BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c88950_g1_i1 len=618 path=[1:0-617]

Length=618
                                                                      Score     E

ref|XP_002868035.1|  hypothetical protein ARALYDRAFT_493093             103   5e-23   
ref|NP_193515.1|  putative AT-hook DNA-binding family protein           103   6e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285880.1|  hypothetical protein CARUB_v10007383mg             103   6e-23   
emb|CDX90445.1|  BnaA03g43360D                                          103   7e-23   
gb|KFK23205.1|  hypothetical protein AALP_AAs54797U000100               103   7e-23   
ref|XP_009136874.1|  PREDICTED: putative DNA-binding protein ESCA...    103   8e-23   
gb|ABD65169.1|  hypothetical protein 40.t00056                          103   1e-22   Brassica oleracea
ref|XP_010518859.1|  PREDICTED: putative DNA-binding protein ESCA...    100   1e-22   
ref|XP_004133943.1|  PREDICTED: putative DNA-binding protein ESCA...  98.6    3e-21   
ref|XP_007220428.1|  hypothetical protein PRUPE_ppa009347mg           95.5    5e-20   
ref|XP_002312113.2|  hypothetical protein POPTR_0008s05890g           85.9    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_011033055.1|  PREDICTED: putative DNA-binding protein ESCA...  85.9    1e-16   
emb|CBI35166.3|  unnamed protein product                              85.1    2e-16   
ref|XP_002271606.1|  PREDICTED: putative DNA-binding protein ESCA...  85.1    2e-16   Vitis vinifera
ref|XP_008232226.1|  PREDICTED: putative DNA-binding protein ESCA...  84.7    2e-16   
emb|CAN61523.1|  hypothetical protein VITISV_016751                   84.7    2e-16   Vitis vinifera
gb|KHN01050.1|  Putative DNA-binding protein ESCAROLA                 84.3    3e-16   
ref|XP_002281411.1|  PREDICTED: putative DNA-binding protein ESCA...  83.6    5e-16   Vitis vinifera
emb|CAN83987.1|  hypothetical protein VITISV_032602                   83.6    5e-16   Vitis vinifera
ref|XP_009123977.1|  PREDICTED: putative DNA-binding protein ESCA...  84.0    5e-16   
gb|EYU19935.1|  hypothetical protein MIMGU_mgv1a017709mg              84.0    6e-16   
emb|CDY49327.1|  BnaA05g32890D                                        83.6    6e-16   
ref|XP_006606925.1|  PREDICTED: putative DNA-binding protein ESCA...  84.3    7e-16   
ref|XP_008238264.1|  PREDICTED: putative DNA-binding protein ESCA...  83.2    8e-16   
ref|XP_007210169.1|  hypothetical protein PRUPE_ppa019786mg           83.2    8e-16   
ref|XP_009347388.1|  PREDICTED: putative DNA-binding protein ESCA...  82.8    1e-15   
gb|EYU43510.1|  hypothetical protein MIMGU_mgv1a017700mg              82.8    1e-15   
gb|EYU40549.1|  hypothetical protein MIMGU_mgv1a021038mg              82.8    1e-15   
ref|XP_007144108.1|  hypothetical protein PHAVU_007G129400g           82.4    2e-15   
ref|XP_008356452.1|  PREDICTED: putative DNA-binding protein ESCA...  82.0    2e-15   
ref|XP_011070911.1|  PREDICTED: putative DNA-binding protein ESCA...  81.3    3e-15   
ref|XP_008438225.1|  PREDICTED: putative DNA-binding protein ESCA...  80.9    4e-15   
emb|CDY64701.1|  BnaCnng44570D                                        81.3    4e-15   
ref|XP_008377132.1|  PREDICTED: putative DNA-binding protein ESCA...  80.9    6e-15   
ref|XP_004509027.1|  PREDICTED: putative DNA-binding protein ESCA...  80.5    7e-15   
ref|XP_003524711.1|  PREDICTED: putative DNA-binding protein ESCA...  80.1    9e-15   
gb|KDP22981.1|  hypothetical protein JCGZ_01738                       80.5    9e-15   
ref|XP_002519826.1|  ESC, putative                                    79.3    2e-14   Ricinus communis
ref|XP_004964470.1|  PREDICTED: putative DNA-binding protein ESCA...  79.3    2e-14   
gb|KDP42477.1|  hypothetical protein JCGZ_00274                       82.0    3e-14   
gb|KCW77938.1|  hypothetical protein EUGRSUZ_D02188                   78.2    4e-14   
ref|XP_006414185.1|  hypothetical protein EUTSA_v10025859mg           78.2    5e-14   
gb|ACU24276.1|  unknown                                               77.4    6e-14   Glycine max [soybeans]
ref|XP_010053603.1|  PREDICTED: putative DNA-binding protein ESCA...  77.8    6e-14   
ref|XP_004300243.1|  PREDICTED: putative DNA-binding protein ESCA...  77.8    7e-14   
ref|XP_009377073.1|  PREDICTED: putative DNA-binding protein ESCA...  77.4    8e-14   
ref|XP_004163877.1|  PREDICTED: putative DNA-binding protein ESCA...  77.0    8e-14   
ref|XP_008448697.1|  PREDICTED: putative DNA-binding protein ESCA...  77.0    8e-14   
ref|XP_004148759.1|  PREDICTED: putative DNA-binding protein ESCA...  77.0    8e-14   
ref|XP_011090893.1|  PREDICTED: putative DNA-binding protein ESCA...  77.4    8e-14   
ref|XP_003534486.1|  PREDICTED: putative DNA-binding protein ESCA...  77.0    9e-14   
ref|XP_009130966.1|  PREDICTED: putative DNA-binding protein ESCA...  77.0    1e-13   
emb|CDP13007.1|  unnamed protein product                              77.0    1e-13   
emb|CDX78802.1|  BnaA01g08690D                                        77.0    1e-13   
ref|XP_010275243.1|  PREDICTED: putative DNA-binding protein ESCA...  77.0    1e-13   
ref|XP_004953673.1|  PREDICTED: putative DNA-binding protein ESCA...  77.0    1e-13   
ref|XP_009393002.1|  PREDICTED: putative DNA-binding protein ESCA...  76.6    2e-13   
ref|XP_009403254.1|  PREDICTED: putative DNA-binding protein ESCA...  76.6    2e-13   
gb|AFK38460.1|  unknown                                               75.9    2e-13   
gb|AES80473.2|  AT hook motif DNA-binding family protein              75.9    2e-13   
ref|XP_006436718.1|  hypothetical protein CICLE_v10032253mg           76.3    2e-13   
ref|XP_008460731.1|  PREDICTED: putative DNA-binding protein ESCA...  76.3    2e-13   
ref|XP_009616004.1|  PREDICTED: putative DNA-binding protein ESCA...  75.9    2e-13   
ref|XP_009420779.1|  PREDICTED: putative DNA-binding protein ESCA...  76.3    2e-13   
ref|XP_003624255.1|  AT-hook DNA-binding protein                      76.3    3e-13   
ref|XP_002876587.1|  hypothetical protein ARALYDRAFT_486561           75.5    3e-13   
ref|XP_009399398.1|  PREDICTED: putative DNA-binding protein ESCA...  75.5    4e-13   
ref|XP_010269998.1|  PREDICTED: putative DNA-binding protein ESCA...  75.1    4e-13   
ref|XP_009382863.1|  PREDICTED: putative DNA-binding protein ESCA...  75.5    5e-13   
emb|CBI33919.3|  unnamed protein product                              75.1    5e-13   
ref|XP_009399397.1|  PREDICTED: putative DNA-binding protein ESCA...  75.1    5e-13   
ref|XP_009387695.1|  PREDICTED: putative DNA-binding protein ESCA...  75.1    6e-13   
ref|XP_008659508.1|  PREDICTED: putative DNA-binding protein ESCA...  75.1    6e-13   
ref|XP_006368407.1|  DNA-binding family protein                       75.1    6e-13   
ref|XP_009762421.1|  PREDICTED: putative DNA-binding protein ESCA...  74.7    6e-13   
ref|XP_004245889.1|  PREDICTED: putative DNA-binding protein ESCA...  74.7    7e-13   
ref|XP_008803114.1|  PREDICTED: putative DNA-binding protein ESCA...  75.1    7e-13   
ref|XP_010677251.1|  PREDICTED: putative DNA-binding protein ESCA...  74.7    7e-13   
ref|XP_006410687.1|  hypothetical protein EUTSA_v10017027mg           74.7    7e-13   
ref|XP_007039519.1|  AT-hook DNA-binding family protein               74.7    8e-13   
ref|XP_006385649.1|  DNA-binding family protein                       74.7    8e-13   
emb|CDY12779.1|  BnaC04g28620D                                        74.3    9e-13   
ref|XP_003608618.1|  AT-hook DNA-binding protein                      74.3    9e-13   
ref|XP_011028186.1|  PREDICTED: putative DNA-binding protein ESCA...  74.7    9e-13   
ref|XP_006352850.1|  PREDICTED: putative DNA-binding protein ESCA...  74.3    1e-12   
ref|XP_011034536.1|  PREDICTED: putative DNA-binding protein ESCA...  74.3    1e-12   
ref|XP_002320066.1|  DNA-binding family protein                       74.3    1e-12   Populus trichocarpa [western balsam poplar]
gb|AES90815.2|  AT hook motif DNA-binding family protein              74.3    1e-12   
ref|XP_003552472.1|  PREDICTED: putative DNA-binding protein ESCA...  73.9    1e-12   
ref|XP_004492894.1|  PREDICTED: putative DNA-binding protein ESCA...  73.9    1e-12   
ref|XP_010104316.1|  hypothetical protein L484_023266                 73.9    1e-12   
ref|XP_004153985.1|  PREDICTED: putative DNA-binding protein ESCA...  73.2    2e-12   
ref|XP_004145070.1|  PREDICTED: putative DNA-binding protein ESCA...  73.2    2e-12   
ref|XP_007155775.1|  hypothetical protein PHAVU_003G230600g           73.6    2e-12   
ref|XP_009139154.1|  PREDICTED: putative DNA-binding protein ESCA...  73.9    2e-12   
ref|XP_010548186.1|  PREDICTED: putative DNA-binding protein ESCA...  73.2    2e-12   
gb|EPS64135.1|  hypothetical protein M569_10646                       73.9    2e-12   
gb|KGN61619.1|  hypothetical protein Csa_2G190760                     73.6    2e-12   
ref|XP_004163216.1|  PREDICTED: putative DNA-binding protein ESCA...  73.2    2e-12   
ref|XP_004150655.1|  PREDICTED: putative DNA-binding protein ESCA...  73.2    2e-12   
gb|KCW71795.1|  hypothetical protein EUGRSUZ_E00284                   73.2    2e-12   
ref|XP_010055327.1|  PREDICTED: putative DNA-binding protein ESCA...  73.2    2e-12   
ref|XP_011018582.1|  PREDICTED: putative DNA-binding protein ESCA...  73.6    2e-12   
emb|CDY54780.1|  BnaAnng13510D                                        73.2    2e-12   
ref|XP_011093448.1|  PREDICTED: putative DNA-binding protein ESCA...  73.2    2e-12   
gb|ABD65635.1|  hypothetical protein 23.t00073                        73.2    2e-12   Brassica oleracea
ref|XP_008460074.1|  PREDICTED: putative DNA-binding protein ESCA...  73.6    2e-12   
gb|KFK36425.1|  hypothetical protein AALP_AA4G122700                  73.2    3e-12   
gb|EAZ24374.1|  hypothetical protein OsJ_08128                        71.6    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009133171.1|  PREDICTED: putative DNA-binding protein ESCA...  72.4    3e-12   
gb|ACU24278.1|  unknown                                               72.4    3e-12   Glycine max [soybeans]
emb|CDX79599.1|  BnaC03g19350D                                        72.4    4e-12   
ref|XP_009141480.1|  PREDICTED: putative DNA-binding protein ESCA...  72.4    4e-12   
gb|ADE76470.1|  unknown                                               72.4    4e-12   
dbj|BAJ94962.1|  predicted protein                                    73.2    4e-12   
ref|XP_007156666.1|  hypothetical protein PHAVU_002G006900g           72.4    4e-12   
emb|CDY72485.1|  BnaCnng77890D                                        72.4    4e-12   
ref|XP_006296261.1|  hypothetical protein CARUB_v10025435mg           72.4    5e-12   
ref|XP_002879544.1|  hypothetical protein ARALYDRAFT_482492           72.0    6e-12   
ref|XP_008646163.1|  PREDICTED: putative DNA-binding protein ESCA...  72.8    6e-12   
ref|XP_010505030.1|  PREDICTED: putative DNA-binding protein ESCA...  72.0    6e-12   
ref|XP_009420562.1|  PREDICTED: putative DNA-binding protein ESCA...  72.0    6e-12   
ref|XP_010509635.1|  PREDICTED: putative DNA-binding protein ESCA...  72.0    6e-12   
ref|NP_181070.1|  protein GIANT KILLER                                72.0    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531743.1|  PREDICTED: putative DNA-binding protein ESCA...  71.6    6e-12   
ref|XP_010516702.1|  PREDICTED: putative DNA-binding protein ESCA...  72.0    6e-12   
ref|XP_003570225.1|  PREDICTED: putative DNA-binding protein ESCA...  72.8    6e-12   
ref|XP_010941441.1|  PREDICTED: putative DNA-binding protein ESCA...  69.7    7e-12   
ref|XP_002438341.1|  hypothetical protein SORBIDRAFT_10g012980        72.4    7e-12   Sorghum bicolor [broomcorn]
ref|NP_001047914.1|  Os02g0713700                                     72.4    7e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452654.1|  hypothetical protein SORBIDRAFT_04g030040        72.4    8e-12   Sorghum bicolor [broomcorn]
ref|XP_007139682.1|  hypothetical protein PHAVU_008G050100g           71.6    8e-12   
gb|EYU40290.1|  hypothetical protein MIMGU_mgv1a019526mg              71.6    9e-12   
gb|EEC73884.1|  hypothetical protein OsI_08674                        72.8    1e-11   Oryza sativa Indica Group [Indian rice]
emb|CDX84222.1|  BnaC04g09840D                                        70.1    1e-11   
gb|EPS65599.1|  hypothetical protein M569_09178                       70.1    1e-11   
ref|XP_010052700.1|  PREDICTED: putative DNA-binding protein ESCA...  70.9    2e-11   
gb|EPS62166.1|  hypothetical protein M569_12627                       69.3    2e-11   
ref|XP_010558745.1|  PREDICTED: putative DNA-binding protein ESCA...  70.1    3e-11   
ref|XP_006366237.1|  PREDICTED: putative DNA-binding protein ESCA...  69.3    4e-11   
ref|XP_008799381.1|  PREDICTED: putative DNA-binding protein ESCA...  69.7    4e-11   
emb|CDP09327.1|  unnamed protein product                              69.7    5e-11   
emb|CDY02949.1|  BnaC04g25370D                                        69.7    5e-11   
gb|EPS57290.1|  hypothetical protein M569_17529                       68.6    5e-11   
ref|XP_009103966.1|  PREDICTED: putative DNA-binding protein ESCA...  68.9    5e-11   
emb|CDY31677.1|  BnaA05g08700D                                        68.2    6e-11   
ref|XP_008786310.1|  PREDICTED: putative DNA-binding protein ESCA...  69.3    7e-11   
ref|XP_009103959.1|  PREDICTED: putative DNA-binding protein ESCA...  69.3    7e-11   
ref|XP_003539199.1|  PREDICTED: putative DNA-binding protein ESCA...  68.6    8e-11   
ref|XP_009139507.1|  PREDICTED: putative DNA-binding protein ESCA...  68.9    8e-11   
ref|XP_009143684.1|  PREDICTED: putative DNA-binding protein ESCA...  68.9    8e-11   
emb|CDY53687.1|  BnaA07g37810D                                        68.9    8e-11   
emb|CDY23160.1|  BnaA04g05990D                                        68.9    8e-11   
gb|AFW75435.1|  hypothetical protein ZEAMMB73_958269                  70.5    8e-11   
ref|XP_004976643.1|  PREDICTED: putative DNA-binding protein ESCA...  68.9    1e-10   
dbj|BAC21441.1|  DNA-binding protein-like                             67.4    1e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CDY60321.1|  BnaCnng36000D                                        68.6    1e-10   
ref|NP_001059242.1|  Os07g0235200                                     67.0    1e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CDX88286.1|  BnaC06g37300D                                        68.2    1e-10   
ref|XP_010434615.1|  PREDICTED: putative DNA-binding protein ESCA...  68.6    1e-10   
ref|XP_010451406.1|  PREDICTED: putative DNA-binding protein ESCA...  68.2    1e-10   
ref|XP_008668970.1|  PREDICTED: putative DNA-binding protein ESCA...  68.6    1e-10   
ref|XP_002448423.1|  hypothetical protein SORBIDRAFT_06g026940        68.6    1e-10   Sorghum bicolor [broomcorn]
ref|XP_011086333.1|  PREDICTED: putative DNA-binding protein ESCA...  68.2    2e-10   
ref|XP_010278730.1|  PREDICTED: putative DNA-binding protein ESCA...  65.9    2e-10   
tpg|DAA36260.1|  TPA: hypothetical protein ZEAMMB73_652841            68.9    2e-10   
ref|XP_009383370.1|  PREDICTED: putative DNA-binding protein ESCA...  67.8    2e-10   
ref|XP_008788674.1|  PREDICTED: putative DNA-binding protein ESCA...  68.2    2e-10   
ref|XP_009410344.1|  PREDICTED: putative DNA-binding protein ESCA...  67.8    2e-10   
ref|XP_011002630.1|  PREDICTED: putative DNA-binding protein ESCA...  68.6    2e-10   
ref|XP_003516633.1|  PREDICTED: putative DNA-binding protein ESCA...  67.0    2e-10   
ref|XP_002524209.1|  ESC, putative                                    68.2    2e-10   Ricinus communis
ref|XP_002315208.2|  hypothetical protein POPTR_0010s20780g           68.2    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_001763021.1|  predicted protein                                65.9    3e-10   
dbj|BAK02723.1|  predicted protein                                    67.4    3e-10   
ref|XP_009386796.1|  PREDICTED: putative DNA-binding protein ESCA...  67.0    4e-10   
ref|XP_010097716.1|  hypothetical protein L484_023857                 67.4    4e-10   
ref|XP_009776190.1|  PREDICTED: putative DNA-binding protein ESCA...  66.6    4e-10   
ref|XP_006847733.1|  hypothetical protein AMTR_s00149p00093420        66.6    4e-10   
gb|EYU41285.1|  hypothetical protein MIMGU_mgv1a025243mg              67.0    5e-10   
ref|XP_010439938.1|  PREDICTED: putative DNA-binding protein ESCA...  67.0    5e-10   
ref|XP_003581586.1|  PREDICTED: putative DNA-binding protein ESCA...  67.0    6e-10   
emb|CDP07852.1|  unnamed protein product                              64.7    6e-10   
ref|XP_010538496.1|  PREDICTED: putative DNA-binding protein ESCA...  66.6    6e-10   
emb|CDY45983.1|  BnaA02g18130D                                        66.2    8e-10   
ref|XP_006354677.1|  PREDICTED: putative DNA-binding protein ESCA...  65.9    8e-10   
ref|XP_009128180.1|  PREDICTED: putative DNA-binding protein ESCA...  66.2    9e-10   
ref|XP_004229513.1|  PREDICTED: putative DNA-binding protein ESCA...  65.9    9e-10   
ref|XP_009597193.1|  PREDICTED: putative DNA-binding protein ESCA...  66.2    9e-10   
gb|EPS68305.1|  hypothetical protein M569_06465                       64.7    1e-09   
ref|XP_002315599.1|  hypothetical protein POPTR_0010s07370g           63.2    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009106318.1|  PREDICTED: putative DNA-binding protein ESCA...  65.5    1e-09   
emb|CDX87591.1|  BnaA07g32820D                                        65.5    1e-09   
ref|XP_006390186.1|  hypothetical protein EUTSA_v10019495mg           65.9    1e-09   
ref|XP_001757515.1|  predicted protein                                63.5    2e-09   
ref|XP_002468116.1|  hypothetical protein SORBIDRAFT_01g039840        65.1    2e-09   Sorghum bicolor [broomcorn]
ref|XP_008391057.1|  PREDICTED: putative DNA-binding protein ESCA...  65.1    2e-09   
ref|XP_008354801.1|  PREDICTED: putative DNA-binding protein ESCA...  65.1    2e-09   
emb|CDY20404.1|  BnaC02g24120D                                        64.7    2e-09   
ref|XP_009384565.1|  PREDICTED: putative DNA-binding protein ESCA...  64.3    2e-09   
ref|XP_004494969.1|  PREDICTED: putative DNA-binding protein ESCA...  63.9    2e-09   
ref|XP_010530021.1|  PREDICTED: putative DNA-binding protein ESCA...  64.7    2e-09   
ref|XP_008659816.1|  PREDICTED: putative DNA-binding protein ESCA...  64.7    2e-09   
gb|KFK42071.1|  hypothetical protein AALP_AA2G207300                  64.7    3e-09   
ref|XP_001765845.1|  predicted protein                                62.8    3e-09   
gb|KHN22151.1|  Putative DNA-binding protein ESCAROLA                 63.5    3e-09   
ref|XP_003615275.1|  hypothetical protein MTR_5g066020                63.9    3e-09   
ref|XP_008379732.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...  63.5    4e-09   
ref|XP_008465963.1|  PREDICTED: putative DNA-binding protein ESCA...  63.9    4e-09   
ref|XP_003560568.1|  PREDICTED: putative DNA-binding protein ESCA...  64.3    4e-09   
ref|XP_009351025.1|  PREDICTED: putative DNA-binding protein ESCA...  64.3    4e-09   
ref|XP_004148482.1|  PREDICTED: putative DNA-binding protein ESCA...  63.9    4e-09   
ref|XP_010539761.1|  PREDICTED: putative DNA-binding protein ESCA...  63.9    4e-09   
ref|XP_006435633.1|  hypothetical protein CICLE_v10032034mg           64.7    5e-09   
ref|XP_004984928.1|  PREDICTED: putative DNA-binding protein ESCA...  63.5    5e-09   
ref|XP_001760962.1|  predicted protein                                62.0    6e-09   
ref|XP_009607803.1|  PREDICTED: putative DNA-binding protein ESCA...  63.9    6e-09   
ref|XP_001785561.1|  predicted protein                                61.6    6e-09   
ref|XP_008233653.1|  PREDICTED: putative DNA-binding protein ESCA...  63.9    7e-09   
ref|XP_010027402.1|  PREDICTED: putative DNA-binding protein ESCA...  61.6    7e-09   
ref|XP_007009270.1|  AT-hook protein of GA feedback 2                 63.9    7e-09   
ref|XP_002437301.1|  hypothetical protein SORBIDRAFT_10g024540        63.2    7e-09   Sorghum bicolor [broomcorn]
gb|AIV43386.1|  AHL protein                                           63.5    7e-09   
ref|XP_009409024.1|  PREDICTED: putative DNA-binding protein ESCA...  63.5    8e-09   
gb|AIV43385.1|  AHL protein                                           62.8    8e-09   
ref|XP_004490439.1|  PREDICTED: putative DNA-binding protein ESCA...  62.8    8e-09   
dbj|BAJ98882.1|  predicted protein                                    62.8    9e-09   
dbj|BAJ94538.1|  predicted protein                                    63.2    1e-08   
ref|XP_009336832.1|  PREDICTED: putative DNA-binding protein ESCA...  63.2    1e-08   
ref|NP_001152652.1|  DNA-binding protein                              62.8    1e-08   Zea mays [maize]
ref|XP_008681074.1|  PREDICTED: DNA-binding protein isoform X1        62.8    1e-08   
ref|XP_004503162.1|  PREDICTED: putative DNA-binding protein ESCA...  63.2    1e-08   
ref|XP_007218339.1|  hypothetical protein PRUPE_ppa008610mg           63.5    1e-08   
ref|XP_003602928.1|  hypothetical protein MTR_3g100470                63.2    1e-08   
ref|XP_003558257.1|  PREDICTED: putative DNA-binding protein ESCA...  62.8    1e-08   
ref|XP_009774038.1|  PREDICTED: putative DNA-binding protein ESCA...  63.2    1e-08   
ref|XP_008375698.1|  PREDICTED: putative DNA-binding protein ESCA...  62.8    1e-08   
ref|XP_009418604.1|  PREDICTED: putative DNA-binding protein ESCA...  62.8    2e-08   
emb|CDP12442.1|  unnamed protein product                              63.5    2e-08   
ref|XP_006301299.1|  hypothetical protein CARUB_v10021706mg           62.4    2e-08   
ref|XP_002887643.1|  hypothetical protein ARALYDRAFT_476807           62.4    2e-08   
ref|XP_011085041.1|  PREDICTED: putative DNA-binding protein ESCA...  62.4    2e-08   
ref|XP_009384686.1|  PREDICTED: putative DNA-binding protein ESCA...  62.0    2e-08   
gb|KCW61537.1|  hypothetical protein EUGRSUZ_H04257                   62.0    2e-08   
