDQQGLHRMERHPANGSRGIGAPP  61

Query  277  -KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNY  381
             KSG GGKFTWEGP    + +LD +PAAID  DPNY
Sbjct  62   PKSGRGGKFTWEGPDSVVDSQLDPLPAAIDRNDPNY  97



>ref|NP_001145418.1| uncharacterized protein LOC100278780 [Zea mays]
 gb|ACG47411.1| hypothetical protein [Zea mays]
Length=153

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 63/103 (61%), Gaps = 7/103 (7%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPAS---GIPLGKQS  276
             R   RDEEG K   K  V ET   DT KH E+KL ++G+HR +R PA+   G+ +G   
Sbjct  5    MRVTHRDEEGKKVTEKMPVPETRRPDTAKHFERKLEEQGLHRFERHPANAPRGVGIGAPP  64

Query  277  -KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEK  402
             KSG GGK+TWEGP    E +LD  P AID  DPNY  EEAE+
Sbjct  65   PKSGRGGKYTWEGPGGLVEDQLDPAPPAIDPNDPNY--EEAEE  105



>ref|XP_002441825.1| hypothetical protein SORBIDRAFT_08g002950 [Sorghum bicolor]
 gb|EES15663.1| hypothetical protein SORBIDRAFT_08g002950 [Sorghum bicolor]
Length=146

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPAS---GIPLG-KQ  273
             R   RDEEG K   K  V ET   DT KH E+KL ++G+HR +R PA+   G+ +G   
Sbjct  5    MRVTHRDEEGKKVTEKMPVPETRRPDTAKHFERKLEEQGLHRFERHPANAPRGVGIGTPP  64

Query  274  SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNY  381
             KSG GGKFTWEGP    + +LD  P AID  DPNY
Sbjct  65   PKSGRGGKFTWEGPGGVVDGQLDPAPPAIDANDPNY  100



>gb|ACG25635.1| hypothetical protein [Zea mays]
 gb|ACR38529.1| unknown [Zea mays]
 gb|AFW56024.1| hypothetical protein ZEAMMB73_452374 [Zea mays]
Length=148

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPAS---GIPLG-KQ  273
             R   RDEEG K   K  V ET   DT KH E+KL ++G+HR +R PA+   G+ +G   
Sbjct  5    MRVTHRDEEGKKVTEKMPVPETRRPDTAKHFERKLEEQGLHRFERHPANAPRGVGIGAPP  64

Query  274  SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNY  381
             KSG GGK+TWEGP    E +LD  P AID  DPNY
Sbjct  65   PKSGRGGKYTWEGPGSVVEDQLDPAPPAIDPNDPNY  100



>emb|CBX25316.1| hypothetical_protein [Oryza brachyantha]
Length=144

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 55/95 (58%), Gaps = 4/95 (4%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPLG---KQS  276
             R   RDEEG K   K  + ET   DT KH E+KL ++G HR +R PA+G   G      
Sbjct  1    MRVTHRDEEGKKVTEKMPIPETRRPDTAKHFERKLEEQGFHRLERHPANGPARGIGAPPP  60

Query  277  KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNY  381
            KSG GGKFTWEGP    + +LD  P AID  DPNY
Sbjct  61   KSGRGGKFTWEGPDGLVDTQLDPAPPAIDPDDPNY  95



>ref|XP_004246568.1| PREDICTED: uncharacterized protein LOC101245195 [Solanum lycopersicum]
Length=136

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 84/131 (64%), Gaps = 19/131 (15%)
 Frame = +1

Query  127  DEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTW  306
            +EEG K + K +++T N+DT+K++EKKL +KG+ R +R P+ G+PL    K GHGGK+TW
Sbjct  22   NEEGRKHIEKLDLDTKNVDTVKYVEKKLTEKGVQRLERHPSDGLPLKHDPKKGHGGKYTW  81

Query  307  EGPADEAEYELDDVPAAIDEKDPNY-VDEEAEKSILRgevsgvegmvvgevdvPKVAAEG  483
            EGP        D   A  DE+D N+ V+EEAE            G++VGE++V K+A EG
Sbjct  82   EGP--------DKYNA--DERDLNHNVNEEAEDD--------EGGVIVGEIEVAKLAEEG  123

Query  484  VARVDVHHQLQ  516
            VAR+++   L+
Sbjct  124  VARIEIDPNLK  134



>ref|XP_004978666.1| PREDICTED: uncharacterized protein LOC101777396 [Setaria italica]
Length=148

