BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c89022_g1_i1 len=860 path=[1:0-859]

Length=860
                                                                      Score     E

ref|XP_010089669.1|  hypothetical protein L484_004093                 88.6    2e-17   
ref|XP_009780582.1|  PREDICTED: uncharacterized protein LOC104229621  87.0    6e-17   
ref|XP_009608767.1|  PREDICTED: uncharacterized protein LOC104102684  85.1    2e-16   
ref|XP_009611855.1|  PREDICTED: uncharacterized protein LOC104105301  85.5    3e-16   
ref|XP_004243685.1|  PREDICTED: uncharacterized protein LOC101244203  77.0    1e-13   
ref|XP_010656090.1|  PREDICTED: uncharacterized protein LOC100245572  76.6    2e-13   
ref|XP_011039931.1|  PREDICTED: uncharacterized protein LOC105136...  75.5    4e-13   
ref|XP_009796816.1|  PREDICTED: uncharacterized protein LOC104243335  75.1    7e-13   
ref|XP_011039929.1|  PREDICTED: uncharacterized protein LOC105136...  70.9    2e-11   
gb|KDP33961.1|  hypothetical protein JCGZ_07532                       69.7    5e-11   
ref|XP_011039930.1|  PREDICTED: uncharacterized protein LOC105136...  69.3    7e-11   
ref|XP_006381573.1|  hypothetical protein POPTR_0006s14000g           68.6    8e-11   
ref|XP_003546522.1|  PREDICTED: uncharacterized protein LOC100817225  69.3    8e-11   
ref|XP_002877267.1|  hypothetical protein ARALYDRAFT_905411           68.9    9e-11   
ref|XP_003534964.1|  PREDICTED: uncharacterized protein LOC100782725  68.9    1e-10   
ref|XP_008337817.1|  PREDICTED: uncharacterized protein LOC103400907  70.1    1e-10   
gb|KDO86964.1|  hypothetical protein CISIN_1g028671mg                 67.4    4e-10   
ref|XP_010514709.1|  PREDICTED: uncharacterized protein LOC104790626  66.2    7e-10   
ref|XP_006444519.1|  hypothetical protein CICLE_v10024151mg           66.2    8e-10   
gb|KEH37635.1|  transmembrane protein, putative                       65.9    2e-09   
ref|XP_010536252.1|  PREDICTED: uncharacterized protein LOC104811289  65.5    2e-09   
ref|XP_008242329.1|  PREDICTED: uncharacterized protein LOC103340669  65.1    3e-09   
ref|XP_004488125.1|  PREDICTED: uncharacterized protein LOC101502064  64.7    3e-09   
ref|XP_006492346.1|  PREDICTED: uncharacterized protein LOC102608396  64.3    5e-09   
ref|XP_006400645.1|  hypothetical protein EUTSA_v10014753mg           63.9    6e-09   
gb|KDO73809.1|  hypothetical protein CISIN_1g028872mg                 63.5    1e-08   
gb|KFK42155.1|  hypothetical protein AALP_AA2G218500                  63.2    1e-08   
ref|XP_010503024.1|  PREDICTED: uncharacterized protein LOC104780221  62.8    2e-08   
ref|XP_011093879.1|  PREDICTED: uncharacterized protein LOC105173717  62.4    2e-08   
ref|XP_002874014.1|  hypothetical protein ARALYDRAFT_488984           62.0    2e-08   
ref|XP_008352504.1|  PREDICTED: uncharacterized protein LOC103416009  62.0    3e-08   
ref|XP_010425806.1|  PREDICTED: uncharacterized protein LOC104710844  62.0    3e-08   
ref|XP_002540459.1|  conserved hypothetical protein                   60.8    7e-08   Ricinus communis
ref|XP_006353776.1|  PREDICTED: uncharacterized protein LOC102589679  60.5    8e-08   
ref|XP_003609966.1|  hypothetical protein MTR_4g124850                59.7    2e-07   
ref|XP_011078208.1|  PREDICTED: uncharacterized protein LOC105162007  59.3    3e-07   
ref|XP_007012559.1|  Cysteine and histidine-rich protein 1, putative  58.9    3e-07   
ref|XP_007202575.1|  hypothetical protein PRUPE_ppa011493mg           59.3    3e-07   
ref|NP_189897.1|  uncharacterized protein                             58.9    3e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33839.1|  hypothetical protein AALP_AA5G066500                  58.5    3e-07   
ref|XP_009131815.1|  PREDICTED: uncharacterized protein LOC103856462  58.5    4e-07   
ref|XP_007138624.1|  hypothetical protein PHAVU_009G224300g           58.5    5e-07   
ref|XP_010939867.1|  PREDICTED: uncharacterized protein LOC105058597  57.8    7e-07   
ref|XP_009608776.1|  PREDICTED: uncharacterized protein LOC104102694  57.8    1e-06   
emb|CDX88841.1|  BnaA03g08080D                                        57.4    1e-06   
gb|ACU24519.1|  unknown                                               57.0    1e-06   Glycine max [soybeans]
ref|XP_006419135.1|  hypothetical protein EUTSA_v10002680mg           57.0    1e-06   
ref|XP_010454385.1|  PREDICTED: uncharacterized protein LOC104736148  57.4    2e-06   
ref|XP_010493189.1|  PREDICTED: uncharacterized protein LOC104770456  57.4    2e-06   
ref|XP_010520522.1|  PREDICTED: uncharacterized protein LOC104799609  57.4    2e-06   
ref|XP_010049366.1|  PREDICTED: uncharacterized protein LOC104438004  56.6    2e-06   
ref|XP_010420925.1|  PREDICTED: uncharacterized protein LOC104706426  57.0    2e-06   
gb|KHN07876.1|  hypothetical protein glysoja_032420                   56.2    3e-06   
ref|XP_003542376.1|  PREDICTED: uncharacterized protein LOC100806863  56.2    3e-06   
emb|CDX70943.1|  BnaC03g10270D                                        56.2    3e-06   
ref|XP_006292946.1|  hypothetical protein CARUB_v10019217mg           56.2    3e-06   
gb|AAM63728.1|  unknown                                               56.2    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289919.1|  hypothetical protein CARUB_v10003535mg           56.2    4e-06   
ref|XP_009120771.1|  PREDICTED: uncharacterized protein LOC103845644  55.5    6e-06   
emb|CDX92435.1|  BnaA10g14740D                                        55.1    7e-06   
emb|CDY45068.1|  BnaA02g05080D                                        54.3    1e-05   
ref|XP_009126476.1|  PREDICTED: uncharacterized protein LOC103851374  53.9    2e-05   
ref|XP_006452867.1|  hypothetical protein CICLE_v10009511mg           54.3    2e-05   
gb|EYU25818.1|  hypothetical protein MIMGU_mgv1a020072mg              53.5    2e-05   
ref|NP_568401.1|  uncharacterized protein                             53.9    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009348910.1|  PREDICTED: uncharacterized protein LOC103940513  53.5    2e-05   
gb|EYU28305.1|  hypothetical protein MIMGU_mgv1a021094mg              53.5    3e-05   
emb|CDY16563.1|  BnaC09g37100D                                        53.5    3e-05   
ref|XP_009343378.1|  PREDICTED: uncharacterized protein LOC103935343  52.8    5e-05   
ref|XP_010917423.1|  PREDICTED: uncharacterized protein LOC105042019  52.0    9e-05   
ref|XP_008800514.1|  PREDICTED: uncharacterized protein LOC103714858  51.2    1e-04   
ref|XP_008803397.1|  PREDICTED: uncharacterized protein LOC103716956  51.2    2e-04   
ref|XP_004287665.1|  PREDICTED: uncharacterized protein LOC101305000  50.8    2e-04   
gb|KHN17746.1|  hypothetical protein glysoja_005943                   50.1    2e-04   
gb|ACU15609.1|  unknown                                               48.1    5e-04   Glycine max [soybeans]



>ref|XP_010089669.1| hypothetical protein L484_004093 [Morus notabilis]
 gb|EXB38188.1| hypothetical protein L484_004093 [Morus notabilis]
Length=198

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 88/176 (50%), Gaps = 18/176 (10%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNY+ F      + LWTW ++V+ AA   WRI+           S           
Sbjct  9    EALAFNYVSFGFFTIVNNLWTW-IAVVTAAVSVWRIRAAGEVSRCSEPSVSPPHDDRNSN  67

Query  164  asseppstaprttVTPFSASEGVD--------GSTKG-KFAAYFD-CDDELAggndaesn  313
                P +T  +   TP  A    +        G+TKG KF+ Y+D  D EL    +   +
Sbjct  68   RPLPPCATEEKPASTPIPAKAPANSVEETEIVGATKGGKFSLYYDDVDGELTEEYEEAID  127

Query  314  gngggggEVLV-KDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRRR  478
            G      E    ++W+G WERV+ TRMG+ GWYRYQD+T ++GNVVRLW+G  R R
Sbjct  128  GEMTVTEESDGGEEWWGIWERVLRTRMGKTGWYRYQDLTELNGNVVRLWDGDCRSR  183



>ref|XP_009780582.1| PREDICTED: uncharacterized protein LOC104229621 [Nicotiana sylvestris]
Length=229

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 87/207 (42%), Gaps = 49/207 (24%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskps----sepCQaaa  151
            EALAFNYL F      + +WTW ++V+AAA  FWRIK  S            S+    + 
Sbjct  9    EALAFNYLSFGLYTVVNNIWTW-LAVIAAAFSFWRIKTSSALLKPALVRGDFSDDASPSL  67

Query  152  arrpasseppstaprttVTPFSASEG----------------VDGSTKGKFAAYFDCDDE  283
             +                 P S S G                +  STKG+   YF  DD 
Sbjct  68   PQTAFVPPSEHVETVAADEPASTSRGPSITAPTTISPSVVFHIVHSTKGRLTTYFKQDDV  127

Query  284  LAg----------------------gndaesngngggggEVLVKDWYGCWERVMETRMGE  397
            L                         +   SN       +++  DWY  WE+V+ T+ GE
Sbjct  128  LGPCDDYVDCRDSTDKGESISSQWVQSSIFSNNGTVEMEDLMCNDWYQSWEKVIRTKKGE  187

Query  398  MGWYRYQDITVIDGNVVRLWEGGGRRR  478
            +GWY YQD+ VIDGNVVRLWEG  RRR
Sbjct  188  IGWYSYQDLHVIDGNVVRLWEGCRRRR  214



>ref|XP_009608767.1| PREDICTED: uncharacterized protein LOC104102684 [Nicotiana tomentosiformis]
Length=186

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 90/165 (55%), Gaps = 9/165 (5%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNYL F      + +W W V+V+ AA  FW+IK  S  P  +P  +   A +   P
Sbjct  10   EALAFNYLSFGFLTVVNNVWAW-VAVITAAVSFWKIKTSSTLPSPEPRGDFSGAPSPSPP  68

Query  164  asseppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEVL  343
             ++  PS++  TT          +  TKGK   YF  DD      D + +     G +  
Sbjct  69   QTTSVPSSSTVTTEMYTGVVMNKEEGTKGKLTVYFKQDD--GEECDVDGDDGDQKGEDGA  126

Query  344  VKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRRR  478
            V+ W+  WE +++ R GEMGWYRYQD+ VIDGNVVRLW+G  RRR
Sbjct  127  VEMWFENWENLLKMRNGEMGWYRYQDMKVIDGNVVRLWDGCRRRR  171