gb|EPS64500.1|  hypothetical protein M569_10282                       60.5    2e-08   
ref|XP_001752988.1|  predicted protein                                60.1    2e-08   
dbj|BAJ94293.1|  predicted protein                                    62.4    2e-08   
ref|XP_010024974.1|  PREDICTED: putative DNA-binding protein ESCA...  62.0    3e-08   
gb|EPS71487.1|  hypothetical protein M569_03276                       60.5    3e-08   
ref|NP_177776.1|  AT-hook motif nuclear localized protein 29          62.0    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049682.1|  Os03g0270000                                     61.6    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649829.1|  PREDICTED: putative DNA-binding protein ESCA...  61.6    3e-08   
gb|EAZ26403.1|  hypothetical protein OsJ_10287                        61.2    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008663461.1|  PREDICTED: putative DNA-binding protein ESCA...  62.0    3e-08   
ref|XP_006656611.1|  PREDICTED: putative DNA-binding protein ESCA...  61.6    3e-08   
ref|XP_011016916.1|  PREDICTED: putative DNA-binding protein ESCA...  61.6    4e-08   
ref|XP_002969614.1|  hypothetical protein SELMODRAFT_71342            60.5    4e-08   
ref|XP_006591349.1|  PREDICTED: putative DNA-binding protein ESCA...  61.6    4e-08   
ref|XP_002302339.2|  hypothetical protein POPTR_0002s10520g           61.6    4e-08   Populus trichocarpa [western balsam poplar]
gb|ABL63117.1|  AT-hook DNA-binding protein                           60.8    5e-08   Catharanthus roseus [chatas]
ref|XP_010935004.1|  PREDICTED: LOW QUALITY PROTEIN: putative DNA...  61.2    5e-08   
emb|CDO99189.1|  unnamed protein product                              61.2    5e-08   
ref|XP_008782107.1|  PREDICTED: putative DNA-binding protein ESCA...  60.8    5e-08   
emb|CDX96613.1|  BnaA08g21560D                                        61.2    5e-08   
ref|XP_006588553.1|  PREDICTED: putative DNA-binding protein ESCA...  60.1    6e-08   
gb|ABL63119.1|  AT-hook DNA-binding protein                           60.5    6e-08   Catharanthus roseus [chatas]
ref|XP_009136213.1|  PREDICTED: putative DNA-binding protein ESCA...  61.2    6e-08   
dbj|BAK03205.1|  predicted protein                                    61.2    6e-08   
ref|XP_008777391.1|  PREDICTED: putative DNA-binding protein ESCA...  61.2    6e-08   
ref|XP_009110204.1|  PREDICTED: putative DNA-binding protein ESCA...  61.2    6e-08   
gb|EPS57979.1|  hypothetical protein M569_16838                       59.3    7e-08   
ref|XP_009351431.1|  PREDICTED: putative DNA-binding protein ESCA...  60.8    7e-08   
ref|XP_006354520.1|  PREDICTED: putative DNA-binding protein ESCA...  60.8    7e-08   
emb|CDX85952.1|  BnaC06g21820D                                        60.5    7e-08   
gb|ABZ89182.1|  putative protein                                      60.8    7e-08   Coffea canephora [robusta coffee]
emb|CDX83182.1|  BnaA03g23240D                                        60.1    7e-08   
gb|ADY38789.1|  DNA-binding protein                                   60.8    7e-08   
ref|XP_010907805.1|  PREDICTED: putative DNA-binding protein ESCA...  60.8    8e-08   
gb|EEC81765.1|  hypothetical protein OsI_25448                        58.2    8e-08   Oryza sativa Indica Group [Indian rice]
gb|KDP40294.1|  hypothetical protein JCGZ_02292                       59.3    8e-08   
emb|CDX98771.1|  BnaA03g45560D                                        60.8    8e-08   
emb|CDX94128.1|  BnaC07g37620D                                        60.8    8e-08   
gb|EPS72008.1|  hypothetical protein M569_02750                       58.9    8e-08   
emb|CDY41289.1|  BnaA01g12500D                                        60.8    8e-08   
ref|XP_009137280.1|  PREDICTED: putative DNA-binding protein ESCA...  60.8    9e-08   
ref|XP_007144002.1|  hypothetical protein PHAVU_007G120900g           60.5    9e-08   
ref|XP_009134025.1|  PREDICTED: putative DNA-binding protein ESCA...  60.1    9e-08   
ref|XP_002319649.1|  DNA-binding family protein                       60.1    1e-07   
ref|NP_001056730.1|  Os06g0136900                                     60.5    1e-07   
ref|XP_009379018.1|  PREDICTED: putative DNA-binding protein ESCA...  60.5    1e-07   
emb|CDX82978.1|  BnaC01g14280D                                        60.5    1e-07   
ref|XP_010266082.1|  PREDICTED: putative DNA-binding protein ESCA...  60.5    1e-07   
emb|CDY21451.1|  BnaC03g27460D                                        59.7    1e-07   
ref|XP_008461695.1|  PREDICTED: putative DNA-binding protein ESCA...  60.1    1e-07   
ref|XP_008371927.1|  PREDICTED: putative DNA-binding protein ESCA...  60.5    1e-07   
ref|XP_002314642.2|  hypothetical protein POPTR_0010s08500g           60.1    1e-07   
ref|XP_010102152.1|  hypothetical protein L484_021386                 59.7    1e-07   
ref|XP_004161914.1|  PREDICTED: putative DNA-binding protein ESCA...  59.7    1e-07   
ref|XP_004147679.1|  PREDICTED: putative DNA-binding protein ESCA...  59.7    1e-07   
ref|XP_009402315.1|  PREDICTED: putative DNA-binding protein ESCA...  60.1    1e-07   
ref|XP_010243718.1|  PREDICTED: putative DNA-binding protein ESCA...  59.7    1e-07   
ref|XP_010277472.1|  PREDICTED: putative DNA-binding protein ESCA...  60.1    1e-07   
emb|CDX83510.1|  BnaA03g19960D                                        60.5    1e-07   
ref|XP_002963027.1|  hypothetical protein SELMODRAFT_404546           58.5    1e-07   
ref|XP_011029905.1|  PREDICTED: putative DNA-binding protein ESCA...  59.7    2e-07   
gb|ABR17623.1|  unknown                                               59.7    2e-07   
ref|XP_009343806.1|  PREDICTED: putative DNA-binding protein ESCA...  60.1    2e-07   
ref|XP_002980302.1|  hypothetical protein SELMODRAFT_420013           58.5    2e-07   
ref|XP_011030530.1|  PREDICTED: putative DNA-binding protein ESCA...  59.7    2e-07   
ref|XP_011038532.1|  PREDICTED: putative DNA-binding protein ESCA...  59.7    2e-07   
ref|XP_006601994.1|  PREDICTED: putative DNA-binding protein ESCA...  59.7    2e-07   
ref|XP_004952401.1|  PREDICTED: putative DNA-binding protein ESCA...  59.7    2e-07   
ref|XP_010107687.1|  hypothetical protein L484_007706                 59.7    2e-07   
ref|XP_010262258.1|  PREDICTED: putative DNA-binding protein ESCA...  59.3    2e-07   
ref|XP_002529315.1|  DNA binding protein, putative                    59.7    2e-07   
gb|KCW60423.1|  hypothetical protein EUGRSUZ_H03144                   58.2    2e-07   
ref|XP_010938728.1|  PREDICTED: putative DNA-binding protein ESCA...  59.3    2e-07   
ref|XP_008229461.1|  PREDICTED: putative DNA-binding protein ESCA...  58.9    2e-07   
ref|NP_001141263.1|  hypothetical protein                             59.3    2e-07   
ref|XP_009356620.1|  PREDICTED: putative DNA-binding protein ESCA...  58.9    2e-07   
gb|EEE65050.1|  hypothetical protein OsJ_20047                        57.4    2e-07   
ref|XP_008796294.1|  PREDICTED: putative DNA-binding protein ESCA...  59.3    2e-07   
ref|XP_003536146.1|  PREDICTED: putative DNA-binding protein ESCA...  58.9    2e-07   
ref|XP_002451872.1|  hypothetical protein SORBIDRAFT_04g009050        59.3    3e-07   
ref|XP_007035040.1|  AT-hook motif nuclear localized protein 20       58.9    3e-07   
gb|KEH34733.1|  AT hook motif DNA-binding family protein              58.9    3e-07   
ref|XP_010471803.1|  PREDICTED: putative DNA-binding protein ESCA...  58.9    3e-07   
emb|CDY30003.1|  BnaC01g40050D                                        58.9    3e-07   
ref|NP_001046754.1|  Os02g0448000                                     58.9    3e-07   
ref|XP_006655164.1|  PREDICTED: putative DNA-binding protein ESCA...  58.9    3e-07   
ref|XP_003570419.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    3e-07   
ref|XP_007226723.1|  hypothetical protein PRUPE_ppa019745mg           58.9    3e-07   
ref|XP_004296621.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    3e-07   
ref|XP_008362336.1|  PREDICTED: putative DNA-binding protein ESCA...  58.2    4e-07   
ref|XP_008353637.1|  PREDICTED: putative DNA-binding protein ESCA...  58.2    4e-07   
ref|XP_008342359.1|  PREDICTED: putative DNA-binding protein ESCA...  58.2    4e-07   
ref|XP_008224392.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    4e-07   
ref|XP_006408178.1|  hypothetical protein EUTSA_v10021166mg           58.9    4e-07   
ref|XP_009374299.1|  PREDICTED: putative DNA-binding protein ESCA...  57.4    4e-07   
ref|XP_006487869.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    4e-07   
ref|XP_006442718.1|  hypothetical protein CICLE_v10023369mg           58.5    4e-07   
ref|XP_002864011.1|  hypothetical protein ARALYDRAFT_917968           58.5    4e-07   
ref|XP_002312579.2|  hypothetical protein POPTR_0008s16440g           58.5    4e-07   
ref|XP_010675211.1|  PREDICTED: putative DNA-binding protein ESCA...  58.9    4e-07   
emb|CDY21124.1|  BnaA01g33550D                                        58.5    4e-07   
ref|XP_010064232.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    4e-07   
dbj|BAK05209.1|  predicted protein                                    58.5    4e-07   
ref|XP_010026866.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    5e-07   
ref|NP_199781.1|  Predicted AT-hook DNA-binding family protein        58.2    5e-07   
ref|XP_006282022.1|  hypothetical protein CARUB_v10028261mg           58.2    5e-07   
ref|XP_008803362.1|  PREDICTED: putative DNA-binding protein ESCA...  58.2    5e-07   
ref|XP_002979146.1|  hypothetical protein SELMODRAFT_57074            56.6    5e-07   
ref|XP_006589299.1|  PREDICTED: putative DNA-binding protein ESCA...  58.5    5e-07   
gb|KHN30735.1|  Putative DNA-binding protein ESCAROLA                 58.2    5e-07   
ref|NP_001146992.1|  DNA binding protein                              58.5    5e-07   
ref|XP_010104063.1|  hypothetical protein L484_008144                 58.5    6e-07   
emb|CDP00129.1|  unnamed protein product                              58.2    6e-07   
ref|XP_003556450.2|  PREDICTED: putative DNA-binding protein ESCA...  58.2    6e-07   
ref|NP_001062524.1|  Os08g0563200                                     57.4    6e-07   
ref|XP_008451183.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    6e-07   
ref|XP_010933490.1|  PREDICTED: putative DNA-binding protein ESCA...  58.2    7e-07   
ref|XP_009794976.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    7e-07   
ref|XP_006653717.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    8e-07   
ref|XP_009589802.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    8e-07   
ref|XP_004302076.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    8e-07   
ref|XP_008451184.1|  PREDICTED: putative DNA-binding protein ESCA...  57.4    9e-07   
gb|KFK29628.1|  hypothetical protein AALP_AA7G158600                  57.4    9e-07   
ref|XP_009148828.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    9e-07   
ref|XP_006647239.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    9e-07   
emb|CDY45266.1|  BnaA06g09360D                                        56.6    1e-06   
ref|XP_006477506.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    1e-06   
ref|XP_009376245.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    1e-06   
ref|XP_009376246.1|  PREDICTED: putative DNA-binding protein ESCA...  57.8    1e-06   
ref|XP_004974243.1|  PREDICTED: putative DNA-binding protein ESCA...  57.0    1e-06   
emb|CDY42810.1|  BnaC03g23960D                                        57.8    1e-06   
ref|XP_009392781.1|  PREDICTED: putative DNA-binding protein ESCA...  57.4    1e-06   
ref|XP_010694781.1|  PREDICTED: putative DNA-binding protein ESCA...  57.4    1e-06   
gb|AGC22550.1|  male sterility related AT-hook DNA binding protein    57.0    1e-06   
ref|XP_002285689.1|  PREDICTED: putative DNA-binding protein ESCA...  57.4    1e-06   
ref|XP_010482260.1|  PREDICTED: putative DNA-binding protein ESCA...  57.0    1e-06   
ref|XP_006420137.1|  hypothetical protein CICLE_v10005603mg           57.0    1e-06   
ref|XP_010440994.1|  PREDICTED: putative DNA-binding protein ESCA...  57.0    1e-06   
emb|CAN74013.1|  hypothetical protein VITISV_003550                   57.4    1e-06   
ref|XP_010032377.1|  PREDICTED: putative DNA-binding protein ESCA...  57.4    1e-06   
ref|XP_010416570.1|  PREDICTED: putative DNA-binding protein ESCA...  57.0    1e-06   
ref|XP_009594477.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    2e-06   
ref|XP_004239909.1|  PREDICTED: putative DNA-binding protein ESCA...  57.0    2e-06   
ref|XP_002265280.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    2e-06   
ref|XP_007226323.1|  hypothetical protein PRUPE_ppa022234mg           57.0    2e-06   
ref|XP_006433842.1|  hypothetical protein CICLE_v10001847mg           57.0    2e-06   
ref|XP_008346594.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    2e-06   
ref|XP_010428713.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    2e-06   
ref|XP_009383099.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    2e-06   
ref|XP_003538721.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    2e-06   
ref|XP_003522748.1|  PREDICTED: putative DNA-binding protein ESCA...  56.6    2e-06   
gb|EAZ06834.1|  hypothetical protein OsI_29071                        55.8    2e-06   
ref|XP_004954422.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    2e-06   
ref|XP_010524099.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    2e-06   
ref|XP_003526530.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    2e-06   
ref|XP_010458945.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    2e-06   
ref|XP_009133560.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    2e-06   
gb|AFW74083.1|  DNA-binding protein                                   55.8    2e-06   
ref|XP_006472999.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    2e-06   
ref|XP_006363711.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    2e-06   
ref|XP_007163438.1|  hypothetical protein PHAVU_001G234600g           56.2    2e-06   
ref|XP_004501632.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    3e-06   
ref|XP_008378577.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    3e-06   
ref|XP_010038368.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    3e-06   
ref|XP_008780228.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    3e-06   
ref|XP_004299724.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    3e-06   
ref|XP_002445646.1|  hypothetical protein SORBIDRAFT_07g023325        56.2    3e-06   
ref|XP_004956262.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    3e-06   
ref|XP_003571267.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    3e-06   
ref|XP_007141260.1|  hypothetical protein PHAVU_008G181100g           55.8    3e-06   
ref|XP_009384866.1|  PREDICTED: putative DNA-binding protein ESCA...  56.2    3e-06   
ref|XP_003544827.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    3e-06   
ref|XP_002444566.1|  hypothetical protein SORBIDRAFT_07g023830        54.3    4e-06   
ref|XP_008456342.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    4e-06   
emb|CAN75757.1|  hypothetical protein VITISV_028561                   55.8    4e-06   
ref|XP_003573204.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    4e-06   
ref|XP_008219285.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    4e-06   
ref|NP_001053704.1|  Os04g0590200                                     55.8    4e-06   
ref|XP_010658536.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    4e-06   
emb|CDY65376.1|  BnaC05g49680D                                        55.5    4e-06   
emb|CBI31637.3|  unnamed protein product                              55.8    4e-06   
gb|KDO38155.1|  hypothetical protein CISIN_1g044200mg                 53.5    4e-06   
ref|XP_006355697.1|  PREDICTED: putative DNA-binding protein ESCA...  55.8    4e-06   
ref|XP_004145056.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    4e-06   
ref|XP_004139388.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    5e-06   
ref|XP_008467078.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    5e-06   
ref|XP_006412109.1|  hypothetical protein EUTSA_v10025798mg           55.5    5e-06   
ref|XP_004307477.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    5e-06   
ref|XP_004495563.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    5e-06   
gb|EYU29016.1|  hypothetical protein MIMGU_mgv1a023550mg              55.5    5e-06   
ref|XP_011011418.1|  PREDICTED: putative DNA-binding protein ESCA...  55.5    5e-06   
ref|XP_009788952.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    6e-06   
ref|XP_010508503.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    6e-06   
ref|XP_010506134.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    6e-06   
dbj|BAK02851.1|  predicted protein                                    55.1    6e-06   
ref|XP_004973703.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    6e-06   
ref|XP_009377422.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    7e-06   
ref|XP_008380207.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    7e-06   
ref|XP_007201570.1|  hypothetical protein PRUPE_ppa018299mg           54.7    7e-06   
gb|ABL63118.1|  AT-hook DNA-binding protein                           55.1    7e-06   
gb|EMS64253.1|  hypothetical protein TRIUR3_00437                     55.1    7e-06   
ref|XP_010108102.1|  hypothetical protein L484_023188                 55.1    7e-06   
gb|KDP46909.1|  hypothetical protein JCGZ_10400                       54.7    7e-06   
ref|XP_004307301.1|  PREDICTED: putative DNA-binding protein ESCA...  55.1    7e-06   
ref|XP_002892810.1|  hypothetical protein ARALYDRAFT_471623           53.9    7e-06   
ref|XP_004305833.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    8e-06   
emb|CDX79838.1|  BnaA05g03180D                                        54.7    8e-06   
emb|CDY53650.1|  BnaC04g52840D                                        54.7    8e-06   
ref|XP_009142892.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    8e-06   
ref|XP_006846339.1|  hypothetical protein AMTR_s00012p00257450        54.7    8e-06   
ref|XP_002881881.1|  DNA-binding family protein                       54.7    8e-06   
ref|XP_010496121.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    9e-06   
ref|XP_002306539.2|  DNA-binding family protein                       54.7    9e-06   
ref|NP_181822.1|  AT-hook motif nuclear-localized protein 16          54.7    9e-06   
ref|XP_007018209.1|  AT-hook DNA-binding family protein               54.7    9e-06   
ref|XP_004298711.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    9e-06   
ref|XP_008373872.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    9e-06   
ref|XP_006606853.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    1e-05   
ref|XP_006295752.1|  hypothetical protein CARUB_v10024872mg           54.3    1e-05   
gb|KDP23697.1|  hypothetical protein JCGZ_23530                       54.7    1e-05   
ref|XP_010506133.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    1e-05   
gb|ABL63121.1|  AT-hook DNA-binding protein                           54.7    1e-05   
ref|XP_010532413.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    1e-05   
gb|EEE69571.1|  hypothetical protein OsJ_29091                        55.1    1e-05   
ref|XP_007137650.1|  hypothetical protein PHAVU_009G144300g           54.3    1e-05   
ref|XP_006411566.1|  hypothetical protein EUTSA_v10017103mg           54.3    1e-05   
ref|XP_010257112.1|  PREDICTED: putative DNA-binding protein ESCA...  54.7    1e-05   
ref|XP_002527105.1|  DNA binding protein, putative                    54.3    1e-05   
ref|XP_008794313.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    1e-05   
ref|NP_191646.1|  AT-hook motif nuclear-localized protein 18          54.3    1e-05   
ref|XP_010035901.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    1e-05   
ref|XP_008791267.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    1e-05   
ref|XP_008238673.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    1e-05   
ref|XP_003576887.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    1e-05   
emb|CDP17786.1|  unnamed protein product                              54.3    1e-05   
ref|XP_003616459.1|  AT-hook DNA-binding protein                      54.3    1e-05   
ref|XP_010923237.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    1e-05   
ref|XP_008364289.1|  PREDICTED: putative DNA-binding protein ESCA...  54.3    1e-05   
ref|XP_010927036.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    2e-05   
ref|XP_008444938.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    2e-05   
ref|XP_008235832.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    2e-05   
gb|KGN56888.1|  hypothetical protein Csa_3G141840                     53.9    2e-05   
ref|XP_011094152.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    2e-05   
ref|XP_008439362.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    2e-05   
ref|XP_004134419.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    2e-05   
ref|XP_010274873.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    2e-05   
ref|XP_004171657.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    2e-05   
emb|CDX68095.1|  BnaA07g21350D                                        53.5    2e-05   
ref|XP_002284519.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    2e-05   
ref|XP_009400746.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    2e-05   
ref|XP_007048865.1|  AT-hook DNA-binding family protein               53.5    2e-05   
ref|XP_010324605.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    2e-05   
ref|XP_009778295.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    2e-05   
ref|XP_009784030.1|  PREDICTED: putative DNA-binding protein ESCA...  53.5    2e-05   
ref|XP_010552065.1|  PREDICTED: putative DNA-binding protein ESCA...  53.9    2e-05   
tpg|DAA48555.1|  TPA: hypothetical protein ZEAMMB73_420043            53.5    2e-05   