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 83/142 (58%), Gaps = 10/142 (7%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPAS---GIPLG-KQ  273
             R   RDEEG K   K  + ET   DT KH E+KL ++G HR +R PA+   G+ +G   
Sbjct  4    MRVTHRDEEGKKVTEKMPIPETRRPDTAKHFERKLEEQGFHRLERHPANAPRGVGIGTPP  63

Query  274  SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgvegmvvge  453
             KSG GGK+TWEGP    + ELD  P AID  DPNY   E +   +  E    + +VVGE
Sbjct  64   PKSGRGGKYTWEGPGGLVQDELDPAPPAIDPNDPNY---EEDDGAVGAEDDAAKEVVVGE  120

Query  454  vdvPKVAAE--GVARVDVHHQL  513
            V+V KVA E  GVARVDV  QL
Sbjct  121  VEVAKVAEERDGVARVDVAPQL  142



>emb|CBX25514.1| hypothetical_protein [Oryza glaberrima]
Length=143

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 60/113 (53%), Gaps = 12/113 (11%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPLG----KQ  273
             R   RDEEG K   K  + ET   DT +H E+KL ++G HR +R PA+G          
Sbjct  1    MRVTHRDEEGKKVTEKVPIPETRRPDTARHFERKLEEQGFHRLERHPANGPARAGIGAPP  60

Query  274  SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNY-------VDEEAEKSIL  411
             KSG GGKFTWEGP    + +L   P A+D  DPNY       VDEE  K ++
Sbjct  61   PKSGRGGKFTWEGPDGPVDAQLQPAPPAVDPNDPNYDEGDGAGVDEEVAKEVV  113



>ref|NP_001065754.1| Os11g0149200 [Oryza sativa Japonica Group]
 gb|AAX92746.1| AT3g10020/T22K18_16 [Oryza sativa Japonica Group]
 gb|ABA91490.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27599.1| Os11g0149200 [Oryza sativa Japonica Group]
 gb|EAY79947.1| hypothetical protein OsI_35111 [Oryza sativa Indica Group]
Length=146

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 60/113 (53%), Gaps = 12/113 (11%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPLG----KQ  273
             R   RDEEG K   K  + ET   DT +H E+KL ++G HR +R PA+G          
Sbjct  4    MRVTHRDEEGKKVTEKVPIPETRRPDTARHFERKLEEQGFHRLERHPANGPARAGIGAPP  63

Query  274  SKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNY-------VDEEAEKSIL  411
             KSG GGKFTWEGP    + +L   P A+D  DPNY       VDEE  K ++
Sbjct  64   PKSGRGGKFTWEGPDGPVDAQLQPAPPAVDPNDPNYDEGDGAGVDEEVAKEVV  116



>ref|XP_007202841.1| hypothetical protein PRUPE_ppa014598mg [Prunus persica]
 gb|EMJ04040.1| hypothetical protein PRUPE_ppa014598mg [Prunus persica]
Length=124

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 5/85 (6%)
 Frame = +1

Query  277  KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSILRgevsgvegmvvgev  456
            KSGHGGK+ WEGP D AE E+D VP AIDE DPNYVDE AE+ I++GE + V G+VVG+V
Sbjct  39   KSGHGGKYKWEGPDDVAENEMDPVPPAIDEGDPNYVDEVAEERIVKGEDADVAGLVVGKV  98

Query  457  dvPKVAA--EGVARVDV---HHQLQ  516
            +V K     EGVARV+V   H+ L+
Sbjct  99   EVAKATENREGVARVEVVTPHNHLE  123



>gb|ADE77124.1| unknown [Picea sitchensis]
Length=142

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 59/104 (57%), Gaps = 11/104 (11%)
 Frame = +1

Query  190  KHIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEK  369
            +++++K + KG  R +R P SG   G   KSGHGGK+TWEGP  E     DD PAAIDE 
Sbjct  28   EYLQQKTVQKGYERLERHPVSGY-RGLPRKSGHGGKYTWEGPRGEE----DDFPAAIDEH  82

Query  370  DPNYVDEEAEKSILRgevsgvegmvvgevdvPKVAAEGVARVDV  501
            DPN++D+  E+         VE   V        A +GVAR+DV
Sbjct  83   DPNFIDDAQEQRDREVADGVVEAAKV------PAAPQGVARIDV  120



>ref|XP_010552987.1| PREDICTED: uncharacterized protein LOC104823222 [Tarenaya hassleriana]
Length=100

