BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8893_g1_i1 len=1919 path=[199:0-1918]

Length=1919
                                                                      Score     E

gb|AGS94414.1|  beta-fructofuranosidase                                 799   0.0     
ref|XP_006466029.1|  PREDICTED: beta-fructofuranosidase, insolubl...    792   0.0     
ref|XP_006426549.1|  hypothetical protein CICLE_v10025259mg             789   0.0     
emb|CDO97904.1|  unnamed protein product                                786   0.0     
ref|XP_010062641.1|  PREDICTED: beta-fructofuranosidase, insolubl...    783   0.0     
gb|AFA46812.1|  cell wall invertase                                     781   0.0     
gb|ABI17893.1|  cell-wall invertase                                     781   0.0     Coffea canephora [robusta coffee]
ref|XP_007024490.1|  Glycosyl hydrolases family 32 protein isoform 1    768   0.0     
gb|KHG16454.1|  Beta-fructofuranosidase, insoluble isoenzyme CWIN...    767   0.0     
gb|KDP40759.1|  hypothetical protein JCGZ_24758                         754   0.0     
ref|NP_001268208.1|  cell wall apoplastic invertase                     751   0.0     
ref|XP_010106248.1|  hypothetical protein L484_005113                   748   0.0     
ref|NP_001280910.1|  beta-fructofuranosidase, insoluble isoenzyme...    746   0.0     
ref|XP_008227859.1|  PREDICTED: beta-fructofuranosidase, insolubl...    745   0.0     
ref|XP_008228278.1|  PREDICTED: beta-fructofuranosidase, insolubl...    745   0.0     
emb|CBI35961.3|  unnamed protein product                                743   0.0     
ref|XP_007221470.1|  hypothetical protein PRUPE_ppa003412mg             739   0.0     
ref|XP_010262081.1|  PREDICTED: beta-fructofuranosidase, insolubl...    739   0.0     
gb|KGN45520.1|  hypothetical protein Csa_7G450770                       738   0.0     
ref|XP_002521398.1|  Beta-fructofuranosidase, cell wall isozyme p...    734   0.0     Ricinus communis
ref|XP_007215309.1|  hypothetical protein PRUPE_ppa003470mg             731   0.0     
gb|KCW69765.1|  hypothetical protein EUGRSUZ_F03137                     729   0.0     
ref|XP_006466030.1|  PREDICTED: beta-fructofuranosidase, insolubl...    728   0.0     
ref|XP_006426548.1|  hypothetical protein CICLE_v10025243mg             726   0.0     
ref|XP_003546695.1|  PREDICTED: beta-fructofuranosidase, cell wal...    726   0.0     
gb|AFH77955.1|  cell wall invertase                                     724   0.0     
ref|XP_004141805.1|  PREDICTED: beta-fructofuranosidase, insolubl...    724   0.0     
ref|XP_004168885.1|  PREDICTED: beta-fructofuranosidase, insolubl...    724   0.0     
gb|AAD10960.1|  cell wall invertase precursor                           721   0.0     Fragaria x ananassa
ref|XP_007150512.1|  hypothetical protein PHAVU_005G158500g             718   0.0     
ref|XP_004297549.1|  PREDICTED: beta-fructofuranosidase, insolubl...    717   0.0     
gb|AFD62257.1|  acid invertase                                          712   0.0     
gb|KDO65252.1|  hypothetical protein CISIN_1g008242mg                   709   0.0     
ref|XP_003543590.1|  PREDICTED: beta-fructofuranosidase, cell wal...    711   0.0     
ref|XP_003597593.1|  Beta-fructofuranosidase, cell wall isozyme         711   0.0     
ref|XP_003531611.1|  PREDICTED: beta-fructofuranosidase, cell wal...    709   0.0     
gb|AFD62258.1|  acid invertase                                          707   0.0     
ref|NP_001236325.1|  beta-fructofuranosidase precursor                  706   0.0     
gb|AFK37518.1|  unknown                                                 707   0.0     
ref|XP_002521396.1|  Beta-fructofuranosidase, cell wall isozyme p...    706   0.0     Ricinus communis
gb|KEH18387.1|  cell-wall invertase                                     702   0.0     
ref|XP_010685379.1|  PREDICTED: fructan 6-exohydrolase                  702   0.0     
ref|NP_566464.1|  beta-fructofuranosidase, insoluble isoenzyme CW...    701   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534898.1|  PREDICTED: beta-fructofuranosidase, insolubl...    701   0.0     
ref|XP_009146448.1|  PREDICTED: beta-fructofuranosidase, insolubl...    699   0.0     
ref|XP_010685381.1|  PREDICTED: fructan 6-exohydrolase-like isofo...    698   0.0     
gb|KHN11275.1|  Beta-fructofuranosidase, cell wall isozyme              698   0.0     
ref|XP_004510389.1|  PREDICTED: beta-fructofuranosidase, cell wal...    699   0.0     
ref|XP_004486839.1|  PREDICTED: beta-fructofuranosidase, cell wal...    698   0.0     
ref|XP_010542426.1|  PREDICTED: beta-fructofuranosidase, insolubl...    697   0.0     
gb|ABD28503.1|  Sialidase                                               697   0.0     Medicago truncatula
pdb|2AC1|A  Chain A, Crystal Structure Of A Cell-Wall Invertase F...    696   0.0     
ref|XP_004297561.1|  PREDICTED: fructan 6-exohydrolase-like             698   0.0     
pdb|2XQR|A  Chain A, Crystal Structure Of Plant Cell Wall Inverta...    695   0.0     
pdb|2OXB|A  Chain A, Crystal Structure Of A Cell-Wall Invertase (...    694   0.0     
ref|XP_010062633.1|  PREDICTED: fructan 6-exohydrolase-like             693   0.0     
pdb|2QQV|A  Chain A, Crystal Structure Of A Cell-Wall Invertase (...    693   0.0     
gb|KHN39312.1|  Beta-fructofuranosidase, cell wall isozyme              694   0.0     
pdb|2QQW|A  Chain A, Crystal Structure Of A Cell-Wall Invertase (...    693   0.0     
ref|XP_010042359.1|  PREDICTED: beta-fructofuranosidase, insolubl...    693   0.0     
ref|XP_010501204.1|  PREDICTED: beta-fructofuranosidase, insolubl...    694   0.0     
emb|CDX97519.1|  BnaA05g25600D                                          693   0.0     
pdb|2QQU|A  Chain A, Crystal Structure Of A Cell-Wall Invertase (...    691   0.0     
ref|XP_010501217.1|  PREDICTED: beta-fructofuranosidase, insolubl...    692   0.0     
ref|XP_009117459.1|  PREDICTED: beta-fructofuranosidase, insolubl...    692   0.0     
emb|CDY51739.1|  BnaA01g37220D                                          692   0.0     
emb|CDY37487.1|  BnaC01g37450D                                          692   0.0     
ref|XP_004141685.1|  PREDICTED: beta-fructofuranosidase, insolubl...    689   0.0     
ref|XP_006407167.1|  hypothetical protein EUTSA_v10020376mg             691   0.0     
gb|KHN30053.1|  Beta-fructofuranosidase, cell wall isozyme              690   0.0     
emb|CDX97518.1|  BnaA05g25610D                                          690   0.0     
ref|XP_010487155.1|  PREDICTED: beta-fructofuranosidase, insolubl...    689   0.0     
ref|NP_001189881.1|  beta-fructofuranosidase, insoluble isoenzyme...    689   0.0     
ref|XP_010487154.1|  PREDICTED: beta-fructofuranosidase, insolubl...    688   0.0     
ref|XP_007135539.1|  hypothetical protein PHAVU_010G137900g             687   0.0     
ref|XP_010465245.1|  PREDICTED: beta-fructofuranosidase, insolubl...    687   0.0     
ref|XP_010271619.1|  PREDICTED: beta-fructofuranosidase, insolubl...    687   0.0     
ref|XP_002884989.1|  beta-fructofuranosidase                            687   0.0     
ref|XP_007024491.1|  Glycosyl hydrolases family 32 protein isoform 2    684   0.0     
ref|XP_009146452.1|  PREDICTED: beta-fructofuranosidase, insolubl...    685   0.0     
emb|CAA84527.1|  cell wall invertase II; beta-furanofructosidase        685   0.0     Vicia faba var. minor [tick bean]
ref|XP_010465247.1|  PREDICTED: beta-fructofuranosidase, insolubl...    685   0.0     
gb|AIQ77652.1|  cell wall invertase FCw-Inv                             683   0.0     
gb|AFV59226.1|  cell wall invertase CcwINV                              683   0.0     
emb|CAA57389.1|  beta-fructofuranosidase                                683   0.0     Oxybasis rubra [pigweed]
gb|KFK38729.1|  hypothetical protein AALP_AA3G153000                    683   0.0     
gb|AEB66647.1|  cell wall invertase                                     683   0.0     
ref|XP_010501163.1|  PREDICTED: beta-fructofuranosidase, insolubl...    682   0.0     
gb|KGN45521.1|  hypothetical protein Csa_7G450780                       679   0.0     
ref|XP_010465246.1|  PREDICTED: beta-fructofuranosidase, insolubl...    682   0.0     
gb|AFV59225.1|  cell wall invertase NcwINV                              681   0.0     
gb|AEB66646.1|  cell wall invertase                                     682   0.0     
ref|XP_004515311.1|  PREDICTED: beta-fructofuranosidase, cell wal...    680   0.0     
gb|AFJ21580.1|  cell wall invertase                                     678   0.0     
ref|XP_010685380.1|  PREDICTED: beta-fructofuranosidase, cell wal...    678   0.0     
ref|XP_010487151.1|  PREDICTED: beta-fructofuranosidase, insolubl...    678   0.0     
gb|KDO65253.1|  hypothetical protein CISIN_1g008242mg                   674   0.0     
gb|AFJ21574.1|  cell wall invertase                                     677   0.0     
ref|XP_010245596.1|  PREDICTED: beta-fructofuranosidase, insolubl...    676   0.0     
emb|CDY23644.1|  BnaC05g39500D                                          676   0.0     
ref|XP_004303654.1|  PREDICTED: beta-fructofuranosidase, insolubl...    674   0.0     
ref|XP_006297301.1|  hypothetical protein CARUB_v10013316mg             675   0.0     
gb|KDO65258.1|  hypothetical protein CISIN_1g008686mg                   674   0.0     
ref|XP_009147526.1|  PREDICTED: beta-fructofuranosidase, insolubl...    674   0.0     
ref|XP_007135538.1|  hypothetical protein PHAVU_010G137800g             672   0.0     
gb|AAC17166.1|  cell wall invertase                                     671   0.0     Pisum sativum [garden pea]
ref|XP_006342970.1|  PREDICTED: beta-fructofuranosidase, insolubl...    670   0.0     
gb|KEH39515.1|  cell-wall invertase                                     667   0.0     
emb|CDY33067.1|  BnaC06g07120D                                          670   0.0     
sp|Q9LIB9.2|INV5_ARATH  RecName: Full=Beta-fructofuranosidase, in...    669   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AES98262.2|  cell-wall invertase                                     669   0.0     
ref|XP_002891812.1|  beta-fructofuranosidase 5                          670   0.0     
ref|XP_006481745.1|  PREDICTED: beta-fructofuranosidase, insolubl...    668   0.0     
ref|XP_004515313.1|  PREDICTED: beta-fructofuranosidase, cell wal...    667   0.0     
emb|CDY24053.1|  BnaA06g00510D                                          668   0.0     
gb|KEH18388.1|  cell-wall invertase                                     665   0.0     
ref|XP_008779528.1|  PREDICTED: beta-fructofuranosidase, insolubl...    665   0.0     
ref|XP_010912308.1|  PREDICTED: beta-fructofuranosidase, insolubl...    665   0.0     
emb|CAC81824.1|  invertase                                              664   0.0     Beta vulgaris [beet]
ref|NP_564676.1|  beta-fructofuranosidase 5                             665   0.0     Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44438.1|  beta-fructofuranosidase (AtFruct5)                     665   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404354.1|  PREDICTED: beta-fructofuranosidase, insolubl...    664   0.0     
ref|XP_006858327.1|  hypothetical protein AMTR_s00064p00137280          664   0.0     
ref|XP_007027801.1|  Cell wall invertase 2 isoform 1                    663   0.0     
ref|XP_002278880.2|  PREDICTED: beta-fructofuranosidase, insolubl...    662   0.0     Vitis vinifera
gb|AEX15264.1|  cell wall invertase                                     661   0.0     
ref|XP_009626391.1|  PREDICTED: beta-fructofuranosidase, insolubl...    660   0.0     
ref|XP_002884988.1|  ATCWINV5                                           660   0.0     
gb|AEX15263.1|  cell wall invertase                                     660   0.0     
ref|XP_006392688.1|  hypothetical protein EUTSA_v10011339mg             660   0.0     
ref|XP_004235589.1|  PREDICTED: beta-fructofuranosidase, insolubl...    658   0.0     
ref|NP_187994.1|  beta-fructofuranosidase, insoluble isoenzyme CW...    657   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683702.1|  PREDICTED: beta-fructofuranosidase, insolubl...    657   0.0     
ref|XP_006356523.1|  PREDICTED: beta-fructofuranosidase, insolubl...    656   0.0     
ref|XP_006407168.1|  hypothetical protein EUTSA_v10020395mg             657   0.0     
gb|KDO70479.1|  hypothetical protein CISIN_1g008189mg                   656   0.0     
gb|AAO21213.1|  cell wall invertase                                     657   0.0     Musa acuminata [banana]
ref|XP_010262079.1|  PREDICTED: beta-fructofuranosidase, insolubl...    655   0.0     
dbj|BAA89048.1|  beta-fructofuranosidase                                656   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009372510.1|  PREDICTED: beta-fructofuranosidase, insolubl...    655   0.0     
ref|XP_008387018.1|  PREDICTED: beta-fructofuranosidase, insolubl...    654   0.0     
ref|XP_010480033.1|  PREDICTED: beta-fructofuranosidase, insolubl...    655   0.0     
ref|XP_006854303.1|  hypothetical protein AMTR_s00039p00100360          653   0.0     
ref|XP_007024492.1|  Glycosyl hydrolases family 32 protein isoform 3    650   0.0     
ref|XP_010912309.1|  PREDICTED: beta-fructofuranosidase, insolubl...    653   0.0     
ref|XP_006297319.1|  hypothetical protein CARUB_v10013339mg             652   0.0     
ref|XP_010654109.1|  PREDICTED: beta-fructofuranosidase, insolubl...    652   0.0     
ref|XP_010931117.1|  PREDICTED: beta-fructofuranosidase, insolubl...    652   0.0     
gb|AAG50837.1|AC073944_4  beta-fructofuranosidase, putative             653   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004241885.1|  PREDICTED: beta-fructofuranosidase, insolubl...    650   0.0     
ref|XP_009397581.1|  PREDICTED: beta-fructofuranosidase, insolubl...    651   0.0     
ref|XP_011094304.1|  PREDICTED: beta-fructofuranosidase, insolubl...    651   0.0     
ref|XP_006430160.1|  hypothetical protein CICLE_v10013701mg             650   0.0     
ref|XP_009758023.1|  PREDICTED: beta-fructofuranosidase, insolubl...    649   0.0     
gb|KFK38674.1|  hypothetical protein AALP_AA3G145300                    649   0.0     
ref|XP_011094306.1|  PREDICTED: beta-fructofuranosidase, insolubl...    647   0.0     
gb|AFR69123.1|  cell wall invertase                                     647   0.0     
ref|XP_011019433.1|  PREDICTED: beta-fructofuranosidase, insolubl...    646   0.0     
ref|XP_011077846.1|  PREDICTED: beta-fructofuranosidase, insolubl...    646   0.0     
ref|XP_002530337.1|  Beta-fructofuranosidase, insoluble isoenzyme...    645   0.0     Ricinus communis
ref|XP_010245601.1|  PREDICTED: beta-fructofuranosidase, insolubl...    644   0.0     
ref|XP_004975576.1|  PREDICTED: beta-fructofuranosidase, insolubl...    645   0.0     
ref|XP_002309496.1|  invertase family protein                           643   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009388284.1|  PREDICTED: beta-fructofuranosidase, insolubl...    643   0.0     
ref|XP_010648345.1|  PREDICTED: beta-fructofuranosidase, insolubl...    642   0.0     
emb|CAA49162.1|  beta-fructofuranosidase                                643   0.0     Daucus carota [carrots]
ref|XP_010648344.1|  PREDICTED: beta-fructofuranosidase, insolubl...    641   0.0     
gb|EYU38654.1|  hypothetical protein MIMGU_mgv1a003581mg                641   0.0     
gb|AFH77951.1|  cell wall invertase                                     641   0.0     
ref|XP_008243524.1|  PREDICTED: beta-fructofuranosidase, insolubl...    641   0.0     
ref|XP_006356522.1|  PREDICTED: beta-fructofuranosidase, insolubl...    639   0.0     
ref|XP_010322785.1|  PREDICTED: beta-fructofuranosidase, insolubl...    638   0.0     
ref|XP_010059629.1|  PREDICTED: beta-fructofuranosidase, insolubl...    639   0.0     
sp|P26792.1|INV1_DAUCA  RecName: Full=Beta-fructofuranosidase, in...    639   0.0     Daucus carota [carrots]
ref|XP_004515314.1|  PREDICTED: beta-fructofuranosidase, cell wal...    636   0.0     
sp|Q43089.1|INV1_PEA  RecName: Full=Beta-fructofuranosidase, cell...    637   0.0     Pisum sativum [garden pea]
emb|CAB95010.1|  invertase                                              635   0.0     Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007012302.1|  Glycosyl hydrolases family 32 protein, putative    638   0.0     
gb|ADF27781.1|  cell-wall invertase                                     638   0.0     
ref|NP_001052747.1|  Os04g0413200                                       636   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008442862.1|  PREDICTED: beta-fructofuranosidase, insolubl...    635   0.0     
ref|XP_009600222.1|  PREDICTED: beta-fructofuranosidase, insolubl...    635   0.0     
ref|XP_004515216.1|  PREDICTED: beta-fructofuranosidase, insolubl...    635   0.0     
emb|CAA84526.1|  beta-fructofuranosidase; cell wall invertase I; ...    634   0.0     Vicia faba var. minor [tick bean]
gb|AFR69122.1|  cell wall invertase                                     634   0.0     
emb|CDM80288.1|  unnamed protein product                                635   0.0     
ref|XP_010912306.1|  PREDICTED: beta-fructofuranosidase, insolubl...    634   0.0     
gb|EYU35515.1|  hypothetical protein MIMGU_mgv1a003330mg                634   0.0     
emb|CCV19961.1|  beta-fructofuranosidase, insoluble isoenzyme IVR...    634   0.0     
ref|XP_002489109.1|  hypothetical protein SORBIDRAFT_0067s002010        634   0.0     Sorghum bicolor [broomcorn]
emb|CDP08275.1|  unnamed protein product                                632   0.0     
ref|XP_002530338.1|  Beta-fructofuranosidase, insoluble isoenzyme...    632   0.0     Ricinus communis
gb|AEV46305.1|  apoplastic invertase                                    632   0.0     
emb|CAN71810.1|  hypothetical protein VITISV_003872                     629   0.0     Vitis vinifera
gb|AEV46307.1|  apoplastic invertase                                    632   0.0     
gb|EYU35517.1|  hypothetical protein MIMGU_mgv1a003306mg                631   0.0     
emb|CDP15447.1|  unnamed protein product                                630   0.0     
gb|AEV46308.1|  apoplastic invertase                                    631   0.0     
ref|XP_008452732.1|  PREDICTED: beta-fructofuranosidase, insolubl...    630   0.0     
gb|ABY81288.1|  cell-wall invertase                                     630   0.0     Populus alba x Populus grandidentata
emb|CDM80514.1|  unnamed protein product                                630   0.0     
gb|AFW58193.1|  invertase cell wall3                                    630   0.0     
emb|CCV19967.1|  beta-fructofuranosidase, insoluble isoenzyme IVR...    630   0.0     
gb|EMT10261.1|  Beta-fructofuranosidase, insoluble isoenzyme 3          629   0.0     
ref|XP_004149196.1|  PREDICTED: beta-fructofuranosidase, insolubl...    629   0.0     
gb|ABY81289.1|  cell-wall invertase                                     629   0.0     Populus alba x Populus grandidentata
gb|AAQ24870.1|  cell wall invertase 3                                   629   0.0     Oryza sativa Indica Group [Indian rice]
gb|EMS66375.1|  Beta-fructofuranosidase, insoluble isoenzyme 3          629   0.0     
ref|XP_002309419.1|  cell-wall invertase family protein                 628   0.0     Populus trichocarpa [western balsam poplar]
ref|NP_001275055.1|  beta-fructofuranosidase, insoluble isoenzyme...    629   0.0     
gb|KEH42003.1|  beta-fructofuranosidase                                 627   0.0     
gb|AEV46306.1|  apoplastic invertase                                    628   0.0     
ref|XP_009592423.1|  PREDICTED: beta-fructofuranosidase, insolubl...    628   0.0     
gb|AEV46299.1|  apoplastic invertase                                    627   0.0     
ref|XP_009758032.1|  PREDICTED: beta-fructofuranosidase, insolubl...    627   0.0     
ref|XP_009783398.1|  PREDICTED: beta-fructofuranosidase, insolubl...    627   0.0     
ref|NP_001117494.1|  beta-fructofuranosidase 5                          626   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307158.1|  hypothetical protein CARUB_v10008754mg             626   0.0     
ref|XP_011094303.1|  PREDICTED: beta-fructofuranosidase, insolubl...    627   0.0     
gb|AEV46298.1|  apoplastic invertase                                    627   0.0     
ref|NP_001185230.1|  beta-fructofuranosidase 5                          626   0.0     
gb|AEV46321.1|  apoplastic invertase                                    626   0.0     
ref|XP_009601011.1|  PREDICTED: beta-fructofuranosidase, insolubl...    626   0.0     
gb|AEV46309.1|  apoplastic invertase                                    626   0.0     
gb|AAM28823.1|AF506004_2  cell-wall invertase                           625   0.0     Solanum lycopersicum
emb|CDP08274.1|  unnamed protein product                                625   0.0     
ref|XP_010049203.1|  PREDICTED: beta-fructofuranosidase, insolubl...    625   0.0     
gb|KDP34087.1|  hypothetical protein JCGZ_07658                         625   0.0     
ref|XP_009803979.1|  PREDICTED: beta-fructofuranosidase, insolubl...    625   0.0     
ref|XP_011004211.1|  PREDICTED: beta-fructofuranosidase, insolubl...    624   0.0     
emb|CAA79676.1|  beta-fructofuranosidase                                625   0.0     Solanum tuberosum [potatoes]
gb|ADN06440.1|  invertase                                               624   0.0     
gb|AAL16015.1|AF420223_1  cell wall invertase                           624   0.0     Carica papaya [mamon]
emb|CAD40590.2|  OJ000126_13.7                                          624   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CAB85898.1|  beta-fructosidase                                      624   0.0     Solanum pennellii
ref|XP_009600223.1|  PREDICTED: beta-fructofuranosidase, insolubl...    623   0.0     
gb|AEV46338.1|  apoplastic invertase                                    623   0.0     
gb|ADM47341.1|  apoplastic invertase                                    623   0.0     
gb|AEV46303.1|  apoplastic invertase                                    623   0.0     
gb|AES82076.2|  beta-fructofuranosidase, insoluble protein              622   0.0     
emb|CAB76673.1|  invertase, putative                                    622   0.0     Solanum tuberosum [potatoes]
ref|XP_008784034.1|  PREDICTED: beta-fructofuranosidase, insolubl...    622   0.0     
emb|CAA57428.1|  beta-fructofuranosidase                                622   0.0     Nicotiana tabacum [American tobacco]