>ref|XP_002868035.1| hypothetical protein ARALYDRAFT_493093 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44294.1| hypothetical protein ARALYDRAFT_493093 [Arabidopsis lyrata subsp. 
lyrata]
Length=294

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE
Sbjct  183  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  237



>ref|NP_193515.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
 gb|AAL48232.1|AF446359_1 AT4g17800/dl4935c [Arabidopsis thaliana]
 emb|CAB10560.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78783.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM19932.1| AT4g17800/dl4935c [Arabidopsis thaliana]
 tpd|FAA00294.1| TPA: AT-hook motif nuclear localized protein 23 [Arabidopsis 
thaliana]
 gb|AEE83952.1| putative AT-hook DNA-binding family protein [Arabidopsis thaliana]
Length=292

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN  175
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE   
Sbjct  181  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDEQQQ  238



>ref|XP_006285880.1| hypothetical protein CARUB_v10007383mg [Capsella rubella]
 gb|EOA18778.1| hypothetical protein CARUB_v10007383mg [Capsella rubella]
Length=296

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN  175
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE   
Sbjct  183  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDEQQQ  240



>emb|CDX90445.1| BnaA03g43360D [Brassica napus]
Length=274

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLTIF+AGGQG ++GGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  ++
Sbjct  162  APPGATSLTIFVAGGQGQVIGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDEQQHL  220



>gb|KFK23205.1| hypothetical protein AALP_AAs54797U000100 [Arabis alpina]
Length=295

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN  175
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE   
Sbjct  180  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDEQQQ  237



>ref|XP_009136874.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=291

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLTIF+AGGQG ++GGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  ++
Sbjct  179  APPGATSLTIFVAGGQGQVIGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDEQQHL  237



>gb|ABD65169.1| hypothetical protein 40.t00056 [Brassica oleracea]
Length=293

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLTIF+AGGQG ++GGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  ++
Sbjct  181  APPGATSLTIFVAGGQGQVIGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDEQQHL  239



>ref|XP_010518859.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=196

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIV+AASFTNVAYERLPLEED
Sbjct  90   APPGATSLTIFLAGGQGQIVGGSVVGELTAAGPVIVMAASFTNVAYERLPLEED  143



>ref|XP_004133943.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004155773.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN56642.1| hypothetical protein Csa_3G127050 [Cucumis sativus]
Length=254

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 63/87 (72%), Gaps = 13/87 (15%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+E+E     
Sbjct  147  APPGATSLTIFLAGGQGQIVGGNVVGSLIASGPVIVIASSFTNVAYERLPLDEEEQ----  202

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
                        GG   +NPFPDPS G
Sbjct  203  ---------PPNGGGSLSNPFPDPSVG  220



>ref|XP_007220428.1| hypothetical protein PRUPE_ppa009347mg [Prunus persica]
 gb|EMJ21627.1| hypothetical protein PRUPE_ppa009347mg [Prunus persica]
Length=296

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 68/91 (75%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN--  175
            APPGATSLTIFLAGG G ++GG+VVG L A+GPVIVIA+SFTNVAYERLPLEE++     
Sbjct  176  APPGATSLTIFLAGGSGQVMGGNVVGALIASGPVIVIASSFTNVAYERLPLEEEDQLQMQ  235

Query  176  --VDNggggggaasaaggaVYNNPFPDPSTG  262
              V    GGGG+    GG    NPFPDPS+G
Sbjct  236  QPVPQSSGGGGSGGGGGGGGVTNPFPDPSSG  266



>ref|XP_002312113.2| hypothetical protein POPTR_0008s05890g [Populus trichocarpa]
 gb|EEE89480.2| hypothetical protein POPTR_0008s05890g [Populus trichocarpa]
Length=336

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +PPGAT LT++LAG QG +VGG+V+GEL AAGPV+VIAA+F+N  YERLPLEE E
Sbjct  209  SPPGATRLTVYLAGAQGQVVGGTVMGELVAAGPVMVIAATFSNATYERLPLEEQE  263



>ref|XP_011033055.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
 ref|XP_011033132.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=334

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +PPGAT LT++LAG QG +VGG+V+GEL AAGPV+VIAA+F+N  YERLPLEE E
Sbjct  207  SPPGATRLTVYLAGAQGQVVGGTVMGELVAAGPVMVIAATFSNATYERLPLEEQE  261



>emb|CBI35166.3| unnamed protein product [Vitis vinifera]
Length=275

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG+T LTI+LAGGQ  +VGGSVVG L AAGPV+VIAA+F+N  YERLPLE++E
Sbjct  167  APPGSTGLTIYLAGGQAQVVGGSVVGSLIAAGPVMVIAATFSNATYERLPLEDEE  221



>ref|XP_002271606.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=291

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG+T LTI+LAGGQ  +VGGSVVG L AAGPV+VIAA+F+N  YERLPLE++E
Sbjct  167  APPGSTGLTIYLAGGQAQVVGGSVVGSLIAAGPVMVIAATFSNATYERLPLEDEE  221