>ref|XP_009611855.1| PREDICTED: uncharacterized protein LOC104105301 [Nicotiana tomentosiformis]
Length=230

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 88/208 (42%), Gaps = 50/208 (24%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskps----sepCQaaa  151
            EALAFNYL F      + +WTW ++V+ AA  FWRIK  S    S       S+    + 
Sbjct  9    EALAFNYLSFGLFTVVNNIWTW-LAVITAAFSFWRIKTSSALLKSALVRGDFSDDSSPSL  67

Query  152  arrpasseppstaprttVTPFSASEGVD-------------GSTKGKFAAYFDCDDELAg  292
             R                 P S S G                STKG+F AY+  D+ L  
Sbjct  68   PRTAFVPPSEHGETVAADEPASTSRGPSITAPTTISPFHRVDSTKGRFTAYYKADNVLGP  127

Query  293  --------------------------gndaesngngggggEVLVKDWYGCWERVMETRMG  394
                                       +   SN       +++  DWY  WE+V+ T+ G
Sbjct  128  CNDDVDCRDSTDKEDHGESRISSQWVKSSILSNNGTVEVEDLMCNDWYQSWEKVIRTKKG  187

Query  395  EMGWYRYQDITVIDGNVVRLWEGGGRRR  478
            E+GWY YQD+ VIDGN+VRLWEG  RRR
Sbjct  188  EIGWYSYQDLHVIDGNIVRLWEGCRRRR  215



>ref|XP_004243685.1| PREDICTED: uncharacterized protein LOC101244203 [Solanum lycopersicum]
Length=171

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 83/162 (51%), Gaps = 14/162 (9%)
 Frame = +2

Query  2    EALAFNYLRFDKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpassepp  181
            EALAFNY  FD +WTW  +V+ AA  FW+IK  S + P+   +    A++          
Sbjct  10   EALAFNYWSFDVVWTWIAAVVTAAITFWKIKSSSSTLPTPEPALLTLASSQVELMRLSTE  69

Query  182  staprttVTPFSASEGVDGS-------TKGKFAAYFDCDDELAggndaesngngggggEV  340
             T      TP SA    D +       TKGK   YF+ +DE     D +  G       V
Sbjct  70   RTCS----TPASAVMLFDDAFLVKEEGTKGKVTVYFNPEDEDECNGDDQELGEEDKNDGV  125

Query  341  LVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGG  466
               +W+  WE++++ R GE GWY YQD+ +I+G++VRLW+G 
Sbjct  126  ---EWFENWEKLLKLRKGERGWYCYQDMKLINGSIVRLWDGS  164



>ref|XP_010656090.1| PREDICTED: uncharacterized protein LOC100245572 [Vitis vinifera]
Length=189

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 83/173 (48%), Gaps = 14/173 (8%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslspp------skpssepCQa  145
            +ALAFNY+ F      + LWTW V+V+ AA  FW I++ + +         K        
Sbjct  11   DALAFNYVSFGFFALVNNLWTW-VAVVTAAVSFWSIRIRAAASAGAVLSPLKSEPPELHD  69

Query  146  aaarrpasseppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesn-gng  322
                  ++       P  +  P   + G  G TKGKF  Y++ D +  G           
Sbjct  70   RETDASSAPSTLKEDPAPSTVPAVVAAGGGGVTKGKFTVYYENDRKSDGEVALAGPWAAS  129

Query  323  ggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRRRS  481
                +    +W   WE VM+TRMGE+GWY  QD TV++G+VVR W+G GRRRS
Sbjct  130  DCDVDGDCGEWSQWWEGVMKTRMGELGWYSCQDRTVLNGSVVRFWDGRGRRRS  182



>ref|XP_011039931.1| PREDICTED: uncharacterized protein LOC105136332 isoform X3 [Populus 
euphratica]
 ref|XP_011039932.1| PREDICTED: uncharacterized protein LOC105136332 isoform X4 [Populus 
euphratica]
Length=199

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 90/185 (49%), Gaps = 28/185 (15%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            +ALAF+Y+        + LWTW V+V+ AA  FWRI+           S        +  
Sbjct  9    DALAFDYVNLGILAIINNLWTW-VAVITAAVSFWRIRAAGAVKTLAEPSPSPDYIERQIT  67

Query  164  asseppstaprttVTPFSASEGV--------------DGSTKGKFAAYFDCDDELAggnd  301
             SS P +++  TT TP S +E                +G  KGKF  Y+  DD    GN 
Sbjct  68   ESSHPETSSTATTATPKSVTEPAAPGSVSSSPSVFEDNGPKKGKFVVYYQDDDRQNEGNL  127

Query  302  aesngngggggEVLVKDWYGC------WERVMETRMGEMGWYRYQDITVIDGNVVRLWEG  463
             + + +G     VL  +W  C      WER++   MGE GWYR QD+TVI+GNVVRLW+G
Sbjct  128  DDDDEDGEEELTVL-GEWRRCGGEITLWERMLRVSMGEYGWYRCQDLTVINGNVVRLWDG  186

Query  464  GGRRR  478
              R +
Sbjct  187  VRREK  191



>ref|XP_009796816.1| PREDICTED: uncharacterized protein LOC104243335 [Nicotiana sylvestris]
Length=200

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 88/179 (49%), Gaps = 23/179 (13%)
 Frame = +2

Query  2    EALAFNYLRFD------KLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNYL F        +W W V+V+ AA  FWRIK  S  P  +P  +   A +   P
Sbjct  10   EALAFNYLSFGFLTVVYNVWAW-VAVITAAVSFWRIKTSSTLPLPEPRGDFSGAPSPSPP  68

Query  164  asseppstaprttVT-----PFSA---------SEGVDGSTKGKFAAYFDCDDELAggnd  301
              +  PS +    V      P S          S   +  TKGK   YF  DD      D
Sbjct  69   PPTSVPSCSSSPQVERVAKEPSSTVTTEMYPGVSMNKEEGTKGKLTVYFKQDD--GEECD  126

Query  302  aesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRRR  478
             + +     G +  V+ W+  WE +++ R GEMGWYR QD+ VIDGNVVRLW+G  RRR
Sbjct  127  VDGDDGDQDGEDGAVEMWFENWENLLKMRNGEMGWYRCQDMKVIDGNVVRLWDGCRRRR  185



>ref|XP_011039929.1| PREDICTED: uncharacterized protein LOC105136332 isoform X1 [Populus 
euphratica]
Length=203

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 93/189 (49%), Gaps = 32/189 (17%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIK----VpslsppskpssepCQaaa  151
            +ALAF+Y+        + LWTW V+V+ AA  FWRI+    V +L+ PS       +   
Sbjct  9    DALAFDYVNLGILAIINNLWTW-VAVITAAVSFWRIRAAGAVKTLAEPSPSPDYIERQIT  67

Query  152  arrpasseppstaprttVTPFSASEGV--------------DGSTKGKFAAYFDCDDELA  289
                  +   S++  TT TP S +E                +G  KGKF  Y+  DD   
Sbjct  68   ESSHPETSSSSSSTTTTTTPKSVTEPAAPGSVSSSPSVFEDNGPKKGKFVVYYQDDDRQN  127

Query  290  ggndaesngngggggEVLVKDWYGC------WERVMETRMGEMGWYRYQDITVIDGNVVR  451
             GN  + + +G     VL  +W  C      WER++   MGE GWYR QD+TVI+GNVVR
Sbjct  128  EGNLDDDDEDGEEELTVL-GEWRRCGGEITLWERMLRVSMGEYGWYRCQDLTVINGNVVR  186

Query  452  LWEGGGRRR  478
            LW+G  R +
Sbjct  187  LWDGVRREK  195



>gb|KDP33961.1| hypothetical protein JCGZ_07532 [Jatropha curcas]
Length=208

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 88/194 (45%), Gaps = 35/194 (18%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarr-  160
            EALAF+Y  F      + LWTW V+++ AA  FWRI+          SS   +  ++   
Sbjct  9    EALAFDYASFGIFTVVNNLWTW-VALITAAISFWRIRTSGAGGVVSSSSLKSEPLSSVNC  67

Query  161  ----------------------passeppstaprttVTPFSASEGV---DGSTKGKFAAY  265
                                  P+    P+ A    + P SA   V   DG  K KF  Y
Sbjct  68   IDCHGNKSRTVIEKSAIKSVIEPSKQPVPAAATSKRLKPASARPSVFENDGVIKAKFVVY  127

Query  266  FDCDDELAggndaesngngggggE--VLVKDWYGCWERVMETRMGEMGWYRYQDITVIDG  439
            ++ D E  G  D E      G  E      +W   WE+V+  RMG+M WYRYQD+T I+G
Sbjct  128  YEDDREGEGNGDCEEYSTVVGEWENGSGYGEWRESWEKVLRIRMGDMDWYRYQDLTAING  187

Query  440  NVVRLWEGGGRRRS  481
            NVVRLW+G  R+ +
Sbjct  188  NVVRLWDGFRRKST  201



>ref|XP_011039930.1| PREDICTED: uncharacterized protein LOC105136332 isoform X2 [Populus 
euphratica]
Length=201

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 88/187 (47%), Gaps = 30/187 (16%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQ--aaaar  157
            +ALAF+Y+        + LWTW V+V+ AA  FWRI+           S           
Sbjct  9    DALAFDYVNLGILAIINNLWTW-VAVITAAVSFWRIRAAGAVKTLAEPSPSPDYIERQIT  67

Query  158  rpasseppstaprttVTPFSASEGV--------------DGSTKGKFAAYFDCDDELAgg  295
              +  E  S++  TT TP S +E                +G  KGKF  Y+  DD    G
Sbjct  68   ESSHPETSSSSTATTATPKSVTEPAAPGSVSSSPSVFEDNGPKKGKFVVYYQDDDRQNEG  127

Query  296  ndaesngngggggEVLVKDWYGC------WERVMETRMGEMGWYRYQDITVIDGNVVRLW  457
            N  + + +G     VL  +W  C      WER++   MGE GWYR QD+TVI+GNVVRLW
Sbjct  128  NLDDDDEDGEEELTVL-GEWRRCGGEITLWERMLRVSMGEYGWYRCQDLTVINGNVVRLW  186

Query  458  EGGGRRR  478
            +G  R +
Sbjct  187  DGVRREK  193



>ref|XP_006381573.1| hypothetical protein POPTR_0006s14000g [Populus trichocarpa]
 gb|ERP59370.1| hypothetical protein POPTR_0006s14000g [Populus trichocarpa]
Length=170

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 80/172 (47%), Gaps = 32/172 (19%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            +AL F+Y+        + LWTW V+V+ AA  FWRI+           S        +  
Sbjct  9    DALVFDYVNLGILTIINNLWTW-VAVITAAVSFWRIRAAGAVKTLAEPSPSPDYIERK--  65

Query  164  asseppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEVL  343
                         +T  S  E  +G+ KGKF  Y+  DD+     + +  G        +
Sbjct  66   -------------ITDPSVFED-NGAKKGKFVVYYYQDDDRQNEGNIDGGGEEEL---TV  108