gb|AEV46301.1|  apoplastic invertase                                    622   0.0     
ref|XP_007027808.1|  Cell wall invertase 2                              622   0.0     
emb|CDM80283.1|  unnamed protein product                                622   0.0     
ref|NP_001233842.1|  acid invertase                                     622   0.0     
gb|AEV46304.1|  apoplastic invertase                                    622   0.0     
gb|AEV46300.1|  apoplastic invertase                                    622   0.0     
ref|XP_003535739.1|  PREDICTED: beta-fructofuranosidase, insolubl...    621   0.0     
emb|CAA80358.1|  beta-fructofuranosidase                                621   0.0     Solanum tuberosum [potatoes]
gb|AEV46325.1|  apoplastic invertase                                    622   0.0     
gb|AEV46324.1|  apoplastic invertase                                    621   0.0     
gb|AEV46323.1|  apoplastic invertase                                    621   0.0     
gb|AAM22409.1|AF506005_1  cell-wall invertase                           621   0.0     Solanum lycopersicum
gb|AEV46337.1|  apoplastic invertase                                    621   0.0     
gb|AEV46339.1|  apoplastic invertase                                    621   0.0     
gb|AEV46334.1|  apoplastic invertase                                    621   0.0     
ref|NP_001104898.1|  invertase cell wall3 precursor                     621   0.0     Zea mays [maize]
gb|AEV46336.1|  apoplastic invertase                                    620   0.0     
ref|XP_007012299.1|  Glycosyl hydrolases family 32 protein              620   0.0     
gb|AEV46330.1|  apoplastic invertase                                    620   0.0     
gb|AEV46333.1|  apoplastic invertase                                    620   0.0     
ref|XP_007027802.1|  Cell wall invertase 2 isoform 2                    617   0.0     
ref|XP_009768656.1|  PREDICTED: beta-fructofuranosidase, insolubl...    618   0.0     
gb|AEV46322.1|  apoplastic invertase                                    620   0.0     
ref|XP_007204106.1|  hypothetical protein PRUPE_ppa004218mg             617   0.0     
gb|AEV46332.1|  apoplastic invertase                                    619   0.0     
ref|XP_004975575.1|  PREDICTED: beta-fructofuranosidase, insolubl...    619   0.0     
emb|CAC37923.1|  fructan 1-exohydrolase IIb                             619   0.0     Cichorium intybus [radicchio]
gb|AEV46326.1|  apoplastic invertase                                    619   0.0     
ref|XP_008452733.1|  PREDICTED: beta-fructofuranosidase, insolubl...    618   0.0     
emb|CCV19963.1|  beta-fructofuranosidase, insoluble isoenzyme IVR...    619   0.0     
gb|AEV46327.1|  apoplastic invertase                                    619   0.0     
gb|AFH77950.1|  cell wall invertase                                     619   0.0     
gb|AAC96065.1|  cell wall invertase                                     618   0.0     Triticum aestivum [Canadian hard winter wheat]
gb|KFK34511.1|  hypothetical protein AALP_AA5G154900                    618   0.0     
ref|XP_010912307.1|  PREDICTED: beta-fructofuranosidase, insolubl...    618   0.0     
emb|CDP08273.1|  unnamed protein product                                618   0.0     
gb|EMT20540.1|  Beta-fructofuranosidase, insoluble isoenzyme 3          618   0.0     
ref|XP_009779642.1|  PREDICTED: beta-fructofuranosidase, insolubl...    617   0.0     
ref|XP_011094300.1|  PREDICTED: beta-fructofuranosidase, insolubl...    617   0.0     
ref|XP_002323420.2|  soluble acid invertase family protein              616   0.0     
gb|AEV46331.1|  apoplastic invertase                                    616   0.0     
ref|XP_010262080.1|  PREDICTED: beta-fructofuranosidase, insolubl...    613   0.0     
ref|NP_565837.1|  beta-fructofuranosidase, insoluble isoenzyme CW...    616   0.0     
emb|CAD49079.1|  fructan 1-exohydrolase                                 615   0.0     
ref|XP_004249435.1|  PREDICTED: beta-fructofuranosidase, insolubl...    616   0.0     
ref|XP_009783406.1|  PREDICTED: beta-fructofuranosidase, insolubl...    615   0.0     
ref|XP_006392687.1|  hypothetical protein EUTSA_v10011339mg             613   0.0     
emb|CAC37922.1|  fructan 1-exohydrolase IIa                             614   0.0     
ref|XP_010049202.1|  PREDICTED: beta-fructofuranosidase, insolubl...    615   0.0     
ref|XP_009620523.1|  PREDICTED: beta-fructofuranosidase, insolubl...    614   0.0     
gb|AEV46317.1|  apoplastic invertase                                    614   0.0     
gb|AEV46318.1|  apoplastic invertase                                    614   0.0     
ref|NP_001275327.1|  beta-fructofuranosidase, insoluble isoenzyme...    614   0.0     
gb|AAM61359.1|  putative beta-fructofuranosidase (invertase)            614   0.0     
ref|NP_001274815.1|  beta-fructofuranosidase, insoluble isoenzyme...    614   0.0     
ref|XP_004141427.1|  PREDICTED: beta-fructofuranosidase, insolubl...    613   0.0     
gb|AEV46313.1|  apoplastic invertase                                    613   0.0     
ref|XP_004157397.1|  PREDICTED: beta-fructofuranosidase, insolubl...    614   0.0     
ref|XP_006450861.1|  hypothetical protein CICLE_v10007827mg             613   0.0     
gb|KCW81699.1|  hypothetical protein EUGRSUZ_C03054                     612   0.0     
ref|XP_006341086.1|  PREDICTED: beta-fructofuranosidase, insolubl...    613   0.0     
gb|AEV46319.1|  apoplastic invertase                                    612   0.0     
ref|XP_006475906.1|  PREDICTED: beta-fructofuranosidase, insolubl...    613   0.0     
ref|NP_001234793.1|  beta-fructofuranosidase                            612   0.0     
ref|XP_010097051.1|  Beta-fructofuranosidase, insoluble isoenzyme...    612   0.0     
ref|XP_010239883.1|  PREDICTED: beta-fructofuranosidase, insolubl...    612   0.0     
ref|XP_009141565.1|  PREDICTED: beta-fructofuranosidase, insolubl...    613   0.0     
gb|EYU35516.1|  hypothetical protein MIMGU_mgv1a025972mg                613   0.0     
emb|CDY43744.1|  BnaAnng07590D                                          612   0.0     
pdb|1ST8|A  Chain A, Crystal Structure Of Fructan 1-Exohydrolase ...    610   0.0     
ref|XP_009804784.1|  PREDICTED: beta-fructofuranosidase, insolubl...    612   0.0     
ref|XP_010686857.1|  PREDICTED: fructan 6-exohydrolase-like             610   0.0     
gb|AAM22411.1|AF506007_1  cell-wall invertase                           610   0.0     
ref|XP_002881429.1|  ATCWINV4                                           612   0.0     
ref|XP_010505149.1|  PREDICTED: beta-fructofuranosidase, insolubl...    612   0.0     
gb|AEV46315.1|  apoplastic invertase                                    611   0.0     
gb|AEV46316.1|  apoplastic invertase                                    611   0.0     
ref|XP_008243523.1|  PREDICTED: beta-fructofuranosidase, insolubl...    611   0.0     
ref|XP_006652264.1|  PREDICTED: beta-fructofuranosidase, insolubl...    611   0.0     
ref|XP_003625858.1|  Beta-fructofuranosidase, insoluble isoenzyme       610   0.0     
pdb|2AEZ|A  Chain A, Crystal Structure Of Fructan 1-Exohydrolase ...    609   0.0     
ref|XP_010553388.1|  PREDICTED: beta-fructofuranosidase, insolubl...    610   0.0     
ref|XP_008387019.1|  PREDICTED: beta-fructofuranosidase, insolubl...    607   0.0     
emb|CDY23227.1|  BnaA04g05320D                                          610   0.0     
emb|CAA72062.1|  fructosidase                                           609   0.0     
ref|NP_001274823.1|  beta-fructofuranosidase, insoluble isoenzyme...    609   0.0     
ref|XP_009139443.1|  PREDICTED: beta-fructofuranosidase, insolubl...    611   0.0     
gb|AEV46340.1|  apoplastic invertase                                    608   0.0     
ref|XP_011019434.1|  PREDICTED: beta-fructofuranosidase, insolubl...    608   0.0     
emb|CAC19366.1|  fructan 1-exohydrolase I                               607   0.0     
ref|XP_011004706.1|  PREDICTED: beta-fructofuranosidase, insolubl...    608   0.0     
gb|AGT16261.1|  beta-fructofuranosidase                                 607   0.0     
ref|XP_004249827.1|  PREDICTED: beta-fructofuranosidase, insolubl...    607   0.0     
dbj|BAC42957.1|  putative beta-fructofuranosidase                       607   0.0     
gb|AGX01484.1|  apoplastic invertase                                    607   0.0     
gb|AEV46312.1|  apoplastic invertase                                    607   0.0     
gb|AEV46311.1|  apoplastic invertase                                    607   0.0     
ref|XP_010515731.1|  PREDICTED: LOW QUALITY PROTEIN: beta-fructof...    607   0.0     
gb|ABK28599.1|  unknown                                                 607   0.0     
ref|NP_190828.2|  beta-fructofuranosidase, insoluble isoenzyme CW...    607   0.0     
ref|XP_010520702.1|  PREDICTED: beta-fructofuranosidase, insolubl...    606   0.0     
ref|XP_006647344.1|  PREDICTED: beta-fructofuranosidase, insolubl...    606   0.0     
ref|XP_002877875.1|  predicted protein                                  606   0.0     
ref|XP_010509503.1|  PREDICTED: beta-fructofuranosidase, insolubl...    605   0.0     
ref|XP_007204152.1|  hypothetical protein PRUPE_ppa019728mg             605   0.0     
ref|XP_006588847.1|  PREDICTED: beta-fructofuranosidase, insolubl...    604   0.0     
ref|NP_001151535.1|  beta-fructofuranosidase, insoluble isoenzyme...    605   0.0     
ref|XP_002466502.1|  hypothetical protein SORBIDRAFT_01g008910          604   0.0     
ref|XP_003579704.1|  PREDICTED: beta-fructofuranosidase, insolubl...    604   0.0     
gb|AAM28822.1|AF506004_1  cell-wall invertase                           603   0.0     
ref|NP_001234701.1|  cell-wall invertase                                603   0.0     
ref|XP_006410790.1|  hypothetical protein EUTSA_v10016415mg             603   0.0     
gb|AAA63802.1|  invertase                                               603   0.0     
ref|XP_009404355.1|  PREDICTED: beta-fructofuranosidase, insolubl...    603   0.0     
gb|EPS65342.1|  cell-wall invertase                                     603   0.0     
gb|AAO45698.1|  beta-fructofuranosidase                                 602   0.0     
emb|CAB76674.1|  invertase, putative                                    602   0.0     
emb|CDP20113.1|  unnamed protein product                                602   0.0     
ref|XP_002309497.2|  hypothetical protein POPTR_0006s24400g             602   0.0     
emb|CDP15446.1|  unnamed protein product                                602   0.0     
ref|XP_009628470.1|  PREDICTED: beta-fructofuranosidase, insolubl...    602   0.0     
gb|AAO45697.1|  beta-fructofuranosidase                                 602   0.0     
emb|CAA72009.1|  invertase                                              599   0.0     
ref|XP_010516826.1|  PREDICTED: beta-fructofuranosidase, insolubl...    600   0.0     
dbj|BAM74038.1|  cell wall invertase                                    600   0.0     
ref|XP_007204585.1|  hypothetical protein PRUPE_ppa003343mg             600   0.0     
emb|CAJ77148.1|  putative fructan 1-exohydrolase                        600   0.0     
sp|Q39693.1|INV3_DAUCA  RecName: Full=Beta-fructofuranosidase, in...    600   0.0     
ref|XP_009133067.1|  PREDICTED: beta-fructofuranosidase, insolubl...    600   0.0     
gb|KFK36513.1|  hypothetical protein AALP_AA4G133900                    599   0.0     
ref|XP_003575078.1|  PREDICTED: beta-fructofuranosidase, insolubl...    598   0.0     
ref|XP_006403787.1|  hypothetical protein EUTSA_v10010231mg             598   0.0     
ref|XP_006658883.1|  PREDICTED: beta-fructofuranosidase, insolubl...    598   0.0     
ref|XP_006653374.1|  PREDICTED: beta-fructofuranosidase, insolubl...    597   0.0     
gb|AGI03950.1|  defective invertase Nin88                               598   0.0     
ref|XP_004305655.1|  PREDICTED: beta-fructofuranosidase, insolubl...    595   0.0     
ref|XP_009597209.1|  PREDICTED: beta-fructofuranosidase, insolubl...    597   0.0     
ref|XP_007162921.1|  hypothetical protein PHAVU_001G191600g             596   0.0     
gb|ABB77249.1|  cell wall invertase BObetaFRUCT1                        597   0.0     
gb|EPS69453.1|  cell-wall invertase                                     596   0.0     
dbj|BAJ88320.1|  predicted protein                                      596   0.0     
emb|CDX79661.1|  BnaC03g19970D                                          596   0.0     
gb|KDP37325.1|  hypothetical protein JCGZ_06779                         593   0.0     
ref|XP_010504008.1|  PREDICTED: LOW QUALITY PROTEIN: beta-fructof...    596   0.0     
gb|ABB77250.1|  cell wall invertase BObetaFRUCT2                        595   0.0     
sp|Q01IS7.2|INV2_ORYSI  RecName: Full=Beta-fructofuranosidase, in...    595   0.0     
emb|CCV19962.1|  beta-fructofuranosidase, insoluble isoenzyme IVR...    594   0.0     
ref|XP_004975574.1|  PREDICTED: beta-fructofuranosidase, insolubl...    595   0.0     
ref|NP_001052748.1|  Os04g0413500                                       595   0.0     
emb|CAB43403.1|  beta-fructofuranosidase                                594   0.0     
ref|XP_008444460.1|  PREDICTED: LOW QUALITY PROTEIN: beta-fructof...    594   0.0     
gb|EMT04613.1|  Beta-fructofuranosidase, insoluble isoenzyme 1          593   0.0     
gb|KDP37326.1|  hypothetical protein JCGZ_06780                         593   0.0     
gb|ACL53374.1|  unknown                                                 593   0.0     
ref|XP_006651789.1|  PREDICTED: beta-fructofuranosidase, insolubl...    593   0.0     
ref|XP_004515312.1|  PREDICTED: beta-fructofuranosidase, cell wal...    593   0.0     
ref|XP_003544539.1|  PREDICTED: beta-fructofuranosidase, insolubl...    592   0.0     
ref|XP_006293891.1|  hypothetical protein CARUB_v10022878mg             592   0.0     
gb|AFW71688.1|  cell wall invertase1                                    592   0.0     
dbj|BAM74037.1|  cell wall invertase                                    592   0.0     
ref|XP_004952653.1|  PREDICTED: beta-fructofuranosidase, cell wal...    591   0.0     
ref|XP_004142928.1|  PREDICTED: beta-fructofuranosidase, insolubl...    591   0.0     
ref|XP_006293151.1|  hypothetical protein CARUB_v10019464mg             591   0.0     
ref|XP_003556736.1|  PREDICTED: beta-fructofuranosidase, insolubl...    590   0.0     
gb|KGN62386.1|  hypothetical protein Csa_2G351670                       591   0.0     
ref|XP_004168388.1|  PREDICTED: beta-fructofuranosidase, insolubl...    590   0.0     
gb|KHN46025.1|  Beta-fructofuranosidase, insoluble isoenzyme 1          587   0.0     
ref|XP_009628471.1|  PREDICTED: beta-fructofuranosidase, insolubl...    589   0.0     
gb|AAZ29515.1|  cell wall invertase                                     589   0.0     
ref|NP_001105369.1|  beta-fructofuranosidase, cell wall isozyme p...    589   0.0     
gb|AAQ24868.1|  cell wall invertase 2                                   589   0.0     
gb|AFV09274.1|  cell wall invertase                                     588   0.0     
ref|XP_004494206.1|  PREDICTED: beta-fructofuranosidase, insolubl...    588   0.0     
ref|XP_010686854.1|  PREDICTED: fructan 6-exohydrolase-like             587   0.0     
emb|CAD19323.1|  exocellular acid invertase 2                           588   0.0     
ref|XP_008243660.1|  PREDICTED: beta-fructofuranosidase, insolubl...    585   0.0     
gb|EMS48640.1|  Beta-fructofuranosidase, insoluble isoenzyme 1          587   0.0     
ref|XP_007161027.1|  hypothetical protein PHAVU_001G036800g             587   0.0     
ref|XP_004986250.1|  PREDICTED: beta-fructofuranosidase, insolubl...    585   0.0     
sp|Q39692.1|INV2_DAUCA  RecName: Full=Beta-fructofuranosidase, in...    587   0.0     
gb|AAY85659.1|  cell wall invertase 1                                   586   0.0     
ref|XP_008243659.1|  PREDICTED: beta-fructofuranosidase, insolubl...    584   0.0     
sp|A2X5P7.2|INV1_ORYSI  RecName: Full=Beta-fructofuranosidase, in...    586   0.0     
ref|XP_010669385.1|  PREDICTED: beta-fructofuranosidase, insolubl...    586   0.0     
dbj|BAL73222.1|  fructan 1-exohydrolase                                 585   0.0     
ref|XP_004249824.1|  PREDICTED: beta-fructofuranosidase, insolubl...    582   0.0     
gb|AFW58192.1|  beta-fructofuranosidase, insoluble isoenzyme 2          585   0.0     
gb|ACG47298.1|  beta-fructofuranosidase, insoluble isoenzyme 2 pr...    585   0.0     
gb|AFV09275.1|  cell wall invertase                                     584   0.0     
gb|AAD02511.1|  cell wall invertase Incw1                               584   0.0     
tpg|DAA37899.1|  TPA: miniature seed1                                   584   0.0     
emb|CAD58960.1|  apoplastic invertase 1                                 583   0.0     
gb|AAP59437.1|  cell wall invertase                                     581   0.0     
emb|CAD40589.2|  OJ000126_13.8                                          583   0.0     
emb|CAH67363.1|  OSIGBa0134P10.9                                        583   0.0     
ref|XP_004498878.1|  PREDICTED: beta-fructofuranosidase, insolubl...    581   0.0     
gb|AAD02510.1|  cell wall invertase Incw2                               583   0.0     
ref|NP_001105596.1|  miniature seed1 precursor                          583   0.0     
ref|XP_010696575.1|  PREDICTED: fructan 6-exohydrolase-like             580   0.0     
ref|NP_001047034.1|  Os02g0534400                                       580   0.0     
ref|XP_010536191.1|  PREDICTED: beta-fructofuranosidase, insolubl...    581   0.0     
gb|AAF06991.1|AF165179_1  cell wall invertase 2                         581   0.0     
gb|KHG30589.1|  Beta-fructofuranosidase, insoluble isoenzyme CWIN...    580   0.0     
ref|XP_006426547.1|  hypothetical protein CICLE_v10027399mg             579   0.0     
gb|EMT06339.1|  Beta-fructofuranosidase, insoluble isoenzyme 2          580   0.0     
dbj|BAB90855.1|  cell wall invertase                                    579   0.0     
ref|XP_006605559.1|  PREDICTED: beta-fructofuranosidase, insolubl...    578   0.0     
gb|ADE60580.1|  GIF1                                                    579   0.0     
ref|XP_010685382.1|  PREDICTED: beta-fructofuranosidase, cell wal...    575   0.0     
ref|XP_003553601.2|  PREDICTED: beta-fructofuranosidase, insolubl...    575   0.0     
ref|XP_006601227.1|  PREDICTED: fructan 6-exohydrolase-like             576   0.0     
gb|AAF06992.1|AF165180_1  cell wall invertase 2                         577   0.0     
ref|XP_011094302.1|  PREDICTED: beta-fructofuranosidase, insolubl...    574   0.0     
ref|XP_010312228.1|  PREDICTED: beta-fructofuranosidase, insolubl...    573   0.0     
ref|XP_007161026.1|  hypothetical protein PHAVU_001G036700g             574   0.0     
ref|XP_003588973.1|  Beta-fructofuranosidase, insoluble isoenzyme...    574   0.0     
gb|EAY86157.1|  hypothetical protein OsI_07532                          574   0.0     
gb|AAF06993.1|AF165181_1  cell wall invertase                           574   0.0     
ref|XP_010097052.1|  Beta-fructofuranosidase, insoluble isoenzyme...    576   0.0     
gb|KFK24015.1|  hypothetical protein AALP_AAs47660U000100               597   0.0     
ref|XP_007161023.1|  hypothetical protein PHAVU_001G036600g             573   0.0     
gb|EPS71507.1|  hypothetical protein M569_03251                         570   0.0     
ref|XP_006387748.1|  hypothetical protein POPTR_0609s00200g             570   0.0     
ref|XP_004975572.1|  PREDICTED: beta-fructofuranosidase, insolubl...    570   0.0     
ref|XP_006339275.1|  PREDICTED: beta-fructofuranosidase, insolubl...    568   0.0     
ref|XP_003549347.2|  PREDICTED: fructan 6-exohydrolase-like             569   0.0     
ref|NP_001030847.1|  beta-fructofuranosidase, insoluble isoenzyme...    568   0.0     
ref|XP_010912310.1|  PREDICTED: beta-fructofuranosidase, insolubl...    566   0.0     
ref|XP_002489106.1|  hypothetical protein SORBIDRAFT_0067s002240        565   0.0     
gb|KDO65255.1|  hypothetical protein CISIN_1g008242mg                   561   0.0     
ref|XP_009366766.1|  PREDICTED: beta-fructofuranosidase, insolubl...    564   0.0     
ref|XP_009377886.1|  PREDICTED: beta-fructofuranosidase, insolubl...    563   0.0     
dbj|BAK07035.1|  predicted protein                                      565   0.0     
ref|XP_004498875.1|  PREDICTED: beta-fructofuranosidase, insolubl...    565   0.0     
emb|CBI30319.3|  unnamed protein product                                562   0.0     
gb|ADE60654.1|  CIN1                                                    563   0.0     
ref|XP_003588978.1|  Beta-fructofuranosidase, insoluble isoenzyme       563   0.0     
ref|XP_006338931.1|  PREDICTED: beta-fructofuranosidase, insolubl...    560   0.0     
ref|XP_009600224.1|  PREDICTED: beta-fructofuranosidase, insolubl...    561   0.0     
ref|XP_003559454.2|  PREDICTED: beta-fructofuranosidase, insolubl...    558   0.0     
ref|XP_002489110.1|  hypothetical protein SORBIDRAFT_0067s002110        559   0.0     
gb|ADP88916.1|  cell wall invertase                                     555   0.0     
ref|XP_010312324.1|  PREDICTED: beta-fructofuranosidase, insolubl...    557   0.0     
gb|ABM65159.1|  cell wall invertase                                     556   0.0     
gb|ABM65158.1|  cell wall invertase                                     556   0.0     
gb|ABM65156.1|  cell wall invertase                                     556   0.0     
gb|EYU29327.1|  hypothetical protein MIMGU_mgv1a003514mg                558   0.0     
gb|KHN37038.1|  Fructan 6-exohydrolase                                  557   0.0     
gb|ABM65157.1|  cell wall invertase                                     555   0.0     
ref|XP_004960196.1|  PREDICTED: beta-fructofuranosidase, insolubl...    558   0.0     
gb|ADE60630.1|  CIN1                                                    556   0.0     
gb|ADE60661.1|  CIN1                                                    555   0.0     
ref|XP_004303541.1|  PREDICTED: LOW QUALITY PROTEIN: beta-fructof...    552   0.0     
gb|ADE60650.1|  CIN1                                                    554   0.0     
gb|ADE60571.1|  GIF1                                                    553   0.0     
ref|XP_010093754.1|  Beta-fructofuranosidase, insoluble isoenzyme 1     560   0.0     
ref|XP_008462457.1|  PREDICTED: beta-fructofuranosidase, insolubl...    545   0.0     