>ref|XP_008232226.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=295

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 67/90 (74%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGG G ++GG+VVG L A+GPVIVIA+SFTNVAYERLPLEE+E   + 
Sbjct  176  APPGATSLTIFLAGGSGQVMGGNVVGALIASGPVIVIASSFTNVAYERLPLEEEEQLQMQ  235

Query  182  N---ggggggaasaaggaVYNNPFPDPSTG  262
                   GGG +   GG    NPFPDPS+G
Sbjct  236  QPVPQSSGGGGSGGGGGGGVTNPFPDPSSG  265



>emb|CAN61523.1| hypothetical protein VITISV_016751 [Vitis vinifera]
Length=259

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG+T LTI+LAGGQ  +VGGSVVG L AAGPV+VIAA+F+N  YERLPLE++E
Sbjct  135  APPGSTGLTIYLAGGQAQVVGGSVVGSLIAAGPVMVIAATFSNATYERLPLEDEE  189



>gb|KHN01050.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=295

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG+T LT++L GGQG +VGGSVVG L AAGPV+VIAA+F N  YERLPL+ED+
Sbjct  173  APPGSTGLTVYLTGGQGQIVGGSVVGSLVAAGPVMVIAATFANATYERLPLDEDD  227



>ref|XP_002281411.1| PREDICTED: putative DNA-binding protein ESCAROLA [Vitis vinifera]
Length=282

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 68/87 (78%), Gaps = 3/87 (3%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+E+E   + 
Sbjct  169  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEEEPLQMQ  228

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
                    +S  GG   NNPFPDPS G
Sbjct  229  Q---QVPQSSGGGGGGINNPFPDPSAG  252



>emb|CAN83987.1| hypothetical protein VITISV_032602 [Vitis vinifera]
Length=282

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 68/87 (78%), Gaps = 3/87 (3%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+E+E   + 
Sbjct  169  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEEEPLQMQ  228

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
                    +S  GG   NNPFPDPS G
Sbjct  229  Q---QVPQSSGGGGGGINNPFPDPSAG  252



>ref|XP_009123977.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=314

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPG+T LTI+LA GQG +VGGSVVG L AAGPV++IAA+F+N  YERLPL+E+E +
Sbjct  189  APPGSTGLTIYLASGQGQIVGGSVVGPLMAAGPVMLIAATFSNATYERLPLDEEEAA  245



>gb|EYU19935.1| hypothetical protein MIMGU_mgv1a017709mg [Erythranthe guttata]
Length=322

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            +P GA+ LT++LAGGQG +VGG+VVG L A+GPV+VIAA+FTN AYERLPLEED
Sbjct  185  SPTGASGLTVYLAGGQGQIVGGTVVGALVASGPVMVIAATFTNAAYERLPLEED  238



>emb|CDY49327.1| BnaA05g32890D [Brassica napus]
Length=314

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPG+T LTI+LA GQG +VGGSVVG L AAGPV++IAA+F+N  YERLPL+E+E +
Sbjct  189  APPGSTGLTIYLASGQGQIVGGSVVGPLMAAGPVMLIAATFSNATYERLPLDEEEAA  245



>ref|XP_006606925.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=385

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG+T LT++L GGQG +VGGSVVG L AAGPV+VIAA+F N  YERLPL+ED+
Sbjct  263  APPGSTGLTVYLTGGQGQIVGGSVVGSLVAAGPVMVIAATFANATYERLPLDEDD  317



>ref|XP_008238264.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=283

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAG QG +VGGSVVGELTAAGPVIVIA+SFTNVAYERLPL+E+E   V 
Sbjct  167  APPGATSLTIFLAGVQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLDEEEQLQV-  225

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
                G G +   GG V NNPFPDPS+G
Sbjct  226  QVPQGSGGSGGGGGGVGNNPFPDPSSG  252



>ref|XP_007210169.1| hypothetical protein PRUPE_ppa019786mg [Prunus persica]
 gb|EMJ11368.1| hypothetical protein PRUPE_ppa019786mg [Prunus persica]
Length=283

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAG QG +VGGSVVGELTAAGPVIVIA+SFTNVAYERLPL+E+E   V 
Sbjct  167  APPGATSLTIFLAGVQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLDEEEQLQV-  225

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
                G G +   G  V NNPFPDPS+G
Sbjct  226  QVPQGSGGSGGGGVGVGNNPFPDPSSG  252



>ref|XP_009347388.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=293

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 74/91 (81%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIA+SFTNVAYERLPL+E+E   V 
Sbjct  170  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLDEEEQLQVQ  229

Query  182  N----ggggggaasaaggaVYNNPFPDPSTG  262
            +    GG GGG     GG V NNPFPDPS+G
Sbjct  230  DPQGSGGSGGGGGGVGGGGVGNNPFPDPSSG  260



>gb|EYU43510.1| hypothetical protein MIMGU_mgv1a017700mg [Erythranthe guttata]
Length=309

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            T LTI+LAGGQG ++GGSVVG+L A+GPVI++AASF+N AYERLPLEEDE
Sbjct  189  TGLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEEDE  238



>gb|EYU40549.1| hypothetical protein MIMGU_mgv1a021038mg [Erythranthe guttata]
Length=310

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            T LTI+LAGGQG ++GGSVVG+L A+GPVI++AASF+N AYERLPLEEDE
Sbjct  190  TGLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEEDE  239



>ref|XP_007144108.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
 gb|ESW16102.1| hypothetical protein PHAVU_007G129400g, partial [Phaseolus vulgaris]
Length=310

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG+T LT++LAGGQG ++GGSVVG L A GPV+VIAA+F N  YERLPL+ED+
Sbjct  190  APPGSTGLTVYLAGGQGQVLGGSVVGPLVATGPVMVIAATFANATYERLPLDEDD  244



>ref|XP_008356452.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=290

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIA+SFTNVAYERLPL+E+E   V 
Sbjct  170  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLDEEEQLQVQ  229

Query  182  -NggggggaasaaggaVYNNPFPDPSTG  262
               G GG      GG+V NNPFPDPS+G
Sbjct  230  VPQGSGGSGGGGGGGSVGNNPFPDPSSG  257



>ref|XP_011070911.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=255

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            T LTI+LAGGQG ++GGSVVG+L A+GPVI++AASF+N AYERLPLEE+E +
Sbjct  178  TGLTIYLAGGQGQVLGGSVVGQLLASGPVIIMAASFSNAAYERLPLEEEENA  229



>ref|XP_008438225.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=253

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 65/88 (74%), Gaps = 13/88 (15%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDET-SNV  178
            APPGATSLTIFLAGGQG ++GG+VVG L A+GPVIVIA+SFTNVAYERLPL+E+E  SN 
Sbjct  145  APPGATSLTIFLAGGQGQIIGGNVVGSLIASGPVIVIASSFTNVAYERLPLDEEEQPSNG  204

Query  179  DNggggggaasaaggaVYNNPFPDPSTG  262
              GG              +NPFPDPS G
Sbjct  205  GGGGS------------LSNPFPDPSVG  220



>emb|CDY64701.1| BnaCnng44570D [Brassica napus]
Length=311

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLE  157
            APPG+T LTI+LAGGQG +VGGSVVG L AAGPV++IAA+F+N  YERLPL+
Sbjct  186  APPGSTGLTIYLAGGQGQIVGGSVVGPLMAAGPVMLIAATFSNATYERLPLD  237



>ref|XP_008377132.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=293

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 73/91 (80%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGELT AGPVIVIA+SFTNVAYERLPL+E+E   V 
Sbjct  170  APPGATSLTIFLAGGQGQVVGGSVVGELTTAGPVIVIASSFTNVAYERLPLDEEEQLQVQ  229

Query  182  N----ggggggaasaaggaVYNNPFPDPSTG  262
            +    GG GGG     G +V NNPFPDPS+G
Sbjct  230  DPQGSGGTGGGGGGVGGVSVGNNPFPDPSSG  260



>ref|XP_004509027.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=300

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 70/92 (76%), Gaps = 5/92 (5%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV-  178
            APPGATSLTI+LAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE+E   + 
Sbjct  176  APPGATSLTIYLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEEEQIQMQ  235

Query  179  ----DNggggggaasaaggaVYNNPFPDPSTG  262
                    G GG     GG V NN FPDPS+G
Sbjct  236  AAAGGGSQGSGGGGGGGGGGVVNNAFPDPSSG  267



>ref|XP_003524711.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=276

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTI+LAGGQG +VGG+VVGELTAAGPVIVIAASFTNVAYERLPLEEDE     
Sbjct  173  APPGATSLTIYLAGGQGQVVGGNVVGELTAAGPVIVIAASFTNVAYERLPLEEDEQQQQ-  231

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
                   A +++ G   NNPFPDPS+G
Sbjct  232  QLQIQSPATTSSQGNNNNNPFPDPSSG  258



>gb|KDP22981.1| hypothetical protein JCGZ_01738 [Jatropha curcas]
Length=301

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE   + 
Sbjct  182  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE--QLQ  239

Query  182  NggggggaasaaggaVYNNPFPD  250
                GGG    +GG V NNPFPD
Sbjct  240  MQSSGGGGDGGSGGGVGNNPFPD  262



>ref|XP_002519826.1| ESC, putative [Ricinus communis]
 gb|EEF42430.1| ESC, putative [Ricinus communis]
Length=289

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 66/83 (80%), Gaps = 4/83 (5%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+EDE   + 
Sbjct  172  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEDEQLQMQ  231

Query  182  NggggggaasaaggaVYNNPFPD  250
            +    G +    G  V NNPFPD
Sbjct  232  S----GSSGGGGGSGVGNNPFPD  250



>ref|XP_004964470.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=328

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APP AT LT++L+GGQG +VGG+V G L A+GPV+++AA F N AYERLPL++DE
Sbjct  200  APPSATGLTVYLSGGQGQIVGGAVAGPLVASGPVVIVAACFGNAAYERLPLDDDE  254



>gb|KDP42477.1| hypothetical protein JCGZ_00274 [Jatropha curcas]
Length=1065

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            AP  ++  T++LAG +G +VGGSV+G L AAGPVIVIAA+FTN AYERLPLE+DE
Sbjct  180  APRSSSGFTVYLAGRKGKVVGGSVMGPLIAAGPVIVIAATFTNAAYERLPLEDDE  234



>gb|KCW77938.1| hypothetical protein EUGRSUZ_D02188, partial [Eucalyptus grandis]
Length=277

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 64/87 (74%), Gaps = 8/87 (9%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGEL A+GPVIVIAASFTNVAYERLPLEE+E   + 
Sbjct  175  APPGATSLTIFLAGGQGQVVGGSVVGELIASGPVIVIAASFTNVAYERLPLEEEEQIQMQ  234

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
                             ++PFPDPS+G
Sbjct  235  AAAAAASGG--------HSPFPDPSSG  253



>ref|XP_006414185.1| hypothetical protein EUTSA_v10025859mg [Eutrema salsugineum]
 gb|ESQ55638.1| hypothetical protein EUTSA_v10025859mg [Eutrema salsugineum]
Length=297

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  ++
Sbjct  183  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDEQQHL  241



>gb|ACU24276.1| unknown [Glycine max]
Length=254

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLT+FL GGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+EDE+  + 
Sbjct  155  APPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDEDESMQMQ  214

Query  182  N-ggggggaasaaggaVYNNPFPDPSTG  262
                  G  +   GG V NN FPDPS+G
Sbjct  215  QGQSSAGDGSGDHGGGVSNNSFPDPSSG  242



>ref|XP_010053603.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=289

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 64/87 (74%), Gaps = 8/87 (9%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGEL A+GPVIVIAASFTNVAYERLPLEE+E   + 
Sbjct  175  APPGATSLTIFLAGGQGQVVGGSVVGELIASGPVIVIAASFTNVAYERLPLEEEEQIQMQ  234

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
                             ++PFPDPS+G
Sbjct  235  AAAAAASGG--------HSPFPDPSSG  253



>ref|XP_004300243.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Fragaria 
vesca subsp. vesca]
Length=291

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIA+SFTNVAYERLPLEE+E   + 
Sbjct  168  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLEEEEQLQIQ  227

Query  182  ---NggggggaasaaggaVYNNPFPDPSTG  262
                  G GG+    GG   NNPFPDPS+G
Sbjct  228  PQAGSQGSGGSGGGGGGVGNNNPFPDPSSG  257



>ref|XP_009377073.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=293

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 72/91 (79%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGELTA GPVIVIA+SFTNVAYERLPL+E+E   V 
Sbjct  170  APPGATSLTIFLAGGQGQVVGGSVVGELTAVGPVIVIASSFTNVAYERLPLDEEEQLQVQ  229

Query  182  N----ggggggaasaaggaVYNNPFPDPSTG  262
            +    GG GGG     GG V NNPFP PS+G
Sbjct  230  DPQGSGGSGGGGGGVGGGGVGNNPFPYPSSG  260



>ref|XP_004163877.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=248

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN  175
            APPGATSLTIFLAGGQG +VGG+V GELTAAGPVI+IAASFTNVAYERLPL+E++   
Sbjct  145  APPGATSLTIFLAGGQGQVVGGTVAGELTAAGPVILIAASFTNVAYERLPLDEEDQQQ  202



>ref|XP_008448697.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=248

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN  175
            APPGATSLTIFLAGGQG +VGG+V GELTAAGPVI+IAASFTNVAYERLPL+E++   
Sbjct  145  APPGATSLTIFLAGGQGQVVGGTVAGELTAAGPVILIAASFTNVAYERLPLDEEDQQQ  202



>ref|XP_004148759.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN55771.1| hypothetical protein Csa_3G011730 [Cucumis sativus]
Length=248

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN  175
            APPGATSLTIFLAGGQG +VGG+V GELTAAGPVI+IAASFTNVAYERLPL+E++   
Sbjct  145  APPGATSLTIFLAGGQGQVVGGTVAGELTAAGPVILIAASFTNVAYERLPLDEEDQQQ  202



>ref|XP_011090893.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=307

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            ++LTI+LAGGQG ++GG+VVG L A+GPV+++AASF N AYERLPLEE+ET+
Sbjct  195  SALTIYLAGGQGQVMGGTVVGPLLASGPVVIMAASFGNAAYERLPLEEEETA  246



>ref|XP_003534486.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Glycine max]
 ref|XP_006587787.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Glycine max]
 ref|XP_006587788.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X3 [Glycine max]
Length=270

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLT+FL GGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+EDE+  + 
Sbjct  155  APPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDEDESMQMQ  214

Query  182  N-ggggggaasaaggaVYNNPFPDPSTG  262
                  G  +   GG V NN FPDPS+G
Sbjct  215  QGQSSAGDGSGDHGGGVSNNSFPDPSSG  242



>ref|XP_009130966.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=293

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIA+SFTNVAYERLPLEEDE  ++
Sbjct  180  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLEEDEQQHL  238



>emb|CDP13007.1| unnamed protein product [Coffea canephora]
Length=297

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+EDE   +
Sbjct  175  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEDEQLQI  233



>emb|CDX78802.1| BnaA01g08690D [Brassica napus]
Length=291

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIA+SFTNVAYERLPLEEDE  ++
Sbjct  180  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLEEDEQQHL  238



>ref|XP_010275243.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=285

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 72/92 (78%), Gaps = 5/92 (5%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV-  178
            APPGATSLTIFLAGGQG +VGGSVVG L AAGPVIVIAASFTNVAYERLPL+E+E   + 
Sbjct  164  APPGATSLTIFLAGGQGQVVGGSVVGALIAAGPVIVIAASFTNVAYERLPLDEEEPLQIQ  223

Query  179  ----DNggggggaasaaggaVYNNPFPDPSTG  262
                 + GGGG +A A G    NNPFPDPS+G
Sbjct  224  PPVSQSSGGGGASAGAGGAGGVNNPFPDPSSG  255



>ref|XP_004953673.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=324

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            APPG + LT+FL+GGQG ++GGSVVG L AAGPV+++AASF N  YERLPL
Sbjct  191  APPGVSGLTVFLSGGQGQVIGGSVVGPLVAAGPVVLMAASFANAVYERLPL  241



>ref|XP_009393002.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=307

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            + LTI+LAGGQG +VGGSVVG L A+GPVI++AASF N AYERLPL+E+E
Sbjct  191  SGLTIYLAGGQGQIVGGSVVGALIASGPVIIMAASFGNAAYERLPLDEEE  240



>ref|XP_009403254.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403255.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=293

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            AP GAT LT+FLAGGQG ++GGSVVG L AAGPV+++ ASF+N  YE LPLE +E
Sbjct  170  APLGATGLTVFLAGGQGQVIGGSVVGPLVAAGPVVLMTASFSNAMYEHLPLEGEE  224



>gb|AFK38460.1| unknown [Medicago truncatula]
Length=269

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSL++FL GGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+EDE+  + 
Sbjct  156  APPGATSLSVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDEDESLQMQ  215

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
             G    G     G  V NN FPDPS+G
Sbjct  216  QGQSSAGGGGGGGDGV-NNSFPDPSSG  241