Query  344  VKDWYGC------WERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRRRS  481
            + +W  C      W R++  RMGE GWYR QD+TVI+GNVVRLW+G  R ++
Sbjct  109  LGEWDRCGEEITLWVRMLRVRMGEYGWYRCQDLTVINGNVVRLWDGVRREKN  160



>ref|XP_003546522.1| PREDICTED: uncharacterized protein LOC100817225 [Glycine max]
Length=203

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 83/173 (48%), Gaps = 19/173 (11%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNYL F      + LWTW +++L AA  FW+I+      P        QA  + RP
Sbjct  9    EALAFNYLSFGLLTALNNLWTW-LALLTAAFSFWKIRSTGCLKPEPKPEAQVQAQPSIRP  67

Query  164  asseppstaprttVT-------PFSAS--EGVDGSTKGKFAAYFDCDDELAggndaesng  316
                   T  +T  T       PFS S  +G +G+ KGK   Y++ D ++          
Sbjct  68   DRVADLLTVEKTEPTQQDAVLVPFSPSLLQGENGARKGKLTVYYEKDMDMQCTCGEREGL  127

Query  317  ngg-gggEVLVKDWYGCWERVMETRMGEM--GWYRYQDITVIDGNVVRLWEGG  466
                   E    +W+  WER++  R GE   GWY +QD+T ++GNVVR W+ G
Sbjct  128  LTAWEEKEGTETEWWKRWERLLRLRNGENENGWYTWQDLTELNGNVVRFWDCG  180



>ref|XP_002877267.1| hypothetical protein ARALYDRAFT_905411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53526.1| hypothetical protein ARALYDRAFT_905411 [Arabidopsis lyrata subsp. 
lyrata]
Length=189

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 83/172 (48%), Gaps = 17/172 (10%)
 Frame = +2

Query  2    EALAFNYLRF--DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpasse  175
            E LAF+Y+ F  + LWTW ++V+ AA  FWRI+  + S            +    P    
Sbjct  9    EVLAFDYVNFVFNNLWTW-IAVVTAAVSFWRIRATTTSGGGGRDDGFIDESPREPPKPQA  67

Query  176  ppstaprttVTP---FSASEG------VDGSTKGKFAAYFD--CDDELAggndaesngng  322
              +     T  P    + +E        DG TKGK   Y++   D E    +   +    
Sbjct  68   TKAALVVETKPPSVKVTETEDWSLLLCNDGVTKGKLTVYYEEMIDGEREEDDGETTVVKY  127

Query  323  ggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRRR  478
            GGG      +W+  WERV++ R G+ GWYRY D+TVI+GNVVRLW+  G R 
Sbjct  128  GGGAS---GEWWERWERVVKMRNGDEGWYRYVDLTVINGNVVRLWDANGVRN  176



>ref|XP_003534964.1| PREDICTED: uncharacterized protein LOC100782725 [Glycine max]
Length=206

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 83/177 (47%), Gaps = 23/177 (13%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNYL F      + LWTW +++L AA  FW+I+      P   +    Q       
Sbjct  9    EALAFNYLSFGFLTALNNLWTW-LALLTAALSFWKIRSAGCPKPRPKTEAQAQPFFRPEA  67

Query  164  as-----seppstaprttVTPFSA-------SEGVDGSTKGKFAAYFDCDDE--LAggnd  301
             +      +   T       PFS        +   +G  KGKF  Y++ +D       ++
Sbjct  68   VADLLIVEKTEPTKQHAATAPFSPPLLRGENNSEENGERKGKFTVYYEEEDMGMQCTCDE  127

Query  302  aesngngggggEVLVKDWYGCWERVMETRMGEM--GWYRYQDITVIDGNVVRLWEGG  466
             E         E    +W+  WER+++ R GE   GWYR+QD+T ++G+VVR+W+GG
Sbjct  128  NEGLLTAWKEKEGTETEWWNRWERLLQLRNGESENGWYRWQDLTELNGSVVRIWDGG  184



>ref|XP_008337817.1| PREDICTED: uncharacterized protein LOC103400907 [Malus domestica]
Length=300

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 84/186 (45%), Gaps = 33/186 (18%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNYL F      + LWTW ++VL AA  FWR++  + +  +  SS     +     
Sbjct  101  EALAFNYLSFGLFTVVNNLWTW-IAVLTAAVSFWRLRPRAAATSAISSSALKFRSQPAIS  159

Query  164  asseppstaprttVTPFSASEGVDGS----------------TKG-KFAAYF---DCDDE  283
              S   S+         SA++ V+                  TKG KFA YF   D + +
Sbjct  160  GLSLNGSSPVPEITQSNSAAKKVEPPCFVPALAKFGDSTVQLTKGSKFAVYFEDSDVESD  219

Query  284  LAggndaesngnggggg---EVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRL  454
            L   +      +        EV    W   WE V+  R GEM WYRYQD+T ++GNVVRL
Sbjct  220  LTATSSLTPEKDETEESGSDEVAAASW---WEDVLTLRTGEMSWYRYQDLTELNGNVVRL  276

Query  455  WEGGGR  472
            W+   R
Sbjct  277  WDDYSR  282



>gb|KDO86964.1| hypothetical protein CISIN_1g028671mg [Citrus sinensis]
Length=205

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 89/194 (46%), Gaps = 51/194 (26%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EAL F+Y  F      + LWTW V+V+ AA  FWRI+  S S              +   
Sbjct  12   EALTFSYAIFGVFPIVNNLWTW-VAVITAAISFWRIRATSFSYRPDHQQPRIHRNTSGSQ  70

Query  164  asseppstaprttVTPFSAS-------EGVDGSTKG-KFAAYF--------DCDDELAgg  295
            A     +++   ++   +A+         VDG T+G K+   +        D D E+   
Sbjct  71   AQPSANTSSVGYSIPATAATLPSANHVNDVDGVTEGSKYTLCYYEEEQRDSDADGEVTS-  129

Query  296  ndaesngngggggEVLVKDW------YGC-----WERV-METRMGEMGWYRYQDITVIDG  439
                           +VK+W       GC     WERV M  R+G+MGWYR+QD+TV++G
Sbjct  130  ---------------VVKEWRDDDGVSGCGERWEWERVRMTARIGDMGWYRWQDLTVVNG  174

Query  440  NVVRLWEGGGRRRS  481
            NVVRLW+   RRRS
Sbjct  175  NVVRLWDECRRRRS  188



>ref|XP_010514709.1| PREDICTED: uncharacterized protein LOC104790626 [Camelina sativa]
Length=190

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 84/172 (49%), Gaps = 18/172 (10%)
 Frame = +2

Query  2    EALAFNYLRF--DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpasse  175
            E LAF+Y+ F  + LWTW ++V+ AA  FWRI+  + +       E  +  + R P   +
Sbjct  9    EVLAFDYVNFVFNNLWTW-IAVVTAAVSFWRIRSTTTTSGRGSRDEGFKDESPRDPQKPQ  67

Query  176  ppstaprttVTP----FSASEG------VDGSTKGKFAAYFD--CDDELAggndaesngn  319
                       P     + +E        DG TKGK   Y++   D E        +   
Sbjct  68   ATKAPLVVETRPPRVKVTETEDWSLLLCNDGVTKGKLTVYYEEEIDGERDEDGGETTAVK  127

Query  320  gggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRR  475
             GGG      +W+  WERV++ R G+ GWYRY D+TVI+G+VVRLW+  G R
Sbjct  128  YGGGES---GEWWERWERVVKMRNGDEGWYRYVDLTVINGSVVRLWDANGVR  176



>ref|XP_006444519.1| hypothetical protein CICLE_v10024151mg [Citrus clementina]
 gb|ESR57759.1| hypothetical protein CICLE_v10024151mg [Citrus clementina]
Length=202

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 88/194 (45%), Gaps = 51/194 (26%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EAL F Y  F      + LWTW V+V+ AA  FWRI+  S S              +   
Sbjct  9    EALTFRYAIFGVFPIVNNLWTW-VAVITAAISFWRIRATSFSYRPDHQQPRIHRNTSGSQ  67

Query  164  asseppstaprttVTPFSAS-------EGVDGSTKG-KFAAYF--------DCDDELAgg  295
            A     +++   ++   +A+         VDG T+G K+   +        D D E+   
Sbjct  68   AQPSANTSSVGYSIPATAATLPSANHVTDVDGVTEGSKYTLCYYEEEQRDSDADGEVTS-  126

Query  296  ndaesngngggggEVLVKDW------YGC-----WERV-METRMGEMGWYRYQDITVIDG  439
                           +VK+W       GC     WERV M  R+G+MGWYR+QD+TV++G
Sbjct  127  ---------------VVKEWRDDDGVSGCGERWEWERVRMTARIGDMGWYRWQDLTVVNG  171

Query  440  NVVRLWEGGGRRRS  481
            NVVRLW+   RRRS
Sbjct  172  NVVRLWDECRRRRS  185



>gb|KEH37635.1| transmembrane protein, putative [Medicago truncatula]
Length=210

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 82/181 (45%), Gaps = 28/181 (15%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNYL F      + LWTW    + AA  FW+I+         P S     + +   
Sbjct  10   EALAFNYLNFGLITILNNLWTWLA--ITAALSFWKIRSSGCPKSLDPVSVKPDQSVSVSN  67

Query  164  asseppstaprttV-----------TPFS---ASEGVDGSTKGKFAAYFDCDDELAggnd  301
             +S        + +           TP +    S+ VDG  KGKF  Y+  D +     +
Sbjct  68   VTSPVEIKPDESVLISTENVTSKTETPPTLSDVSDDVDGVRKGKFTLYYKEDMQCGFNKN  127

Query  302  aesngngggggE----VLVKDWYGCWERVMETRMGEM--GWYRYQDITVIDGNVVRLWEG  463
            + +        E     +  +W+ CWE+V+  R GE   GWY  QD+T ++GNVV++W+G
Sbjct  128  SSNCYRQLPVVEGWEPEVEVEWWKCWEKVLRLRNGENENGWYTCQDLTELNGNVVKIWDG  187

Query  464  G  466
            G
Sbjct  188  G  188



>ref|XP_010536252.1| PREDICTED: uncharacterized protein LOC104811289 [Tarenaya hassleriana]
Length=206

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 85/185 (46%), Gaps = 27/185 (15%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNY+ F      + LWTW ++V  AA  FWRI+  +    S P      +A +   
Sbjct  9    EALAFNYVSFGIFSVVNNLWTW-IAVATAAVSFWRIRATTGGDSSSPMMIDHCSAVSEEI  67

Query  164  asseppstaprttVTPFSA-SEGVD-------------GSTKGKFAAYFDCDDELAggnd  301
             +      +P   + P S  +  V+             G TKGK  AY++ D E    + 
Sbjct  68   GAESENKASPNDDIEPQSTGTPAVETATAIWTPLMCGVGVTKGKLTAYYENDGESDNDDG  127

Query  302  aesngngggggEVLVKDWYGCWER------VMETRMGEMGWYRYQDITVIDGNVVRLWEG  463
              +  + G     L+  + G  ER      V+ T  GE  WYRY D+TVI+GNVVRLW+ 
Sbjct  128  ELTAISNGVKKGKLMLYYDGDRERDSNDGGVLRTMNGEDDWYRYVDLTVINGNVVRLWDD  187

Query  464  GGRRR  478
             G R 
Sbjct  188  NGVRN  192



>ref|XP_008242329.1| PREDICTED: uncharacterized protein LOC103340669 [Prunus mume]
Length=207