>gb|AGS94414.1| beta-fructofuranosidase [Actinidia chinensis]
Length=569

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/555 (68%), Positives = 456/555 (82%), Gaps = 4/555 (1%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             G   +ASH++ +  + LQ   P++TYRTS+HFQPP+NWMNDPNGPM+YKG+YH FYQYNP
Sbjct  19    GHGVEASHVIYRTFQNLQATNPDNTYRTSYHFQPPKNWMNDPNGPMMYKGIYHLFYQYNP  78

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
              GA +G I W HSTS D VNW    PA+ P QP  DING WSGS TILP   PA+LYTG+
Sbjct  79    YGADWGNIVWAHSTSVDFVNWTPRAPAIFPDQPG-DINGCWSGSTTILPGYKPAILYTGI  137

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             D +  QVQNLAVP+N SDP L EWVKSP NPL+AP + N+INA+SFRDPTT+W GPD  W
Sbjct  138   DPQKSQVQNLAVPKNLSDPLLIEWVKSPYNPLMAPTNLNQINASSFRDPTTSWLGPDKTW  197

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPNGLDTSL  1104
             R+++GSK  RRGLAILYRSKDFV WV+AKHPLHS + +GMWECPDF+PVS S  GLDT+ 
Sbjct  198   RVIIGSKRHRRGLAILYRSKDFVHWVKAKHPLHSAKDTGMWECPDFFPVS-SQGGLDTNT  256

Query  1103  VGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFY  924
             VG  IKHVLK+SLD+++HDYYT+G Y+  +D+Y+PDKGSVDND+GLRYDYGKFYASKTFY
Sbjct  257   VGLGIKHVLKLSLDDTKHDYYTVGMYNLDKDRYVPDKGSVDNDTGLRYDYGKFYASKTFY  316

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             DS K+RRILWGWINESL   EYVKQGWSG+Q IPR++WLDK+ KQLVQWP+ E+EKLR N
Sbjct  317   DSAKKRRILWGWINESLPQPEYVKQGWSGIQAIPRSIWLDKSEKQLVQWPIMEIEKLRGN  376

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
             +V+MPS++LK GS+ E+S ++AAQAD+E++F  +E  KAE M+  W T+PQ+LCS+K  S
Sbjct  377   RVDMPSSVLKGGSMLEISSVTAAQADVEISFGEIELEKAELMDPSW-TNPQLLCSRKATS  435

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
             V+GG+GPFGLKVLAS++ +EYTAVFFR+F G+N   VVLMCSDQ+RSSL+  TDKT+YGA
Sbjct  436   VKGGLGPFGLKVLASKDLKEYTAVFFRIFKGHNKY-VVLMCSDQSRSSLNHNTDKTTYGA  494

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             FV+V+P  E+LSLR LIDHSIVESFG  GK CIT+RVYPT AIG  AHLYAFN G  S++
Sbjct  495   FVEVDPTNEQLSLRSLIDHSIVESFGGGGKACITARVYPTLAIGNWAHLYAFNYGSGSVR  554

Query  203   LSKLTAWSMKKPTIN  159
             +SKL+AWSMKK  IN
Sbjct  555   ISKLSAWSMKKALIN  569



>ref|XP_006466029.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Citrus sinensis]
 gb|KDO65251.1| hypothetical protein CISIN_1g008242mg [Citrus sinensis]
Length=573

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/557 (65%), Positives = 459/557 (82%), Gaps = 3/557 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             +G VE QASH V +NL+  Q   PN  YRT +HFQPP+NW+NDPNG M+YKG+YH FYQY
Sbjct  18    HGVVELQASHHVYRNLQTSQSTSPNQPYRTGYHFQPPKNWINDPNGVMIYKGIYHLFYQY  77

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTSKDL+NW  H PA+ PSQ  +DING WSGSATILP   PA+ YT
Sbjct  78    NPKGAVWGNIVWAHSTSKDLINWIPHDPAIYPSQ-QSDINGCWSGSATILPGEKPAIFYT  136

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D  NRQVQNLAVP+N SDPYL+EWVKSP+NPL+AP+  N+IN +SFRDPTTAW GPD 
Sbjct  137   GIDPHNRQVQNLAVPKNLSDPYLREWVKSPKNPLMAPDAMNQINTSSFRDPTTAWLGPDK  196

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ R+GLAILYRSKDFV W++AKHPLHS +G+GMWECPDF+PVST   NGLD
Sbjct  197   RWRVIIGSKINRKGLAILYRSKDFVHWIKAKHPLHSVKGTGMWECPDFFPVSTYGLNGLD  256

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS +G   KHVLK+SLD+++H+YYT+GTY   +D+Y+PD+GSV++DSGLR+DYGK+YASK
Sbjct  257   TSDMGPNTKHVLKVSLDDTKHEYYTVGTYSTAKDRYVPDEGSVESDSGLRFDYGKYYASK  316

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             TF+D  K RR+LWGW+NES    + VK+GW+G+Q IPR +WLDK+ K LVQWPV E+EKL
Sbjct  317   TFFDGAKNRRVLWGWVNESSSVNDDVKKGWAGIQAIPRKLWLDKSGKHLVQWPVVEIEKL  376

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQK  573
             R N+V++PS +LK GSV EV+G++AAQAD+E++F + +F KAEK++  W T+PQ+LCSQK
Sbjct  377   RVNQVQVPSKLLKGGSVIEVTGVTAAQADVEISFDVSDFKKAEKLDPGW-TNPQLLCSQK  435

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTS  393
             GASV+G +GPFGL  LAS++ +EYTAVFFR+F G +N  VVLMCSDQ+RSSL+   DKT+
Sbjct  436   GASVKGALGPFGLLALASKDLKEYTAVFFRIFKGEDNKFVVLMCSDQSRSSLNSDNDKTT  495

Query  392   YGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             YGAF++V+P+ E+LSLR LIDHSIVESFG  GK CIT+RVYPT AI + AHLYAFNNG  
Sbjct  496   YGAFLNVDPVYEKLSLRSLIDHSIVESFGVGGKACITARVYPTLAIDDYAHLYAFNNGTE  555

Query  212   SIKLSKLTAWSMKKPTI  162
             ++K++ L+AWSMKK  +
Sbjct  556   NVKINGLSAWSMKKAQL  572



>ref|XP_006426549.1| hypothetical protein CICLE_v10025259mg [Citrus clementina]
 gb|ESR39789.1| hypothetical protein CICLE_v10025259mg [Citrus clementina]
Length=573

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/557 (65%), Positives = 459/557 (82%), Gaps = 3/557 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             +G VE QASH V +NL+  Q   PN  YRT +HFQPP+NW+NDPNG M+YKG+YH FYQY
Sbjct  18    HGVVELQASHHVYRNLQTSQSTSPNQPYRTGYHFQPPKNWINDPNGVMIYKGIYHLFYQY  77

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTSKDL+NW  H PA+ PSQ  +DING WSGSATILP   PA+ YT
Sbjct  78    NPKGAVWGNIVWAHSTSKDLINWIPHDPAIYPSQ-QSDINGCWSGSATILPGEKPAIFYT  136

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D  NRQVQNLAVP+N SDPYL+EWVKSP+NPL+AP+  N+IN +SFRDPTTAW GPD 
Sbjct  137   GIDPHNRQVQNLAVPKNLSDPYLREWVKSPKNPLMAPDAMNQINTSSFRDPTTAWLGPDK  196

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ R+GLAILYRSKDF+ W++AKHPLHS +G+GMWECPDF+PVST   NGLD
Sbjct  197   RWRVIIGSKINRKGLAILYRSKDFLHWIKAKHPLHSVKGTGMWECPDFFPVSTYGLNGLD  256

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS +G   KHVLK+SLD+++H+YYT+GTY   +D+Y+PD+GSV++DSGLR+DYGK+YASK
Sbjct  257   TSDMGPNTKHVLKVSLDDTKHEYYTVGTYSTAKDRYVPDEGSVESDSGLRFDYGKYYASK  316

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             TF+DS K RR+LWGW+NES    + VK+GW+G+Q IPR +WLDK+ K LVQWPV E+EKL
Sbjct  317   TFFDSAKNRRVLWGWVNESSSVNDDVKKGWAGIQAIPRKLWLDKSGKHLVQWPVVEIEKL  376

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQK  573
             R N+V++PS +LK GSV EV+G++AAQAD+E++F + +F KAEK++  W T+PQ++CSQK
Sbjct  377   RVNQVQVPSKLLKGGSVIEVTGVTAAQADVEISFDVSDFKKAEKLDPGW-TNPQLICSQK  435

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTS  393
             GASV+G +GPFGL  LAS++ +EYTAVFFR+F G +   VVLMCSDQ+RSSL+   DKT+
Sbjct  436   GASVKGALGPFGLLALASKDLKEYTAVFFRIFKGEDKKFVVLMCSDQSRSSLNSDNDKTT  495

Query  392   YGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             YGAF++V+P+ E+LSLR LIDHSIVESFG  GK CIT+RVYPT AI + AHLYAFNNG  
Sbjct  496   YGAFLNVDPVYEKLSLRSLIDHSIVESFGVGGKACITARVYPTLAIDDYAHLYAFNNGTE  555

Query  212   SIKLSKLTAWSMKKPTI  162
             ++K++ L+AWSMKK  +
Sbjct  556   NVKINGLSAWSMKKAQL  572



>emb|CDO97904.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/558 (66%), Positives = 450/558 (81%), Gaps = 4/558 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             +G +E +ASH V +NL +LQP  P+ TYRTS+HFQPP+NWMNDPNGP VYKG+YH FYQY
Sbjct  19    HGILEAEASHGVYRNLASLQPASPSQTYRTSYHFQPPKNWMNDPNGPTVYKGLYHLFYQY  78

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NP G  +G I W HSTSKDL+NW  H  A+ PSQ   D+NG WSGS T+L    PA+LYT
Sbjct  79    NPLGPDWGNIVWAHSTSKDLINWNPHKAAIFPSQ-KGDVNGCWSGSTTMLRGENPAILYT  137

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +++QVQNLAVPRN SDPYL EWVKSP NPL+ P   NKI+++SFRDPTTAW GPDG
Sbjct  138   GIDPKSQQVQNLAVPRNLSDPYLIEWVKSPYNPLMTPTPENKIDSSSFRDPTTAWLGPDG  197

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPNGLDT  1110
              WR++VG+K+ RRG A+LYRSKDFVRW +A+HPL+S +G+GMWECPDFYPVS+SP GLDT
Sbjct  198   RWRVIVGNKLNRRGKALLYRSKDFVRWTKAQHPLYSIQGTGMWECPDFYPVSSSPIGLDT  257

Query  1109  SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKT  930
             S +G  +KHVLK+SLD+++HD Y IGTY H +D ++P+ G+ +  SGLRYDYGKFYASKT
Sbjct  258   STIGEGVKHVLKVSLDDTKHDQYAIGTYVHSKDVFVPNAGAAEKFSGLRYDYGKFYASKT  317

Query  929   FYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR  750
             FYDSLK+RRILWGWINESL   +Y+ QGWSGVQ IPR +WLDK+ KQLVQWP+ E+E LR
Sbjct  318   FYDSLKKRRILWGWINESLSREDYIAQGWSGVQAIPRLIWLDKSGKQLVQWPISEIETLR  377

Query  749   SNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIM-EFGKAEKMEERWTTDPQVLCSQK  573
               KV  P T+LK GS  EV GI AAQAD++V+F++  +  +A+ ++  W TDPQ+LCSQK
Sbjct  378   QKKVGYPLTLLKSGSTLEVQGIKAAQADVDVSFQVASQLEQADALDPSW-TDPQLLCSQK  436

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTS  393
             GASVRGG GPFGLKVLAS++ QEYTAVFFR+F   N   VVLMCSDQ+RSSL++K DKT+
Sbjct  437   GASVRGGAGPFGLKVLASKDLQEYTAVFFRIFKARNKY-VVLMCSDQSRSSLNEKPDKTT  495

Query  392   YGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             YGAF+DV+P+ EELSLR LIDHSIVESFG KGK CITSRVYPTKA+G +A LY FN G  
Sbjct  496   YGAFLDVDPLHEELSLRSLIDHSIVESFGGKGKACITSRVYPTKALGNEARLYVFNYGKA  555

Query  212   SIKLSKLTAWSMKKPTIN  159
             ++ +S + AW+MK  +IN
Sbjct  556   NVAISSMNAWTMKNASIN  573



>ref|XP_010062641.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Eucalyptus grandis]
 gb|KCW69766.1| hypothetical protein EUGRSUZ_F03138 [Eucalyptus grandis]
Length=579

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/558 (66%), Positives = 455/558 (82%), Gaps = 5/558 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEA-LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQ  1653
             +G +   ASH V ++L+  ++       YRTS+HFQPP+NW+NDPNGPM+YKG+YH FYQ
Sbjct  24    HGVLHVGASHKVYRHLQTTVESTSVKQPYRTSYHFQPPKNWINDPNGPMIYKGIYHLFYQ  83

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             YNPKGA +G I W HSTSKDLVNW  H+PA+ PSQ  +DING WSGSATILP   PA+LY
Sbjct  84    YNPKGAVWGNIVWAHSTSKDLVNWTPHVPAIFPSQ-KSDINGCWSGSATILPGYKPAILY  142

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG++ +N+QVQNLAVP+N SDPYL EWVKSPRNPL+AP   N INA+SFRDPTT W GPD
Sbjct  143   TGINPQNQQVQNLAVPKNLSDPYLIEWVKSPRNPLMAPTAMNGINASSFRDPTTGWVGPD  202

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGL  1116
             G WR+++GSK  R G+AILYRSKDFV W +A+HPLHS E +GMWECPDF+PVS   P GL
Sbjct  203   GRWRVIIGSKKDRMGMAILYRSKDFVHWTEAQHPLHSAENTGMWECPDFFPVSVQVPVGL  262

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS+ G  +KHVLK+SLD+++H+YYT+GTY+ V DKY+PD+GSVD+DSGLRYDYGKFYAS
Sbjct  263   DTSINGPNVKHVLKVSLDDTKHEYYTVGTYNSVTDKYVPDEGSVDSDSGLRYDYGKFYAS  322

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+DS K+RRILWGWINES    + +K+GWSGVQ IPRT+WLDK+ KQLVQWP+ E+EK
Sbjct  323   KTFFDSEKKRRILWGWINESSSVDDDIKKGWSGVQAIPRTLWLDKSGKQLVQWPIVEIEK  382

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQ  576
             LR+N+V++P+ ++K G+V EVSGI+AAQAD+EV+F++ E  KAE ++  W T+PQ+LCS+
Sbjct  383   LRTNQVDLPNKLIKGGTVLEVSGITAAQADVEVSFEVKELEKAEVLDPTW-TNPQMLCSE  441

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKT  396
             KGASV+G +GPFGL V+AS+  QEYTAVFFR+F G N   VVLMCSDQ+RSSL+   DKT
Sbjct  442   KGASVKGSLGPFGLLVMASKGLQEYTAVFFRIFKGQNKY-VVLMCSDQSRSSLNNNNDKT  500

Query  395   SYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGV  216
             +YGAF+DV+P+ E+LSLR LIDHSIVESFG  GK CIT+RVYP  A+   +HL+ FNNG 
Sbjct  501   TYGAFLDVDPLHEKLSLRTLIDHSIVESFGGGGKSCITARVYPVLAVENGSHLHVFNNGT  560

Query  215   HSIKLSKLTAWSMKKPTI  162
              S+ + KLTAWSMKK  I
Sbjct  561   QSVGVPKLTAWSMKKAHI  578



>gb|AFA46812.1| cell wall invertase [Manihot esculenta]
Length=576

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/561 (65%), Positives = 454/561 (81%), Gaps = 7/561 (1%)
 Frame = -1

Query  1829  YGGVETQASHIV---LQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFF  1659
             YG  E +ASH +    QNL+       +  YRTS+HFQPP+NWMNDPNGPM+YKG+YH F
Sbjct  19    YGVFELEASHHIYHTFQNLQESAVSASSQPYRTSYHFQPPKNWMNDPNGPMIYKGLYHLF  78

Query  1658  YQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPAL  1479
             YQYNPKGA +G I WGHSTSKDLVNW  H  A+ PSQP+ DING WSGSATILP+  PA+
Sbjct  79    YQYNPKGAVWGNIVWGHSTSKDLVNWTPHKVAIYPSQPS-DINGTWSGSATILPDGKPAI  137

Query  1478  LYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRG  1299
             LYTG++  N+QVQNLA+P+NPSDPYL EWVKSP NPL+AP   N+INA+SFRDPTTAWRG
Sbjct  138   LYTGINPLNQQVQNLAIPKNPSDPYLIEWVKSPNNPLMAPTPENQINASSFRDPTTAWRG  197

Query  1298  PDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPN  1122
              DG W+++VGSK+ R+GLA LYRSKDFV W++AKHPLHS + +GMWEC DF+PVS  SP 
Sbjct  198   VDGRWKVIVGSKINRKGLAYLYRSKDFVYWIKAKHPLHSAKNTGMWECVDFFPVSANSPV  257

Query  1121  GLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             G++ S++GS  K+VLK SLD+++HD YTIG YDHV+D+Y PD+GSV+ D GLRYDYGKFY
Sbjct  258   GVEMSVLGSDFKYVLKASLDDTKHDCYTIGEYDHVKDRYTPDEGSVEGDPGLRYDYGKFY  317

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTF+DS K RR+LWGW+NES   ++ +K+GW+G+Q IPR VWLDK+ KQLVQWP+QE+
Sbjct  318   ASKTFFDSAKNRRLLWGWLNESSSVSDDIKKGWAGIQAIPRVVWLDKSGKQLVQWPIQEI  377

Query  761   EKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
             EKLR N V +PS  LK GSV EV G++A+QAD+E+TFK+ +F KAE ++  W T+PQ+LC
Sbjct  378   EKLRVNPVHLPSQYLKGGSVVEVPGVTASQADVEITFKVSDFSKAEVLDPSW-TNPQLLC  436