>gb|AES80473.2| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=269

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSL++FL GGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+EDE+  + 
Sbjct  156  APPGATSLSVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDEDESLQMQ  215

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
             G    G     G  V NN FPDPS+G
Sbjct  216  QGQSSAGGGGGGGDGV-NNSFPDPSSG  241



>ref|XP_006436718.1| hypothetical protein CICLE_v10032253mg [Citrus clementina]
 ref|XP_006485575.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR49958.1| hypothetical protein CICLE_v10032253mg [Citrus clementina]
 gb|KDO40054.1| hypothetical protein CISIN_1g022380mg [Citrus sinensis]
Length=298

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+EDE
Sbjct  180  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEDE  234



>ref|XP_008460731.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Cucumis 
melo]
Length=283

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            APPG+T LT++LAGGQG ++GG+VVG L A GPV+++AA+F N  YERLPL++
Sbjct  171  APPGSTGLTVYLAGGQGQVIGGTVVGPLLAGGPVMLVAATFANATYERLPLQD  223



>ref|XP_009616004.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=269

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 70/92 (76%), Gaps = 5/92 (5%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS---  172
            APPGATSLTIFLAGGQG +VGGSVVGEL A+GPVIVIA+SFTNVAYERLPLEEDE S   
Sbjct  159  APPGATSLTIFLAGGQGQVVGGSVVGELIASGPVIVIASSFTNVAYERLPLEEDEGSLQI  218

Query  173  --NVDNggggggaasaaggaVYNNPFPDPSTG  262
               V     G G  S  GG V NN FPDPS+G
Sbjct  219  QPQVSQVSSGNGPNSGGGGGVNNNQFPDPSSG  250



>ref|XP_009420779.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=305

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            T LTI+LAGGQG +VGGSVVG L A+GPVI++AASF N AYERLPL+++E
Sbjct  192  TGLTIYLAGGQGQIVGGSVVGPLIASGPVIIMAASFGNAAYERLPLDDEE  241



>ref|XP_003624255.1| AT-hook DNA-binding protein [Medicago truncatula]
Length=316

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSL++FL GGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+EDE+  + 
Sbjct  203  APPGATSLSVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDEDESLQMQ  262

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
             G    G     G  V NN FPDPS+G
Sbjct  263  QGQSSAGGGGGGGDGV-NNSFPDPSSG  288



>ref|XP_002876587.1| hypothetical protein ARALYDRAFT_486561 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52846.1| hypothetical protein ARALYDRAFT_486561 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDET  169
            T LT++LAGGQG ++GGS+VG L A+GPV+++AASF N AYERL LEE+ET
Sbjct  160  TGLTVYLAGGQGQVIGGSLVGPLMASGPVVIMAASFGNAAYERLQLEEEET  210



>ref|XP_009399398.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=267

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS--N  175
            APPGATSLTIFLAGGQG +VGG+V G L AAGPV+VI ASFTNVAYERLPLEE+E+    
Sbjct  145  APPGATSLTIFLAGGQGQVVGGNVAGTLLAAGPVLVITASFTNVAYERLPLEEEESPPLQ  204

Query  176  VDNggggggaasaaggaVYNNPFPDPST  259
            +      G       G    +PFPDPS+
Sbjct  205  MQPPAPQGSGGDGGSGGAGGSPFPDPSS  232



>ref|XP_010269998.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=280

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTI+LAGGQG +VGGSVVG L A+GPVIVIAASFTNVAYERLPL+E+E   + 
Sbjct  163  APPGATSLTIYLAGGQGQVVGGSVVGALIASGPVIVIAASFTNVAYERLPLDEEEPLQMQ  222

Query  182  -NggggggaasaaggaVYNNPFPDPSTG  262
                   G  +   G   NNPFPDPS+G
Sbjct  223  PPVSQSPGGGAGVSGGGVNNPFPDPSSG  250



>ref|XP_009382863.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382873.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=309

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            T LTI+LAGGQG +VGGSVVG L A+ PVI++AASF N AYERLPL+E+E
Sbjct  197  TGLTIYLAGGQGQIVGGSVVGALIASSPVIIMAASFGNAAYERLPLDEEE  246



>emb|CBI33919.3| unnamed protein product [Vitis vinifera]
Length=298

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+E+E
Sbjct  199  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEEE  253



>ref|XP_009399397.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=291

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS--N  175
            APPGATSLTIFLAGGQG +VGG+V G L AAGPV+VI ASFTNVAYERLPLEE+E+    
Sbjct  169  APPGATSLTIFLAGGQGQVVGGNVAGTLLAAGPVLVITASFTNVAYERLPLEEEESPPLQ  228

Query  176  VDNggggggaasaaggaVYNNPFPDPST  259
            +      G       G    +PFPDPS+
Sbjct  229  MQPPAPQGSGGDGGSGGAGGSPFPDPSS  256



>ref|XP_009387695.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387696.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=288

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  5    PPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            PPGA+ LT+FLAGGQG ++GGSVVG L AAGPV++ AASF N  YERLPL
Sbjct  176  PPGASGLTVFLAGGQGQVMGGSVVGPLVAAGPVVLNAASFANAMYERLPL  225



>ref|XP_008659508.1| PREDICTED: putative DNA-binding protein ESCAROLA [Zea mays]
 gb|AFW86529.1| hypothetical protein ZEAMMB73_546585 [Zea mays]
Length=309

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            APPGA++L++++AGGQG ++GGSV G+L AAGPV+++AASF N  YERLPL
Sbjct  176  APPGASNLSVYVAGGQGQVMGGSVAGQLIAAGPVVLMAASFANAVYERLPL  226



>ref|XP_006368407.1| DNA-binding family protein [Populus trichocarpa]
 gb|ERP64976.1| DNA-binding family protein [Populus trichocarpa]
Length=298

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+ED+
Sbjct  180  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEDD  234



>ref|XP_009762421.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=272

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPGATSLTIFLAGGQG +VGGSVVGEL A+GPVIVIA+SFTNVAYERLPLEEDE S
Sbjct  160  APPGATSLTIFLAGGQGQVVGGSVVGELIASGPVIVIASSFTNVAYERLPLEEDEGS  216



>ref|XP_004245889.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=291

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 64/86 (74%), Gaps = 8/86 (9%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFL GGQG +VGGSVVGEL AAGPVIVIA+SFTNVAYERLPLEED  +   
Sbjct  176  APPGATSLTIFLGGGQGQVVGGSVVGELIAAGPVIVIASSFTNVAYERLPLEEDGNTQGS  235

Query  182  NggggggaasaaggaVYNNPFPDPST  259
            +GG G            NNPFPDPS 
Sbjct  236  DGGDGVLNN--------NNPFPDPSN  253



>ref|XP_008803114.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=318

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    PGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            PGA+ LT++LAG QG +VGGSVVGEL A+GPV+VIAA+F N  YERLPL
Sbjct  186  PGASGLTVYLAGRQGQMVGGSVVGELVASGPVMVIAATFANAIYERLPL  234



>ref|XP_010677251.1| PREDICTED: putative DNA-binding protein ESCAROLA [Beta vulgaris 
subsp. vulgaris]
Length=290

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLTIFLAGGQG +VGG+VVGEL AAGPVIVIAASFTNVAYERLPLEE+E + V
Sbjct  174  APPGATSLTIFLAGGQGQVVGGNVVGELVAAGPVIVIAASFTNVAYERLPLEEEEAAAV  232



>ref|XP_006410687.1| hypothetical protein EUTSA_v10017027mg [Eutrema salsugineum]
 gb|ESQ52140.1| hypothetical protein EUTSA_v10017027mg [Eutrema salsugineum]
Length=290

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGELTAAGPV+V+AASFTNVAYERLPL+E E
Sbjct  179  APPGATSLTIFLAGAQGQVVGGNVVGELTAAGPVMVMAASFTNVAYERLPLDEHE  233



>ref|XP_007039519.1| AT-hook DNA-binding family protein [Theobroma cacao]
 gb|EOY24020.1| AT-hook DNA-binding family protein [Theobroma cacao]
Length=292

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGGSVVGEL AAGPVIVIAASFTNVAYERLPL+EDE
Sbjct  178  APPGATSLTIFLAGGQGQVVGGSVVGELMAAGPVIVIAASFTNVAYERLPLDEDE  232



>ref|XP_006385649.1| DNA-binding family protein [Populus trichocarpa]
 gb|ERP63446.1| DNA-binding family protein [Populus trichocarpa]
Length=298

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+ED+
Sbjct  178  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEDD  232



>emb|CDY12779.1| BnaC04g28620D [Brassica napus]
Length=282

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG+T LT++LAG QG ++GGSVVG L A G V+VIAA+F+N  YERLP+E++E
Sbjct  162  APPGSTGLTVYLAGVQGQVLGGSVVGPLVAIGSVMVIAATFSNATYERLPIEDEE  216



>ref|XP_003608618.1| AT-hook DNA-binding protein [Medicago truncatula]
Length=285

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS-NV  178
            APPGATSLTI+LAGGQG +VGGSVVGEL AAGPVIVIAASFTNVAYE+LPLEE++     
Sbjct  164  APPGATSLTIYLAGGQGQVVGGSVVGELIAAGPVIVIAASFTNVAYEKLPLEEEQLQMQA  223

Query  179  DNggggggaasaaggaVYNNPFPDPSTG  262
            + GGG  G+    GG   NNPFPDPS+G
Sbjct  224  EAGGGSQGSGGGGGGNNNNNPFPDPSSG  251



>ref|XP_011028186.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=298

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+ED+
Sbjct  178  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEDD  232



>ref|XP_006352850.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=293

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 65/85 (76%), Gaps = 8/85 (9%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVGEL AAGPVIVIA+SFTNVAYERLPLEED  +   
Sbjct  178  APPGATSLTIFLAGGQGQVVGGSVVGELMAAGPVIVIASSFTNVAYERLPLEEDGNTQGS  237

Query  182  NggggggaasaaggaVYNNPFPDPS  256
            +GGG G           NNPF DPS
Sbjct  238  DGGGDGVVN--------NNPFSDPS  254



>ref|XP_011034536.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=300

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            + LT++LAGGQG ++GGSV G L A+GPV+V+AASF N AYERLPLEED
Sbjct  183  SGLTVYLAGGQGQVIGGSVAGPLLASGPVVVMAASFGNAAYERLPLEED  231



>ref|XP_002320066.1| DNA-binding family protein [Populus trichocarpa]
 gb|EEE98381.1| DNA-binding family protein [Populus trichocarpa]
Length=300

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            + LT++LAGGQG ++GGSV G L A+GPV+V+AASF N AYERLPLEED
Sbjct  183  SGLTVYLAGGQGQVIGGSVAGPLLASGPVVVMAASFGNAAYERLPLEED  231



>gb|AES90815.2| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=296

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS-NV  178
            APPGATSLTI+LAGGQG +VGGSVVGEL AAGPVIVIAASFTNVAYE+LPLEE++     
Sbjct  175  APPGATSLTIYLAGGQGQVVGGSVVGELIAAGPVIVIAASFTNVAYEKLPLEEEQLQMQA  234

Query  179  DNggggggaasaaggaVYNNPFPDPSTG  262
            + GGG  G+    GG   NNPFPDPS+G
Sbjct  235  EAGGGSQGSGGGGGGNNNNNPFPDPSSG  262



>ref|XP_003552472.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=268

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLT+FL GGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+E+E+  + 
Sbjct  155  APPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDEEESMQM-  213

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
              G        +GG V NN FPDPS+G
Sbjct  214  QQGQSSAGGGGSGGGVSNNSFPDPSSG  240



>ref|XP_004492894.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X1 [Cicer arietinum]
 ref|XP_004492895.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X2 [Cicer arietinum]
 ref|XP_004492896.1| PREDICTED: putative DNA-binding protein ESCAROLA-like isoform 
X3 [Cicer arietinum]
Length=267

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSL++FL GGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPLEEDE+  + 
Sbjct  155  APPGATSLSVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLEEDES--LQ  212

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
               G        GG   NN FPDPS+G
Sbjct  213  MQQGQSSTGGGGGGDGVNNSFPDPSSG  239



>ref|XP_010104316.1| hypothetical protein L484_023266 [Morus notabilis]
 gb|EXB99736.1| hypothetical protein L484_023266 [Morus notabilis]
Length=274

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLT+FL+GGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE++   V
Sbjct  169  APPGATSLTVFLSGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEEDQGQV  227



>ref|XP_004153985.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004160698.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN46273.1| hypothetical protein Csa_6G079180 [Cucumis sativus]
Length=253

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGG+VVG L A+GPVIVIA+SF+NVAYERLPL+E+E     
Sbjct  151  APPGATSLTIFLAGGQGQVVGGNVVGALIASGPVIVIASSFSNVAYERLPLDEEEMPM--  208

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
              GGG G     GG  +NNPFPD S+G
Sbjct  209  QAGGGDGDGGEGGGEGHNNPFPDASSG  235



>ref|XP_004145070.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=253

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 69/87 (79%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGG+VVG L A+GPVIVIA+SF+NVAYERLPL+E+E     
Sbjct  151  APPGATSLTIFLAGGQGQVVGGNVVGALIASGPVIVIASSFSNVAYERLPLDEEEMPM--  208

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
              GGGGG     GG  +NNPFPD S+G
Sbjct  209  QAGGGGGGGGEGGGEGHNNPFPDASSG  235



>ref|XP_007155775.1| hypothetical protein PHAVU_003G230600g [Phaseolus vulgaris]
 gb|ESW27769.1| hypothetical protein PHAVU_003G230600g [Phaseolus vulgaris]
Length=285

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTI+LAGGQG +VGG+VVGELTAAGPVIVIAASFTNVAYERLPL+E+E   + 
Sbjct  166  APPGATSLTIYLAGGQGQVVGGNVVGELTAAGPVIVIAASFTNVAYERLPLDEEEQLQIQ  225



>ref|XP_009139154.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
 ref|XP_009139155.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
 ref|XP_009139156.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
 emb|CDX76085.1| BnaA04g03490D [Brassica napus]
Length=307

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +P  A  LT++LAG QG ++GG V G LTA+GPVIVIAA+F+N  YERLP+E+D+
Sbjct  186  SPAAAAGLTVYLAGAQGQVLGGGVAGPLTASGPVIVIAATFSNATYERLPIEDDQ  240



>ref|XP_010548186.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=258

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  8    PGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            PGA  LT++LAGGQG +VGG+V G L AAGPV+++AASF N  Y+RLP+EE E
Sbjct  154  PGAGGLTVYLAGGQGEVVGGNVAGPLVAAGPVVLMAASFANAVYDRLPMEEAE  206



>gb|EPS64135.1| hypothetical protein M569_10646 [Genlisea aurea]
Length=318

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +SLTI+LAG QG ++GG++VG L A+GPV+++AASF N AYERLPLEE+E
Sbjct  199  SSLTIYLAGSQGQVMGGTIVGPLIASGPVVIMAASFGNAAYERLPLEEEE  248



>gb|KGN61619.1| hypothetical protein Csa_2G190760 [Cucumis sativus]
Length=285

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    PPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            PP +T LT++LAGGQG ++GG+VVG L A GPVI+IAA+F N  YERLPL+ 
Sbjct  175  PPCSTGLTVYLAGGQGQVIGGTVVGPLLAGGPVILIAATFANATYERLPLQH  226



>ref|XP_004163216.1| PREDICTED: putative DNA-binding protein ESCAROLA-like, partial 
[Cucumis sativus]
Length=277

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    PPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            PP +T LT++LAGGQG ++GG+VVG L A GPVI+IAA+F N  YERLPL+ 
Sbjct  167  PPCSTGLTVYLAGGQGQVIGGTVVGPLLAGGPVILIAATFANATYERLPLQH  218



>ref|XP_004150655.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
Length=281

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    PPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            PP +T LT++LAGGQG ++GG+VVG L A GPVI+IAA+F N  YERLPL+ 
Sbjct  171  PPCSTGLTVYLAGGQGQVIGGTVVGPLLAGGPVILIAATFANATYERLPLQH  222



>gb|KCW71795.1| hypothetical protein EUGRSUZ_E00284 [Eucalyptus grandis]
Length=281

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLT+FLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+E++     
Sbjct  165  APPGATSLTVFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEEDQQ--L  222

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
            +         +  GA   N +PDPS+G
Sbjct  223  HMQPPASQPPSGPGAAAGNSYPDPSSG  249



>ref|XP_010055327.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=282

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLT+FLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL+E++     
Sbjct  166  APPGATSLTVFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLDEEDQQ--L  223

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
            +         +  GA   N +PDPS+G
Sbjct  224  HMQPPASQPPSGPGAAAGNSYPDPSSG  250



>ref|XP_011018582.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=298

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL ED+
Sbjct  180  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPLGEDD  234



>emb|CDY54780.1| BnaAnng13510D [Brassica napus]
Length=292

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLTIF+AGGQG +VGGSVVGELTAAGPVIVIA+SFTNVAYERLPLEEDE  ++
Sbjct  180  APPGATSLTIFVAGGQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLEEDEQQHL  238