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 86/181 (48%), Gaps = 30/181 (17%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpsls-ppskpssepCQaaaarr  160
            EALAFNY+ F      + LWTW V+VL AA  F  +K+ + +   S   S  C   +   
Sbjct  10   EALAFNYVSFGLFTVVNNLWTW-VAVLTAAVSFLSLKLRASTGAASTAISSSCLFNSPPS  68

Query  161  passeppstaprttVTPFSASEGVDGS------------------TKG-KFAAYFDCDDE  283
                    ++P   +TP   ++    S                  TKG KF  Y+D  D 
Sbjct  69   NDDRSSNGSSPAPEITPSETADEPPCSVLSLVAAPYKFEDDRIVVTKGLKFTLYYD--DN  126

Query  284  LAggndaesngngggggEVLVKDWYG-CWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
              G  D ++   G   G+  V D  G   E V+  R+GEMGWYR+QD+T ++GNVVRLW+
Sbjct  127  AEGDVDLKAEEAGECDGDEAVADVCGESLEGVLRLRLGEMGWYRHQDLTELNGNVVRLWD  186

Query  461  G  463
            G
Sbjct  187  G  187



>ref|XP_004488125.1| PREDICTED: uncharacterized protein LOC101502064 [Cicer arietinum]
Length=200

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 76/173 (44%), Gaps = 19/173 (11%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNYL F      + LWTW +++L AA  FW+I+         P+S           
Sbjct  10   EALAFNYLNFGLVTILNNLWTW-LALLTAALSFWKIRSSGCPKSVDPNSIIPDPVKKPLL  68

Query  164  asseppstaprttVTPFSASEGVDGSTKGKFAAYFDCD----------DELAggndaesn  313
               +          T     + VDG  KGKF  Y++ D          D         + 
Sbjct  69   PFEDVTDKIISPRKTLTVGCDEVDGVRKGKFTVYYEEDMQCGRRESTGDNFCYRLLPVAE  128

Query  314  gngggggEVLVKDWYGCWERVMETRMGEM--GWYRYQDITVIDGNVVRLWEGG  466
            G      E    +W+ CWE+V+  R GE   GWY  QD+T ++GNVV+ W+GG
Sbjct  129  GWVPEERETRETEWWRCWEKVLTLRNGENENGWYTCQDLTELNGNVVKFWDGG  181



>ref|XP_006492346.1| PREDICTED: uncharacterized protein LOC102608396 [Citrus sinensis]
Length=206

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 87/192 (45%), Gaps = 51/192 (27%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EAL F+Y  F      + LWTW V+V+ AA  FWRI+  S S              +   
Sbjct  12   EALTFSYAIFGVFPIVNNLWTW-VAVITAAISFWRIRATSFSYRPDHQQPRIHRNTSGSQ  70

Query  164  asseppstaprttVTPFSAS-------EGVDGSTKG-KFAAYF--------DCDDELAgg  295
            A     +++   ++   +A+         VDG T+G K+   +        D D E+   
Sbjct  71   AQPSANTSSVEYSIPATAATLPSANHVNDVDGVTEGSKYTLCYYEEEQRDSDADGEVTS-  129

Query  296  ndaesngngggggEVLVKDW------YGC-----WERV-METRMGEMGWYRYQDITVIDG  439
                           +VK+W       GC     WERV M  R+G+MGWYR+QD+TV++G
Sbjct  130  ---------------VVKEWRDDDGVSGCGERWEWERVRMTARIGDMGWYRWQDLTVVNG  174

Query  440  NVVRLWEGGGRR  475
            NVVRLW+   RR
Sbjct  175  NVVRLWDECRRR  186



>ref|XP_006400645.1| hypothetical protein EUTSA_v10014753mg [Eutrema salsugineum]
 gb|ESQ42098.1| hypothetical protein EUTSA_v10014753mg [Eutrema salsugineum]
Length=191

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 80/186 (43%), Gaps = 41/186 (22%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVps----------------lspp  115
            EALAF Y  F      + +WTW ++V+ AA  FWRI+V S                    
Sbjct  9    EALAFEYASFGVLAVVNNVWTW-IAVVTAAVSFWRIRVTSIGDEGHGCGFIEELTGSKSE  67

Query  116  skpssepCQaaaarrpasseppstaprttVTPFSASEGV---DGSTKGKFAAYFD-----  271
             +      QA +     ++       +  V    A   +   DG TKGK   Y++     
Sbjct  68   QEAGYLEPQAMSGPVEETTFAAPLLKQKVVKKTEARAPLMCDDGVTKGKLTMYYEVDVDG  127

Query  272  ---CDDELAggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGN  442
               CD EL   N                 +W+  WERV++ R G+ GWYRY D+TVI+GN
Sbjct  128  ERFCDGELTAVNYGGGGL-------GDCGEWWERWERVVKMRNGDDGWYRYVDLTVINGN  180

Query  443  VVRLWE  460
            VVRLW+
Sbjct  181  VVRLWD  186



>gb|KDO73809.1| hypothetical protein CISIN_1g028872mg [Citrus sinensis]
Length=202

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 85/185 (46%), Gaps = 36/185 (19%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNY  F      + LW W V+V+ AA  FWRI+  S S              +   
Sbjct  9    EALAFNYATFGVFTVVNNLWAW-VAVITAAISFWRIRTTSFSDKPDHQQPLIDRNTSGSQ  67

Query  164  asseppstaprttVTP-----FSASEGVDGSTKG-KFAAYFDCDDELAggndaesngngg  325
             +  P + +      P       ++  VDG T+G K+  Y+          + ++  +G 
Sbjct  68   LARPPANASSADAAPPCPIPALPSANDVDGVTEGSKYTFYY--------YEEGQTEVHGD  119

Query  326  gggEVLVKDW---------YGC-----WERV-METRMGEMGWYRYQDITVIDGNVVRLWE  460
            G    +VK+W           C     WE V M  R+G+MGWYR QD+TV++GNVVRLW+
Sbjct  120  GEATSVVKEWRDDADSDGVSSCVDWREWEGVRMRARIGDMGWYRCQDLTVVNGNVVRLWD  179

Query  461  GGGRR  475
               RR
Sbjct  180  ERRRR  184



>gb|KFK42155.1| hypothetical protein AALP_AA2G218500 [Arabis alpina]
Length=196

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 82/183 (45%), Gaps = 25/183 (14%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsp----------pskpsse  133
            EALAF Y  F      + +WTW ++V+ AA  FWRI++ +                  S+
Sbjct  9    EALAFEYASFGVFAAVNNVWTW-LAVVTAAVSFWRIRITTTISDGDVHGCVLVEELTGSK  67

Query  134  pCQaaaarrpasseppstaprttVTPFSASEGV-------DGSTKGKFAAYFDCD-DELA  289
              Q +    P S           V        V       DG TKGK   Y++ D D   
Sbjct  68   SEQESGYLEPESMTGLVEETVGQVKEMKTVTEVWEPLMYDDGVTKGKLTMYYEVDVDGGK  127

Query  290  ggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGG  469
              +   ++ N GGG      +W+  WE+VM  R G+  WYRY D+TVI+GNVVRLW+  G
Sbjct  128  CVDGELTDVNYGGGLGGDCGEWWEKWEKVMRLRNGDDSWYRYVDLTVINGNVVRLWDDNG  187

Query  470  RRR  478
             R 
Sbjct  188  IRN  190



>ref|XP_010503024.1| PREDICTED: uncharacterized protein LOC104780221 [Camelina sativa]
Length=207

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 82/172 (48%), Gaps = 18/172 (10%)
 Frame = +2

Query  2    EALAFNYLRF--DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpasse  175
            E LAF+Y+ F  + LWTW ++V+ AA  FWRI+  +         E     + R P   +
Sbjct  37   EVLAFDYVNFVFNNLWTW-IAVVTAAVSFWRIRSTTTISGRGRRDEGFIDESPREPQKPQ  95

Query  176  ppstaprttVTP----FSASEG------VDGSTKGKFAAYFD--CDDELAggndaesngn  319
                       P     + +E        DG TKGK   Y++   D E     +  +   
Sbjct  96   ATKAPLVVETRPPKVKVTETEDWSLLLCNDGVTKGKLTVYYEEEIDGERDEDGEETTAVK  155

Query  320  gggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRR  475
             GGG      +W+  WE V++ R G+ GWYRY D+TVI+G+VVRLW+  G R
Sbjct  156  YGGGES---GEWWERWESVVKMRNGDEGWYRYVDLTVINGSVVRLWDANGVR  204



>ref|XP_011093879.1| PREDICTED: uncharacterized protein LOC105173717 [Sesamum indicum]
Length=202

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 91/182 (50%), Gaps = 24/182 (13%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALA NYL +      + +W W V+V+ AA  FWRI+  S +P S P         A   
Sbjct  9    EALALNYLSYGFFTAVNNIWAW-VAVITAAVSFWRIRALSSAPVSTPEPRRRSHDTASTS  67

Query  164  asseppstaprttVT---------PFSAS---EGVDGSTKGKFAAYFDCDDELAggndae  307
            +S+ P    P T  T         P   S    G +GSTK KF+ Y++ DD        E
Sbjct  68   SSAPPKVAEPATLSTAGETQLSSAPAKTSCPTLGREGSTKTKFSLYYEEDDFREDDEGGE  127

Query  308  sngngggggEVLVKD---WYGCWERVM-ETRMGEMGWYRYQDITVIDGNVVRLWEGG-GR  472
            +  +G G   V  K        WER+M   RMG+MGWYR+QD  V DG+VVRLW+ G GR
Sbjct  128  NEDDGDGTAGVSEKSGRYLSEDWERMMVVVRMGDMGWYRWQDRAVFDGSVVRLWDQGRGR  187

Query  473  RR  478
            RR
Sbjct  188  RR  189



>ref|XP_002874014.1| hypothetical protein ARALYDRAFT_488984 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50273.1| hypothetical protein ARALYDRAFT_488984 [Arabidopsis lyrata subsp. 
lyrata]
Length=184

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 82/180 (46%), Gaps = 35/180 (19%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAF Y  F      + +WTW ++V+ AA  FWRI+V ++      +    +     + 
Sbjct  9    EALAFEYASFGVFAVVNNVWTW-IAVVTAAVSFWRIRVTTIGVGDGHACVLIEELTGSKS  67

Query  164  asseppstaprttVTPFSASEGV---------------DGSTKGKFAAYFDCDDEL----  286
             +           + P S +  V               DG TKGK   Y++ D ++    
Sbjct  68   ENESGR-------LEPKSITGPVKETETVTTTEPLMYDDGVTKGKLTMYYEVDVDVDGER  120

Query  287  --AggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
                 +   +  + GGG      +W+  WERV+  R G+ GWYRY D+TVI+GNVVR W+
Sbjct  121  CVESVDGELTAVSYGGGLGNCGGEWWEKWERVVRMRNGDDGWYRYVDLTVINGNVVRFWD  180



>ref|XP_008352504.1| PREDICTED: uncharacterized protein LOC103416009 [Malus domestica]
Length=190

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 86/184 (47%), Gaps = 34/184 (18%)
 Frame = +2