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD  402
             S+KG SVRG +GPFGL VLAS+  QEYT+VFFR+F G N + VVLMCSDQ+RSSL+   D
Sbjct  437   SRKGGSVRGSLGPFGLLVLASKGMQEYTSVFFRIFKGQNKH-VVLMCSDQSRSSLNPDND  495

Query  401   KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNN  222
             KT YGAFVDV+P+ E+LSLR LIDHS+VESFG  GK CI++RVYP  AI E AHLYAFNN
Sbjct  496   KTMYGAFVDVDPVHEQLSLRSLIDHSVVESFGGHGKNCISARVYPMLAINEAAHLYAFNN  555

Query  221   GVHSIKLSKLTAWSMKKPTIN  159
             G  ++ +++L+AWSMKK  IN
Sbjct  556   GSEAVTITRLSAWSMKKAHIN  576



>gb|ABI17893.1| cell-wall invertase [Coffea canephora]
Length=576

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/558 (66%), Positives = 449/558 (80%), Gaps = 4/558 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             +G +E +ASH V +NL +LQP  P+ TYRTS+HFQPP+NWMNDPNGP VY+G+YH FYQY
Sbjct  19    HGILEAEASHGVYRNLASLQPASPSQTYRTSYHFQPPKNWMNDPNGPTVYRGLYHLFYQY  78

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NP G  +G I W HSTSKDL+NW  H  A+ PSQ   D+NG WSGS T+L    PA+LYT
Sbjct  79    NPLGPDWGNIVWAHSTSKDLINWNPHKAAIFPSQ-KGDVNGCWSGSTTMLRGENPAILYT  137

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +++QVQNLAVPRN SDPYL EWVKSP NPL+ P   NKI+++SFRDPTTAW GPDG
Sbjct  138   GIDPKSQQVQNLAVPRNLSDPYLIEWVKSPYNPLMTPTPENKIDSSSFRDPTTAWLGPDG  197

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPNGLDT  1110
              WR++VG+K+ RRG A+LYRSKDFVRW +A+HPL+S +G+GMWECPDFYPVS+SP GLDT
Sbjct  198   RWRVIVGNKLNRRGKALLYRSKDFVRWTKAQHPLYSIQGTGMWECPDFYPVSSSPIGLDT  257

Query  1109  SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKT  930
             S +G  +KHVLK+SLD+++HD Y IGTY H +D ++P+ G+ +  SGLRYDYGK YASKT
Sbjct  258   STIGEGVKHVLKVSLDDTKHDQYAIGTYVHSKDVFVPNAGAAEKFSGLRYDYGKSYASKT  317

Query  929   FYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR  750
             FYDSLK+RRILWGWINESL   +Y+ QGWSGVQ IPR VWLDK+ KQLVQWP+ E+E LR
Sbjct  318   FYDSLKKRRILWGWINESLSREDYIAQGWSGVQAIPRLVWLDKSGKQLVQWPISEIETLR  377

Query  749   SNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIM-EFGKAEKMEERWTTDPQVLCSQK  573
               KV  P T+LK GS  EV GI AAQAD++V+F++  +  +A+ ++  W TDPQ+LCSQK
Sbjct  378   QKKVGYPLTLLKSGSTLEVQGIKAAQADVDVSFQVAPQLEQADALDPSW-TDPQLLCSQK  436

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTS  393
             GASVRGG GPFGLKVLAS++ QEYTAVFFR+F   N   VVLMCSDQ+RSSL++K DKT+
Sbjct  437   GASVRGGTGPFGLKVLASKDLQEYTAVFFRIFKARNKY-VVLMCSDQSRSSLNEKPDKTT  495

Query  392   YGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             YGAF+DV+P+ EELSLR LIDHSIVESFG KGK CITSRVYPTKA+G +A LY FN G  
Sbjct  496   YGAFLDVDPLHEELSLRSLIDHSIVESFGGKGKACITSRVYPTKALGNEARLYVFNYGKA  555

Query  212   SIKLSKLTAWSMKKPTIN  159
             ++ +S + AW+MK  +IN
Sbjct  556   NVAISSMNAWTMKNASIN  573



>ref|XP_007024490.1| Glycosyl hydrolases family 32 protein isoform 1 [Theobroma cacao]
 gb|EOY27112.1| Glycosyl hydrolases family 32 protein isoform 1 [Theobroma cacao]
Length=579

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/559 (64%), Positives = 454/559 (81%), Gaps = 5/559 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQP-PYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQ  1653
             +G VE +ASH V +NL+  Q     N  YRT +HFQPP+NW+NDPNGPMVYKG+YH FYQ
Sbjct  21    HGVVELEASHHVYKNLQTDQSTASANQPYRTGYHFQPPKNWINDPNGPMVYKGLYHLFYQ  80

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             YNPKGA +G I W HSTSKDLVNW  H PA+ PSQP+ DING WSGSATILP+  PA+LY
Sbjct  81    YNPKGAVWGNIVWAHSTSKDLVNWTPHDPAIYPSQPS-DINGCWSGSATILPDGKPAILY  139

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D +++QVQNLA+P+N SDPYL+EW+KS +NPL+ P   N+INA+SFRDPTTAW GPD
Sbjct  140   TGIDPQDKQVQNLAMPKNLSDPYLREWIKSSKNPLMQPTAQNQINASSFRDPTTAWLGPD  199

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
               WR+++GSK+ R+GLAILY+S+DFV W+QA+ PLHS + +GMWECPDF+PVS    NG+
Sbjct  200   KKWRLIIGSKIHRQGLAILYKSEDFVHWIQAQSPLHSAKDTGMWECPDFFPVSVRGQNGV  259

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             D S+ G  +KHVLK+SLD+++H+YYT+G+YD V+D Y PDKGSV++DSGLRYDYGKFYAS
Sbjct  260   DISVNGPFVKHVLKVSLDDTKHEYYTLGSYDIVKDIYTPDKGSVESDSGLRYDYGKFYAS  319

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+D+ K RRILWGWINES    + VK+GW+GVQ IPR +WL K+ KQLVQWP+ E++K
Sbjct  320   KTFFDTAKHRRILWGWINESSSVHDDVKKGWAGVQAIPRKLWLSKSGKQLVQWPIVEIQK  379

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQ  576
             LRSN + +PS +LK GS  EVSG++AAQAD++++FK+ +F KAE ++  W T+PQ+LCSQ
Sbjct  380   LRSNHLRLPSKLLKGGSEIEVSGVTAAQADVDISFKVTDFEKAEVLKPSW-TNPQLLCSQ  438

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKT  396
             +GASV+GG+GPFGL VLASE  +E TAVFFR+F G N   VVLMCSDQ+RSSL++  DKT
Sbjct  439   QGASVKGGLGPFGLLVLASEGLKENTAVFFRIFKGQNKY-VVLMCSDQSRSSLNEDNDKT  497

Query  395   SYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGV  216
             +YGAF+DV+P  + LSLR LIDHSIVESFG  GK CIT+RVYPT AI   AHLY FNNG 
Sbjct  498   TYGAFLDVDPEHQYLSLRSLIDHSIVESFGGGGKACITARVYPTLAINNAAHLYVFNNGS  557

Query  215   HSIKLSKLTAWSMKKPTIN  159
              ++++++L AWSMKK  +N
Sbjct  558   EAVEIAELNAWSMKKAKLN  576



>gb|KHG16454.1| Beta-fructofuranosidase, insoluble isoenzyme CWINV1 -like protein 
[Gossypium arboreum]
Length=570

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/559 (65%), Positives = 450/559 (81%), Gaps = 8/559 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYP-NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQ  1653
             +G VE +ASH V +NL+ +Q     +  YRT FHFQPP+NW+N   G MVYKG+YH FYQ
Sbjct  18    HGIVELEASHHVYRNLQTVQSAASTDQPYRTGFHFQPPKNWIN---GVMVYKGLYHLFYQ  74

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             YNPKGA +G I W HSTSKDLVNW  H PA+ PSQP+ DING WSGSATILP   PA+LY
Sbjct  75    YNPKGAVWGNIVWAHSTSKDLVNWTPHEPAIFPSQPS-DINGCWSGSATILPGGKPAMLY  133

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D++N QVQNLAVP+N SDPYL+EWVKSP+NPL+ P   N+INA+SFRDPTTAW GPD
Sbjct  134   TGIDTKNSQVQNLAVPKNLSDPYLREWVKSPKNPLMQPTAQNQINASSFRDPTTAWLGPD  193

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGL  1116
               WR+++GSK+ R+GL ILY+SKDFV WVQA  PLHS + +GMWECPDFYPV  S  NG+
Sbjct  194   KKWRVIIGSKINRQGLVILYKSKDFVNWVQAPMPLHSAKDTGMWECPDFYPVPVSGKNGV  253

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTSL G  +KHVLKISLD+++HD YTIG+YD+++D YIPDKGSV+NDSGLRYDYGK+YAS
Sbjct  254   DTSLNGPYVKHVLKISLDDTKHDLYTIGSYDNLKDIYIPDKGSVENDSGLRYDYGKYYAS  313

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF DS+K RRIL GW+NES    + +K+GW+GV  IPR VWLDK+ KQL+QWPV E++K
Sbjct  314   KTFLDSIKNRRILCGWLNESSSVADDIKKGWAGVHAIPRQVWLDKSGKQLMQWPVVEIQK  373

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQ  576
             LR+N V +PS +LK GSV EVSG++A+QAD++++FKI +F KAE +   W T+PQ+LCSQ
Sbjct  374   LRTNHVSLPSRLLKGGSVVEVSGVTASQADVDISFKISDFEKAEVLNPSW-TNPQLLCSQ  432

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKT  396
             KGASV+GG+GPFGL VLAS+   E TAVFFR+F G N   VVLMCSDQ+RSSL++  DKT
Sbjct  433   KGASVKGGVGPFGLLVLASKGLTENTAVFFRIFKGQNKY-VVLMCSDQSRSSLNQANDKT  491

Query  395   SYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGV  216
             +YGAF+DV+P+ + LSLR LIDHSIVESFG  GK C+++RVYPT AI   AHL+ FNNG 
Sbjct  492   TYGAFLDVDPLHQSLSLRSLIDHSIVESFGGGGKACMSARVYPTLAINNTAHLFVFNNGS  551

Query  215   HSIKLSKLTAWSMKKPTIN  159
              ++K++KL AWSMKK  IN
Sbjct  552   EAVKIAKLNAWSMKKAIIN  570



>gb|KDP40759.1| hypothetical protein JCGZ_24758 [Jatropha curcas]
Length=579

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/562 (62%), Positives = 444/562 (79%), Gaps = 9/562 (2%)
 Frame = -1

Query  1829  YGGVETQASHIV----LQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHF  1662
             +G  E +ASH +    LQ+LE+         YRT +HFQPP+NWMNDPNGPM+YKG+YH 
Sbjct  22    HGVFELEASHHIYDQTLQSLESTDSTSITQPYRTGYHFQPPKNWMNDPNGPMIYKGIYHL  81

Query  1661  FYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPA  1482
             FYQYNPK A +G I W HSTS+DLVNW  H  A+ PSQP  DING WSGSAT LPN  PA
Sbjct  82    FYQYNPKEAVWGNIVWAHSTSRDLVNWTPHKFAIYPSQPG-DINGTWSGSATFLPNGTPA  140

Query  1481  LLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWR  1302
             +LYTG++ +N+QVQNLA+P+N SDPYL +WVK+PRNPL+APN  N+INATSFRDPTTAW 
Sbjct  141   ILYTGINPQNQQVQNLAMPKNTSDPYLLDWVKTPRNPLMAPNAQNQINATSFRDPTTAWL  200

Query  1301  GPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSP  1125
             G DG W++++GSK+ RRGLAILY SKDF+ WV+AKHPLHS EG+GMWECPDF+PV +   
Sbjct  201   GADGRWKVIIGSKIHRRGLAILYTSKDFINWVKAKHPLHSAEGTGMWECPDFFPVLANGK  260

Query  1124  NGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKF  945
             NG+D   +   +K+VLK SLD+++HD+YTIG YDHV+D Y P++GS D DSGLRYDYGKF
Sbjct  261   NGVDLK-IQKGVKYVLKFSLDDTKHDHYTIGDYDHVKDIYTPNRGSTDGDSGLRYDYGKF  319

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASKTF+DS K RRILWGW NES   ++ +K+GW+G+Q IPR +WL K+ KQL+QWP++E
Sbjct  320   YASKTFFDSAKNRRILWGWSNESSSVSDDIKKGWAGIQAIPRVIWLGKSGKQLIQWPIEE  379

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             +EKLR+N + +P  +LKKGSV +V+G++AAQAD+E++FK+    KAE +   W T+PQ++
Sbjct  380   IEKLRTNPINLPRKVLKKGSVLQVAGVTAAQADVEISFKVSNLEKAEVLNPSW-TNPQLV  438

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKT  405
             CS+KGASVRG +GPFGL VLAS   +EYT+VFFR+F    N  VVLMCSDQ+RSSL+   
Sbjct  439   CSRKGASVRGSLGPFGLLVLASNGFEEYTSVFFRIFK-RQNKYVVLMCSDQSRSSLNPGN  497

Query  404   DKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFN  225
             DKT+YGAFVDV+P+ E++SLR LIDHS+VESFG  GK CI +RVYP  AI E AHL+AFN
Sbjct  498   DKTTYGAFVDVDPVHEQISLRSLIDHSVVESFGGGGKSCILTRVYPQLAINEAAHLHAFN  557

Query  224   NGVHSIKLSKLTAWSMKKPTIN  159
             NG  S+ +++ +AWSMKK  IN
Sbjct  558   NGSESVTITRFSAWSMKKARIN  579



>ref|NP_001268208.1| cell wall apoplastic invertase [Vitis vinifera]
 gb|AAT09980.1| cell wall apoplastic invertase [Vitis vinifera]
Length=576

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/531 (66%), Positives = 428/531 (81%), Gaps = 4/531 (1%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHI  1569
             YRT +HFQP +NWMNDPNGPM+YKG+YHFFYQYNP GA +G I W HSTS DLVNW  H 
Sbjct  49    YRTGYHFQPRKNWMNDPNGPMIYKGLYHFFYQYNPHGAVWGNIVWAHSTSTDLVNWTPHK  108

Query  1568  PALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWV  1389
              A+SPSQPA DING WSGSATILPN  P +LYTG+D +N+QVQN+AVP+N SDP+L EW 
Sbjct  109   YAISPSQPA-DINGCWSGSATILPNGKPVILYTGIDPQNKQVQNMAVPKNLSDPFLLEWT  167

Query  1388  KSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRW  1209
             K  +NPL+ P   N INA+SFRDPTTAW+G DG WR+++GSK+ R+GLAILYRSKDFVRW
Sbjct  168   KLSQNPLMEPTTINSINASSFRDPTTAWQGTDGRWRVIIGSKIKRKGLAILYRSKDFVRW  227

Query  1208  VQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSKIKHVLKISLDESRHDYYTIG  1032
              +A+HPLHSG+ +GMWECPDF+PVS  S  G+DTS +   +K+VLK+SLD+++HDYYTIG
Sbjct  228   TKAQHPLHSGKNTGMWECPDFFPVSINSSTGVDTSSISKTLKYVLKLSLDDTKHDYYTIG  287

Query  1031  TYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVK  852
             +Y+  +D Y+PDKGSVDNDSGLRYDYGKFYASKTF+D+ K RRILWGWINES      ++
Sbjct  288   SYNREKDTYVPDKGSVDNDSGLRYDYGKFYASKTFFDNAKNRRILWGWINESSSVEHDIE  347

Query  851   QGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQ  672
             +GWSGVQ IPR VWLDK+ KQL+QWP+ E+EK R     M S  LK GS  EV GI+A+Q
Sbjct  348   KGWSGVQAIPRNVWLDKSGKQLLQWPIAEIEKQRIKPGHMSSRELKGGSKVEVGGITASQ  407

Query  671   ADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAV  492
             AD+E++FKI +F KAE  +E W ++PQ+LCSQ+GASV+GG+GPFGL VLAS+  +EYTAV
Sbjct  408   ADVEISFKISDFKKAEVFDESW-SNPQLLCSQRGASVKGGLGPFGLMVLASKGMEEYTAV  466

Query  491   FFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVES  312
             FFR+F       VVLMCSDQ+RSSLD   DKT+YGAF+DV+P+ E+LSLR LIDHSIVES
Sbjct  467   FFRIFK-RQTKYVVLMCSDQSRSSLDNDNDKTTYGAFLDVDPVHEKLSLRSLIDHSIVES  525

Query  311   FGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             FG  GKVCIT+RVYPT AI  +AHLYAFN G  S+ ++ L AWSMKK  IN
Sbjct  526   FGGGGKVCITARVYPTLAIDGEAHLYAFNKGTGSVGMTTLRAWSMKKAKIN  576



>ref|XP_010106248.1| hypothetical protein L484_005113 [Morus notabilis]
 gb|EXC09157.1| hypothetical protein L484_005113 [Morus notabilis]
Length=571

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/558 (63%), Positives = 446/558 (80%), Gaps = 7/558 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             +G  + +ASH V  NL+  +       YRTS+HFQPP+NW+N   GPM+YKG+YH FYQY
Sbjct  20    HGVFKLEASHNVYTNLQVSESVPAEQPYRTSYHFQPPKNWIN---GPMIYKGLYHLFYQY  76

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             N KGA +G I W HSTS DLVNW  H PA+ PSQP+ DING WSGS TILPN  P + YT
Sbjct  77    NLKGAVWGNIVWAHSTSTDLVNWTPHDPAIYPSQPS-DINGCWSGSTTILPNGKPVIFYT  135

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +NRQVQNLA+P+N SDP+L+EWVK  +NPL+AP   N+IN++SFRDPTTAWRGPD 
Sbjct  136   GIDPQNRQVQNLAMPKNLSDPFLREWVKLTKNPLMAPAQTNRINSSSFRDPTTAWRGPDN  195

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WRI++GSK  RRGLAILYRS+DF+ WV+A+HPLHS +G+GMWECPDF+PV+  SP G+D
Sbjct  196   RWRIIIGSKRDRRGLAILYRSRDFLNWVKAQHPLHSAKGNGMWECPDFFPVAVDSPIGVD  255

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS++G+K+KHVLK+SLD+++H+YYTIGTY   +DKYIPD+GSV++D+GLRYDYGKFYASK
Sbjct  256   TSVIGNKVKHVLKVSLDDTKHEYYTIGTYAIKKDKYIPDEGSVESDAGLRYDYGKFYASK  315

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             TF+DS+KRRRILWGWINES    + + +GW+GVQ IPRT+ LDK+ KQL+QWPV E+EKL
Sbjct  316   TFFDSVKRRRILWGWINESSSVNDDINKGWAGVQAIPRTLLLDKSGKQLIQWPVPEIEKL  375

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQK  573
             R N+V   + +LK GSV +V  ++A QAD+E++FKI    KAE ++  W T+PQ+LCSQK
Sbjct  376   RINQVNFSNKLLKGGSVLKVPKVTATQADVEISFKISGLEKAEVLDPTW-TNPQILCSQK  434

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTS  393
             GASV+  +GPFGL VLAS   +EYTAVFFR+F G+N   VVL+CSDQ+RSSL +  DKT+
Sbjct  435   GASVKSSLGPFGLLVLASNGLKEYTAVFFRIFKGHNKY-VVLLCSDQSRSSLKQDNDKTT  493

Query  392   YGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             YG F++V+ + E LSLR LIDHSIVESFG KGK CIT+RVYPT AIG+ A+L+AFNNG  
Sbjct  494   YGVFLNVDLVHETLSLRSLIDHSIVESFGGKGKACITARVYPTLAIGDGAYLFAFNNGTQ  553

Query  212   SIKLSKLTAWSMKKPTIN  159
              ++++ L AWSMKK  IN
Sbjct  554   DVEIANLNAWSMKKAKIN  571



>ref|NP_001280910.1| beta-fructofuranosidase, insoluble isoenzyme CWINV1-like precursor 
[Malus domestica]
 gb|AFU56876.1| cell wall invertase [Malus domestica]
Length=577

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/561 (64%), Positives = 444/561 (79%), Gaps = 11/561 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPNH------TYRTSFHFQPPRNWMNDPNGPMVYKGVYHFF  1659
             +  +ASH V ++L+       +H       YRT +HFQPP+NW+NDPNGP++YKG+YH F
Sbjct  21    LRLEASHHVYRSLQTYSELTSSHHHPDTEPYRTGYHFQPPKNWINDPNGPLIYKGIYHLF  80

Query  1658  YQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPAL  1479
             YQYNPKG  +G I W HSTS DLVNW  H  A+ PSQP+ DING WSGSATILP+  P +
Sbjct  81    YQYNPKGVVWGNIVWAHSTSTDLVNWTPHDAAIFPSQPS-DINGCWSGSATILPSGKPVI  139

Query  1478  LYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRG  1299
             LYTG++ +N+QVQNLA P+N SDP+L+EWVK P+NPL+AP   N INA+SFRDPTTAW G
Sbjct  140   LYTGINPQNQQVQNLAYPKNLSDPFLREWVKVPQNPLMAPTQANHINASSFRDPTTAWLG  199

Query  1298  PDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPN  1122
             PD  WR+++GSK  +RGLAILYRSKDF+ WV+AKHPLHS + +GMWECPDF+PVS    N
Sbjct  200   PDKRWRVIIGSKQNQRGLAILYRSKDFLSWVKAKHPLHSAKKTGMWECPDFFPVSIHGQN  259

Query  1121  GLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             GLD+S  G  +KHVLK SLD ++H+YYTIGTY+  +D YIPDKGSV++DSGLRYDYGKFY
Sbjct  260   GLDSSENGPAVKHVLKASLDNTKHEYYTIGTYNIDKDIYIPDKGSVESDSGLRYDYGKFY  319