>ref|XP_011093448.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=281

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTI+LAGGQG +VGG+V+G L A+GPVI+IAASFTNVAYERLPL+E++   + 
Sbjct  165  APPGATSLTIYLAGGQGQVVGGNVMGALIASGPVIIIAASFTNVAYERLPLDEEDGVQMQ  224

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
                        GG   N  FPDPS G
Sbjct  225  QATSQPSGGGGNGGVGGNQ-FPDPSLG  250



>gb|ABD65635.1| hypothetical protein 23.t00073 [Brassica oleracea]
Length=292

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV  178
            APPGATSLTIF+AGGQG +VGGSVVGELTAAGPVIVIA+SFTNVAYERLPLEEDE  ++
Sbjct  180  APPGATSLTIFVAGGQGQVVGGSVVGELTAAGPVIVIASSFTNVAYERLPLEEDEQQHL  238



>ref|XP_008460074.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=322

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGG+VVG L A+GPVIVIA+SF+NVAYERLPL+E+E     
Sbjct  220  APPGATSLTIFLAGGQGQVVGGNVVGALIASGPVIVIASSFSNVAYERLPLDEEEMPM--  277

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
              GGG G     GG  +NNPFPD S+G
Sbjct  278  QAGGGDGDGGEGGGEGHNNPFPDASSG  304



>gb|KFK36425.1| hypothetical protein AALP_AA4G122700 [Arabis alpina]
Length=283

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E   V 
Sbjct  174  APPGATSLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHEELQVQ  233



>gb|EAZ24374.1| hypothetical protein OsJ_08128 [Oryza sativa Japonica Group]
Length=158

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  11   GATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            GA+ LT+FL+GGQG ++GGSVVG L AAGPV+++AASF N  YERLPL
Sbjct  26   GASGLTVFLSGGQGQVIGGSVVGPLVAAGPVVLMAASFANAVYERLPL  73



>ref|XP_009133171.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=246

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  137  APPGATSLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  191



>gb|ACU24278.1| unknown [Glycine max]
Length=268

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLT+FL GGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+E+E+  + 
Sbjct  155  APPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDEEESMQM-  213

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
              G        +GG V NN FPDPS G
Sbjct  214  QQGQSSAGGGGSGGGVSNNSFPDPSYG  240



>emb|CDX79599.1| BnaC03g19350D [Brassica napus]
Length=273

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  164  APPGATSLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  218



>ref|XP_009141480.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
 emb|CDY59041.1| BnaAnng15660D [Brassica napus]
Length=286

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  177  APPGATSLTIFLAGAQGQVVGGNVVGELVAAGPVMVMAASFTNVAYERLPLDEHE  231



>gb|ADE76470.1| unknown [Picea sitchensis]
Length=294

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVDNgggggg  202
            LTI LAG QG +VGGSV GELTAAGPV +IAASFT+ +Y RLP E DE  N  N      
Sbjct  188  LTISLAGAQGQVVGGSVAGELTAAGPVTIIAASFTSPSYHRLPAELDE-ENAANTQLQNN  246

Query  203  aasaaggaVYNNPFPDPSTG  262
              S A    + +P P+ S G
Sbjct  247  QGSLAASTGHGHPLPNDSCG  266



>dbj|BAJ94962.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  11   GATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            GA+ LT+FL+GGQG ++GGSVVG L AAGPV+++AASF+N  YERLPL
Sbjct  203  GASGLTVFLSGGQGQVIGGSVVGTLVAAGPVVLMAASFSNAVYERLPL  250



>ref|XP_007156666.1| hypothetical protein PHAVU_002G006900g [Phaseolus vulgaris]
 gb|ESW28660.1| hypothetical protein PHAVU_002G006900g [Phaseolus vulgaris]
Length=272

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSL+++LAGGQG +VGGSVVGELTAAGPVIV+AASFTNVAYERLPLEE+E   V 
Sbjct  159  APPGATSLSVYLAGGQGQVVGGSVVGELTAAGPVIVMAASFTNVAYERLPLEEEEEEQVQ  218

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
              GG G   ++    + NNPFPDPS+G
Sbjct  219  ISGGAGVGNNSNNNIINNNPFPDPSSG  245



>emb|CDY72485.1| BnaCnng77890D [Brassica napus]
Length=273

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  164  APPGATSLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  218



>ref|XP_006296261.1| hypothetical protein CARUB_v10025435mg [Capsella rubella]
 gb|EOA29159.1| hypothetical protein CARUB_v10025435mg [Capsella rubella]
Length=286

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  177  APPGATSLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  231



>ref|XP_002879544.1| hypothetical protein ARALYDRAFT_482492 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55803.1| hypothetical protein ARALYDRAFT_482492 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  177  APPGATSLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  231



>ref|XP_008646163.1| PREDICTED: putative DNA-binding protein ESCAROLA [Zea mays]
 gb|AFW73088.1| hypothetical protein ZEAMMB73_437326 [Zea mays]
Length=324

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  11   GATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            GA+ LT+FL+GGQG ++GGSVVG L AAGPV+++AASF N  YERLPL
Sbjct  192  GASGLTVFLSGGQGQVIGGSVVGPLVAAGPVVLMAASFANAVYERLPL  239



>ref|XP_010505030.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=285

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  177  APPGATSLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  231



>ref|XP_009420562.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=294

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            LTIFL+GGQG ++GGSVVG L AAGPV+++AASF N  YERLPLE +E
Sbjct  181  LTIFLSGGQGQVIGGSVVGPLVAAGPVVLMAASFANAMYERLPLEIEE  228



>ref|XP_010509635.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=285

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  177  APPGATSLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  231



>ref|NP_181070.1| protein GIANT KILLER [Arabidopsis thaliana]
 gb|AAC61811.1| putative AT-hook DNA-binding protein [Arabidopsis thaliana]
 tpd|FAA00292.1| TPA: AT-hook motif nuclear localized protein 21 [Arabidopsis 
thaliana]
 gb|AEC09088.1| putative AT-hook DNA-binding protein [Arabidopsis thaliana]
Length=285

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  177  APPGATSLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  231



>ref|XP_010531743.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=259

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGELTAAGPV+++AASFTNVAYERLPL+E E
Sbjct  150  APPGATSLTIFLAGNQGQVVGGNVVGELTAAGPVMIMAASFTNVAYERLPLDEHE  204



>ref|XP_010516702.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=285

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  177  APPGATSLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  231



>ref|XP_003570225.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=337

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  11   GATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            GA+ LT+FL+GGQG ++GGSVVG L AAGPV+++AASF N  YERLPL
Sbjct  200  GASGLTVFLSGGQGQVIGGSVVGSLVAAGPVVLMAASFANAVYERLPL  247



>ref|XP_010941441.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Elaeis 
guineensis]
Length=123

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGGSVVG L AAGPVIVIAASFTNVAYERLPLE++E   + 
Sbjct  2    APPGATSLTIFLAGGQGQVVGGSVVGALIAAGPVIVIAASFTNVAYERLPLEDEEAPPLQ  61



>ref|XP_002438341.1| hypothetical protein SORBIDRAFT_10g012980 [Sorghum bicolor]
 gb|EER89708.1| hypothetical protein SORBIDRAFT_10g012980 [Sorghum bicolor]
Length=310

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  11   GATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            GA+SL++++AGGQG ++GGSVVG+L AAGPV+++AASF N  YERLPL
Sbjct  177  GASSLSVYVAGGQGQVMGGSVVGQLIAAGPVVLMAASFANAVYERLPL  224



>ref|NP_001047914.1| Os02g0713700 [Oryza sativa Japonica Group]
 dbj|BAD07790.1| DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAF09828.1| Os02g0713700 [Oryza sativa Japonica Group]
 dbj|BAH00978.1| unnamed protein product [Oryza sativa Japonica Group]
Length=336

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  11   GATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            GA+ LT+FL+GGQG ++GGSVVG L AAGPV+++AASF N  YERLPL
Sbjct  204  GASGLTVFLSGGQGQVIGGSVVGPLVAAGPVVLMAASFANAVYERLPL  251



>ref|XP_002452654.1| hypothetical protein SORBIDRAFT_04g030040 [Sorghum bicolor]
 gb|EES05630.1| hypothetical protein SORBIDRAFT_04g030040 [Sorghum bicolor]
Length=328

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  11   GATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            GA+ LT+FL+GGQG ++GGSVVG L AAGPV+++AASF N  YERLPL
Sbjct  197  GASGLTVFLSGGQGQVIGGSVVGPLVAAGPVVLMAASFANAVYERLPL  244



>ref|XP_007139682.1| hypothetical protein PHAVU_008G050100g [Phaseolus vulgaris]
 gb|ESW11676.1| hypothetical protein PHAVU_008G050100g [Phaseolus vulgaris]
Length=271

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 2/89 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNV-  178
            APPGATSLT+FL GGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+E+++  + 
Sbjct  155  APPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDEEDSMQMQ  214

Query  179  -DNggggggaasaaggaVYNNPFPDPSTG  262
                  GGG +   GG V NN FPDPS+G
Sbjct  215  QGQSSAGGGGSGGGGGGVSNNSFPDPSSG  243



>gb|EYU40290.1| hypothetical protein MIMGU_mgv1a019526mg [Erythranthe guttata]
Length=292

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTI+LAGGQG +VGG+VVG L AAGPVI+IAASFTNVAYERLPL+E+E   + 
Sbjct  170  APPGATSLTIYLAGGQGQVVGGNVVGALIAAGPVIIIAASFTNVAYERLPLDEEEGLQMQ  229

Query  182  NggggggaasaaggaVYNNPFPDPST  259
                 GG      G    + FPDPS+
Sbjct  230  TPPPSGGVGGGGSGGAGGDQFPDPSS  255



>gb|EEC73884.1| hypothetical protein OsI_08674 [Oryza sativa Indica Group]
Length=415

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  11   GATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            GA+ LT+FL+GGQG ++GGSVVG L AAGPV+++AASF N  YERLPL
Sbjct  283  GASGLTVFLSGGQGQVIGGSVVGPLVAAGPVVLMAASFANAVYERLPL  330



>emb|CDX84222.1| BnaC04g09840D [Brassica napus]
Length=192

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGAT+LTIFLAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  84   APPGATNLTIFLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  138



>gb|EPS65599.1| hypothetical protein M569_09178, partial [Genlisea aurea]
Length=206

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTI+LAGGQG +VGG+VVG L A+GPVI+IAASFTNVAYERLPLEEDE
Sbjct  101  APPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIIIAASFTNVAYERLPLEEDE  155



>ref|XP_010052700.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
 gb|KCW76771.1| hypothetical protein EUGRSUZ_D01127 [Eucalyptus grandis]
Length=271

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLT+FLAG QG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPLEE+E
Sbjct  164  APPGATSLTVFLAGPQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLEEEE  218



>gb|EPS62166.1| hypothetical protein M569_12627, partial [Genlisea aurea]
Length=195

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            AP  A++LTI++AGGQG ++GG+VVG L  +GPV+++AASF N AYERLPL
Sbjct  70   APQSASALTIYIAGGQGRVMGGAVVGPLMTSGPVVLMAASFGNAAYERLPL  120



>ref|XP_010558745.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=300

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAY  139
            APPG+T LTI+LAGGQG +VGGSVVG L AAGPV++IAA+F+N  Y
Sbjct  186  APPGSTGLTIYLAGGQGQIVGGSVVGPLMAAGPVMLIAATFSNATY  231



>ref|XP_006366237.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=265

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIF+AGGQG +VGGSVVGEL A+GPVIVIA+SFTNVAYERLPLEEDE
Sbjct  157  APPGATSLTIFVAGGQGQVVGGSVVGELIASGPVIVIASSFTNVAYERLPLEEDE  211



>ref|XP_008799381.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=296

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 71/96 (74%), Gaps = 10/96 (10%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE-----  166
            APPGATSLTIFLAGGQG +VGGSVVG L AAGPVIVIAASFTNVAYERLPLE++E     
Sbjct  170  APPGATSLTIFLAGGQGQVVGGSVVGALIAAGPVIVIAASFTNVAYERLPLEDEEPPPLQ  229

Query  167  -----TSNVDNggggggaasaaggaVYNNPFPDPST  259
                 +    +GGGGGG  +  GG    NPFPDPS+
Sbjct  230  MQPPVSQGPGSGGGGGGGTNGGGGGGGGNPFPDPSS  265



>emb|CDP09327.1| unnamed protein product [Coffea canephora]
Length=292

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPGATSLTI+LAGGQG +VGG+VVG L A+GPVIVIAASFTNVAYERLPL+ED+ S
Sbjct  166  APPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIVIAASFTNVAYERLPLDEDDHS  222



>emb|CDY02949.1| BnaC04g25370D [Brassica napus]
Length=307

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +P  A  LT++LAG QG ++GG V G L A+GPVIVIAA+F+N  YERLP+E+++
Sbjct  186  SPAAAAGLTVYLAGAQGQVLGGGVAGPLIASGPVIVIAATFSNATYERLPIEDEQ  240



>gb|EPS57290.1| hypothetical protein M569_17529, partial [Genlisea aurea]
Length=218

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG + + ++L+GG G ++GG  VG L A+GPVIV+AA+F N  YERLPLE +E
Sbjct  102  APPGGSGVMVYLSGGSGRVMGGMSVGPLIASGPVIVVAATFANALYERLPLEAEE  156



>ref|XP_009103966.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Brassica 
rapa]
 ref|XP_009103967.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Brassica 
rapa]
Length=263

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +P  A  LTI+LAG QG ++GG V G L A+GPVIVIAA+F N ++ERLP+E+++
Sbjct  147  SPAAAAGLTIYLAGAQGQVLGGGVAGPLIASGPVIVIAATFCNASFERLPIEDEQ  201



>emb|CDY31677.1| BnaA05g08700D [Brassica napus]
Length=197

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGAT+LTI LAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  89   APPGATNLTILLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  143



>ref|XP_008786310.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=295

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGG+VVG L AAGPVIVIAASFTNVAYERLPLEE++
Sbjct  177  APPGATSLTIFLAGGQGQVVGGNVVGALFAAGPVIVIAASFTNVAYERLPLEEED  231



>ref|XP_009103959.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009103960.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009103961.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009103963.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009103964.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009103965.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
Length=298

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +P  A  LTI+LAG QG ++GG V G L A+GPVIVIAA+F N ++ERLP+E+++
Sbjct  182  SPAAAAGLTIYLAGAQGQVLGGGVAGPLIASGPVIVIAATFCNASFERLPIEDEQ  236



>ref|XP_003539199.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=250

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 64/91 (70%), Gaps = 18/91 (20%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL----EEDET  169
            APPGATSL+I+LAGGQG +VGGSVVGEL AAGPVIV+AASFTNVAYERLPL    E+ E 
Sbjct  147  APPGATSLSIYLAGGQGQVVGGSVVGELIAAGPVIVMAASFTNVAYERLPLEEEEEQVEI  206

Query  170  SNVDNggggggaasaaggaVYNNPFPDPSTG  262
            S V                  +NPFPDPS+G
Sbjct  207  SGVAGNN--------------SNPFPDPSSG  223



>ref|XP_009139507.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Brassica 
rapa]
 ref|XP_009139508.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Brassica 
rapa]
Length=279

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            APPG+T LT++LAG QG ++GGSVVG L A G V+VIAA+F+N  YERLP+
Sbjct  162  APPGSTGLTVYLAGVQGQVLGGSVVGPLVAIGSVMVIAATFSNATYERLPI  212



>ref|XP_009143684.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=284

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGAT+LTI LAG QG +VGG+VVGEL AAGPV+V+AASFTNVAYERLPL+E E
Sbjct  176  APPGATNLTILLAGAQGQVVGGNVVGELMAAGPVMVMAASFTNVAYERLPLDEHE  230



>emb|CDY53687.1| BnaA07g37810D [Brassica napus]
Length=298

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +P  A  LTI+LAG QG ++GG V G L A+GPVIVIAA+F N ++ERLP+E+++
Sbjct  182  SPAAAAGLTIYLAGAQGQVLGGGVAGPLIASGPVIVIAATFCNASFERLPIEDEQ  236



>emb|CDY23160.1| BnaA04g05990D [Brassica napus]
Length=279

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            APPG+T LT++LAG QG ++GGSVVG L A G V+VIAA+F+N  YERLP+
Sbjct  162  APPGSTGLTVYLAGVQGQVLGGSVVGPLVAIGSVMVIAATFSNATYERLPI  212



>gb|AFW75435.1| hypothetical protein ZEAMMB73_958269 [Zea mays]
Length=485

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    PPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            P  AT LT++L+ GQG +VGG+V G L A+GPV+++AA F N A++RLPLE+DE
Sbjct  365  PLAATGLTVYLSAGQGQVVGGAVAGPLVASGPVVIVAACFGNAAFDRLPLEDDE  418



>ref|XP_004976643.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=310

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGG+VVG L AAGPVIVIAASF NVAYERLPLEE+E
Sbjct  186  APPGATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLEEEE  240



>dbj|BAC21441.1| DNA-binding protein-like [Oryza sativa Japonica Group]
 dbj|BAC21527.1| DNA-binding protein-like [Oryza sativa Japonica Group]
Length=206