Query  2    EALAFNYLRFDKLWTWWVSVLAAAAGFW--RIKVpslsppskpssepCQaaaarrpasse  175
            EALA NYL F    T WV+VL AA   W  R +  + +  S  SS    + + R   +  
Sbjct  9    EALAVNYLSFGLFTTTWVAVLTAAISXWRLRPRAAAAATSSAISSSSSSSLSFRSQPAVS  68

Query  176  ppstaprttVTPFSASEGV-----------------DGS---TKG-KFAAYFD-----CD  277
              S    + V+  + S+                   DG    TKG KFA YF+      D
Sbjct  69   DLSLHGSSPVSEITQSDAAAKKVDPPCSVPSLANFDDGRVQLTKGSKFAVYFEDSSVESD  128

Query  278  DELAggndaesngnggg---ggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVV  448
             +LA  +   +  +        EV+V +W   WE V+  R GEMGWYR+QD+T ++GNVV
Sbjct  129  XDLAATSSLMAEEDETEWSGSDEVVVANW---WEDVLRLRTGEMGWYRFQDLTELNGNVV  185

Query  449  RLWE  460
            RLW+
Sbjct  186  RLWD  189



>ref|XP_010425806.1| PREDICTED: uncharacterized protein LOC104710844 [Camelina sativa]
Length=219

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 80/167 (48%), Gaps = 18/167 (11%)
 Frame = +2

Query  2    EALAFNYLRF--DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpasse  175
            E LAF+Y+ F  + LWTW ++V+ AA  FWRI+  + +       E     + R P   +
Sbjct  37   EVLAFDYVNFVFNNLWTW-IAVVTAAVSFWRIRSTTTTSDRGSRDEGFIDESPREPQKPQ  95

Query  176  ppstaprttVTP--FSASEG--------VDGSTKGKFAAYFD--CDDELAggndaesngn  319
                +      P     +E          DG TKGK   Y++   D E        +   
Sbjct  96   ATKASLVVETRPPRVKVTETGDWSLLLCSDGVTKGKLTVYYEEEIDGERDEDGGETTAVK  155

Query  320  gggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
             GGG      +W+  WERV++ R G+ GWYRY D+TVI+G+VVRLW 
Sbjct  156  YGGGES---GEWWERWERVVKMRNGDEGWYRYVDLTVINGSVVRLWH  199



>ref|XP_002540459.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF21924.1| conserved hypothetical protein [Ricinus communis]
Length=194

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 77/184 (42%), Gaps = 43/184 (23%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAF+Y+ F      + LWTW V++L AA  FWRIK   L            A      
Sbjct  9    EALAFDYVSFGIFTVVNNLWTW-VALLTAAVSFWRIKTAGLKSEQPRVLS--SAICIDTH  65

Query  164  asseppstaprttVTPFSASEGV------------------DGSTKGKFAAYFDCDDELA  289
             +++          +P S +                     DG TKGKF  Y+  D E  
Sbjct  66   NNNDEARPETSQPESPPSPTLSFSDTASSSSLSSRLSIFENDGVTKGKFVMYYAGDRE--  123

Query  290  ggndaesngngggggEVLVKDWYGC-----WER--VMETRMGEMGWYRYQDITVIDGNVV  448
                   +     G    V   +GC     W    V+ TRM EMGWYR QD+TV +GNVV
Sbjct  124  -------SDGNCDGDGCTVVGVWGCGGSEEWPERIVLRTRMSEMGWYRNQDLTVFNGNVV  176

Query  449  RLWE  460
            RLW+
Sbjct  177  RLWD  180



>ref|XP_006353776.1| PREDICTED: uncharacterized protein LOC102589679 [Solanum tuberosum]
Length=172

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 82/168 (49%), Gaps = 21/168 (13%)
 Frame = +2

Query  2    EALAFNYLRFDK---LWTWWVSVLAAAAGFWRIKVpsls-ppskpssepCQaaaarrpas  169
            EA+AFNY  FD    +WTW V+V+ AA  FW++K  S +  P+ P        A+   +S
Sbjct  6    EAVAFNYWSFDVANIVWTW-VAVVTAAVSFWKMKASSSTWLPTPPEPALVTVLASSSSSS  64

Query  170  seppstaprttVTPFS---------ASEGVDGSTKGKFAAYFDCDDELAggndaesngng  322
                        TP S         + +     TKGK   YF   D+   G+D +  G  
Sbjct  65   QVELMLLSSKERTPPSNNNNNMMMLSDDAFSEGTKGKLTVYFKDGDQCNAGDDDDEEGED  124

Query  323  ggggEVLVKDWY-GCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEG  463
                 V   +W+   WE++   R GEMGWY YQD+ VI+GN+VRLW+G
Sbjct  125  DDHNGV---EWFENNWEKL---RKGEMGWYCYQDMKVINGNIVRLWDG  166



>ref|XP_003609966.1| hypothetical protein MTR_4g124850 [Medicago truncatula]
 gb|AES92163.1| transmembrane protein, putative [Medicago truncatula]
 gb|AFK44829.1| unknown [Medicago truncatula]
Length=185

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 66/168 (39%), Gaps = 21/168 (13%)
 Frame = +2

Query  2    EALAFNYLRFD---KLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpass  172
            + LAFNYL FD    LWTW       A  FWRI  P                        
Sbjct  10   DTLAFNYLSFDFFNHLWTW------LAVIFWRIPTPKPELLPPSHDTSSDKPHLGLEVLE  63

Query  173  eppstaprttVTPFSASEGVDGSTKGKFA---AYFDCDDE--LAggndaesngngggggE  337
                 A    V   S  E  DG TKGK      Y+D +DE  +                E
Sbjct  64   PRHDYACPARVPSNSVVEDDDGVTKGKMKFTLYYYDHEDEDDIDRECKESVETLKKITEE  123

Query  338  VLVKD-----WYGCWERVMETRMGEM--GWYRYQDITVIDGNVVRLWE  460
            +  +      W+  WE ++ TR GE   GWY  QD+TVI+GNVVR W+
Sbjct  124  LWEEKEGRLGWWESWENLLRTRTGENEGGWYTCQDLTVINGNVVRFWD  171



>ref|XP_011078208.1| PREDICTED: uncharacterized protein LOC105162007 [Sesamum indicum]
Length=196

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 83/178 (47%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    EALAFNYLR---FDKLWTWWVSVLAAAAGFWRIKVpslsppskpssepC--Qaaaarrpa  166
            EALAF+YLR      + + W++V+ AA  FWRI+  S    S P        A +     
Sbjct  10   EALAFDYLRCGFLTAVNSVWIAVITAALSFWRIRALSSPLVSTPEPRGSIQDAVSTSEEK  69

Query  167  sseppstaprttVTPFSASEGV---------DGSTKGKFAAYFDCDDELAggndaesngn  319
                 ++A     T    S G          +GS+K KF+  ++ D       D +  G 
Sbjct  70   VGHASASASTPGETKHLLSAGATTWCGVAEREGSSKVKFSLCYNEDIFRGSYEDEDDGGC  129

Query  320  gggggEVLVKDWYG-----CWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRRR  478
             GGG  V +    G      WER    RMG+MGWYR QD+  +DG+VVRLW  GGRRR
Sbjct  130  NGGGAAVTMSGKIGWWCDDVWERTTVVRMGDMGWYRCQDLAALDGSVVRLW--GGRRR  185



>ref|XP_007012559.1| Cysteine and histidine-rich protein 1, putative [Theobroma cacao]
 gb|EOY30178.1| Cysteine and histidine-rich protein 1, putative [Theobroma cacao]
Length=184

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  353  WYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
            W+  WERV+  R GE GWYRYQD+T I+GNVVRLW+
Sbjct  145  WWQSWERVLSVRKGETGWYRYQDLTAINGNVVRLWD  180



>ref|XP_007202575.1| hypothetical protein PRUPE_ppa011493mg [Prunus persica]
 gb|EMJ03774.1| hypothetical protein PRUPE_ppa011493mg [Prunus persica]
Length=208

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 80/183 (44%), Gaps = 30/183 (16%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpsls-ppskpssepCQaaaarr  160
            EALAFNY+ F      + LWTW V+VL AA  F  +++ + +   S   S  C   +   
Sbjct  10   EALAFNYVSFGLFTVVNNLWTW-VAVLTAAVSFLSLRLRASTRAASTAISSSCLFNSPPS  68

Query  161  passeppstaprttVTPFSASEGVDGS------------------TKG-KFAAYFDCDDE  283
                    ++P   +TP   ++    S                  TKG KF  Y++ + E
Sbjct  69   NDDRSSNGSSPVPEITPSETADEPPRSVLSPVAAPCKFEDDRVVVTKGLKFTLYYEDNAE  128

Query  284  LAggndaesngngggggEVLVKDWYGC---WERVMETRMGEMGWYRYQDITVIDGNVVRL  454
                  AE                 GC    E V+  R+GEMGWYR+Q +T ++GNVVRL
Sbjct  129  GRVDLTAEEEEEEAEESAGDEAVAEGCGEWLEGVLRLRLGEMGWYRHQGLTELNGNVVRL  188

Query  455  WEG  463
            W+G
Sbjct  189  WDG  191



>ref|NP_189897.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB86482.1| putative protein [Arabidopsis thaliana]
 gb|AAS99671.1| At3g43110 [Arabidopsis thaliana]
 gb|AAT41803.1| At3g43110 [Arabidopsis thaliana]
 gb|AEE77765.1| uncharacterized protein AT3G43110 [Arabidopsis thaliana]
Length=191

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 79/172 (46%), Gaps = 15/172 (9%)
 Frame = +2

Query  2    EALAFNYLRF--DKLWTWWVSVLAAAAGFWRIKVpslspps-----------kpssepCQ  142
            E LAF+Y+ F  + LWTW ++V+ AA  FWRI+  + +  S                P  
Sbjct  9    EVLAFDYVNFVFNNLWTW-IAVVTAAVSFWRIRATTTTTTSGGGRDNGLIDESFLEPPKP  67

Query  143  aaaarrpasseppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesngng  322
             A          P     T    +S     DG TKGK   Y++ + +     D       
Sbjct  68   QATKAALLMETKPPRVKVTETEDWSLLLCKDGVTKGKLTVYYEEEIDGEREEDDGETTAV  127

Query  323  ggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRRR  478
              GG     +W+  WERV++ R G+ GWYRY D+TVI+GNVVRLW+    R 
Sbjct  128  KYGGGE-SGEWWERWERVVKMRNGDEGWYRYVDLTVINGNVVRLWDANRVRN  178



>gb|KFK33839.1| hypothetical protein AALP_AA5G066500 [Arabis alpina]
Length=172

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 78/159 (49%), Gaps = 16/159 (10%)
 Frame = +2

Query  2    EALAFNYLRF--DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpasse  175
            E LAF+Y+ F  + LWTW ++V+ AA  FWRI+  +         E       ++ A   
Sbjct  9    EVLAFDYVSFILNNLWTW-IAVVTAAVSFWRIRATTSGRDDGFIEEEAVPDPPKQKALVV  67

Query  176  ppstaprttVTP-FSASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEVLVKD  352
                  + T T  +S     DG TKGK   Y+D D+E  G  D E +  G         +
Sbjct  68   ETRPRMKVTDTEDWSLLLCNDGVTKGKLTVYYDDDEETDGERDGEEDRGGE------CGE  121