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTF+DS K RRILWGWINES      +K+GWSG+Q IPRT+WL K+ KQLVQWPVQE+
Sbjct  320   ASKTFFDSSKNRRILWGWINESSSVEGDIKKGWSGLQAIPRTLWLAKSGKQLVQWPVQEI  379

Query  761   EKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
             EKLR   V++PST+LK GSV EV G++AAQAD+E+TF I +F KAE ++  W TDPQ+LC
Sbjct  380   EKLRGKTVKLPSTVLKGGSVREVVGVTAAQADVEITFGISDFKKAEVLDPSW-TDPQLLC  438

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD  402
              QK A+V+G +GPFGL VLAS++ +EYTAVF+R+F  NN   VVL+CSDQ+RSSL+K  D
Sbjct  439   GQKSATVKGSLGPFGLYVLASKDLKEYTAVFYRIFKANNKY-VVLLCSDQSRSSLNKDND  497

Query  401   KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNN  222
             KT+YGAFV V+P++E+LSLR LIDHSIVESFG +GK CIT+RVYPT AI + AHLYAFN 
Sbjct  498   KTTYGAFVKVDPLREKLSLRNLIDHSIVESFGGEGKACITARVYPTLAIDDDAHLYAFNY  557

Query  221   GVHSIKLSKLTAWSMKKPTIN  159
             G   +K++  +AWS+K   IN
Sbjct  558   GTEDVKITG-SAWSLKTAKIN  577



>ref|XP_008227859.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Prunus mume]
Length=577

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/560 (63%), Positives = 442/560 (79%), Gaps = 11/560 (2%)
 Frame = -1

Query  1817  ETQASHIVLQNLEALQPPYPNH------TYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFY  1656
             + +ASH V +NL        +H       YRT +HFQPP+NW+NDPNGP++YKG+YHFFY
Sbjct  22    QLEASHQVYRNLPTYSQLTSSHHHPVNEPYRTGYHFQPPKNWINDPNGPLIYKGIYHFFY  81

Query  1655  QYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALL  1476
             QYNP    +G I W HSTS DLVNW  H  A+ PSQP+ DING WSGSATILP   P +L
Sbjct  82    QYNPLDVVWGNIVWAHSTSTDLVNWTPHDAAIYPSQPS-DINGCWSGSATILPGGKPVML  140

Query  1475  YTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP  1296
             YTG+DS+NRQVQNLA P+N SDP+L+EW K P+NPL+AP+  N+INA+SFRDPTTAW GP
Sbjct  141   YTGIDSQNRQVQNLAYPKNLSDPFLREWTKIPQNPLMAPSQANQINASSFRDPTTAWLGP  200

Query  1295  DGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNG  1119
             D  WR+++G K  + G AILYRSKDF+ WV+AK PLHS E +GMWECPDF+PVS  S NG
Sbjct  201   DKKWRVIIGGKTNQTGEAILYRSKDFLNWVKAKQPLHSAEKTGMWECPDFFPVSIHSQNG  260

Query  1118  LDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             LDTS +G  +KHV K+SLD +R +YYTIGTY+  +D YIPDKGSV++DSGLRYDYGKFYA
Sbjct  261   LDTSKIGPDVKHVFKVSLDNTRREYYTIGTYNIDKDIYIPDKGSVESDSGLRYDYGKFYA  320

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKTF+DS K RRILWGWINES    + +K+GWSG+Q IPRT+WLDK+ KQLVQWP  E+E
Sbjct  321   SKTFFDSSKNRRILWGWINESSTVEDDIKKGWSGLQAIPRTLWLDKSGKQLVQWPAVEIE  380

Query  758   KLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCS  579
             KLR  +V++PS++LK GSV EV G++AAQAD+E+TF I +  KAE ++  W T+PQ+LCS
Sbjct  381   KLREKEVKLPSSVLKGGSVHEVLGVTAAQADVEITFGISDLKKAEVLDPSW-TNPQLLCS  439

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDK  399
             QKGASV+GG+GPFGL VLAS+  +EYT+VF+R+F+ +N + VVL+CSDQ+RSSL K  DK
Sbjct  440   QKGASVKGGLGPFGLLVLASKGLKEYTSVFYRIFIDHNKH-VVLLCSDQSRSSLKKDNDK  498

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
             T+YGAFV+V+P+ E+LSLR LIDHSIVESFG +GK CIT+RVYPT AI   AHLYAFN G
Sbjct  499   TTYGAFVNVDPLHEKLSLRSLIDHSIVESFGGEGKACITARVYPTLAINGDAHLYAFNYG  558

Query  218   VHSIKLSKLTAWSMKKPTIN  159
                +K++  +AWS+K   IN
Sbjct  559   TEDVKITG-SAWSLKTAKIN  577



>ref|XP_008228278.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Prunus mume]
Length=575

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/556 (64%), Positives = 439/556 (79%), Gaps = 8/556 (1%)
 Frame = -1

Query  1811  QASHIVLQNLEALQPPYPNHT----YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             QASH V +NL+       +H     YRT +HFQPP+NW+NDPNGP++YKG+YH FYQYNP
Sbjct  23    QASHHVYRNLQTSLVADSHHQVKEPYRTGYHFQPPKNWINDPNGPLIYKGIYHLFYQYNP  82

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
             KGA +G I W HSTS DLVNW  H  A+ PSQP+ DING WSGSATILP   P +LYTG+
Sbjct  83    KGAVWGNIVWAHSTSTDLVNWTPHDAAIYPSQPS-DINGCWSGSATILPGGKPVILYTGI  141

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             + +N+QVQNLA P+N SDPYL+EW K P+NPL+AP   N+INA+SFRDPTTAW GPD  W
Sbjct  142   NPQNQQVQNLAYPKNLSDPYLREWTKVPQNPLMAPTQANQINASSFRDPTTAWLGPDKRW  201

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTS  1107
             R+++GSK  + G AILYRSKDF+ WV+AKHPLHS + +GMWECPDFYPVS    NGL TS
Sbjct  202   RVIIGSKRDQTGFAILYRSKDFLNWVKAKHPLHSAKKTGMWECPDFYPVSIKGQNGLHTS  261

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
               G  +KHVLK SLD ++ +YYTIGTY+  +D YIPDKGSV++D+GLRYDYGKFYASKTF
Sbjct  262   ENGPDVKHVLKASLDNTKREYYTIGTYNIHKDIYIPDKGSVESDAGLRYDYGKFYASKTF  321

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +DS K RRILWGWINES    + +K+GWSG+Q IPR +WLDK+ KQLVQWPV E+EKLR 
Sbjct  322   FDSSKNRRILWGWINESSSVEDDIKKGWSGIQAIPRKIWLDKSGKQLVQWPVAEIEKLRE  381

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
               V++PS++LK GSV EV G++AAQAD+ +TF+I +F KAE ++  W TDPQ+LCSQK A
Sbjct  382   KGVKLPSSVLKGGSVHEVLGVTAAQADVAITFEISDFKKAEVLDPSW-TDPQLLCSQKNA  440

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
             SV+GG+GPFGL VLAS+  +EYTAVF+R+F G+NN  VVL+CSDQ+RSSL++  DKT+YG
Sbjct  441   SVKGGLGPFGLLVLASKGLKEYTAVFYRIFKGHNNKYVVLLCSDQSRSSLNQDNDKTTYG  500

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
             AF+ V+P+ E+LSLR LIDHS+VESF  +GK CIT+RVYPT AI   AHLYAFN G   +
Sbjct  501   AFLKVDPLHEKLSLRSLIDHSVVESFAGQGKACITARVYPTLAIDVDAHLYAFNYGTDDV  560

Query  206   KLSKLTAWSMKKPTIN  159
             K++  +AWS+K   IN
Sbjct  561   KITG-SAWSLKTAEIN  575



>emb|CBI35961.3| unnamed protein product [Vitis vinifera]
Length=574

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/560 (64%), Positives = 438/560 (78%), Gaps = 7/560 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPY--PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFY  1656
             +G V  +ASH V  +L+   P     +  YRT +HFQP +NWMN    PM+YKG+YHFFY
Sbjct  19    HGFVPLEASHQVYIHLQNQSPSSLKTHQPYRTGYHFQPRKNWMNGI-WPMIYKGLYHFFY  77

Query  1655  QYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALL  1476
             QYNP GA +G I W HSTS DLVNW  H  A+SPSQPA DING WSGSATILPN  P +L
Sbjct  78    QYNPHGAVWGNIVWAHSTSTDLVNWTPHKYAISPSQPA-DINGCWSGSATILPNGKPVIL  136

Query  1475  YTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP  1296
             YTG+D +N+QVQN+AVP+N SDP+L EW K P+NPL+ P   N INA+SFRDPTTAW+G 
Sbjct  137   YTGIDPQNKQVQNMAVPKNLSDPFLLEWTKLPQNPLMEPTTINSINASSFRDPTTAWQGT  196

Query  1295  DGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNG  1119
             DG WR+++GSK+ R+GLAILYRSKDFVRW +A+HPLHSG+ +GMWECPDF+PVS  S  G
Sbjct  197   DGRWRVIIGSKIKRKGLAILYRSKDFVRWTKAQHPLHSGKNTGMWECPDFFPVSINSSTG  256

Query  1118  LDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             +DTS +   +K+VLK+SLD+++HDYYTIG+Y+  +D Y+PDKGSVDNDSGLRYDYGKFYA
Sbjct  257   VDTSSISKTLKYVLKLSLDDTKHDYYTIGSYNREKDTYVPDKGSVDNDSGLRYDYGKFYA  316

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKTF+D+ K RRILWGWINES      +++GWSGVQ IPR VWLDK+ KQL+QWP+ E+E
Sbjct  317   SKTFFDNAKNRRILWGWINESSSVEHDIEKGWSGVQAIPRNVWLDKSGKQLLQWPIAEIE  376

Query  758   KLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCS  579
             K R     M S  LK GS  EV GI+A+QAD+E++FKI +F KAE  +E W ++PQ+LCS
Sbjct  377   KQRIKPGHMSSRELKGGSKVEVGGITASQADVEISFKISDFKKAEVFDESW-SNPQLLCS  435

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDK  399
             Q+GASV+GG+GPFGL VLAS+  +EYTAVFFR+F       VVLMCSDQ+RSSLD   DK
Sbjct  436   QRGASVKGGLGPFGLMVLASKGMEEYTAVFFRIFK-RQTKYVVLMCSDQSRSSLDNDNDK  494

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
             T+YGAF+DV+P+ E+LSLR LIDHSIVESFG  GKVCIT+RVYPT AI  +AHLYAFN G
Sbjct  495   TTYGAFLDVDPVHEKLSLRSLIDHSIVESFGGGGKVCITARVYPTLAIDGEAHLYAFNKG  554

Query  218   VHSIKLSKLTAWSMKKPTIN  159
               S+ ++ L AWSMKK  IN
Sbjct  555   TGSVGMTTLRAWSMKKAKIN  574



>ref|XP_007221470.1| hypothetical protein PRUPE_ppa003412mg [Prunus persica]
 gb|AFI57904.1| cell wall invertase 1 [Prunus persica]
 gb|EMJ22669.1| hypothetical protein PRUPE_ppa003412mg [Prunus persica]
Length=577

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/560 (63%), Positives = 442/560 (79%), Gaps = 11/560 (2%)
 Frame = -1

Query  1817  ETQASHIVLQNLEALQPPYPNH------TYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFY  1656
             + +ASH V +NL        +H       YRT +HFQPP+NW+NDPNGP++YKG+YHFFY
Sbjct  22    QLEASHQVYRNLPTYSQLTSSHHHPVNEPYRTGYHFQPPKNWINDPNGPLIYKGIYHFFY  81

Query  1655  QYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALL  1476
             QYNP    +G I W HSTS DLVNW  H  A+ PSQP+ DING WSGSATILP   P +L
Sbjct  82    QYNPLDVVWGNIVWAHSTSTDLVNWTPHDAAIYPSQPS-DINGCWSGSATILPGGKPVML  140

Query  1475  YTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP  1296
             YTG+D +NRQVQNLA P+N SDP+L+EW K P+NPL+AP+  N+INA+SFRDPTTAW GP
Sbjct  141   YTGIDPQNRQVQNLAYPKNLSDPFLREWAKIPQNPLMAPSQANQINASSFRDPTTAWLGP  200

Query  1295  DGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNG  1119
             D  WR+++G K  + G AILYRSKDF+ WV+AK PLHS E +GMWECPDF+PVS  S NG
Sbjct  201   DKKWRVIIGGKTNQTGEAILYRSKDFLNWVKAKQPLHSAEKTGMWECPDFFPVSIHSQNG  260

Query  1118  LDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             LDTS +G  +KHV K+SLD +R +YYTIGTY+  +D YIPDKGSV++DSGLRYDYGKFYA
Sbjct  261   LDTSKIGPDVKHVFKVSLDNTRREYYTIGTYNIDKDIYIPDKGSVESDSGLRYDYGKFYA  320

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKTF+DS K RRILWGWINES    + +K+GWSG+Q IPRT+WLDK+ KQLVQWPV E+E
Sbjct  321   SKTFFDSSKNRRILWGWINESSTVEDDIKKGWSGLQAIPRTLWLDKSGKQLVQWPVVEIE  380

Query  758   KLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCS  579
             KLR  +V++PS++LK GSV EV G++AAQAD+E+TF I +  KAE ++  W T+PQ+LCS
Sbjct  381   KLREKEVKLPSSVLKGGSVHEVLGVTAAQADVEITFGISDLKKAEVLDPSW-TNPQLLCS  439

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDK  399
             +KGASV+GG+GPFGL VLAS+  +EYT+VF+R+F  +N + VVL+CSDQ+RSSL+K  DK
Sbjct  440   RKGASVKGGLGPFGLLVLASKGLKEYTSVFYRIFKDHNKH-VVLLCSDQSRSSLNKDNDK  498

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
             T+YGAFV+V+P+ E+LSLR L++HSIVESFG +GK CIT+RVYPT AI   AHLYAFN G
Sbjct  499   TTYGAFVNVDPLHEKLSLRSLVNHSIVESFGGEGKACITARVYPTLAINGDAHLYAFNYG  558

Query  218   VHSIKLSKLTAWSMKKPTIN  159
                +K++  +AWS+K   IN
Sbjct  559   TEDVKITG-SAWSLKTAKIN  577



>ref|XP_010262081.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1 
[Nelumbo nucifera]
Length=575

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/557 (63%), Positives = 440/557 (79%), Gaps = 12/557 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQP--PYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPK  1641
              +ASH +  +L+++Q      +  YRT++HFQPP+NWMNDPNGPM+YKG+YH FYQYNP 
Sbjct  24    AEASHPIYMHLQSVQSTSAVDHQPYRTAYHFQPPQNWMNDPNGPMIYKGIYHLFYQYNPF  83

Query  1640  GASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVD  1461
             GA +G I W HSTS DLVNW  H PA+ PS+P  DI G WSGSAT LP   PA+LYTG+D
Sbjct  84    GAVWGNIVWAHSTSTDLVNWVRHDPAIYPSEPF-DIKGCWSGSATFLPGGKPAILYTGID  142

Query  1460  SRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
              +NRQVQNLA P+N SDP L+EW+K  +NPL+AP   N INA+SFRDPTT WRG DG WR
Sbjct  143   PQNRQVQNLAFPKNLSDPLLREWIKLAQNPLMAP--INGINASSFRDPTTGWRGADGRWR  200

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPNG---LDT  1110
             +++GSK  RRG+AILYRSKDF+ W +++HPLHS + +GMWECPDF+PVS  PNG   LDT
Sbjct  201   VIIGSKRRRRGMAILYRSKDFIHWTKSQHPLHSSDNTGMWECPDFFPVS--PNGKMGLDT  258

Query  1109  SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKT  930
             S++   +KHVLK+SLD+++H+YYTIGTYD  +D+Y PD GSVDN SGLRYDYGKFYASKT
Sbjct  259   SVINPGVKHVLKVSLDDTKHEYYTIGTYDPAKDQYSPDPGSVDNGSGLRYDYGKFYASKT  318

Query  929   FYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR  750
             F+D  K+RRILWGWINES    + V++GWSG+Q IPR +WLD + KQLVQWP+ E+E+LR
Sbjct  319   FFDDSKKRRILWGWINESSSVADDVEKGWSGLQAIPRLLWLDSSGKQLVQWPIVEIEQLR  378

Query  749   SNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKG  570
              ++V + +  +K GSV EVSGI+A+QAD+EV+F + +  KAE M   W  +PQ+LCS+KG
Sbjct  379   GDQVNLANKEIKGGSVLEVSGITASQADIEVSFDLSKLEKAEVMNPSW-VNPQLLCSKKG  437

Query  569   ASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSY  390
             ASV+GGIGPFGL VLAS++ +E TA+FFRVF  +    VVLMCSDQ+RSSL K  DKTSY
Sbjct  438   ASVKGGIGPFGLLVLASKDMKEQTAIFFRVFK-DGKRYVVLMCSDQSRSSLGKDIDKTSY  496

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
             GAFVDV+P+ E+LSLR LIDHSIVESFG +GK CIT+RVYP  AIG  AHL+AFNNG  S
Sbjct  497   GAFVDVDPLHEKLSLRTLIDHSIVESFGGQGKACITARVYPKLAIGNGAHLFAFNNGAES  556

Query  209   IKLSKLTAWSMKKPTIN  159
             +K++ L+AWSMK+  IN
Sbjct  557   VKIASLSAWSMKRAHIN  573



>gb|KGN45520.1| hypothetical protein Csa_7G450770 [Cucumis sativus]
Length=578

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/563 (62%), Positives = 445/563 (79%), Gaps = 8/563 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNH---TYRTSFHFQPPRNWMNDPNGPMVYKGVYHFF  1659
             +G  + QASH V +   +   PY  H    YRTS+HFQPP+NW+NDPNGPM+YKG+YH F
Sbjct  18    HGVFQLQASHHVHKPQTSTSLPYHYHHRQPYRTSYHFQPPKNWINDPNGPMIYKGIYHLF  77

Query  1658  YQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPAL  1479
             YQYNPKGA +G I W HSTS DL+NW  H  A+ PSQP+ DING WSGSATILP   PA+
Sbjct  78    YQYNPKGAVWGNIVWAHSTSTDLINWEPHDHAIFPSQPS-DINGCWSGSATILPGEKPAI  136

Query  1478  LYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRG  1299
             LYTG++ +N+QVQNLAVP+N SDPYL+EWVKSP+NPL+AP   N+INA+SFRDPTTAW G
Sbjct  137   LYTGINPKNQQVQNLAVPKNLSDPYLREWVKSPKNPLMAPTPQNQINASSFRDPTTAWLG  196

Query  1298  PDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPN  1122
             P+G WR++VG+KV  RGLA++++SKDF++W Q  HPLH  +GSGMWECPDFYPV+ T   
Sbjct  197   PNGEWRVIVGNKVHTRGLALMFQSKDFIKWDQVDHPLHYADGSGMWECPDFYPVAKTGRR  256

Query  1121  GLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             G+DT++ G  +KHVLK+SLD++RHD YTIGTYD  +D Y+P+KGS++  SGLRYDYGK+Y
Sbjct  257   GVDTTVNGKNVKHVLKVSLDDTRHDVYTIGTYDVEKDIYVPNKGSIEGYSGLRYDYGKYY  316

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTFYD  K+RR+LWGW+NES    + +K+GWSG+QGIPRT+WLD + KQL+QWP++E+
Sbjct  317   ASKTFYDGQKKRRVLWGWVNESSSVEDDIKKGWSGIQGIPRTIWLDASGKQLIQWPIEEI  376

Query  761   EKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
             +KLR NKV + + +LKKGS  EV G++ +QAD+EV+FK+    KA+ ++ ++  +PQVLC
Sbjct  377   QKLRKNKVTLTNKVLKKGSTIEVKGVTPSQADVEVSFKVKNLKKAQILKPQYWENPQVLC  436

Query  581   SQKG--ASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKK  408
             SQKG  A+ +GG+GPFGL VLAS + +EYT+V F +F    +  V LMCSDQ+RSSL+  
Sbjct  437   SQKGRAATTKGGVGPFGLLVLASNDFKEYTSVSFTIFK-KQSKYVALMCSDQSRSSLNPT  495

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
              DKT+YGAF+DV+   E+LSLR LIDHS+VESFG KGK CIT+RVYPT AIG+   LYAF
Sbjct  496   NDKTTYGAFLDVDVDSEDLSLRSLIDHSVVESFGLKGKGCITARVYPTLAIGDNVGLYAF  555

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             NNG  S+ ++KLTAWSMKK  IN
Sbjct  556   NNGTESVTITKLTAWSMKKARIN  578



>ref|XP_002521398.1| Beta-fructofuranosidase, cell wall isozyme precursor, putative 
[Ricinus communis]
 gb|EEF41066.1| Beta-fructofuranosidase, cell wall isozyme precursor, putative 
[Ricinus communis]
Length=514

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/515 (67%), Positives = 421/515 (82%), Gaps = 4/515 (1%)
 Frame = -1

Query  1697  NGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWS  1518
             NGPM+YKG+YH FYQYNPKGA +G I WGHSTSKDLVNW  H PA+ PSQ  ADINGAWS
Sbjct  2     NGPMIYKGIYHLFYQYNPKGAVWGNIVWGHSTSKDLVNWTPHEPAIYPSQ-QADINGAWS  60

Query  1517  GSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKIN  1338
             GSATILP   PA+LYTG+D  N+QVQNLA+P+NPSDPYL EWVKSP NPL+AP   N+IN
Sbjct  61    GSATILPGGTPAILYTGIDPLNQQVQNLALPKNPSDPYLIEWVKSPENPLMAPTSQNQIN  120

Query  1337  ATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWE  1158
             A+SFRDPTTAW+G DGNWR+++GSK+  +GLAILY SK+FV WV+AKHP+HS EG+GMWE
Sbjct  121   ASSFRDPTTAWKGLDGNWRVVIGSKINTKGLAILYTSKNFVNWVKAKHPIHSAEGTGMWE  180