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 5/52 (10%)
 Frame = +2

Query  5    PPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            PPG+T LT++LAGGQG      VVG LTAAGPV+VIA++F N  YERLPL++
Sbjct  106  PPGSTRLTVYLAGGQGQ-----VVGTLTAAGPVMVIASTFANATYERLPLDQ  152



>emb|CDY60321.1| BnaCnng36000D [Brassica napus]
Length=296

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +P  A  LTI+LAG QG ++GG V G L A+GPVIVIAA+F N ++ERLP E+++
Sbjct  180  SPAAAAGLTIYLAGAQGQVLGGGVAGPLIASGPVIVIAATFCNASFERLPFEDEQ  234



>ref|NP_001059242.1| Os07g0235200 [Oryza sativa Japonica Group]
 dbj|BAF21156.1| Os07g0235200, partial [Oryza sativa Japonica Group]
Length=189

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 5/52 (10%)
 Frame = +2

Query  5    PPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            PPG+T LT++LAGGQG      VVG LTAAGPV+VIA++F N  YERLPL++
Sbjct  89   PPGSTRLTVYLAGGQGQ-----VVGTLTAAGPVMVIASTFANATYERLPLDQ  135



>emb|CDX88286.1| BnaC06g37300D [Brassica napus]
Length=276

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            L+IF+AG QGH++GGSVV  L A+GPVI++AASF+N  +ERLPLE+
Sbjct  174  LSIFVAGAQGHVIGGSVVAPLVASGPVILMAASFSNATFERLPLED  219



>ref|XP_010434615.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=294

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/51 (96%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL
Sbjct  179  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  229



>ref|XP_010451406.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=265

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLP  151
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLP
Sbjct  171  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLP  220



>ref|XP_008668970.1| PREDICTED: putative DNA-binding protein ESCAROLA [Zea mays]
Length=309

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPGATSLTIFLAGGQG +VGG+VVG L AAGPVIVIAASF NVAYERLPLEE+E  
Sbjct  184  APPGATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLEEEEAQ  240



>ref|XP_002448423.1| hypothetical protein SORBIDRAFT_06g026940 [Sorghum bicolor]
 gb|EES12751.1| hypothetical protein SORBIDRAFT_06g026940 [Sorghum bicolor]
Length=312

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGG+VVG L AAGPVIVIAASF NVAYERLPLEE+E
Sbjct  187  APPGATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLEEEE  241



>ref|XP_011086333.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=279

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTI+LAGGQG +VGG+VVG L A+GPVI+IAASFTNVAYERLPL+E+E
Sbjct  159  APPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIIIAASFTNVAYERLPLDEEE  213



>ref|XP_010278730.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nelumbo nucifera]
Length=128

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  8    PGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            PGA  LTIF   GQG+ V GSVVG L A+GPV+++A  F N   ERLPLEE+E+S
Sbjct  69   PGAGGLTIFFVRGQGYDVRGSVVGSLIASGPVMLMATLFANAMLERLPLEENESS  123



>tpg|DAA36260.1| TPA: hypothetical protein ZEAMMB73_652841 [Zea mays]
Length=347

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPGATSLTIFLAGGQG +VGG+VVG L AAGPVIVIAASF NVAYERLPLEE+E  
Sbjct  184  APPGATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLEEEEAQ  240



>ref|XP_009383370.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=280

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLE  157
            LT+FLAGGQG ++GG+V G L AAGPV+++AASF N  YERLPLE
Sbjct  174  LTVFLAGGQGQVLGGTVTGPLVAAGPVVLMAASFANAEYERLPLE  218



>ref|XP_008788674.1| PREDICTED: putative DNA-binding protein ESCAROLA [Phoenix dactylifera]
Length=303

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGG+VVG L A GPVIVIAASFTNVAYERLPLE++E
Sbjct  174  APPGATSLTIFLAGGQGQVVGGNVVGALIATGPVIVIAASFTNVAYERLPLEDEE  228



>ref|XP_009410344.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=294

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            L++FL+GGQG ++GGSV G L A GPV+++ ASFTN  YERLPLE D
Sbjct  181  LSVFLSGGQGQVIGGSVAGPLVATGPVVLMVASFTNAVYERLPLEGD  227



>ref|XP_011002630.1| PREDICTED: putative DNA-binding protein ESCAROLA [Populus euphratica]
Length=336

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +PPGAT LT++LAGGQG +VGG+V+GEL AAGPV+VIAA+F+N  YERLPLEE E
Sbjct  203  SPPGATGLTVYLAGGQGQVVGGTVMGELIAAGPVMVIAATFSNATYERLPLEEQE  257



>ref|XP_003516633.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Glycine 
max]
Length=250

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 50/51 (98%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            APPGATSL+I+LAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLPL
Sbjct  144  APPGATSLSIYLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  194



>ref|XP_002524209.1| ESC, putative [Ricinus communis]
 gb|EEF38133.1| ESC, putative [Ricinus communis]
Length=342

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +PPGAT+LT++LAGGQG +VGG+V+G+L AAGPV+VIAA+FTN  +ERLPLEE E
Sbjct  210  SPPGATTLTVYLAGGQGQVVGGTVMGQLVAAGPVMVIAATFTNATFERLPLEEQE  264



>ref|XP_002315208.2| hypothetical protein POPTR_0010s20780g [Populus trichocarpa]
 gb|EEF01379.2| hypothetical protein POPTR_0010s20780g [Populus trichocarpa]
Length=336

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +PPGAT LT++LAGGQG +VGG+V+GEL AAGPV+VIAA+F+N  YERLPLEE E
Sbjct  203  SPPGATGLTVYLAGGQGQVVGGTVMGELIAAGPVMVIAATFSNATYERLPLEEQE  257



>ref|XP_001763021.1| predicted protein [Physcomitrella patens]
 gb|EDQ72226.1| predicted protein [Physcomitrella patens]
Length=162

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            T LT+ LAG  G ++GGSVVG L AAGPV+VIAASF  + YERLPL+ D+
Sbjct  105  TGLTVSLAGAAGQVLGGSVVGTLMAAGPVLVIAASFIGLTYERLPLDNDD  154



>dbj|BAK02723.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=312

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTIFLAGGQG +VGG+VVG L AAGPVIVIAASF NVAYERLPLE++E
Sbjct  187  APPGATSLTIFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLEDEE  241



>ref|XP_009386796.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=293

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  11   GATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLE  157
            GA+ L++FLAGGQG ++GGSV G L A GPV+++ ASF N  YERLPLE
Sbjct  177  GASGLSVFLAGGQGQVMGGSVGGPLVATGPVMLMVASFANAVYERLPLE  225



>ref|XP_010097716.1| hypothetical protein L484_023857 [Morus notabilis]
 gb|EXB70671.1| hypothetical protein L484_023857 [Morus notabilis]
Length=308

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLT+FLAGGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+E+E
Sbjct  175  APPGATSLTVFLAGGQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLDEEE  229



>ref|XP_009776190.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=275

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPGATSLTI+LAGGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+E+  S
Sbjct  156  APPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLDEENES  212



>ref|XP_006847733.1| hypothetical protein AMTR_s00149p00093420 [Amborella trichopoda]
 gb|ERN09314.1| hypothetical protein AMTR_s00149p00093420 [Amborella trichopoda]
Length=272

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLT+FLAGGQG +VGGSVVG L AAGPVIVIAASF NVAYERLP+E++E
Sbjct  164  APPGATSLTVFLAGGQGQVVGGSVVGALVAAGPVIVIAASFANVAYERLPIEDEE  218



>gb|EYU41285.1| hypothetical protein MIMGU_mgv1a025243mg [Erythranthe guttata]
Length=293

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLTI+LAGGQG +VGG+VVG L A+GPVI++AASFTNVAYERLPL+E+E
Sbjct  176  APPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIIVAASFTNVAYERLPLDEEE  230



>ref|XP_010439938.1| PREDICTED: putative DNA-binding protein ESCAROLA [Camelina sativa]
Length=292

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLP  151
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIVIAASFTNVAYERLP
Sbjct  179  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVIAASFTNVAYERLP  228



>ref|XP_003581586.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=325

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSLT+FLAGGQG +VGG+VVG L AAGPVIVIAASF NVAYERLPLE++E
Sbjct  190  APPGATSLTVFLAGGQGQVVGGNVVGALYAAGPVIVIAASFANVAYERLPLEDEE  244



>emb|CDP07852.1| unnamed protein product [Coffea canephora]
Length=160

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGAT+LTI+LAGG G +VGG+VVG L A+GPV+VIAASFTNVAYER+ L+ED+ S   
Sbjct  72   APPGATNLTIYLAGGYGQVVGGNVVGALIASGPVVVIAASFTNVAYERMSLDEDDHS--L  129

Query  182  NggggggaasaaggaVYNNPFPDPSTG  262
                    +S  G    NN F DPS G
Sbjct  130  QMQPPMAGSSGTGAGGSNNKFSDPSLG  156



>ref|XP_010538496.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=289

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLP  151
            APPGATSLTIFLAGGQG +VGGSVVGELTAAGPVIV+AASFTNVAYERLP
Sbjct  179  APPGATSLTIFLAGGQGQVVGGSVVGELTAAGPVIVMAASFTNVAYERLP  228



>emb|CDY45983.1| BnaA02g18130D [Brassica napus]
Length=288

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            L+IFL+GGQG ++GGSVV  L A+GPVI++AASF+N  +ERLPL++
Sbjct  187  LSIFLSGGQGQVIGGSVVAPLVASGPVILMAASFSNATFERLPLKD  232



>ref|XP_006354677.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Solanum 
tuberosum]
Length=256

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPGATSLTI+LAGGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+E+  S
Sbjct  145  APPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLDEENES  201



>ref|XP_009128180.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=287

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            L+IFL+GGQG ++GGSVV  L A+GPVI++AASF+N  +ERLPL++
Sbjct  186  LSIFLSGGQGQVIGGSVVAPLVASGPVILMAASFSNATFERLPLKD  231



>ref|XP_004229513.1| PREDICTED: putative DNA-binding protein ESCAROLA [Solanum lycopersicum]
Length=265

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPGATSLTI+LAGGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+E+  S
Sbjct  153  APPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLDEENES  209



>ref|XP_009597193.1| PREDICTED: putative DNA-binding protein ESCAROLA, partial [Nicotiana 
tomentosiformis]
Length=295

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPGATSLTI+LAGGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+E+  S
Sbjct  179  APPGATSLTIYLAGGQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLDEENES  235



>gb|EPS68305.1| hypothetical protein M569_06465, partial [Genlisea aurea]
Length=209

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            + LTI+LA  QG +VGG V G L A GPV+++AASF N AYERLPL+E E
Sbjct  112  SGLTIYLAASQGQVVGGIVAGPLLAYGPVVIMAASFGNAAYERLPLDESE  161



>ref|XP_002315599.1| hypothetical protein POPTR_0010s07370g [Populus trichocarpa]
 gb|EEF01770.1| hypothetical protein POPTR_0010s07370g [Populus trichocarpa]
Length=121

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  5    PPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            PPG TSLTIFL GGQG +VGGSVVGELTA GPVIVIAAS TN+AYERL L+ED+
Sbjct  53   PPGTTSLTIFLYGGQGQVVGGSVVGELTAVGPVIVIAASLTNMAYERLSLDEDD  106



>ref|XP_009106318.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brassica rapa]
Length=288

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            L+IF+AG QG ++GGSVV  L A+GPVI++AASF+N  +ERLPLE+
Sbjct  186  LSIFVAGAQGQVIGGSVVAPLVASGPVILMAASFSNATFERLPLED  231



>emb|CDX87591.1| BnaA07g32820D [Brassica napus]
Length=280

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            L+IF+AG QG ++GGSVV  L A+GPVI++AASF+N  +ERLPLE+
Sbjct  178  LSIFVAGAQGQVIGGSVVAPLVASGPVILMAASFSNATFERLPLED  223



>ref|XP_006390186.1| hypothetical protein EUTSA_v10019495mg [Eutrema salsugineum]
 gb|ESQ27472.1| hypothetical protein EUTSA_v10019495mg [Eutrema salsugineum]
Length=306

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            L++FLAGGQG ++GG+V+  L A+GPVI++AASF+N  +ERLPLE+
Sbjct  198  LSVFLAGGQGQVIGGNVMAPLVASGPVILMAASFSNATFERLPLED  243



>ref|XP_001757515.1| predicted protein [Physcomitrella patens]
 gb|EDQ77572.1| predicted protein, partial [Physcomitrella patens]
Length=156

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            T LT+ LAG  G ++GGSVVG L AAGPV+VIAASF    YERLPL+ D+
Sbjct  105  TGLTVTLAGAAGQVLGGSVVGTLMAAGPVLVIAASFLGPTYERLPLDPDD  154



>ref|XP_002468116.1| hypothetical protein SORBIDRAFT_01g039840 [Sorghum bicolor]
 gb|EER95114.1| hypothetical protein SORBIDRAFT_01g039840 [Sorghum bicolor]
Length=272

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            APPGAT L ++LAGGQG +VGGSV+GEL A+GPV+VIAA+F N  YERLPLE+D
Sbjct  155  APPGATGLAVYLAGGQGQVVGGSVMGELIASGPVMVIAATFGNATYERLPLEQD  208



>ref|XP_008391057.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=281

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG T LT++LAGGQG +VGGSV+G L AAGPV+V AA+F N  YERLPLEEDE
Sbjct  151  APPGFTGLTVYLAGGQGQVVGGSVMGSLVAAGPVMVXAATFANATYERLPLEEDE  205



>ref|XP_008354801.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=296

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 66/91 (73%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLP----LEEDET  169
            APPGATSLTIFLAGGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLP     +    
Sbjct  176  APPGATSLTIFLAGGQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLEEEEQLQMQ  235

Query  170  SNVDNggggggaasaaggaVYNNPFPDPSTG  262
              V    GGGG    +GG   +NPFPDPS+G
Sbjct  236  QTVPQSSGGGGGGDGSGGGGVSNPFPDPSSG  266



>emb|CDY20404.1| BnaC02g24120D [Brassica napus]
Length=271

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            L+IFL+GGQG ++GG+VV  L A+GPVI++AASF+N  +ERLPL++
Sbjct  170  LSIFLSGGQGQVIGGNVVAPLVASGPVILMAASFSNATFERLPLKD  215



>ref|XP_009384565.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384566.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=237

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  8    PGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            PG+T LT++LAG Q  ++GGSVVG L A GPV+V+A +F N  YERLPL
Sbjct  135  PGSTGLTVYLAGEQCQVLGGSVVGSLLATGPVMVVATTFGNATYERLPL  183



>ref|XP_004494969.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=211

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 43/56 (77%), Gaps = 3/56 (5%)
 Frame = +2

Query  8    PGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL---EEDE  166
            PG+T LT+ +AG QG ++GG+VVG L A+G V+++AA+F+N  YERLPL   EED 
Sbjct  150  PGSTGLTVCVAGIQGQVMGGAVVGPLVASGTVVIMAATFSNAMYERLPLPIQEEDR  205



>ref|XP_010530021.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=283

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDET  169
            APPGATSLTI LAGGQG +VGGSVVGEL A GPVIV+AASFTNVAYE LPLE DE+
Sbjct  175  APPGATSLTILLAGGQGQVVGGSVVGELIAVGPVIVMAASFTNVAYESLPLEGDES  230



>ref|XP_008659816.1| PREDICTED: putative DNA-binding protein ESCAROLA [Zea mays]
 gb|AFW87407.1| hypothetical protein ZEAMMB73_125178 [Zea mays]
Length=271

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            APP A+ L + ++ GQG ++GGSVVG L AAGPV + AA+F N  YERLPL +
Sbjct  164  APPEASGLAVLVSAGQGQVLGGSVVGPLVAAGPVTIFAATFANAVYERLPLAD  216



>gb|KFK42071.1| hypothetical protein AALP_AA2G207300 [Arabis alpina]
Length=314

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            L+IF++GGQG ++GGSVV  L A+GPVI++AASF+N  +ERLPLE+
Sbjct  193  LSIFVSGGQGQVIGGSVVPPLVASGPVILMAASFSNATFERLPLED  238



>ref|XP_001765845.1| predicted protein [Physcomitrella patens]
 gb|EDQ69436.1| predicted protein [Physcomitrella patens]
Length=165

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            T LT+ LAG  G ++GGSVVG L AAGPV+VIAASF    +ERLPL+ D+
Sbjct  106  TGLTVSLAGAAGQVLGGSVVGTLMAAGPVLVIAASFIGPTFERLPLDNDD  155



>gb|KHN22151.1| Putative DNA-binding protein ESCAROLA, partial [Glycine soja]
Length=207

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            APPGATSLT+FL GGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPL+E
Sbjct  155  APPGATSLTVFLGGGQGQVVGGNVVGPLVASGPVIVIASSFTNVAYERLPLDE  207



>ref|XP_003615275.1| hypothetical protein MTR_5g066020 [Medicago truncatula]
 gb|AES98233.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=252