Query  353  WYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGG  469
            W   WER+   R G  GWYRY D+T I+GNVVRLW+  G
Sbjct  122  W---WERM---RNGGDGWYRYVDLTEINGNVVRLWDANG  154



>ref|XP_009131815.1| PREDICTED: uncharacterized protein LOC103856462 [Brassica rapa]
Length=191

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 83/183 (45%), Gaps = 26/183 (14%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAF Y  F      + +WTW ++V+ AA  FWR+KV ++      +            
Sbjct  9    EALAFQYASFGVLAVVNNVWTW-IAVVTAAVSFWRMKVTTIGDNGGHAGCSLLEDVTASK  67

Query  164  asseppstaprttVTPFSASEGV---------------DGSTKG-KFAAYFDCD---DEL  286
            A  E     P+    P  A+E                 DG TKG K   Y++ D   +E 
Sbjct  68   AEQESDRQEPQKMAGPVEAAEAPPVNETEVNWEPLMCDDGVTKGTKLTMYYEVDVDHEER  127

Query  287  AggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGG  466
                + +      GGG     +W+  WERV++ R G+  WYRY D+TVI+G+VVRLW+  
Sbjct  128  CVDGEGDLPTVNYGGGFGNSGEWWERWERVVKMRNGDDVWYRYVDLTVINGSVVRLWDDD  187

Query  467  GRR  475
             R 
Sbjct  188  KRN  190



>ref|XP_007138624.1| hypothetical protein PHAVU_009G224300g [Phaseolus vulgaris]
 gb|ESW10618.1| hypothetical protein PHAVU_009G224300g [Phaseolus vulgaris]
Length=187

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = +2

Query  218  ASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEVLVKDWYGCWERVMETRMGE  397
            A E VDG  KGKF  Y++   + +   + E         E    +W+  WER++  R GE
Sbjct  84   AEEDVDGVRKGKFTVYYEEHVQCSCEIENEGFATAWEESEGSQTEWWERWERLLRLRNGE  143

Query  398  M--GWYRYQDITVIDGNVVRLWEGG  466
               GWY  QD+TV++G+VVRLW+GG
Sbjct  144  SENGWYTRQDVTVLNGSVVRLWDGG  168



>ref|XP_010939867.1| PREDICTED: uncharacterized protein LOC105058597 [Elaeis guineensis]
Length=171

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 71/160 (44%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    EALAFNYLRFDKLWTW-WVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpassep  178
            EALAF Y     +W W W +VLAAA G WRI+               +      P  +E 
Sbjct  9    EALAFRYPADVAVWLWAWFAVLAAALGLWRIRAAHPPA--------PKPPRPLDPIGAEA  60

Query  179  pstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEVLVKDWY  358
             S       +P   ++G+  + K +F AYF  DD+           +G G      ++  
Sbjct  61   VSAPALMEQSPSCNADGI-ATPKARFMAYFHADDDSDEKERGGGVSDGDGEETEEEEEEE  119

Query  359  GCW--ERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGR  472
              W  ER M    G +GWYRYQD T  +G VVRLW+G  R
Sbjct  120  TPWGWERRMVRNGGNLGWYRYQDDTAFNGGVVRLWDGNVR  159



>ref|XP_009608776.1| PREDICTED: uncharacterized protein LOC104102694 [Nicotiana tomentosiformis]
Length=206

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  341  LVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRRRS  481
            L K+ +  WE  ++ R GEM WY YQD+ VIDG+VVRLW+G  RRR+
Sbjct  146  LSKELFENWESAVKMRKGEMEWYSYQDMRVIDGSVVRLWDGCRRRRN  192



>emb|CDX88841.1| BnaA03g08080D [Brassica napus]
Length=191

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 83/183 (45%), Gaps = 26/183 (14%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAF Y  F      + +WTW ++V+ AA  FWR+KV ++      +            
Sbjct  9    EALAFQYASFGVLAVVNNVWTW-IAVVTAAVSFWRMKVTTIGDNGGHAGCSLLEDVTASK  67

Query  164  asseppstaprttVTPFSASEGV---------------DGSTKG-KFAAYFDCD---DEL  286
            A  E     P+    P  A+E                 DG TKG K   Y++ D   +E 
Sbjct  68   AEQESDHQEPQKMAGPVEAAEAPPVNETEVNWEPLMCDDGVTKGTKLTMYYEVDVDHEER  127

Query  287  AggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGG  466
                + E      GGG     +W+  WERV++ R G+  WYRY ++TVI+G+VVRLW+  
Sbjct  128  CVDGEGELPTVNYGGGFGNSGEWWERWERVVKMRNGDDVWYRYVELTVINGSVVRLWDDD  187

Query  467  GRR  475
             R 
Sbjct  188  KRN  190



>gb|ACU24519.1| unknown [Glycine max]
Length=180

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 71/163 (44%), Gaps = 29/163 (18%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EA AFNYL F      +  WTW       A  FWR + P+      P             
Sbjct  8    EAQAFNYLGFGFLTLLNNFWTW------LAFTFWRTRAPTSELLPPPDDPV---------  52

Query  164  asseppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEVL  343
                   + P     P      VDG+ KGKF  Y++ + E    +  E+       G  L
Sbjct  53   ----RDESDPVAVTGPSPTVVDVDGARKGKFTLYYEDESERECESHQETTALTERDGRGL  108

Query  344  VKDWYGCWERVMETRMGE--MGWYRYQDITVIDGNVVRLWEGG  466
               W+  WE ++E R GE   GWY  QD+TV++G+VVRLW+GG
Sbjct  109  --KWWESWEELLEIRRGEDQNGWYTCQDLTVLNGSVVRLWDGG  149



>ref|XP_006419135.1| hypothetical protein EUTSA_v10002680mg [Eutrema salsugineum]
 gb|ESQ37571.1| hypothetical protein EUTSA_v10002680mg [Eutrema salsugineum]
Length=185

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 77/162 (48%), Gaps = 13/162 (8%)
 Frame = +2

Query  2    EALAFNYLRF--DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpasse  175
            + LA +Y+ F  + LW W ++V+ AA  FWRI+  +    +             +P ++ 
Sbjct  9    DVLALDYVSFLLNNLWAW-IAVVTAAVSFWRIRATTNGSKNDVRLIDESPREPPKPQATA  67

Query  176  ppstaprttVT-----PFSASEGVDGSTKGKFAAYFD--CDDELAggndaesngnggggg  334
              +      VT      +S     DG TKG+F  Y++   D E    +    + N  GG 
Sbjct  68   ALAVETGPRVTVTEMEDWSPLLCNDGLTKGRFTVYYEEEIDGERDNEDGGIRSVNYRGGE  127

Query  335  EVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
                 +W+  WERV+  R G  GWYRY D TVI+GNVV+LW 
Sbjct  128  ---CGEWWEKWERVVTVRNGGDGWYRYVDSTVINGNVVKLWN  166



>ref|XP_010454385.1| PREDICTED: uncharacterized protein LOC104736148 [Camelina sativa]
Length=198

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 81/177 (46%), Gaps = 25/177 (14%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVps------------lsppskps  127
            EALAF Y  F      + +WTW ++V+ AA  FWRI+V +                + P 
Sbjct  9    EALAFQYASFGVFAVVNNVWTW-IAVVTAAVSFWRIRVTTIGDGDGHACVLLEESRTDPV  67

Query  128  sepCQaaaarrpasseppstaprttVTPFSASEGVDGSTKGK-FAAYFDCDDE-----LA  289
             E          A+ +      + TVT        DG TKGK    Y++ D +       
Sbjct  68   KETVTKTPQSITATVKETVARVKETVTKREMLTCDDGETKGKKLTMYYEVDVDSDRGRCI  127

Query  290  ggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
             G      GN GGG      DW+G WE V+  R G+  WYRY D+TVI+GNVVRLW+
Sbjct  128  DGELTAVTGNYGGGLGDCGGDWWGKWEGVVRMRNGDDSWYRYVDLTVINGNVVRLWD  184



>ref|XP_010493189.1| PREDICTED: uncharacterized protein LOC104770456 [Camelina sativa]
Length=205

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 82/185 (44%), Gaps = 34/185 (18%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAF Y  F      + +WTW ++V+ AA  FWRI+V ++      +    + +     
Sbjct  9    EALAFQYASFGVFAAVNNVWTW-IAVVTAAVSFWRIRVTTIGDGDGHACVLLEESRTGPV  67

Query  164  asseppstaprttVTPFSASEGV--------------------DGSTKGK-FAAYFDCDD  280
              +        T  TP S +  V                    DG TKGK    Y++ D 
Sbjct  68   KETVARVKETVTK-TPQSITATVKETVAQVKETITKTEPLTCDDGVTKGKKLTMYYEVDV  126

Query  281  E-----LAggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNV  445
            +        G      G+ GGG      +W+G WE V+  R G+  WYRY D+TVI+GNV
Sbjct  127  DSDGGRCIDGELTAVTGDYGGGLGDCGGEWWGKWEGVVRMRNGDDSWYRYVDLTVINGNV  186

Query  446  VRLWE  460
            VRLW+
Sbjct  187  VRLWD  191



>ref|XP_010520522.1| PREDICTED: uncharacterized protein LOC104799609 [Tarenaya hassleriana]
Length=217

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 61/205 (30%), Positives = 80/205 (39%), Gaps = 51/205 (25%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EAL FNY+        + LWTW ++V+ AA  FW I+V      + P      +A     
Sbjct  9    EALPFNYIGIGILSAVNNLWTW-IAVVTAAVSFWGIRVTGGGDSTPPLKIGHCSAVFEEI  67

Query  164  asseppstaprttVTPFSASEGV------------------DGSTKGKFAAYFDCDDELA  289
                   TA      P +A+                     DG TKGK   Y+  D EL 
Sbjct  68   GGESERQTAQTDDCEPQAAATPAEKTVTLTEKAFLRPLMCNDGVTKGKLTVYYGGDGELT  127

Query  290  ggn-----------------------daesngngggggEVLVKDWYGCWERVMETRMGEM  400
              +                       D         G +  V++W   WERV+ T  GE 
Sbjct  128  AISDEGDGFTKGKLTLYCDGDGVGDNDDGEITAISDGRDGEVEEW---WERVVRTMNGED  184

Query  401  GWYRYQDITVIDGNVVRLWEGGGRR  475
             WYRY D+TVI+GNVVRLW+  G R
Sbjct  185  SWYRYVDLTVINGNVVRLWDDNGVR  209



>ref|XP_010049366.1| PREDICTED: uncharacterized protein LOC104438004 [Eucalyptus grandis]
Length=197

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 45/84 (54%), Gaps = 8/84 (10%)
 Frame = +2

Query  236  GSTKGKFAAYFD---CDDELAggndaesngngggggEVLVKDWYGCWERVMETRMGEMGW  406
            G TKGKFA Y++    DDE         +    GGGE     W   WER    R GE GW
Sbjct  119  GVTKGKFATYYEEDRRDDEPPPPAATTVDEAAFGGGE-----WRWSWERAARMRDGERGW  173

Query  407  YRYQDITVIDGNVVRLWEGGGRRR  478
            Y +QD+ VI+GNVVRLW+    RR
Sbjct  174  YSFQDLMVINGNVVRLWDERVSRR  197



>ref|XP_010420925.1| PREDICTED: uncharacterized protein LOC104706426 [Camelina sativa]
Length=205