Query  1157  CPDFYPVSTSPN-GLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVD  981
             CPDFYPV+ + N G+D S +G  IK+VLK+SLD ++HDYYTIG YDHV+D Y PD GS+D
Sbjct  181   CPDFYPVAINKNTGVDLSNLGPGIKYVLKVSLDNTKHDYYTIGQYDHVQDVYTPDTGSID  240

Query  980   NDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDK  801
              D GLRYDYGKFYASKTF+DS + RRILWGW+NES    + +K+GW+G+QG+PR + LDK
Sbjct  241   GDGGLRYDYGKFYASKTFFDSAENRRILWGWLNESSSVDDDMKKGWAGIQGVPRVILLDK  300

Query  800   TRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEK  621
             +RKQLVQWP++E+EKLR N V +   +LK GS+ EVSG++AAQAD+E++FKI    KAE 
Sbjct  301   SRKQLVQWPIKEIEKLRVNPVHLHRKVLKGGSLLEVSGVTAAQADVEISFKIANIEKAEV  360

Query  620   MEERWT-TDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLM  444
             + +  T  +PQ+LCSQKGASV+G +GPFGL + AS+  QEYT+VFFR+F   N   VVLM
Sbjct  361   LNQDVTQMNPQMLCSQKGASVKGSLGPFGLHLFASKGMQEYTSVFFRIFKVQNKY-VVLM  419

Query  443   CSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPT  264
             CSDQ+RSSL+  TDKT+YGAF+ V+P+ EELSLR LIDHSIVESFG KGK CI++RVYP 
Sbjct  420   CSDQSRSSLNPTTDKTTYGAFLAVDPLHEELSLRCLIDHSIVESFGGKGKSCISARVYPK  479

Query  263   KAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
              AI E AHLYAFNNG  S+ +++L+AWSMKK  IN
Sbjct  480   LAINEAAHLYAFNNGSQSVTITRLSAWSMKKAKIN  514



>ref|XP_007215309.1| hypothetical protein PRUPE_ppa003470mg [Prunus persica]
 gb|EMJ16508.1| hypothetical protein PRUPE_ppa003470mg [Prunus persica]
Length=572

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/556 (63%), Positives = 435/556 (78%), Gaps = 11/556 (2%)
 Frame = -1

Query  1811  QASHIVLQNLEALQPPYPNHT----YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             QASH V +NL+       +H     YRT +HFQPP+NW+N   GP+++KG+YH FYQYNP
Sbjct  23    QASHHVYRNLQTSLVADSHHQVKEPYRTGYHFQPPKNWIN---GPLIFKGIYHLFYQYNP  79

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
             +G  +G I W HSTS DLVNW  H  A+ PSQP+ DING WSGSATILP   P +LYTG+
Sbjct  80    EGVVWGNIVWAHSTSTDLVNWTPHDAAIYPSQPS-DINGCWSGSATILPGGKPVILYTGI  138

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             + +N QVQNLA P+N SDPYL+EW K P+NPL+AP   N+INA+SFRDPTTAW GPD  W
Sbjct  139   NPQNEQVQNLAYPKNLSDPYLREWTKVPQNPLMAPTQANQINASSFRDPTTAWLGPDKRW  198

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTS  1107
             R+++GSK  + G AILYRSKDF+ WV+AKHPLHS + +GMWECPDFYPVS    NGL TS
Sbjct  199   RVIIGSKRDQTGFAILYRSKDFLNWVKAKHPLHSAKKTGMWECPDFYPVSIKGQNGLHTS  258

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
               G  +KHVLK SLD ++ +YYTIGTY+  +D YIPDKGSV++D+GLRYDYGKFYASKTF
Sbjct  259   ENGPDVKHVLKASLDNTKREYYTIGTYNIHKDIYIPDKGSVESDAGLRYDYGKFYASKTF  318

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +DS K RRILWGWINES    +  K+GWSG+Q IPR +WLDK+ KQLVQWPV E+EKLR 
Sbjct  319   FDSSKNRRILWGWINESSSVEDDTKKGWSGIQAIPRKIWLDKSGKQLVQWPVAEIEKLRE  378

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
              +V++PS+ LK GSV EV G++AAQAD+++TF+I +F KAE ++  W TDPQ+LCSQKGA
Sbjct  379   KEVKLPSSALKGGSVHEVLGVTAAQADVDITFEISDFKKAEVLDPSW-TDPQLLCSQKGA  437

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
             SV+GG+GPFGL VLAS+  +EYTAVF+R+F G+NN  VVL+CSDQ+RSSL++  DKT+YG
Sbjct  438   SVKGGLGPFGLLVLASKGLKEYTAVFYRIFKGHNNKYVVLLCSDQSRSSLNQDNDKTTYG  497

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
             AF+ V+P+ E+LSLR LIDHSIVESF  +GK CIT+RVYPT AI   AHLYAFN G   +
Sbjct  498   AFLKVDPLHEKLSLRSLIDHSIVESFAGQGKACITARVYPTLAIDVDAHLYAFNYGTEDV  557

Query  206   KLSKLTAWSMKKPTIN  159
             K++  +AWS+K   IN
Sbjct  558   KITG-SAWSLKTAEIN  572



>gb|KCW69765.1| hypothetical protein EUGRSUZ_F03137 [Eucalyptus grandis]
Length=578

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/565 (61%), Positives = 440/565 (78%), Gaps = 19/565 (3%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLE-------ALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGV  1671
             +G +   AS  V +NL+       A+QP      YRTS+HFQPP NWMNDPNGPM+YKG+
Sbjct  25    HGVLHVGASRSVHRNLQTTAESTSAMQP------YRTSYHFQPPNNWMNDPNGPMIYKGI  78

Query  1670  YHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNN  1491
             YH FYQYNPKGA +G I W HSTS DLVNW  H+PA+ PS+   D+NG WSGSATIL  +
Sbjct  79    YHLFYQYNPKGAIWGNIVWAHSTSTDLVNWTPHVPAIVPSE-EYDVNGCWSGSATILQEH  137

Query  1490  MPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTT  1311
              PA+LYTGV+ +N+QVQNLAVP+N SDPYL EWVKSP+NPL+ P   N I+  SFRDPTT
Sbjct  138   KPAILYTGVNRQNQQVQNLAVPKNLSDPYLIEWVKSPQNPLMEPTAMNMISPDSFRDPTT  197

Query  1310  AWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST  1131
             AW GPDG WR+++GS+  R G+AILYRS+DFV W +A HPL+S   +GMWECPDF+PVS 
Sbjct  198   AWVGPDGGWRVIIGSRSNRTGMAILYRSEDFVNWTKAGHPLYSANDTGMWECPDFFPVSA  257

Query  1130  -SPNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDY  954
              +P GLDTS+ G  +KHVLK+S   S+ DYYTIGTY+ + + Y+P +GSVD++SGLRYDY
Sbjct  258   QAPVGLDTSINGPNVKHVLKVSY--SQQDYYTIGTYNSITNTYVPVEGSVDSNSGLRYDY  315

Query  953   GKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWP  774
             GK+YASKTF+DS   RRILW WI ES  + + + +GWSG+Q IPRT+WLDK+ KQLVQWP
Sbjct  316   GKYYASKTFFDSKNNRRILWAWIKESSSEDDDINKGWSGIQAIPRTLWLDKSGKQLVQWP  375

Query  773   VQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDP  594
             + E+EKLR+N+V++P+ +++ G++ EVSGI+AAQAD+ V+FK+ E  +A+ ++  W TDP
Sbjct  376   ILEIEKLRTNQVDLPNQLIEGGAILEVSGITAAQADVVVSFKVKELERADSLDPTW-TDP  434

Query  593   QVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLD  414
             Q+LCS+KGA V+G +GPFGL V+AS+  QEYTAVFFR+F G N   VVLMCSDQ+RSSL+
Sbjct  435   QMLCSRKGALVKGSLGPFGLLVMASKGLQEYTAVFFRIFKGQNKY-VVLMCSDQSRSSLN  493

Query  413   KKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLY  234
                DKT+YGAF+DV+P+QE+LSLR LIDHSIVESFG  GK CIT+RVYP  A+ +  HL+
Sbjct  494   HSNDKTTYGAFLDVDPLQEKLSLRTLIDHSIVESFGGGGKSCITARVYPLLAVEDGTHLH  553

Query  233   AFNNGVHSIKLSKLTAWSMKKPTIN  159
              FNNG  S+ + KL+AWSMKK  IN
Sbjct  554   IFNNGNQSVGVPKLSAWSMKKARIN  578



>ref|XP_006466030.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Citrus sinensis]
Length=580

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/565 (61%), Positives = 436/565 (77%), Gaps = 10/565 (2%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPP------YPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVY  1668
             +G VE +A+H +   L+  Q        Y    YRT +HFQPP +W+NDPNGPM+YKG+Y
Sbjct  18    HGIVELEATHHIYSRLQTPQNETKTPWDYRFQPYRTGYHFQPPWHWINDPNGPMIYKGIY  77

Query  1667  HFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNM  1488
             H FYQYNPKGA +G I W HSTS+DL+NW  H P + PSQ  +D+NG WSGSATILP   
Sbjct  78    HLFYQYNPKGAVWGNIVWAHSTSRDLINWFPHPPTIFPSQ-KSDVNGCWSGSATILPGEK  136

Query  1487  PALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTA  1308
             P +LYTG+D   +QVQN+A P++ SDPYL+EWVKS +NPL+AP++ N INA+SFRDPTTA
Sbjct  137   PVILYTGIDPDKKQVQNIAYPKDLSDPYLKEWVKSDKNPLMAPDNVNNINASSFRDPTTA  196

Query  1307  WRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-  1131
             W+GPD  WR+ +GSK+   G AILY+SKDF+ WV+AK PLH+   +GMWEC DFYPV+T 
Sbjct  197   WQGPDNIWRVAIGSKINDLGFAILYKSKDFLNWVKAKRPLHATRHTGMWECVDFYPVATN  256

Query  1130  SPNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYG  951
             S  GLDTS +G  +KHVLKISLD+++HDYYTIG+Y++  DKY PDKG +D D+GL+YDYG
Sbjct  257   SQCGLDTSTLGPNVKHVLKISLDDTKHDYYTIGSYNYTTDKYTPDKGLIDGDAGLKYDYG  316

Query  950   KFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPV  771
             KFYASKTF+DS K RRILWGWINES    + +K+GW+GVQ IPR ++LD + KQLVQWPV
Sbjct  317   KFYASKTFFDSAKNRRILWGWINESQSVADDIKKGWAGVQAIPRNIYLDGSGKQLVQWPV  376

Query  770   QELEKLRSN-KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDP  594
              ELE+LRS+  V +    L+ G + EV+G++AAQAD+E+TF+I +  KAE+   RW T  
Sbjct  377   SELEQLRSSPPVNVFDKRLEAGELHEVTGVTAAQADVEITFEITDISKAEEYRPRW-THA  435

Query  593   QVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLD  414
             Q LC+ K ASVRGG+GPFGL+VLAS + QEYT+VFFRVF   +N PVVLMCSDQ+RSSL+
Sbjct  436   QWLCNTKNASVRGGLGPFGLRVLASSDSQEYTSVFFRVFKKADNKPVVLMCSDQSRSSLN  495

Query  413   KKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLY  234
             +  DKT+YGAFVDV+P++E+LSLR LIDHSIVESFG  G+ CIT+RVYP  AI +KA LY
Sbjct  496   EDNDKTTYGAFVDVDPIKEKLSLRSLIDHSIVESFGGSGRACITARVYPITAIEDKARLY  555

Query  233   AFNNGVHSIKLSKLTAWSMKKPTIN  159
             AFNN    + +S L+AWSMKK  I+
Sbjct  556   AFNNATEGVTISTLSAWSMKKAQIS  580



>ref|XP_006426548.1| hypothetical protein CICLE_v10025243mg [Citrus clementina]
 gb|ESR39788.1| hypothetical protein CICLE_v10025243mg [Citrus clementina]
Length=580

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/565 (61%), Positives = 437/565 (77%), Gaps = 10/565 (2%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPP------YPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVY  1668
             +G VE +A+H +   L+  Q        Y    YRT +HFQPP +W+NDPNGPM+YKG+Y
Sbjct  18    HGIVELEATHHIYSRLQTPQNETKTPWDYRFQPYRTGYHFQPPWHWINDPNGPMIYKGIY  77

Query  1667  HFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNM  1488
             H FYQYNPKGA +G I W HSTS+DL+NW  H PA+ PSQ  +D+NG WSGSATILP   
Sbjct  78    HLFYQYNPKGAVWGNIVWAHSTSRDLINWFPHPPAIFPSQ-KSDVNGCWSGSATILPGEK  136

Query  1487  PALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTA  1308
             P +LYTG+D   +QVQN+A P++ SDPYL+EWVKS +NPL+AP++ N INA+SFRDPTTA
Sbjct  137   PVILYTGIDPDKKQVQNIAYPKDLSDPYLKEWVKSDKNPLMAPDNVNNINASSFRDPTTA  196

Query  1307  WRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-T  1131
             W+GPD  WR+ +GSK+   G AILY+SKDF+ WV+AK PLH+   +GMWEC DFYPV+  
Sbjct  197   WQGPDNIWRVAIGSKINDLGFAILYKSKDFLNWVKAKRPLHAARHTGMWECVDFYPVAPN  256

Query  1130  SPNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYG  951
             S  GLDTS +G  +KHVLKISLD+++HDYYTIG+Y++  DKY PDKG +D D+GL+YDYG
Sbjct  257   SHCGLDTSTLGPNVKHVLKISLDDTKHDYYTIGSYNYTTDKYTPDKGLIDGDAGLKYDYG  316

Query  950   KFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPV  771
             KFYASKTF+DS K RRILWGWINES    + +K+GW+GVQ IPR ++LD + KQLVQWPV
Sbjct  317   KFYASKTFFDSAKSRRILWGWINESQSVADDIKKGWAGVQAIPRNIYLDGSGKQLVQWPV  376

Query  770   QELEKLRSN-KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDP  594
              ELE+LRS+  + +    L+ G + EV+G++AAQAD+E+TF+I +  KAE+   RW T  
Sbjct  377   SELEQLRSSPPINVFDKRLEAGELHEVTGVTAAQADVEITFEITDISKAEEYRPRW-THA  435

Query  593   QVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLD  414
             Q LC+ K ASVRGG+GPFGL+VLAS + QEYT+VFFRVF   +N PVVLMCSDQ+RSSL+
Sbjct  436   QWLCNTKNASVRGGLGPFGLRVLASSDSQEYTSVFFRVFKKADNKPVVLMCSDQSRSSLN  495

Query  413   KKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLY  234
             +  DKT+YGAFVDV+P++++LSLR LIDHSIVESFG  G+ CIT+RVYP  AI +KA LY
Sbjct  496   EDNDKTTYGAFVDVDPIKDKLSLRSLIDHSIVESFGGSGRACITARVYPITAIEDKARLY  555

Query  233   AFNNGVHSIKLSKLTAWSMKKPTIN  159
             AFNN   ++ +S L+AWSMKK  I+
Sbjct  556   AFNNATEAVTISTLSAWSMKKAQIS  580



>ref|XP_003546695.1| PREDICTED: beta-fructofuranosidase, cell wall isozyme-like isoform 
1 [Glycine max]
 gb|KHN32695.1| Beta-fructofuranosidase, cell wall isozyme [Glycine soja]
Length=575

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/560 (61%), Positives = 435/560 (78%), Gaps = 8/560 (1%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             G +  +A+H V +NL+ L     +  YRT++HFQPP+NW+NDPNGPM YKG+YH FYQYN
Sbjct  20    GILPIEATHHVYRNLQTLSSDSSDQPYRTAYHFQPPKNWINDPNGPMRYKGLYHLFYQYN  79

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKDLVNW     A+ PSQP+ DING WSGSATILP   PA+LYTG
Sbjct  80    PKGAVWGNIVWAHSVSKDLVNWTPLDHAIYPSQPS-DINGCWSGSATILPGGKPAILYTG  138

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             +D  N QVQNLA+P+N SDP L+EWVKSP+NPL+AP   N IN++SFRDPTTAW G DG 
Sbjct  139   IDPNNHQVQNLALPKNMSDPLLREWVKSPKNPLMAPTSANMINSSSFRDPTTAWLGKDGY  198

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV----STSPNG  1119
             WR+L+GSK+  RG+AILY+SK+FV WVQAK PLHS EG+GMWECPDFYPV     +S  G
Sbjct  199   WRVLIGSKIHTRGMAILYKSKNFVNWVQAKQPLHSAEGTGMWECPDFYPVLNNKPSSTIG  258

Query  1118  LDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             LDTS+ G  ++HVLK+SLD+ +HD+Y IGTYD  +D + PD G  D+ + LRYDYGK+YA
Sbjct  259   LDTSVNGDNVRHVLKVSLDDKKHDHYLIGTYDIAKDIFTPDNGFEDSQTVLRYDYGKYYA  318

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKT ++  K RR+L GW+NES   ++ +K+GW+G+  IPR +WL K+ KQLVQWPV ELE
Sbjct  319   SKTIFEDGKNRRVLLGWVNESSSVSDDIKKGWAGIHTIPRAIWLHKSGKQLVQWPVVELE  378

Query  758   KLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCS  579
              LR N V  P+ ++K G + +V+G++AAQAD+E++F + EFGK E +++ W  DPQ+LCS
Sbjct  379   SLRVNPVHWPTKVVKGGEMLQVTGVTAAQADVEISFDVNEFGKGEVLDQ-W-VDPQILCS  436

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDK  399
             +KGA+V+GG+GPFGL V AS   QEYTAVFFR+F   N N +VLMCSDQ+RSSL+K  D 
Sbjct  437   RKGAAVKGGLGPFGLLVFASRGLQEYTAVFFRIFRYQNKN-LVLMCSDQSRSSLNKDNDM  495

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
             T+YG FVD++P+ E+LSLR LIDHS+VESFG +G+ CIT+RVYPT AI EKA LYAFNNG
Sbjct  496   TTYGTFVDMDPLHEKLSLRTLIDHSVVESFGGEGRACITARVYPTIAINEKAQLYAFNNG  555

Query  218   VHSIKLSKLTAWSMKKPTIN  159
               ++K+++L+AWSM+K  IN
Sbjct  556   TAAVKITRLSAWSMEKAKIN  575



>gb|AFH77955.1| cell wall invertase [Manihot esculenta]
Length=576

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/565 (61%), Positives = 434/565 (77%), Gaps = 15/565 (3%)
 Frame = -1

Query  1829  YGGVETQASHIV---LQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFF  1659
             +G  E +ASH +   LQNL+          YRT++HFQP +NWMN   GPM+YKG+YH F
Sbjct  19    HGVFELEASHQIYHTLQNLDDFDAK-TTQPYRTAYHFQPSKNWMN---GPMIYKGIYHLF  74

Query  1658  YQYNPKGA--SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMP  1485
             YQYNPKGA   +G I W HSTS DLVNW     A+ PSQP+ D NG WSGSATI P+  P
Sbjct  75    YQYNPKGAVWMWGSIVWAHSTSTDLVNWTPQSVAIYPSQPS-DSNGTWSGSATIFPDGTP  133

Query  1484  ALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAW  1305
             A+L+TGV++  +QVQNLA+P+N  DPYL EWVK P NP++AP   N INA+SFRDPTTAW
Sbjct  134   AMLFTGVNTLGQQVQNLAMPKNTCDPYLLEWVKLPSNPVMAPTRENHINASSFRDPTTAW  193

Query  1304  RGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-S  1128
              G DG W++++GSK+ R+GLA LY S+DFV W++A++  HS E +GMWEC DF+PVS  S
Sbjct  194   LGADGRWKVVIGSKINRKGLAYLYTSEDFVHWIEAQNQFHSAEDTGMWECVDFFPVSVNS  253

Query  1127  PNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGK  948
               G+D  ++ S IK+V K SLD+++HDYYT+G YDHV++ Y PD+GSVD DSGLRYDYGK
Sbjct  254   SVGVDLQMLRSNIKYVFKASLDDTKHDYYTVGEYDHVKNVYTPDEGSVDGDSGLRYDYGK  313

Query  947   FYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQ  768
             FYASKTF+DS K RRILWGW+NES   T  +K+GWSG+Q IPRT+WLDK+ KQLVQWP+Q
Sbjct  314   FYASKTFFDSAKNRRILWGWVNESSSVTADIKKGWSGIQAIPRTIWLDKSGKQLVQWPIQ  373

Query  767   ELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQV  588
             E+EKLR+N V +P  +LKKGSV EV G+ AAQAD+E+TF + +F   E ++  W T+PQ+
Sbjct  374   EIEKLRTNAVRLPGKILKKGSVLEVPGVIAAQADVEITFNVSDFSTGEVLDPSW-TNPQL  432

Query  587   LCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKK  408
             LC QKGASV+G +GPFGL VLASE+ QEYTAVFFR+F G N   VVLMCSDQ+RSSL+  
Sbjct  433   LCCQKGASVKGSLGPFGLLVLASESLQEYTAVFFRIFKGKNKY-VVLMCSDQSRSSLNPD  491

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEK--AHLY  234
              DKT+YGAFVDV+P+ E+LSLR LIDHS+VESFG +GK C+T+RVYPT  + E   AHLY
Sbjct  492   NDKTTYGAFVDVDPVHEQLSLRSLIDHSVVESFGGQGKSCMTARVYPTFTVKEDAPAHLY  551

Query  233   AFNNGVHSIKLSKLTAWSMKKPTIN  159
              FNNG  S+ +++L+AWSMKK  IN
Sbjct  552   VFNNGSESVTITRLSAWSMKKAKIN  576



>ref|XP_004141805.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Cucumis sativus]
Length=585

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/555 (62%), Positives = 433/555 (78%), Gaps = 14/555 (3%)
 Frame = -1