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN  175
            +PP     +I LA  QG +VGG VVG L AAG V VIAASF N +Y RLPLEED  +N
Sbjct  155  SPPMNKEFSISLAAPQGQIVGGFVVGPLLAAGTVFVIAASFNNPSYHRLPLEEDVRNN  212



>ref|XP_008379732.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA-binding protein 
ESCAROLA [Malus domestica]
Length=227

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYER  145
            APP A+ L +FLAGGQG +VGGSVVG L A+GPVI+I  SF N A +R
Sbjct  131  APPEASGLALFLAGGQGQIVGGSVVGPLRASGPVILIVVSFANAACDR  178



>ref|XP_008465963.1| PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]
Length=272

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            APPGATSLTI+LAGGQG +VGG+VVGEL AAGPV +IAASFTNVAYERLPL
Sbjct  162  APPGATSLTIYLAGGQGQVVGGNVVGELVAAGPVTIIAASFTNVAYERLPL  212



>ref|XP_003560568.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=291

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            AP  A+ L + LA GQG ++GG VVG L AA PV + AA+F N  YERLPL++D   +V 
Sbjct  176  APAEASGLAVLLAAGQGQVLGGRVVGPLVAATPVTLFAATFANAVYERLPLQDDAVVDVK  235



>ref|XP_009351025.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=296

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 70/91 (77%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN--  175
            APPGATSLTIFLAGGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPLEE+E     
Sbjct  176  APPGATSLTIFLAGGQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLEEEEQLQMQ  235

Query  176  --VDNggggggaasaaggaVYNNPFPDPSTG  262
              V    GGGG    +GG   +NPFPDPS+G
Sbjct  236  QPVPQSSGGGGGGDGSGGVGVSNPFPDPSSG  266



>ref|XP_004148482.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 ref|XP_004168425.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cucumis 
sativus]
 gb|KGN60397.1| hypothetical protein Csa_3G902390 [Cucumis sativus]
Length=271

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            APPGATSLTI+LAGGQG +VGG+VVGEL AAGPV +IAASFTNVAYERLPL
Sbjct  161  APPGATSLTIYLAGGQGQVVGGNVVGELVAAGPVTIIAASFTNVAYERLPL  211



>ref|XP_010539761.1| PREDICTED: putative DNA-binding protein ESCAROLA [Tarenaya hassleriana]
Length=280

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            L+IFLAG +G +VGGSVV  L A+GPVI++AASF+N  +ERLP EE+
Sbjct  177  LSIFLAGERGQVVGGSVVAPLVASGPVILMAASFSNAVFERLPNEEE  223



>ref|XP_006435633.1| hypothetical protein CICLE_v10032034mg [Citrus clementina]
 ref|XP_006486403.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Citrus 
sinensis]
 gb|ESR48873.1| hypothetical protein CICLE_v10032034mg [Citrus clementina]
Length=338

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +PPGAT LT++LAGGQG +VGG+V+G L A+GPV+VIAA+FTN  YERLP+E++E
Sbjct  203  SPPGATGLTVYLAGGQGQVVGGTVMGALMASGPVMVIAATFTNATYERLPMEDEE  257



>ref|XP_004984928.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Setaria 
italica]
Length=270

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            APPGAT L ++LAGGQG +VGGSV+GEL A+GPV+VIAA+F N  YERLPL++D
Sbjct  155  APPGATGLAVYLAGGQGQVVGGSVMGELIASGPVMVIAATFGNATYERLPLDQD  208



>ref|XP_001760962.1| predicted protein [Physcomitrella patens]
 gb|EDQ74351.1| predicted protein [Physcomitrella patens]
Length=159

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            T LTI  AG  G ++GG VVG L AA PV+V+A SFT   Y+RLPL EDE
Sbjct  110  TGLTISFAGASGQVLGGCVVGALMAASPVLVVATSFTGATYDRLPLAEDE  159



>ref|XP_009607803.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana tomentosiformis]
Length=319

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            +PPGAT LT++LAG QG +VGG+VVGEL A+GPV+VIAA+FTN  +ERLPLEE+  S
Sbjct  203  SPPGATGLTVYLAGSQGQVVGGNVVGELMASGPVMVIAATFTNATFERLPLEEENAS  259



>ref|XP_001785561.1| predicted protein [Physcomitrella patens]
 gb|EDQ49626.1| predicted protein [Physcomitrella patens]
Length=155

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            T LTI  AG  G ++GG V G LTAA PV+VIA SFT   Y+RLPL +DE
Sbjct  106  TGLTISFAGASGQVLGGCVAGALTAASPVLVIATSFTGATYDRLPLADDE  155



>ref|XP_008233653.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=326

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +PPGAT LT++LAGGQG +VGG+V+G L A+GPV+VIAA+FTN  YERLPLE+++
Sbjct  197  SPPGATGLTVYLAGGQGQVVGGTVMGALVASGPVMVIAATFTNATYERLPLEDEQ  251



>ref|XP_010027402.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=168

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            APPG+T LTI LAGG G +V  SVVG L A GP++++A +F+N  YERL +  D
Sbjct  62   APPGSTGLTISLAGGGGQVVSRSVVGSLVALGPIVLVAVTFSNATYERLMVPAD  115



>ref|XP_007009270.1| AT-hook protein of GA feedback 2 [Theobroma cacao]
 gb|EOY18080.1| AT-hook protein of GA feedback 2 [Theobroma cacao]
Length=339

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            +PPGAT LT++LAGGQG +VGGSV+G L A+GPV+VIAA+FTN  YERLP+E++
Sbjct  204  SPPGATGLTVYLAGGQGQVVGGSVIGALIASGPVMVIAATFTNAVYERLPIEDE  257



>ref|XP_002437301.1| hypothetical protein SORBIDRAFT_10g024540 [Sorghum bicolor]
 gb|EER88668.1| hypothetical protein SORBIDRAFT_10g024540 [Sorghum bicolor]
Length=270

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APP A+ L + ++ GQG ++GG VVG L AAGPV + AA+F N  YERLPL +    +V 
Sbjct  155  APPEASGLAVLVSAGQGQVLGGCVVGPLVAAGPVTIFAATFANAVYERLPLADAPELDVK  214



>gb|AIV43386.1| AHL protein [Triticum aestivum]
Length=289

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            AP  A+ L + L+ GQG ++GG VVG L AAGPV + AA+F N  YERLPL++   ++V 
Sbjct  179  APSEASGLAVMLSAGQGQVLGGCVVGPLVAAGPVTLFAATFANAVYERLPLQDAADADVK  238



>ref|XP_009409024.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409025.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409026.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409027.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409028.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409029.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=318

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +PPGAT LT++L+GGQG +VGG+V+GEL A+GPV+VIAA+F+N  YERLPL+++E
Sbjct  187  SPPGATGLTVYLSGGQGQVVGGNVIGELIASGPVMVIAATFSNATYERLPLDDEE  241



>gb|AIV43385.1| AHL protein [Triticum aestivum]
Length=256

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            APPGAT L ++LAGGQG +VGGSV+GEL A+GPV+VIAA+F N  YERLPL++D
Sbjct  144  APPGATGLAVYLAGGQGQVVGGSVMGELLASGPVMVIAATFGNATYERLPLDQD  197



>ref|XP_004490439.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=253

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN  175
             +I LAG QG ++GG VVG L AAG V VIAASF N +Y RLPLEED  S 
Sbjct  165  FSISLAGPQGQIIGGFVVGRLVAAGTVFVIAASFNNPSYHRLPLEEDVRSK  215



>dbj|BAJ98882.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=256

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            APPGAT L ++LAGGQG +VGGSV+GEL A GPV+VIAA+F N  YERLPL++D
Sbjct  144  APPGATGLAVYLAGGQGQVVGGSVMGELLACGPVMVIAATFGNATYERLPLDQD  197



>dbj|BAJ94538.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPGATSL+ FLA GQG +VGGSV G L AAGPV+V+A+SF+NVAYERLPLE+ +
Sbjct  163  APPGATSLSAFLARGQGQVVGGSVAGALVAAGPVVVVASSFSNVAYERLPLEDGD  217



>ref|XP_009336832.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
 ref|XP_009350412.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=296

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 63/91 (69%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLA GQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPLEE+E   + 
Sbjct  176  APPGATSLTIFLAAGQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLEEEEQLQMQ  235

Query  182  NggggggaasaaggaVY----NNPFPDPSTG  262
                        G        +NPFPDPS+G
Sbjct  236  QPLPQSSGGGGGGEGSGGGGASNPFPDPSSG  266



>ref|NP_001152652.1| DNA-binding protein [Zea mays]
 gb|ACG48758.1| DNA-binding protein [Zea mays]
Length=273

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            APPGAT LT++LAGGQG +VGGSV+GEL A+GPV+VIAA+F N  YERLPL++
Sbjct  155  APPGATGLTVYLAGGQGQVVGGSVMGELIASGPVMVIAATFGNATYERLPLDQ  207



>ref|XP_008681074.1| PREDICTED: DNA-binding protein isoform X1 [Zea mays]
 tpg|DAA44604.1| TPA: DNA-binding protein [Zea mays]
Length=273

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            APPGAT LT++LAGGQG +VGGSV+GEL A+GPV+VIAA+F N  YERLPL++
Sbjct  155  APPGATGLTVYLAGGQGQVVGGSVMGELIASGPVMVIAATFGNATYERLPLDQ  207



>ref|XP_004503162.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Cicer 
arietinum]
Length=308

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +PPGAT LT++LAGGQG +VGGSV G L A+GPV+VIAA+F N  YERLPLE+++
Sbjct  172  SPPGATGLTVYLAGGQGQVVGGSVAGSLIASGPVMVIAATFANATYERLPLEDEQ  226



>ref|XP_007218339.1| hypothetical protein PRUPE_ppa008610mg [Prunus persica]
 gb|EMJ19538.1| hypothetical protein PRUPE_ppa008610mg [Prunus persica]
Length=325

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            +PPGAT LT++LAGGQG +VGG+V+G L A+GPV+V+AA+FTN  YERLPLE+++
Sbjct  197  SPPGATGLTVYLAGGQGQVVGGTVMGALVASGPVMVVAATFTNATYERLPLEDEQ  251



>ref|XP_003602928.1| hypothetical protein MTR_3g100470 [Medicago truncatula]
 gb|AES73179.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=290

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSN  175
            ++ +I LAG QG +VGG V G L AAG V VIA+SF N +Y RLPLEEDE  N
Sbjct  182  SNFSISLAGPQGQIVGGIVAGNLIAAGTVFVIASSFNNPSYHRLPLEEDEGGN  234



>ref|XP_003558257.1| PREDICTED: putative DNA-binding protein ESCAROLA [Brachypodium 
distachyon]
Length=283

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGAT L ++LAGGQG +VGGSV+GEL A+GPV+VIAA+F N  YERLPL  DE S  D
Sbjct  160  APPGATGLAVYLAGGQGQVVGGSVMGELLASGPVMVIAATFGNATYERLPL--DEASQAD  217



>ref|XP_009774038.1| PREDICTED: putative DNA-binding protein ESCAROLA [Nicotiana sylvestris]
Length=323

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            +PPGAT LT++LAG QG +VGG+VVGEL A+GPV+VIAA+FTN  +E+LPLEE+  S
Sbjct  207  SPPGATGLTVYLAGSQGQVVGGNVVGELMASGPVMVIAATFTNATFEKLPLEEENVS  263



>ref|XP_008375698.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=296

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETSNVD  181
            APPGATSLTIFLAGGQG +VGG+VVG L A+GPVIVIA+SFTNVAYERLPLEE+E   + 
Sbjct  176  APPGATSLTIFLAGGQGQVVGGNVVGALIASGPVIVIASSFTNVAYERLPLEEEEQLQMQ  235

Query  182  NggggggaasaaggaVY----NNPFPDPSTG  262
                        G        +NPFPDPS+G
Sbjct  236  QPLPQSSGGGGGGEGSGGGGASNPFPDPSSG  266



>ref|XP_009418604.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=290

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLE  157
            APPGATSL +FLAGG G +VGGSVVG L AAGPVIVIAASFTNVAYERLPL+
Sbjct  160  APPGATSLAVFLAGGPGQVVGGSVVGALIAAGPVIVIAASFTNVAYERLPLD  211



>emb|CDP12442.1| unnamed protein product [Coffea canephora]
Length=661

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPGAT+LTI+LAGG G +VGG+VVG L   GPVIVIAASF+NVAYERL L+ED+ S
Sbjct  583  APPGATNLTIYLAGGYGQVVGGNVVGALITFGPVIVIAASFSNVAYERLSLDEDDHS  639



>ref|XP_006301299.1| hypothetical protein CARUB_v10021706mg [Capsella rubella]
 gb|EOA34197.1| hypothetical protein CARUB_v10021706mg [Capsella rubella]
Length=298

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPL  154
            L+IFL+G QG +VGG+VV  L A+GPVI++AASF+N  +ERLPL
Sbjct  185  LSIFLSGAQGQMVGGNVVAPLVASGPVILMAASFSNATFERLPL  228



>ref|XP_002887643.1| hypothetical protein ARALYDRAFT_476807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63902.1| hypothetical protein ARALYDRAFT_476807 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            L+IFL+G QG ++GG+VV  L A+GPVI++AASF+N  +ERLPLE+
Sbjct  180  LSIFLSGVQGQVIGGNVVAPLVASGPVILMAASFSNATFERLPLED  225



>ref|XP_011085041.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=299

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDETS  172
            APPGAT L ++LAGGQG +VGG+V G L A+GPV+VIAA+FTN  YERLPLE++  S
Sbjct  180  APPGATGLAVYLAGGQGQVVGGTVAGALVASGPVMVIAATFTNAVYERLPLEDEAAS  236



>ref|XP_009384686.1| PREDICTED: putative DNA-binding protein ESCAROLA [Musa acuminata 
subsp. malaccensis]
Length=288

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYER  145
            APPGATSLTIFL GGQG ++GGSVVGEL AAGPVIVI A+FT VAYER
Sbjct  163  APPGATSLTIFLVGGQGQVIGGSVVGELIAAGPVIVIGATFTKVAYER  210



>gb|KCW61537.1| hypothetical protein EUGRSUZ_H04257, partial [Eucalyptus grandis]
Length=272

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG+T LTI+LAGGQG +VGGSVVG L A+GPV+VIAA+F+N  YERLPLEEDE
Sbjct  163  APPGSTGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIAATFSNATYERLPLEEDE  217



>gb|EPS64500.1| hypothetical protein M569_10282, partial [Genlisea aurea]
Length=174

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APP AT+L++ L   QG  VGG+V G L A+G VI+  ASF NVAYE+L ++E+E
Sbjct  119  APPIATNLSVILGDSQGQTVGGNVAGALIASGTVILTTASFANVAYEKLQVKEEE  173



>ref|XP_001752988.1| predicted protein [Physcomitrella patens]
 gb|EDQ82029.1| predicted protein, partial [Physcomitrella patens]
Length=156

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  17   TSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            T LT+ LAG  G ++GGSVVG L AAGPV+VIAASF    + RLPL+ D+
Sbjct  106  TGLTVSLAGAAGQVLGGSVVGTLMAAGPVVVIAASFMGPTFVRLPLDADD  155



>dbj|BAJ94293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
             PPGAT L ++LAGGQG +VGG+V+GEL A+GPV+V+AA+F+N  YERLPL E+E
Sbjct  193  CPPGATGLAVYLAGGQGQVVGGTVIGELVASGPVMVVAATFSNATYERLPLAEEE  247



>ref|XP_010024974.1| PREDICTED: putative DNA-binding protein ESCAROLA [Eucalyptus 
grandis]
Length=282

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    APPGATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEEDE  166
            APPG+T LTI+LAGGQG +VGGSVVG L A+GPV+VIAA+F+N  YERLPLEEDE
Sbjct  163  APPGSTGLTIYLAGGQGQVVGGSVVGSLVASGPVMVIAATFSNATYERLPLEEDE  217



>gb|EPS71487.1| hypothetical protein M569_03276, partial [Genlisea aurea]
Length=200

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  14   ATSLTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEED  163
            A+ LT  +AG +G L GG+V G + A GPV+VIA++FTN  +ERLPLE+D
Sbjct  151  ASGLTALIAGPRGELAGGAVRGPMVADGPVMVIASTFTNATFERLPLEDD  200



>ref|NP_177776.1| AT-hook motif nuclear localized protein 29 [Arabidopsis thaliana]
 gb|AAG51949.1|AC015450_10 unknown protein; 41834-42742 [Arabidopsis thaliana]
 tpd|FAA00300.1| TPA: AT-hook motif nuclear localized protein 29 [Arabidopsis 
thaliana]
 gb|AEE35850.1| AT-hook motif nuclear localized protein 29 [Arabidopsis thaliana]
Length=302

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  23   LTIFLAGGQGHLVGGSVVGELTAAGPVIVIAASFTNVAYERLPLEE  160
            L+IFL+G QG ++GG+VV  L A+GPVI++AASF+N  +ERLPLE+
Sbjct  187  LSIFLSGVQGQVIGGNVVAPLVASGPVILMAASFSNATFERLPLED  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 820624058880