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D  K TV  +A  R E+G KR+ K E++T N D +KHIE+KLMD+G+ R +R P  GIP
Sbjct  6    VDEKKNTVVLKAEHRSEDGMKRIEKFELKTRNPDKIKHIERKLMDQGVQRMERHPMDGIP  65

Query  262  LGK-QSKSGHGGK  297
            L +   KSG+  +
Sbjct  66   LKRPPPKSGYSTR  78



>ref|XP_009353179.1| PREDICTED: uncharacterized protein LOC103944437 [Pyrus x bretschneideri]
Length=114

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +1

Query  82   IDNTKETVTFRAVGRDEEGGKRVTKHEVETHNIDTLKHIEKKLMDKGIHRKDRRPASGIP  261
            +D+ K  +T R V  DEEG KRV K E+ THNID++K++EKKL+DKG+ R +R    G  
Sbjct  41   VDDKKYKLTIRMVTHDEEGRKRVEKMELPTHNIDSIKYVEKKLIDKGVQRLERHLRDGTG  100

Query  262  LGK-QSKSGHGGK  297
            + +   +SGHGGK
Sbjct  101  IRRPPPESGHGGK  113



>ref|XP_006663208.1| PREDICTED: uncharacterized protein LOC102706422 [Oryza brachyantha]
Length=128

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 46/92 (50%), Gaps = 17/92 (18%)
 Frame = +1

Query  109  FRAVGRDEEGGKRVTKHEV-ETHNIDTLKHIEKKLMDKGIHRKDRRPASGIPLGKQSKSG  285
             R   RDEEG K   K  + ET   DT KH E+KL ++G                  KSG
Sbjct  4    MRVTHRDEEGKKVTEKMPIPETRRPDTAKHFERKLEEQGF----------------PKSG  47

Query  286  HGGKFTWEGPADEAEYELDDVPAAIDEKDPNY  381
             GGKFTWEGP    + +LD  P AID  DPNY
Sbjct  48   RGGKFTWEGPDGLVDTQLDPAPPAIDPDDPNY  79



>ref|XP_002982408.1| hypothetical protein SELMODRAFT_421764 [Selaginella moellendorffii]
 gb|EFJ16653.1| hypothetical protein SELMODRAFT_421764 [Selaginella moellendorffii]
Length=130

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 6/74 (8%)
 Frame = +1

Query  193  HIEKKLMDKGIHRKDRRPASGIPLGKQS---KSGHGGKFTWEGPADEAEYELDDVPAAID  363
            + ++K   KG+ R +R    G P+G ++   K G GG+FTWEG  D  +Y+ + VP AID
Sbjct  33   YADRKNAKKGVERLNRH---GGPVGVRAQPKKGGKGGEFTWEGNKDPTQYDKESVPVAID  89

Query  364  EKDPNYVDEEAEKS  405
            EKDPNYVDEE E+ 
Sbjct  90   EKDPNYVDEEQEEQ  103



>ref|XP_002966570.1| hypothetical protein SELMODRAFT_407590 [Selaginella moellendorffii]
 gb|EFJ32597.1| hypothetical protein SELMODRAFT_407590 [Selaginella moellendorffii]
Length=130

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 6/74 (8%)
 Frame = +1

Query  193  HIEKKLMDKGIHRKDRRPASGIPLGKQS---KSGHGGKFTWEGPADEAEYELDDVPAAID  363
            + ++K   KG+ R +R    G P+G ++   K G GG+FTWEG  D  +Y+ + VP AID
Sbjct  33   YADRKNAKKGVERLNRH---GGPVGVRAQPKKGGKGGEFTWEGNKDPTQYDKESVPVAID  89

Query  364  EKDPNYVDEEAEKS  405
            EK PNYVDEE E+ 
Sbjct  90   EKGPNYVDEEQEEQ  103



>gb|ABK20936.1| unknown [Picea sitchensis]
Length=84

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 42/72 (58%), Gaps = 10/72 (14%)
 Frame = +1

Query  193  HIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPA---AID  363
            H   + + KGI R DRR ASGI  G   K GHGGKFTW G      +   D+P    A+D
Sbjct  15   HFRARDVKKGIERLDRRSASGIN-GSPKKGGHGGKFTWGG------FRSSDLPYSQPALD  67

Query  364  EKDPNYVDEEAE  399
            EKDPNY+D + E
Sbjct  68   EKDPNYMDRDDE  79



>ref|XP_002963484.1| hypothetical protein SELMODRAFT_405387 [Selaginella moellendorffii]
 gb|EFJ35355.1| hypothetical protein SELMODRAFT_405387 [Selaginella moellendorffii]
Length=130