Query  1811  QASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGAS  1632
             + SH VL   +  QP      YRTS+HFQPP+NW+NDPNGPM+YKG+YHFFYQYNPKGA 
Sbjct  41    RTSHFVLHQHQQ-QP------YRTSYHFQPPKNWINDPNGPMIYKGIYHFFYQYNPKGAV  93

Query  1631  FGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRN  1452
             +G I W HSTS DL+NW  H  A+ PSQP+ DING WSGSATILP   PA+LYTG++ +N
Sbjct  94    WGNIVWAHSTSTDLINWEPHDHAIFPSQPS-DINGCWSGSATILPGEKPAILYTGINPKN  152

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
             +QVQNLAVP+N SDPYL+EWVKSP+NPL+AP   N IN +SFRDPTTAW G DG WR+++
Sbjct  153   QQVQNLAVPKNLSDPYLREWVKSPKNPLMAPTPQNHINVSSFRDPTTAWLGRDGEWRVII  212

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGS  1095
             GSK+  RGLAI+YRSKDFVRW Q  HPL   +  GMWECPDF+PV+ T   G++  + GS
Sbjct  213   GSKIDARGLAIMYRSKDFVRWNQVDHPLRYKDDMGMWECPDFFPVAKTGRTGVEMKVSGS  272

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +KH+LK+SLD+++HD YT+GTY+  +D YIP+KGS++  +GLRYDYGK+YASKTF+DS 
Sbjct  273   HVKHILKVSLDDTKHDVYTVGTYNWKKDIYIPNKGSIEGYNGLRYDYGKYYASKTFFDSQ  332

Query  914   KRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE  735
             K+RR+LWGW+NES    + +K+GWSGVQ IPR +WLD + KQL+QWP+ E++KLR+NKV+
Sbjct  333   KKRRVLWGWVNESSSVDDDIKKGWSGVQAIPRAIWLDASGKQLIQWPIVEIQKLRNNKVK  392

Query  734   MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR-  558
             + + +LKKGS  EV G++AAQAD+E++FK+    KAE ++  W  DPQ+LCSQKG S   
Sbjct  393   LTNEVLKKGSTIEVKGVTAAQADVEISFKVENLKKAEILKPEW-KDPQLLCSQKGTSSTT  451

Query  557   --GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
               G +GPFGL VLAS + +EYT+VFF VF    +  VVLMCSDQ+RSSL    DKT+YGA
Sbjct  452   EGGSVGPFGLLVLASNDLKEYTSVFFTVFK-KPHKYVVLMCSDQSRSSLHSNNDKTTYGA  510

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             F+DV+P +E +SLR LIDHSIVESFG KGK CIT+RVYPT AIG+   LYAFNNG  S+ 
Sbjct  511   FLDVDPTRENISLRSLIDHSIVESFGIKGKGCITARVYPTLAIGDNVSLYAFNNGTDSVT  570

Query  203   LSKLTAWSMKKPTIN  159
             ++KLTAWSMKK  IN
Sbjct  571   ITKLTAWSMKKAHIN  585



>ref|XP_004168885.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Cucumis sativus]
Length=585

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/555 (62%), Positives = 431/555 (78%), Gaps = 14/555 (3%)
 Frame = -1

Query  1811  QASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGAS  1632
             + SH VL   +  QP      YRTS+HFQPP+NW+NDPNGPM+YKG+YHFFYQYNPKGA 
Sbjct  41    RTSHFVLHQHQQ-QP------YRTSYHFQPPKNWINDPNGPMIYKGIYHFFYQYNPKGAV  93

Query  1631  FGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRN  1452
             +G I W HSTS DL+NW  H  A+ PSQP+ DING WSGSATILP   PA+LYTG++ +N
Sbjct  94    WGNIVWAHSTSTDLINWEPHDHAIFPSQPS-DINGCWSGSATILPGEKPAILYTGINPKN  152

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
             +QVQNLAVP+N SDPYL+EWVKSP+NPL+AP   N IN +SFRDPTTAW G DG WR+++
Sbjct  153   QQVQNLAVPKNLSDPYLREWVKSPKNPLMAPTPQNHINVSSFRDPTTAWLGRDGEWRVII  212

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGS  1095
             GSK+  RGLAI+YRSKDFVRW Q  HPL   +  GMWECPDF+PV+ T   G++  + GS
Sbjct  213   GSKIDSRGLAIMYRSKDFVRWNQVDHPLRYKDDMGMWECPDFFPVAKTGRTGVEMKVSGS  272

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +KH+LK+SLD+++HD YT+GTY+  +D YIP+KGS++  +GLRYDYGK+YASKTF+DS 
Sbjct  273   HVKHILKVSLDDTKHDVYTVGTYNWKKDIYIPNKGSIEGYNGLRYDYGKYYASKTFFDSQ  332

Query  914   KRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE  735
             K+RR+LWGW+NES    + +K+GWSGVQ IPR +WLD + KQL+QWP+ E++KLR NKV+
Sbjct  333   KKRRVLWGWVNESSSVDDDIKKGWSGVQAIPRAIWLDASGKQLIQWPIVEIQKLRDNKVK  392

Query  734   MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR-  558
             + + +LKKGS  EV G++AAQAD+E++FK+    KAE ++  W  DPQ+LCSQKG S   
Sbjct  393   LTNEVLKKGSTIEVKGVTAAQADVEISFKVENLKKAEILKPEW-KDPQLLCSQKGTSSTT  451

Query  557   --GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
               G +GPFGL VLAS + +EYT+VFF VF    +  VVLMC DQ+RSSL    DKT+YGA
Sbjct  452   EGGSVGPFGLLVLASNDLKEYTSVFFTVFK-KQHKYVVLMCGDQSRSSLHSNNDKTTYGA  510

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             F+DV+P +E LSLR LIDHSIVESFG KGK CIT+RVYPT AIG+   LYAFNNG  S+ 
Sbjct  511   FLDVDPTRENLSLRSLIDHSIVESFGIKGKGCITARVYPTLAIGDDVSLYAFNNGTDSVT  570

Query  203   LSKLTAWSMKKPTIN  159
             ++KLTAWSMKK  IN
Sbjct  571   ITKLTAWSMKKAHIN  585



>gb|AAD10960.1| cell wall invertase precursor [Fragaria x ananassa]
Length=577

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/564 (62%), Positives = 433/564 (77%), Gaps = 10/564 (2%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQ----PPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHF  1662
             +G +E QASH V  NL+  Q     P     YRT +HFQP +NW+NDPNGP++YKG+YH 
Sbjct  17    FGVIELQASHHVYSNLQTTQLASTHPQAKDPYRTGYHFQPRKNWINDPNGPLIYKGIYHL  76

Query  1661  FYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPA  1482
             FYQYNP    +G I W HSTS DLVNW  H  A+ PS   +DING WSGS TILP+  PA
Sbjct  77    FYQYNPSSVVWGNIVWAHSTSTDLVNWIPHEAAIYPSI-LSDINGCWSGSVTILPSGKPA  135

Query  1481  LLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWR  1302
             +LYTG++    QVQNLA P+N SDP+L+EWVK P+NPL+AP   N+INA+SFRDPTTAW 
Sbjct  136   ILYTGINPDKEQVQNLAFPKNLSDPFLREWVKVPQNPLMAPTQANQINASSFRDPTTAWL  195

Query  1301  GPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSP  1125
             GPD  WR+++GSK   RGLAILYRSKDF+ W +AKHPL+S   +GMWECPDF+PVS T  
Sbjct  196   GPDKRWRLIIGSKRNHRGLAILYRSKDFMHWTKAKHPLYSTPKNGMWECPDFFPVSKTKL  255

Query  1124  NGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKF  945
              GLDTS +G  +KHVLK+SLD +R +YYTIGTY+  +D YIPD GS+++DSGLRYDYGKF
Sbjct  256   LGLDTSAIGPDVKHVLKVSLDNTRKEYYTIGTYNVSKDIYIPDDGSIESDSGLRYDYGKF  315

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASKTF+DS K RRILWGWINES   +  +K+GWSG+Q IPRT+ LDK+RKQLVQWPV E
Sbjct  316   YASKTFFDSAKNRRILWGWINESSSVSGDIKKGWSGLQAIPRTIVLDKSRKQLVQWPVVE  375

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             LEKLR+N+V++PST+LK GS+ EV G++AAQAD++V F+I +  KAE M+  W T+ Q+L
Sbjct  376   LEKLRTNEVKLPSTLLKGGSLHEVIGVTAAQADVDVAFEISDLKKAEVMDPSW-TNAQLL  434

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDK  411
             CS+KG SV+G +GPFGL    S++ +E TA+F+R+F  +NNN   VVLMCSDQ+RSSL+ 
Sbjct  435   CSKKGTSVKGALGPFGLLAFVSKDLKEKTAIFYRIFKSHNNNNKYVVLMCSDQSRSSLNP  494

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               D T+YG FV+V+P+ E+LSLR LIDHSIVESFG KGK CIT+RVYPT A+    HLYA
Sbjct  495   DNDMTTYGTFVNVDPLHEKLSLRSLIDHSIVESFGGKGKECITARVYPTLAVDGDTHLYA  554

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN G  S+K++  +AWSMK   IN
Sbjct  555   FNYGSESVKIAG-SAWSMKTAKIN  577



>ref|XP_007150512.1| hypothetical protein PHAVU_005G158500g [Phaseolus vulgaris]
 gb|ESW22506.1| hypothetical protein PHAVU_005G158500g [Phaseolus vulgaris]
Length=574

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/560 (61%), Positives = 436/560 (78%), Gaps = 8/560 (1%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHT-YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             G +  +A+H V +NL+ L     +H  YRT++HFQPP+NW+NDPN PM YKG+YH FYQY
Sbjct  19    GVLPIEATHHVYRNLQTLSSHSSDHQPYRTAYHFQPPQNWINDPNAPMRYKGLYHLFYQY  78

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HS SKDLVNW     A+ PSQ  +DING WSGSATILP   PA+LYT
Sbjct  79    NPKGAVWGNIVWAHSVSKDLVNWTPLDHAIYPSQ-QSDINGCWSGSATILPGGKPAILYT  137

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D  N QVQNLA+P+N SDP L EWVKSP+NPL+AP   N+IN++SFRDPTTAW+G DG
Sbjct  138   GIDPNNHQVQNLAIPKNFSDPLLLEWVKSPKNPLMAPTEANQINSSSFRDPTTAWQGKDG  197

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSP--NG  1119
              WR+++GSKV RRG+AILY+SK+FV WVQA+HPLHS EG+GMWECPDFYPV + SP   G
Sbjct  198   YWRVVIGSKVHRRGVAILYKSKNFVNWVQAEHPLHSAEGTGMWECPDFYPVLNKSPLTTG  257

Query  1118  LDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             LDTS+ G  ++HVLK+SLD+++HD+Y IGTYD+ +D + PD G  D    LR+DYGK+YA
Sbjct  258   LDTSVNGDNVRHVLKVSLDDTKHDHYLIGTYDYTKDIFTPDTGFEDTQHVLRHDYGKYYA  317

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKT ++  K RR+L+GW+NES    + +K+GWSG+  IPRT+WL K+ KQLVQWPV E+E
Sbjct  318   SKTIFEDGKNRRVLFGWVNESSSVADDIKKGWSGIHTIPRTIWLHKSGKQLVQWPVVEIE  377

Query  758   KLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCS  579
              LR N V  PS ++  G + +V+G++A QAD+EV+F++ + GKAE + + W  DPQ+LC 
Sbjct  378   SLRVNPVHWPSKVVNGGEILQVTGVTATQADVEVSFEVNKIGKAEVL-DHW-EDPQILCG  435

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDK  399
             +KGA+V+GG+GPFGL V AS   QEYTAVFFR+F   + N +VLMCSDQ+RSSL+K  DK
Sbjct  436   RKGAAVKGGLGPFGLLVFASGGLQEYTAVFFRIFRYQSKN-LVLMCSDQSRSSLNKDNDK  494

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
             T+YG FVDV+P+ E+LSLR LIDHSIVESF  +G+ CIT+RVYPT AI +KA LYAFNNG
Sbjct  495   TTYGTFVDVDPLLEKLSLRTLIDHSIVESFEGEGRACITARVYPTIAINDKAQLYAFNNG  554

Query  218   VHSIKLSKLTAWSMKKPTIN  159
               S+K++KL+AWSMKK  IN
Sbjct  555   TASVKITKLSAWSMKKAKIN  574



>ref|XP_004297549.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Fragaria vesca subsp. vesca]
Length=578

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/564 (61%), Positives = 431/564 (76%), Gaps = 10/564 (2%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQ----PPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHF  1662
             YG +E QASH V  NL+  Q     P     YRT +HFQP +NW+NDPNGP++YKG+YH 
Sbjct  18    YGVIELQASHHVYSNLQTTQLTSTHPQAKDPYRTGYHFQPRKNWINDPNGPLIYKGIYHL  77

Query  1661  FYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPA  1482
             FYQYNP    +G I W HSTS DLVNW  H  A+ PS   +DING WSGS TILP   PA
Sbjct  78    FYQYNPSSVVWGNIVWAHSTSTDLVNWIPHEAAIYPSI-LSDINGCWSGSVTILPGGKPA  136

Query  1481  LLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWR  1302
             +LYTG++    QVQNLA P+N SDP+L+EWVK P+NPL+AP   N+INA+SFRDPTTAW 
Sbjct  137   ILYTGINPDKEQVQNLAFPKNLSDPFLREWVKVPQNPLMAPTQANQINASSFRDPTTAWL  196

Query  1301  GPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSP  1125
             GPD  WR+++GSK  +RGLAILYRSKDF+ W +AKHPL+S   +GMWECPDF+PVS T  
Sbjct  197   GPDKRWRLIIGSKRNQRGLAILYRSKDFMHWTKAKHPLYSTPKNGMWECPDFFPVSKTKL  256

Query  1124  NGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKF  945
              GLDTS +G  +KHVLK+SLD +R +YYTIGTY+  +D YIPD GS+++DSGLRYDYGKF
Sbjct  257   LGLDTSAIGPDVKHVLKVSLDNTRKEYYTIGTYNVSKDIYIPDDGSIESDSGLRYDYGKF  316

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASKTF+DS K RRILWGWINES   +  +K+GWSG+Q IPRT+ LDK+ KQLVQWPV E
Sbjct  317   YASKTFFDSAKNRRILWGWINESSSVSGDIKKGWSGLQAIPRTIVLDKSGKQLVQWPVVE  376

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             LEKLR+ +V++PST+LK GS+ EV G++AAQAD++V F+I +  KAE  +  W T+ Q+L
Sbjct  377   LEKLRTKEVKLPSTLLKGGSLHEVIGVTAAQADVDVAFEISDLKKAEVTDPSW-TNAQLL  435

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDK  411
             CS+KG SV+G +GPFGL    S++ +E TA+F+R+F  +NNN   VVLMCSDQ+RSSL+ 
Sbjct  436   CSKKGTSVKGALGPFGLLAFVSKDLKEKTAIFYRIFKSHNNNNKYVVLMCSDQSRSSLNP  495

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               D T+YGAFV+V+P+ E+LSLR LIDHSIVESFG KGK CIT+RVYPT A+    HLYA
Sbjct  496   DNDMTTYGAFVNVDPLYEKLSLRSLIDHSIVESFGGKGKACITARVYPTLAVDGDTHLYA  555

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN G  S+K++  +AWSMK   IN
Sbjct  556   FNYGSESVKIAG-SAWSMKTAKIN  578



>gb|AFD62257.1| acid invertase [Kummerowia stipulacea]
Length=573

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/558 (60%), Positives = 436/558 (78%), Gaps = 10/558 (2%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             YG V   A H V +NL+++     N  YRT++HFQPP+NW+NDPNGP+ Y+G+YH FYQY
Sbjct  25    YGSV---AEHHVYRNLQSVSSGSTNQPYRTAYHFQPPKNWINDPNGPLRYRGLYHLFYQY  81

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HS SKDLVNW    PA+ PSQP+ DING WSGS T+LP N PA+LYT
Sbjct  82    NPKGAVWGNIVWAHSVSKDLVNWTPLDPAIFPSQPS-DINGCWSGSTTLLPGNKPAILYT  140

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQNLA P+N SDP+L+EWVKSP+NPL+AP   NKIN++SFRDPTTAW G DG
Sbjct  141   GIDPQNQQVQNLAQPKNLSDPFLREWVKSPKNPLMAPTSANKINSSSFRDPTTAWLGKDG  200

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLD  1113
             +WR+LVGSK   RGLAILYRSKDFV WVQAKHPLHS  GSG+WECPDF+PV +    GLD
Sbjct  201   HWRVLVGSKRRTRGLAILYRSKDFVNWVQAKHPLHSTLGSGIWECPDFFPVLNKGTLGLD  260

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS++G  + HVLK+SLD+ +HDYY IG+Y+  +D +IPD G+   +  LRYDYGK+YASK
Sbjct  261   TSVIGDYVSHVLKVSLDDKKHDYYMIGSYNVAKDAFIPDNGA--KEFVLRYDYGKYYASK  318

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             TF+D  K+RRIL GW+NES    + +K+GWSG+  IPRT+WL ++ KQLVQWPV E+EKL
Sbjct  319   TFFDDGKKRRILLGWVNESSSVADDIKKGWSGIHTIPRTIWLHESGKQLVQWPVVEVEKL  378

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQK  573
             R+N V +P  +LK G + +++G++A QAD+E++F++    +AE ++  + TDPQ+LC++K
Sbjct  379   RANPVNLPPQVLKGGQLLQINGVTATQADVEISFQVNNLREAEVLD--YWTDPQILCNKK  436

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTS  393
             G++V+GG+GPFGL V AS+   EYT+VFFR+F   N N +VL+CSDQ+ SSL+K  D T+
Sbjct  437   GSAVKGGLGPFGLLVFASKGLHEYTSVFFRIFKQQNKN-LVLLCSDQSSSSLNKDNDLTT  495

Query  392   YGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             YG FVDV+P+ E+LSLR LIDHS+VESFG +G+  IT+RVYPT AI +KA +YAFNNG  
Sbjct  496   YGTFVDVDPLHEKLSLRTLIDHSVVESFGGEGRAVITARVYPTLAINDKAQIYAFNNGTT  555

Query  212   SIKLSKLTAWSMKKPTIN  159
              +K++ L+AWSMKK  I+
Sbjct  556   DVKITSLSAWSMKKAQIS  573



>gb|KDO65252.1| hypothetical protein CISIN_1g008242mg [Citrus sinensis]
Length=516

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/500 (65%), Positives = 413/500 (83%), Gaps = 3/500 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             +G VE QASH V +NL+  Q   PN  YRT +HFQPP+NW+NDPNG M+YKG+YH FYQY
Sbjct  18    HGVVELQASHHVYRNLQTSQSTSPNQPYRTGYHFQPPKNWINDPNGVMIYKGIYHLFYQY  77

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTSKDL+NW  H PA+ PSQ  +DING WSGSATILP   PA+ YT
Sbjct  78    NPKGAVWGNIVWAHSTSKDLINWIPHDPAIYPSQ-QSDINGCWSGSATILPGEKPAIFYT  136

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D  NRQVQNLAVP+N SDPYL+EWVKSP+NPL+AP+  N+IN +SFRDPTTAW GPD 
Sbjct  137   GIDPHNRQVQNLAVPKNLSDPYLREWVKSPKNPLMAPDAMNQINTSSFRDPTTAWLGPDK  196

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ R+GLAILYRSKDFV W++AKHPLHS +G+GMWECPDF+PVST   NGLD
Sbjct  197   RWRVIIGSKINRKGLAILYRSKDFVHWIKAKHPLHSVKGTGMWECPDFFPVSTYGLNGLD  256

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS +G   KHVLK+SLD+++H+YYT+GTY   +D+Y+PD+GSV++DSGLR+DYGK+YASK
Sbjct  257   TSDMGPNTKHVLKVSLDDTKHEYYTVGTYSTAKDRYVPDEGSVESDSGLRFDYGKYYASK  316

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             TF+D  K RR+LWGW+NES    + VK+GW+G+Q IPR +WLDK+ K LVQWPV E+EKL
Sbjct  317   TFFDGAKNRRVLWGWVNESSSVNDDVKKGWAGIQAIPRKLWLDKSGKHLVQWPVVEIEKL  376

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQK  573
             R N+V++PS +LK GSV EV+G++AAQAD+E++F + +F KAEK++  W T+PQ+LCSQK
Sbjct  377   RVNQVQVPSKLLKGGSVIEVTGVTAAQADVEISFDVSDFKKAEKLDPGW-TNPQLLCSQK  435

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTS  393
             GASV+G +GPFGL  LAS++ +EYTAVFFR+F G +N  VVLMCSDQ+RSSL+   DKT+
Sbjct  436   GASVKGALGPFGLLALASKDLKEYTAVFFRIFKGEDNKFVVLMCSDQSRSSLNSDNDKTT  495

Query  392   YGAFVDVNPMQEELSLRILI  333
             YGAF++V+P+ E+LSLR L+
Sbjct  496   YGAFLNVDPVYEKLSLRSLV  515



>ref|XP_003543590.1| PREDICTED: beta-fructofuranosidase, cell wall isozyme-like isoform 
1 [Glycine max]
Length=574

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/560 (60%), Positives = 430/560 (77%), Gaps = 8/560 (1%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             G +  +A+H V +NL+ L     +  YRT++HFQP +NW+NDPNGPM YKG+YH FYQYN
Sbjct  19    GVLPIEATHHVYRNLQTLSSDSSDQPYRTAYHFQPRKNWINDPNGPMRYKGLYHLFYQYN  78

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS S DLVNW     A+ PSQP+ DING WSGSATILP   PA+LYTG
Sbjct  79    PKGAVWGNIVWAHSISNDLVNWTPLDHAIYPSQPS-DINGCWSGSATILPRGKPAILYTG  137

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             ++    QVQNLA+P+N SDP L+EWVKSP+NPL+AP   N IN++SFRDPTTAW G DG 
Sbjct  138   INPNKHQVQNLAIPKNMSDPLLREWVKSPKNPLMAPTISNNINSSSFRDPTTAWLGKDGY  197