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 83/185 (45%), Gaps = 34/185 (18%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAF Y         + +WTW ++V+ AA  FWRI+V +       +    + +     
Sbjct  9    EALAFQYASVGAFAAVNNVWTW-IAVVTAAVSFWRIRVTTNGDGDGHACVLLEESRTGPV  67

Query  164  asseppstaprttVTPFSASEGV--------------------DGSTKGK-FAAYFDCD-  277
              +        T  TP S +  V                    DG TKGK    Y++ D 
Sbjct  68   KETVARVKETVTN-TPQSITATVKETVARVKETVAKTEMLTCDDGVTKGKKLKMYYEVDV  126

Query  278  --DE--LAggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNV  445
              DE     G+     GN GGG      +W+G WE V+  R G+ GWYRY D+TVI+GNV
Sbjct  127  DSDEGRCIDGDLTAVTGNYGGGLGDCGGEWWGKWEGVVRMRNGDDGWYRYLDLTVINGNV  186

Query  446  VRLWE  460
            VRLW+
Sbjct  187  VRLWD  191



>gb|KHN07876.1| hypothetical protein glysoja_032420 [Glycine soja]
Length=180

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 71/163 (44%), Gaps = 29/163 (18%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EA AFNYL F      +  WTW       A  FWR + P+      P             
Sbjct  8    EAQAFNYLSFGFLTLLNNFWTW------LAFTFWRTRAPTSELLPPPDDPV---------  52

Query  164  asseppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEVL  343
                   + P     P      VDG+ KGKF  Y++ + E    +  E+       G  L
Sbjct  53   ----RDESDPVAVTGPSPTVVDVDGARKGKFTLYYEDESERECESHQETTALTERDGRGL  108

Query  344  VKDWYGCWERVMETRMGE--MGWYRYQDITVIDGNVVRLWEGG  466
               W+  WE +++ R GE   GWY  QD+TV++G+VVRLW+GG
Sbjct  109  --KWWESWEELLKIRRGEDQNGWYTCQDLTVLNGSVVRLWDGG  149



>ref|XP_003542376.1| PREDICTED: uncharacterized protein LOC100806863 [Glycine max]
Length=180

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 71/163 (44%), Gaps = 29/163 (18%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EA AFNYL F      +  WTW       A  FWR + P+      P             
Sbjct  8    EAQAFNYLSFGFLTLLNNFWTW------LAFTFWRTRAPTSELLPPPDDPV---------  52

Query  164  asseppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEVL  343
                   + P     P      VDG+ KGKF  Y++ + E    +  E+       G  L
Sbjct  53   ----RDESDPVAVTGPSPTVVDVDGARKGKFTLYYEDESERECESHQETTALTERDGRGL  108

Query  344  VKDWYGCWERVMETRMGE--MGWYRYQDITVIDGNVVRLWEGG  466
               W+  WE +++ R GE   GWY  QD+TV++G+VVRLW+GG
Sbjct  109  --KWWESWEELLKIRRGEDQNGWYTCQDLTVLNGSVVRLWDGG  149



>emb|CDX70943.1| BnaC03g10270D [Brassica napus]
Length=190

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 80/183 (44%), Gaps = 27/183 (15%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAF Y  F      + +WTW ++V+ AA  FWR+KV ++           + A   + 
Sbjct  9    EALAFQYASFGVLGVVNNVWTW-IAVVTAAVSFWRMKVTTIGDNDGHGCSLLEDATTSKA  67

Query  164  asseppstaprttVTPFSASEGV---------------DGSTKG-KFAAYFDCD---DEL  286
                      +    P   +E                 DG TKG K   Y++ D   +E 
Sbjct  68   EQESDHQEPQKM-AGPVEEAEAPPVNETDVNWEPLMCDDGVTKGTKLTMYYEVDVDHEER  126

Query  287  AggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGG  466
                +        GGG     +W+  WERV++ R G+  WYRY D+TVIDG+VVRLW+  
Sbjct  127  CVDGEGGLPTVNYGGGFGNSGEWWERWERVVKMRNGDDVWYRYVDLTVIDGSVVRLWDDD  186

Query  467  GRR  475
             R 
Sbjct  187  KRN  189



>ref|XP_006292946.1| hypothetical protein CARUB_v10019217mg [Capsella rubella]
 gb|EOA25844.1| hypothetical protein CARUB_v10019217mg [Capsella rubella]
Length=189

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 79/165 (48%), Gaps = 14/165 (8%)
 Frame = +2

Query  2    EALAFNYLRFDKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpassepp  181
            E LAF+Y+ F+ LWTW ++V+ AA  FWRI+  + +      +     +    P      
Sbjct  9    EVLAFDYV-FNNLWTW-IAVVTAAVSFWRIRATTTTTTVIRDNGFIDDSPREPPLPQATK  66

Query  182  staprttVTPFSASEGV-----------DGSTKGKFAAYFDCDDELAggndaesngnggg  328
            +   + T T     +             DG TKGK   Y++ + E     D     +   
Sbjct  67   APRVKVTETKPPRVKVTETGDWSLLLCNDGVTKGKLTVYYEEEIEREIDEDDGEITDVKY  126

Query  329  ggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEG  463
            GG     +W+  WERV++ R G+ GWYRY D+ VI+G+VVRLW+ 
Sbjct  127  GGG-ESGEWWERWERVVKMRSGDEGWYRYVDLAVINGSVVRLWDA  170



>gb|AAM63728.1| unknown [Arabidopsis thaliana]
Length=193

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 23/175 (13%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpsl-------------sppskp  124
            EALAF Y  F      + +WTW ++V+ AA  FWRI+V ++                SK 
Sbjct  9    EALAFEYASFGVFAVVNNVWTW-IAVVTAAVSFWRIRVTTIGVGDGHACVLIEELTGSKS  67

Query  125  ssepCQaaaarrpasseppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAg---g  295
             +E  +          +      + TVT        DG TK K   Y++ D ++ G    
Sbjct  68   ENESGRLEPKSITGPVKETVARVKETVTKTEPLICDDGVTKRKLTMYYEVDVDVDGGRCV  127

Query  296  ndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
            N   +  + GGG      DW+  W+ V+  R G+  WYRY D+TVI+GNVVRLW+
Sbjct  128  NGDLTAVSYGGGLGNCGGDWWEKWDGVVRMRNGDDSWYRYVDLTVINGNVVRLWD  182



>ref|XP_006289919.1| hypothetical protein CARUB_v10003535mg [Capsella rubella]
 gb|EOA22817.1| hypothetical protein CARUB_v10003535mg [Capsella rubella]
Length=212

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  350  DWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGR  472
            +W+  WERVM  R G+ GWYRY D+TVI+GNVVRLW+   R
Sbjct  163  EWWEKWERVMRMRNGDDGWYRYVDLTVINGNVVRLWDDSNR  203



>ref|XP_009120771.1| PREDICTED: uncharacterized protein LOC103845644 [Brassica rapa]
Length=187

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 77/175 (44%), Gaps = 23/175 (13%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAF Y  F      + +WTW ++V+ AA  FWR++V ++    +      +   A + 
Sbjct  9    EALAFEYASFGVLAIINNVWTW-IAVVTAAVSFWRMRVTTIGEDGRHRCGLLEEQTASKS  67

Query  164  asseppstaprttVTPFSASEGV-------------DGSTKGKFAAYFDCDDELAggnda  304
                     P          E V             DG TKGK   Y++ D +   G D 
Sbjct  68   DQEPQVVAGPVKETAAARVEETVVMKTEVWETLMCDDGVTKGKMTVYYEVDVDGGRGGDG  127

Query  305  esngngggggEVLVKD---WYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
            +            + D   W+  WERV++ R G+  WYRY D+ VI+G+VVRLW+
Sbjct  128  DGELTSAVNYGGGLGDCGEWWERWERVVKMRNGDEDWYRYVDLMVINGSVVRLWD  182



>emb|CDX92435.1| BnaA10g14740D [Brassica napus]
Length=187

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 77/175 (44%), Gaps = 23/175 (13%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAF Y  F      + +WTW ++V+ AA  FWR++V ++    +      +   A + 
Sbjct  9    EALAFEYASFGVLAIINNVWTW-IAVVTAAVSFWRMRVTTIGDDDRHGCGLLEEQTASKS  67

Query  164  asseppstaprttVTPFSASEGV-------------DGSTKGKFAAYFDCDDELAggnda  304
                     P          E V             DG TKGK   Y++ D +   G D 
Sbjct  68   GQEPQAVAGPVKETAAAREEETVVMKTEVWETLMCDDGVTKGKMTVYYEVDVDGGRGGDG  127

Query  305  esngngggggEVLVKD---WYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
            +            + D   W+  WERV++ R G+  WYRY D+ VI+G+VVRLW+
Sbjct  128  DGELTSAVNYGGGLGDCGEWWERWERVVKMRNGDEDWYRYVDLMVINGSVVRLWD  182



>emb|CDY45068.1| BnaA02g05080D [Brassica napus]
Length=186

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 80/177 (45%), Gaps = 28/177 (16%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVps---------------lspps  118
            EALA  Y  F      + +WTW ++V+ AA  FWRI+V +                +   
Sbjct  9    EALALEYASFGCLAVVNNVWTW-IAVVTAAVSFWRIRVTTIKVEDGHGCVLLEGSKASKP  67

Query  119  kpssepCQaaaarrpasseppstaprttV-TPFSASEGVDGSTKGKFAAYFDC--DDELA  289
            +  +   Q  A          +    T V  P    EGV   TKGK   Y++   + E  
Sbjct  68   EQETGHYQPQAVAGAVGETATAQGKETVVWEPLVCDEGV---TKGKLTMYYEVGVEGERC  124

Query  290  ggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
               D E      GGG     +W+  WERV++ R G+  WYRY D+TV++G+VVRLW+
Sbjct  125  VDGDGEVTDVSYGGGLGHCGEWWERWERVLKMRTGDDDWYRYVDVTVLNGSVVRLWD  181



>ref|XP_009126476.1| PREDICTED: uncharacterized protein LOC103851374 [Brassica rapa]
Length=186

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 80/177 (45%), Gaps = 28/177 (16%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVp---------------slspps  118
            EALA  Y  F      + +WTW ++V+ AA  FWRI+V                S +   
Sbjct  9    EALALEYASFGCLAVVNNVWTW-IAVVTAAVSFWRIRVTAIKVEDGHGCVLLEGSKASKP  67

Query  119  kpssepCQaaaarrpasseppstaprttV-TPFSASEGVDGSTKGKFAAYFDC--DDELA  289
            +  +   Q  A          +    T V  P    EGV   TKGK   Y++   + E  
Sbjct  68   EQETGHYQPQAVAGAVGETATAQGKETVVWEPLVCDEGV---TKGKLTMYYEVGVEGERC  124

Query  290  ggndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
               D E      GGG     +W+  WERV++ R G+  WYRY D+TV++G+VVRLW+
Sbjct  125  VDGDGEVTDVSYGGGLGHCGEWWERWERVLKMRTGDDDWYRYVDVTVLNGSVVRLWD  181



>ref|XP_006452867.1| hypothetical protein CICLE_v10009511mg [Citrus clementina]
 gb|ESR66107.1| hypothetical protein CICLE_v10009511mg [Citrus clementina]
Length=205