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +1

Query  193  HIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELD-DVPAAIDEK  369
            H   K + KG+ RKDR P++GI    + KSG GG+FTWEG +   +Y    D+  A+D+ 
Sbjct  28   HAHLKNLKKGVERKDRHPSTGINPSPK-KSGRGGRFTWEGSSHADDYAASYDLNNALDKN  86

Query  370  DPNYVD  387
            DPNYVD
Sbjct  87   DPNYVD  92



>gb|ABK20932.1| unknown [Picea sitchensis]
Length=84

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 41/72 (57%), Gaps = 10/72 (14%)
 Frame = +1

Query  193  HIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVP---AAID  363
            H   + + KGI R DRR ASGI  G   K GHGGKFTW G      +   D P    A+D
Sbjct  15   HFRARDVKKGIERLDRRSASGIN-GSPKKGGHGGKFTWGG------FRSSDPPYSQPALD  67

Query  364  EKDPNYVDEEAE  399
            EKDPNY+D + E
Sbjct  68   EKDPNYMDRDDE  79



>ref|XP_001753773.1| predicted protein [Physcomitrella patens]
 gb|EDQ81525.1| predicted protein [Physcomitrella patens]
Length=174

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +1

Query  187  LKHIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDE  366
            + H+ ++ + KGI R DRR +     G   K GHGGKFT +GP  E +Y  + VP A+D+
Sbjct  23   VDHVHQQNLKKGIERLDRR-SEHPNKGAVKKHGHGGKFTVDGPYREEDY-ANPVPVAMDK  80

Query  367  KDPNYVDEEAEKS  405
             DPNYVD E E++
Sbjct  81   NDPNYVDPEEEEA  93



>ref|XP_002988193.1| hypothetical protein SELMODRAFT_426948 [Selaginella moellendorffii]
 gb|EFJ10612.1| hypothetical protein SELMODRAFT_426948 [Selaginella moellendorffii]
Length=130

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 4/67 (6%)
 Frame = +1

Query  193  HIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTWEGP--ADEAEYELDDVPAAIDE  366
            H   K + KG+ RKDR P++GI    + KSG GG+FTWEG   AD+     DD   A+D+
Sbjct  28   HAHLKNLKKGVERKDRHPSTGINPSPK-KSGRGGRFTWEGSSHADDYAASYDDN-NALDK  85

Query  367  KDPNYVD  387
             DPNYVD
Sbjct  86   NDPNYVD  92



>emb|CDX71716.1| BnaC08g31580D [Brassica napus]
Length=103

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +1

Query  211  MDKGIHRKDRRPASGIPLGKQS-KSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVD  387
            M+KG+ R +R P+ G  + +   KSGHGGK+TWEG A   +YE+   P A+DE D NY D
Sbjct  1    MEKGVQRMERHPSDGTQIRRPPPKSGHGGKYTWEGAARMEDYEMQPDPPAMDEGDLNY-D  59

Query  388  EE  393
            EE
Sbjct  60   EE  61



>emb|CDX91281.1| BnaC02g26920D [Brassica napus]
Length=103

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  211  MDKGIHRKDRRPASGIPL-GKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVD  387
            M+KG+ R +R P+ G  +     KSGHGGK+TWEG A   +YE+   P+ +DE D NY D
Sbjct  1    MEKGVQRMERHPSDGTKIRCPPPKSGHGGKYTWEGAARMEDYEMQPDPSTMDEGDLNY-D  59

Query  388  EE  393
            EE
Sbjct  60   EE  61



>ref|XP_001760726.1| predicted protein [Physcomitrella patens]
 gb|EDQ74465.1| predicted protein [Physcomitrella patens]
Length=119

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query  193  HIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKD  372
            H  ++ + KGI R DRR      L  + K GHGGKFT +GP  + +Y  + +PAA+DE D
Sbjct  25   HAHQQNLKKGIERLDRRSEHPNKLAVK-KHGHGGKFTVDGPFKDEDY-AESIPAAMDEHD  82

Query  373  PNYVD  387
            PNYVD
Sbjct  83   PNYVD  87



>emb|CDX91279.1| BnaC02g26900D [Brassica napus]
Length=103

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  211  MDKGIHRKDRRPASGIPL-GKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVD  387
            M+KG+ R +R P+ G  +     KSGHGGK+TWEG A   +Y++   P+ +DE D NY D
Sbjct  1    MEKGVQRMERHPSDGTKIRCLPPKSGHGGKYTWEGAARMEDYKMQPDPSVMDEGDLNY-D  59

Query  388  EE  393
            EE
Sbjct  60   EE  61



>ref|XP_003633116.1| PREDICTED: programmed cell death protein 4-like [Vitis vinifera]
Length=78

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +1

Query  229  RKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEEAEKSI  408
            RKDR+ A+G+  G   K GHGGKFTW G  + +  E++    A+D KDPN+ D E   S+
Sbjct  19   RKDRKSATGMS-GSPKKGGHGGKFTWSGDGN-SRTEIEFRNGAVDSKDPNFEDPEEIASV  76



>ref|XP_006853737.1| hypothetical protein AMTR_s00056p00175000 [Amborella trichopoda]
 gb|ERN15204.1| hypothetical protein AMTR_s00056p00175000 [Amborella trichopoda]
Length=73

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 2/53 (4%)
 Frame = +1

Query  229  RKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVD  387
            R DR+ A+G+  G   K GHGGKFTW GP    E E D +   +DEKDPNY D
Sbjct  19   RSDRKSATGM-SGDPKKGGHGGKFTWSGPQIFKENE-DYIREYMDEKDPNYQD  69



>gb|ADR71293.1| hypothetical protein 17 [Hevea brasiliensis]
Length=76

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 2/76 (3%)
 Frame = +1

Query  181  DTLKHIEKKLMDKGIHRKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAI  360
            +T+K  +     K   RKDR+ A+G+  G   K GHGGKFTW G    ++ E+     A+
Sbjct  3    NTVKSSKTNANSKSDVRKDRKSATGMS-GSPKKGGHGGKFTWAGDG-YSQAEIGLQGEAV  60

Query  361  DEKDPNYVDEEAEKSI  408
            D KDPN+ D E  +++
Sbjct  61   DVKDPNFEDPEETETV  76



>ref|XP_003620790.1| hypothetical protein MTR_6g090490 [Medicago truncatula]
 gb|AES77008.1| hypothetical protein MTR_6g090490 [Medicago truncatula]
 gb|AFK44390.1| unknown [Medicago truncatula]
Length=89

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = +1

Query  229  RKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVPAAIDEKDPNYVDEE  393
            RKDR+ +SG+  G   K GHGGKFTW G +D  +   ++  AA+D KDPN+ D E
Sbjct  22   RKDRKSSSGMS-GSPKKGGHGGKFTWIG-SDHLQIGAEN-EAALDSKDPNFEDHE  73



>ref|XP_006451323.1| hypothetical protein CICLE_v10010071mg [Citrus clementina]
 gb|ESR64563.1| hypothetical protein CICLE_v10010071mg [Citrus clementina]
 gb|KDO66603.1| hypothetical protein CISIN_1g034887mg [Citrus sinensis]
Length=80

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 5/63 (8%)
 Frame = +1

Query  226  HRKDRRPASGIPLGKQSKSGHGGKFTWEGPA-DEAEYELDDVPAAIDEKDPNYVDEEAEK  402
             R D++ A+G+  G   K GHGGK+TW G    +AE  LD+   AID  DPNY D E +K
Sbjct  20   QRSDKKSATGMN-GSPKKKGHGGKYTWSGDGYSQAEIGLDE---AIDANDPNYEDPEDQK  75

Query  403  SIL  411
              +
Sbjct  76   ETV  78



>gb|KHN40368.1| hypothetical protein glysoja_000866 [Glycine soja]
Length=74

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 6/54 (11%)
 Frame = +1

Query  229  RKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVP-AAIDEKDPNYVD  387
            RKDR+ A+G+  G   K GHGGKFTW G      YE  ++P  A+D KDPN+ D
Sbjct  19   RKDRKSATGLS-GSPKKGGHGGKFTWIGHG----YEQVEMPHGAMDAKDPNFED  67



>ref|XP_003516452.1| PREDICTED: programmed cell death protein 4-like isoform 1 [Glycine 
max]
Length=74

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 6/54 (11%)
 Frame = +1

Query  229  RKDRRPASGIPLGKQSKSGHGGKFTWEGPADEAEYELDDVP-AAIDEKDPNYVD  387
            RKDR+ A+G+  G   K GHGGKFTW G      YE  ++P  A+D KDPN+ D
Sbjct  19   RKDRKSATGLS-GSPKKGGHGGKFTWIGHG----YEQVEMPHGAMDAKDPNFED  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 776559819808