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 76/178 (43%), Gaps = 22/178 (12%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAFNY  F      + LW W V+V+ AA  FWRI+  S S              +   
Sbjct  12   EALAFNYATFSVFTVVNNLWAW-VAVITAAISFWRIRTTSFSDKPDHQQPLIDRNTSGSQ  70

Query  164  asseppstaprttVTPFSAS-----EGVDGSTKG-KFAAYF--------DCDDELAggnd  301
             +  P +T+      P           VDG T+G K+  Y+        D D E      
Sbjct  71   LAQPPANTSSAEAAPPCPIPALPPANDVDGVTEGSKYTFYYYEEGQTEGDGDGEATSVVK  130

Query  302  aesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRR  475
               +     G    V DW       M  R+ +MGWYR QD+TV++GNVVRLW+   RR
Sbjct  131  EWRDDADSDGVSSCV-DWRELEGVRMRARIEDMGWYRCQDLTVVNGNVVRLWDERRRR  187



>gb|EYU25818.1| hypothetical protein MIMGU_mgv1a020072mg [Erythranthe guttata]
Length=176

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 85/175 (49%), Gaps = 23/175 (13%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALA NYL +      + +W W V+V+ AA  FWR  + +LS P   ++  C+A A    
Sbjct  9    EALALNYLTYGFLTVVNSIWPW-VAVITAAVSFWR--IRALSSPELRNAASCKAEAEEEE  65

Query  164  asseppstaprttVTPFSASEGVDGSTKGKFAAYFDCDD-------ELAggndaesngng  322
                  S AP         +   + STK KF  Y++ +D       E        +    
Sbjct  66   EEEAIVSDAPARAFCCRVLAR--ECSTKTKFRLYYEEEDFRGDDGGESDDYRSEVAAAEA  123

Query  323  ggggEVLVKDWYGC--WERVMET-RMGEMGWYRYQDITVIDGNVVRLWEGGGRRR  478
                ++       C  WER M   RMG++GWYR+QD+TV+DG+VVRLWE  GRRR
Sbjct  124  AVSEKLDYCPRRRCDDWERTMVVMRMGDLGWYRWQDMTVLDGSVVRLWE--GRRR  176



>ref|NP_568401.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED92889.1| uncharacterized protein AT5G20790 [Arabidopsis thaliana]
Length=193

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 81/175 (46%), Gaps = 23/175 (13%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpsl-------------sppskp  124
            EALAF Y         + +WTW ++V+ AA  FWRI+V ++                SK 
Sbjct  9    EALAFEYASLGVFAVVNNVWTW-IAVVTAAVSFWRIRVTTIGVGDGHACVLIEELTGSKS  67

Query  125  ssepCQaaaarrpasseppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAg---g  295
             +E  +          +      + TVT        DG TKGK    ++ D ++ G    
Sbjct  68   ENESGRLEPKSITGPVKETVARVKETVTKTEPLICDDGVTKGKLTMCYEVDVDVDGGRCV  127

Query  296  ndaesngngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
            N   +  + GGG      DW+  W+ V+  R G+  WYRY D+TVI+GNVVRLW+
Sbjct  128  NGDLTAVSYGGGLGNCGGDWWEKWDGVVRMRNGDDSWYRYVDLTVINGNVVRLWD  182



>ref|XP_009348910.1| PREDICTED: uncharacterized protein LOC103940513 [Pyrus x bretschneideri]
Length=190

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +2

Query  338  VLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
            V+V +W   W+ V+  R GEMGWYR+QD+T ++GNVVRLW+
Sbjct  152  VVVANW---WDDVLRLRTGEMGWYRFQDLTELNGNVVRLWD  189



>gb|EYU28305.1| hypothetical protein MIMGU_mgv1a021094mg, partial [Erythranthe 
guttata]
Length=182

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 87/171 (51%), Gaps = 16/171 (9%)
 Frame = +2

Query  2    EALAFNYLRF-------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarr  160
            E+LA +YL +       + LW W ++V  A+  +WRI   +LS    P     +   +  
Sbjct  9    ESLAVSYLSYGVYTAVNNMLWAW-IAVFTASVSWWRI-TRALSSSPSPVPLLSRPEQSTP  66

Query  161  passeppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEV  340
            P    P   A      P ++ E    S KGK+ + ++ D+E  G +D +   N  GGG V
Sbjct  67   PPPPRPEPAAVEVAGEPTTSCEC---SPKGKYFSMYNYDNEQGGEDDVDGGSNINGGGSV  123

Query  341  LVKDW---YGCWERVMET-RMGEMGWYRYQDITVIDGNVVRLWEGGGRRRS  481
            +V+        WERVM   +MG+MGWYR QD  V+DG+VVRLW+   RR +
Sbjct  124  VVEKLGRRVDDWERVMVVMKMGDMGWYRCQDFDVLDGSVVRLWDDDRRRHT  174



>emb|CDY16563.1| BnaC09g37100D [Brassica napus]
Length=188

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 76/176 (43%), Gaps = 24/176 (14%)
 Frame = +2

Query  2    EALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrp  163
            EALAF Y+ F      + +WTW ++V+ AA  FWR++V ++    +              
Sbjct  9    EALAFEYVSFGVLAVINNVWTW-IAVVTAAVSFWRMRVTTIGDDGRRHGCGLLEEQTASK  67

Query  164  asseppstaprttVTPFSASEGV--------------DGSTKGKFAAYFDCDDELAggnd  301
               E  + A     T  +  E                DG TKGK   Y++ + +     D
Sbjct  68   TEQERQAVAGPVKETAAARVEEALVMKTEVWETLMCDDGVTKGKMTMYYEVNVDGGRDVD  127

Query  302  aesngngggggEVLVKD---WYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
             +              D   W+  WERV++ R G+  WYRY D+ VI+G+VVRLW+
Sbjct  128  EDGELTSAVNYGCGSGDCGEWWERWERVVKMRNGDEDWYRYVDLMVINGSVVRLWD  183



>ref|XP_009343378.1| PREDICTED: uncharacterized protein LOC103935343 [Pyrus x bretschneideri]
Length=190

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +2

Query  338  VLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVVRLWE  460
            V+V +W   W+ V+  R GEMGWYR+QD+T + GNVVRLW+
Sbjct  152  VVVANW---WDDVLRLRTGEMGWYRFQDLTELSGNVVRLWD  189



>ref|XP_010917423.1| PREDICTED: uncharacterized protein LOC105042019 [Elaeis guineensis]
Length=196

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  365  WERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGRRR  478
            WE +M  R G++GWYRYQD+T ++G+VVRLWE    RR
Sbjct  153  WEGLMVGRRGDLGWYRYQDLTALNGSVVRLWETATSRR  190



>ref|XP_008800514.1| PREDICTED: uncharacterized protein LOC103714858 [Phoenix dactylifera]
Length=173

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 70/158 (44%), Gaps = 6/158 (4%)
 Frame = +2

Query  2    EALAFNYLRFDKLWTW-WVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpassep  178
            EALAF Y      W W W +VLAAA G WRI+      P  P             A S P
Sbjct  9    EALAFRYSAAVAGWLWAWFAVLAAALGLWRIRAALPPSPKPP----GPLDPTGAEAVSAP  64

Query  179  pstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEVLVKDWY  358
            PS       +P   ++G+  + K +F AYF  DD        +   +  G      +D  
Sbjct  65   PSAPVLIEPSPSCNADGI-ATPKARFMAYFHADDGSDEKERGDGISDDDGEETEKEEDAP  123

Query  359  GCWERVMETRMGEMGWYRYQDITVIDGNVVRLWEGGGR  472
              W R +    G++G YRY++ T  +G+VVR W+G  R
Sbjct  124  WGWARRIVRNDGDLGLYRYENRTAFNGSVVRPWDGNVR  161



>ref|XP_008803397.1| PREDICTED: uncharacterized protein LOC103716956 [Phoenix dactylifera]
Length=199

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 6/45 (13%)
 Frame = +2

Query  365  WERVMETRMGEMGWYRYQDITVIDGNVVRLWEGG------GRRRS  481
            WE +M  R G++GWYRYQD+T ++G+VVRLW+G        RRRS
Sbjct  151  WEGLMVRRRGDLGWYRYQDLTALNGSVVRLWDGDSVWTATSRRRS  195



>ref|XP_004287665.1| PREDICTED: uncharacterized protein LOC101305000 [Fragaria vesca 
subsp. vesca]
Length=195

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 78/184 (42%), Gaps = 36/184 (20%)
 Frame = +2

Query  5    ALAFNYLRF------DKLWTWWVSVLAAAAGFWRIKV---------pslsppskpssepC  139
             LAF+Y+ F      + LWTW ++V+ A   FWR++             S     SS  C
Sbjct  8    PLAFDYVSFGLINVVNSLWTW-LAVVTATVSFWRLRPRAIEGLKLHLPSSNDVVRSSNGC  66

Query  140  QaaaarrpasseppstaprttVTPFS--------ASEGVD------GSTKG-KFAAYFDC  274
                   P         PR+   P S        +S G+       G TKG KF  YFD 
Sbjct  67   SPFPETSPPPVTAEEELPRSVSAPPSRAHAAVPSSSSGLGRFEDDGGVTKGVKFTLYFDE  126

Query  275  DDELAggndaesng--ngggggEVLVKDWYGCWERVMETRMGEMGWYRYQDITVIDGNVV  448
            D     G + E +G        E   ++W   WE  +  R  E  WYRYQD+TV +GNVV
Sbjct  127  DTNGDVGGEGEGDGDVTARETEESGGENW---WESCLRMRTEEKSWYRYQDLTVFNGNVV  183

Query  449  RLWE  460
            RLW+
Sbjct  184  RLWD  187



>gb|KHN17746.1| hypothetical protein glysoja_005943 [Glycine soja]
Length=161

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 69/159 (43%), Gaps = 26/159 (16%)
 Frame = +2

Query  2    EALAFNYLRF---DKLWTWWVSVLAAAAGFWRIKVpslsppskpssepCQaaaarrpass  172
            EA AFNYL F      WTW       A  FWR + P+      P       + +   A  
Sbjct  8    EAQAFNYLSFGFLSNFWTW------LALTFWRARTPTSELLPPPDDPIHDESESDPVAVP  61

Query  173  eppstaprttVTPFSASEGVDGSTKGKFAAYFDCDDELAggndaesngngggggEVLVKD  352
                        P   +  VDG+ KGKF   ++  DE     +        G G    ++
Sbjct  62   AR---------VPIPFAVDVDGARKGKFTLCYE--DEFERECETTVTEERDGRG----RE  106

Query  353  WYGCWERVMETRMGEM--GWYRYQDITVIDGNVVRLWEG  463
            W+  WE +++ R GE   GWY  QD+T ++G+VVRLW+G
Sbjct  107  WWESWETLLKLRRGENQNGWYTCQDLTALNGSVVRLWDG  145



>gb|ACU15609.1| unknown [Glycine max]
Length=88

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +2

Query  350  DWYGCWERVMETRMGEM--GWYRYQDITVIDGNVVRLWEGG  466
            +W+  WER+++ R GE   GWYR+QD+T ++G+VVR+W+GG
Sbjct  26   EWWNRWERLLQLRNGESENGWYRWQDLTELNGSVVRIWDGG  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1700790535626