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV----STSPNG  1119
             WR+L+GSK+  RG+AILY+SK+FV WVQAK PLHS EG+GMWECPDFYPV      S  G
Sbjct  198   WRVLIGSKIHTRGMAILYKSKNFVNWVQAKQPLHSAEGTGMWECPDFYPVLDNKGPSTIG  257

Query  1118  LDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             LDTS+ G  ++HVLK+SLD+++HD+Y IGTYD  +D + PD G  D+ + LRYDYGK+YA
Sbjct  258   LDTSVNGDNVRHVLKVSLDDTKHDHYLIGTYDIAKDIFTPDNGFEDSQTVLRYDYGKYYA  317

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKT ++  K RR+L GW+NES    + +K+GW+G+  IPR +WL K+ KQLVQWPV ELE
Sbjct  318   SKTIFEDGKNRRVLLGWVNESSSVPDDIKKGWAGIHTIPRAIWLHKSGKQLVQWPVVELE  377

Query  758   KLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCS  579
              LR N V  P+ ++K G + +V+G++AAQAD+E++F++ EFGKAE + ++W  DPQ+LCS
Sbjct  378   SLRVNPVHWPTKVVKGGEMLQVTGVTAAQADVEISFEVNEFGKAEVL-DKW-VDPQILCS  435

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDK  399
             +KGA+V+GG+GPFGL V AS   QEYTAVFFR+F   N N +VLMCSDQ+RSSL+K  D 
Sbjct  436   RKGAAVKGGLGPFGLLVFASRGLQEYTAVFFRIFRYQNKN-LVLMCSDQSRSSLNKDNDM  494

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
             T+YG FVD++P+ E+LSLR LID S+VESFG +G  CIT+RVYPT AI +KA LY FNNG
Sbjct  495   TTYGTFVDMDPLHEKLSLRTLIDRSVVESFGGEGMACITARVYPTIAINKKAQLYVFNNG  554

Query  218   VHSIKLSKLTAWSMKKPTIN  159
               ++K+++L+AWSMKK  IN
Sbjct  555   TAAVKITRLSAWSMKKAKIN  574



>ref|XP_003597593.1| Beta-fructofuranosidase, cell wall isozyme [Medicago truncatula]
Length=575

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/559 (60%), Positives = 433/559 (77%), Gaps = 9/559 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPNHT--YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             +  +A+H V + LE+      +H   YRT++HFQP +NW+NDPNGPM Y G+YH FYQYN
Sbjct  21    IPIEATHHVYRTLESSSSYSSHHDQPYRTAYHFQPLKNWINDPNGPMRYGGLYHLFYQYN  80

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKDLVNW     A+ PSQP+ DI G WSGSATILP   PA+LYTG
Sbjct  81    PKGAVWGNIVWAHSASKDLVNWTPLDHAIHPSQPS-DIKGCWSGSATILPGGKPAILYTG  139

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             +D  N QVQN+A+P+N SDP L+EW KSP+NPL+ P   NKINA+SFRDPTT+W G DG 
Sbjct  140   IDPNNHQVQNIAIPKNMSDPLLREWKKSPKNPLMEPTVANKINASSFRDPTTSWLGKDGY  199

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS---PNGL  1116
             WR+L+GSKV R+G+AI+Y+SK+FV W +AKHPLHS EG+GMWECPDF+PV        GL
Sbjct  200   WRVLIGSKVHRKGIAIMYKSKNFVDWFEAKHPLHSAEGTGMWECPDFFPVLNKNPLTIGL  259

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS+ G  ++HVLK+SLD+++HD+Y IGTYD V+D ++PD G  +N + LRYDYGK+YAS
Sbjct  260   DTSVNGDDVRHVLKVSLDDTKHDHYLIGTYDTVKDVFVPDNGFENNQNVLRYDYGKYYAS  319

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+D  K RRIL GW NES    + VK+GWSG+  IPR +WL K+ KQLVQWPV+ELE 
Sbjct  320   KTFFDDGKNRRILLGWANESSSVVDDVKKGWSGIHTIPRVIWLHKSGKQLVQWPVKELEN  379

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQ  576
             LR N V  P+ ++K G +  ++G+++ QAD+E++F++ +FGKAE + ++W  DPQ+LCSQ
Sbjct  380   LRMNPVNWPTKVIKGGELIPITGVNSVQADVEISFEVKDFGKAELL-DKW-IDPQILCSQ  437

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKT  396
             KGASV+GG+GPFGL V AS+  QEYTAVFFR+F   + N +VLMCSDQ+RSSL+K+ D T
Sbjct  438   KGASVKGGVGPFGLHVFASKGLQEYTAVFFRIFRYQHKN-LVLMCSDQSRSSLNKENDMT  496

Query  395   SYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGV  216
             +YG FVDV+P+ E+LSLR LIDHS+VESFG +G+ CIT+RVYPT AI +KA LYAFNNG 
Sbjct  497   TYGTFVDVDPLHEKLSLRTLIDHSVVESFGGEGRACITARVYPTLAIHDKALLYAFNNGN  556

Query  215   HSIKLSKLTAWSMKKPTIN  159
              ++K+++L AWSMKK  IN
Sbjct  557   SAVKITRLNAWSMKKAKIN  575



>ref|XP_003531611.1| PREDICTED: beta-fructofuranosidase, cell wall isozyme-like [Glycine 
max]
Length=564

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/553 (60%), Positives = 435/553 (79%), Gaps = 7/553 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
             + A+H + +NL+++     N  YRT++HFQPP NW+NDPNGP+ Y G+YH FYQYNPKGA
Sbjct  18    SAATHHIYRNLQSVSSDSSNQPYRTAYHFQPPNNWINDPNGPLRYGGLYHLFYQYNPKGA  77

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S+DLVNW    PA+ PSQ ++DING WSGSAT+LP N PA+LYTG+DS 
Sbjct  78    VWGNIVWAHSVSRDLVNWTPLDPAIFPSQ-SSDINGCWSGSATLLPGNKPAILYTGIDSL  136

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             N+QVQN A P+N SDP+L+EWVKSP+NPL+AP   NKIN++SFRDPTTAW G DG+WR+L
Sbjct  137   NQQVQNFAQPKNLSDPFLREWVKSPKNPLMAPTSANKINSSSFRDPTTAWLGKDGHWRVL  196

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLDTSLVG  1098
             VGSK   RG+AILYRSKDFV+WVQAKHPLHS  GSGMWECPDF+PV S    G+DTS+ G
Sbjct  197   VGSKRRTRGMAILYRSKDFVKWVQAKHPLHSTLGSGMWECPDFFPVLSNGQLGVDTSVNG  256

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               ++HVLK+SLD+ +HDYY IG+Y+  +D +IPD+ S  N   LRYDYGK+YASKTF+D 
Sbjct  257   EYVRHVLKVSLDDKKHDYYMIGSYNAAKDAFIPDEES--NIFVLRYDYGKYYASKTFFDD  314

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRIL GW+NES    + +K+GWSG+  IPR +WL K+ +QLVQWPV+E+EKLR+  V
Sbjct  315   GKKRRILLGWVNESSSVADDIKKGWSGIHTIPRAIWLHKSGRQLVQWPVEEVEKLRAYPV  374

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              +   +LK G +  ++G++A+QAD+E++F++ +  KAE ++  + TDPQ+LCS+KG+SV+
Sbjct  375   NLLPQVLKGGKLLPINGVTASQADVEISFEVSKLRKAEVLD--YWTDPQILCSKKGSSVK  432

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
              G+GPFGL V ASE  QEYT+VFFR+F  + +  +VL+CSDQ RSSL+K  D TSYG FV
Sbjct  433   SGLGPFGLLVFASEGLQEYTSVFFRIFR-HQHKYLVLLCSDQNRSSLNKDNDLTSYGTFV  491

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             DV+P+ ++LSLR LIDHS+VESFG +G+ CIT+RVYPT AI +KA LYAFNNG   +K++
Sbjct  492   DVDPLHDKLSLRTLIDHSVVESFGGEGRACITARVYPTLAINDKAQLYAFNNGTADVKIT  551

Query  197   KLTAWSMKKPTIN  159
             +L+AWSMKK  I+
Sbjct  552   RLSAWSMKKAQIH  564



>gb|AFD62258.1| acid invertase [Kummerowia stipulacea]
Length=564

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/558 (60%), Positives = 435/558 (78%), Gaps = 10/558 (2%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             YG V   A H V +NL+++     N  YRT++HFQPP+NW+NDPNGP+ Y+G+YH FYQY
Sbjct  16    YGSV---AEHHVYRNLQSVSSGSTNQPYRTAYHFQPPKNWINDPNGPLRYRGLYHLFYQY  72

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HS SKDLVNW    PA+ PSQP+ DING WSGS T+LP N PA+LYT
Sbjct  73    NPKGAVWGNIVWAHSVSKDLVNWTPLDPAIFPSQPS-DINGCWSGSTTLLPGNKPAILYT  131

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQNLA P+N SDP+L+EWVKSP+NPL+AP   NKIN++SFRDPTTAW G DG
Sbjct  132   GIDPQNQQVQNLAQPKNLSDPFLREWVKSPKNPLMAPTSANKINSSSFRDPTTAWLGKDG  191

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLD  1113
             +WR+LVGSK   RGLAILYRSKDFV WVQAKHPLHS  GSG+WECPDF+PV +    GLD
Sbjct  192   HWRVLVGSKRRTRGLAILYRSKDFVNWVQAKHPLHSTLGSGIWECPDFFPVLNKGTLGLD  251

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS++G+ + HVLK+SLD+ +HDYY IG+Y+  +D +IPD G+   +  LRYDYGK+YASK
Sbjct  252   TSVIGNYVSHVLKVSLDDKKHDYYMIGSYNVAKDAFIPDNGA--KEFVLRYDYGKYYASK  309

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             TF+D  K+RRIL GW+NES    + +K+GWSG+  IPRT+WL ++ KQLVQWPV E+EKL
Sbjct  310   TFFDDGKKRRILLGWVNESSSVADDIKKGWSGIHTIPRTIWLHESGKQLVQWPVVEVEKL  369

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQK  573
             R+N V +P  +LK G + +++G++A QAD+E++F++    +AE ++  + TDPQ+LCS+K
Sbjct  370   RANPVNLPPQVLKGGQLLQINGVTATQADVEISFQVNNLREAEVLD--YWTDPQILCSKK  427

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTS  393
             G++V+ G+GPFGL V AS+   EYT+VFFR+F   N N +VL+CSDQ+ SSL+K  D T+
Sbjct  428   GSAVKVGLGPFGLLVFASKGLHEYTSVFFRIFKQQNKN-LVLLCSDQSSSSLNKDNDLTT  486

Query  392   YGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             YG FVDV+ + E+LSLR LIDHS+VESFG +G+  IT+RVYPT AI +KA +YAFNNG  
Sbjct  487   YGTFVDVDLLHEKLSLRTLIDHSVVESFGGEGRAVITARVYPTLAINDKAQIYAFNNGTT  546

Query  212   SIKLSKLTAWSMKKPTIN  159
              +K++ L+AWSMKK  I+
Sbjct  547   DVKITSLSAWSMKKAQIS  564



>ref|NP_001236325.1| beta-fructofuranosidase precursor [Glycine max]
 emb|CAD91338.1| beta-fructofuranosidase [Glycine max]
Length=564

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/553 (60%), Positives = 429/553 (78%), Gaps = 7/553 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
             + A+H V +NL++L     N  YRT++HFQPP+NW+NDPNGP+ Y G+YH FYQYNPKGA
Sbjct  18    SAATHHVYRNLQSLSSDSSNQPYRTAYHFQPPKNWINDPNGPLRYAGLYHLFYQYNPKGA  77

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS SKDLVNW    PA+ PSQP+ DING WSGS T+LP N P +LYTG+D  
Sbjct  78    VWGNIVWAHSVSKDLVNWTPLDPAIFPSQPS-DINGCWSGSTTLLPGNKPVILYTGIDLL  136

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             N+QVQNLA P+N SDP+L+EWVKSP+NPL+AP   NKIN++SFRDPTTAW G DG+WR+L
Sbjct  137   NQQVQNLAQPKNLSDPFLREWVKSPKNPLMAPTSANKINSSSFRDPTTAWLGKDGHWRVL  196

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVG  1098
             VGSK   RG+AILYRSKDFV WVQAKHPL+S  GSGMWECPDF+PV  +   G+DTS+ G
Sbjct  197   VGSKRRTRGIAILYRSKDFVNWVQAKHPLYSILGSGMWECPDFFPVLNNDQLGVDTSVNG  256

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               ++HVLK+SLD+ +HDYY IG+Y+  +D +IPD+ S  N+  LRYDYGK+YASKTF+D 
Sbjct  257   YDVRHVLKVSLDDKKHDYYMIGSYNAAKDAFIPDEES--NEFVLRYDYGKYYASKTFFDD  314

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRIL GW NES      +K+GWSG+  IPR +WL K+ KQLVQWPV E+EKLR+  V
Sbjct  315   GKKRRILLGWANESSSVAADIKKGWSGIHTIPRALWLHKSGKQLVQWPVVEVEKLRAYPV  374

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              +P  +LK G +  ++G++A QAD+E++F++    +AE ++  + TDPQ+LCS+KG+S++
Sbjct  375   NLPPQVLKGGKLLPINGVTATQADVEISFEVSNLREAEVLD--YWTDPQILCSKKGSSIK  432

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
              G+GPFGL V ASE  QEYT+VFFR+F  + +  +VL+CSDQ+RSSL+K  D TSYG FV
Sbjct  433   SGLGPFGLLVFASEGLQEYTSVFFRIFR-HQHKYLVLLCSDQSRSSLNKDNDLTSYGTFV  491

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             DV+P+ E+LSLR LIDHS+VESFG +G+ CIT+RVYPT AI ++A LYAFNNG   + ++
Sbjct  492   DVDPLHEKLSLRTLIDHSVVESFGGEGRACITARVYPTLAINDEAQLYAFNNGTADVNIT  551

Query  197   KLTAWSMKKPTIN  159
             KL AWSMKK  IN
Sbjct  552   KLNAWSMKKAQIN  564



>gb|AFK37518.1| unknown [Medicago truncatula]
Length=575

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/559 (60%), Positives = 431/559 (77%), Gaps = 9/559 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPNHT--YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             +  +A+H V + LE+      +H   YRT++HFQP +NW+NDPNGPM Y G+YH FYQYN
Sbjct  21    IPIEATHHVYRTLESSSSYSSHHDQPYRTAYHFQPLKNWINDPNGPMRYGGLYHLFYQYN  80

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKDLVNW     A+ PSQP+ DI G WSGSATILP   PA+LYTG
Sbjct  81    PKGAVWGNIVWAHSASKDLVNWTPLDHAIHPSQPS-DIKGCWSGSATILPGGKPAILYTG  139

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             +D  N QVQN+A+P+N  DP L+EW KSP+NPL+ P   NKINA+SFRDPTT+W G DG 
Sbjct  140   IDPNNHQVQNIAIPKNMPDPLLREWKKSPKNPLMEPTVANKINASSFRDPTTSWLGKDGY  199

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS---PNGL  1116
             WR+L+GSKV R+G+AI+Y+SK+FV W +AKHPLHS EG+GMWECPDF+PV        GL
Sbjct  200   WRVLIGSKVHRKGIAIMYKSKNFVDWFEAKHPLHSAEGTGMWECPDFFPVLNKNPLTIGL  259

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS+ G  ++HVLK+SLD+++HD+Y IGTYD V+D ++PD G  +N + LRYDYGK+YAS
Sbjct  260   DTSVNGDDVRHVLKVSLDDTKHDHYLIGTYDTVKDVFVPDNGFENNQNVLRYDYGKYYAS  319

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+D  K RRIL GW NES    + VK+GWSG+  IPR +WL K+ KQLVQWPV+ELE 
Sbjct  320   KTFFDDGKNRRILLGWANESSSVVDDVKKGWSGIHTIPRVIWLHKSGKQLVQWPVKELEN  379

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQ  576
             LR N V  P+ ++K G +  ++G+++ QAD+E++F++ +FGKAE + ++W  DPQ+LCSQ
Sbjct  380   LRMNPVNWPTKVIKGGELIPITGVNSVQADVEISFEVKDFGKAELL-DKW-IDPQILCSQ  437

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKT  396
             KGASV+GG+GPFGL V AS+  QEYTAVFFR+F   + N +VLMCSDQ+RSSL+K+ D T
Sbjct  438   KGASVKGGVGPFGLHVFASKGLQEYTAVFFRIFRYQHKN-LVLMCSDQSRSSLNKENDMT  496

Query  395   SYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGV  216
             +YG FVDV+P+ E+LSLR LIDHS+VESFG +G+ CIT+RVYPT AI +KA LYAFNNG 
Sbjct  497   TYGTFVDVDPLHEKLSLRTLIDHSVVESFGGEGRACITARVYPTLAIHDKALLYAFNNGN  556

Query  215   HSIKLSKLTAWSMKKPTIN  159
              ++K++ L AWSMKK  IN
Sbjct  557   SAVKITGLNAWSMKKAKIN  575



>ref|XP_002521396.1| Beta-fructofuranosidase, cell wall isozyme precursor, putative 
[Ricinus communis]
 gb|EEF41064.1| Beta-fructofuranosidase, cell wall isozyme precursor, putative 
[Ricinus communis]
Length=576

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/563 (60%), Positives = 428/563 (76%), Gaps = 13/563 (2%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYP----NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHF  1662
             YG  E +AS  + Q L+   P +        YRT+FHFQPP+NWMN   GPM+Y G+YH 
Sbjct  21    YGVFELEASDHISQTLQI--PEFAITATGQPYRTAFHFQPPKNWMN---GPMIYNGIYHL  75

Query  1661  FYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPA  1482
             FYQYNPKGA +G I WGHSTS+DLVNW  H PA+ PSQ  ADINGA+SGSATILP+  PA
Sbjct  76    FYQYNPKGAVWGNIEWGHSTSEDLVNWTPHEPAIYPSQ-QADINGAFSGSATILPDGTPA  134

Query  1481  LLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWR  1302
             +LYTG+D  N+QVQNLA+P+N SDPYL EWVK   NPL+AP   N+I A+SFRDPTTAW+
Sbjct  135   ILYTGIDPLNQQVQNLALPKNSSDPYLIEWVKLAENPLMAPTSQNQIEASSFRDPTTAWK  194

Query  1301  GPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN  1122
             G DG+WR+++GSK   +GL I+YRSKDFV WVQA+ P++  EG+GMWECPDF+PV+ + N
Sbjct  195   GIDGSWRVVIGSKNKTKGLGIIYRSKDFVNWVQAERPIYEVEGTGMWECPDFFPVAINTN  254

Query  1121  -GLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKF  945
              G+D S +G  IK+VLK SL +   DYY IG YD V D Y PD GS+  D GLR+DYGKF
Sbjct  255   TGVDLSNLGPDIKYVLKASLFDINQDYYAIGEYDGVEDVYTPDTGSISGDGGLRFDYGKF  314

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASK+F+DS K+RRILW WI ES    + +K+GW+G+QG+PR + LDK+RKQLVQWP++E
Sbjct  315   YASKSFFDSDKKRRILWAWIAESSSVDDDIKKGWAGLQGVPRVILLDKSRKQLVQWPIEE  374

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQV  588
             +EKLR N V +P  +L+ GS+ EVSG++AAQA++E++F++    K E + +  T  +PQ+
Sbjct  375   IEKLRVNPVHLPLKVLEGGSLLEVSGVTAAQANVEISFRVANIEKIEVLNQDVTQINPQM  434

Query  587   LCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKK  408
             LCSQKGASV+G +GPFGL V A +  QE+T++FFR+F   N   VVLMCSDQ+RSSL+  
Sbjct  435   LCSQKGASVKGSLGPFGLHVFALKGMQEHTSIFFRIFKVQNKY-VVLMCSDQSRSSLNPT  493

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
             T+KT YG F+DV+P+ EELSLR LIDHSIVESFG KGK CIT+RVYP  AI E A LYAF
Sbjct  494   TNKTIYGTFLDVDPLHEELSLRCLIDHSIVESFGGKGKSCITARVYPELAINEAASLYAF  553

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             NNG  S+ +++L+AWSMKK  IN
Sbjct  554   NNGSESVTITRLSAWSMKKAKIN  576



>gb|KEH18387.1| cell-wall invertase [Medicago truncatula]
Length=578

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/560 (59%), Positives = 433/560 (77%), Gaps = 8/560 (1%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYP-NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             G +  +A+H V +NL++L         YRT++HFQPP+NW+NDPNGP+ YKG+YH FYQY
Sbjct  20    GILPIEATHHVYRNLQSLSSDDSFKQPYRTAYHFQPPKNWINDPNGPLSYKGLYHLFYQY  79

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HS S DLVNW    PA+ PSQP+ DING WSGSATIL  N PA+LYT
Sbjct  80    NPKGAVWGNIVWAHSVSTDLVNWTPLDPAIFPSQPS-DINGCWSGSATILHGNKPAILYT  138

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D  N QVQN+A P+N SDP+L+EW+KSP+NPL+ P   NKINA+SFRDPT+ W G DG
Sbjct  139   GIDPMNHQVQNIAYPKNLSDPFLREWIKSPKNPLMEPTSENKINASSFRDPTSGWLGKDG  198

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLD  1113
             NWRI++GSK   RG+AILY+SKDF+ W+++KHPLHS +G+GMWECPDF+PV      G+D
Sbjct  199   NWRIIIGSKRNTRGIAILYKSKDFINWIKSKHPLHSAKGTGMWECPDFFPVLKIGRFGVD  258

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDN--DSGLRYDYGKFYA  939
             TSL    ++HVLK+SLD+ +HDYY IGTY+  +DK++PDKG  +   +  LRYDYGK+YA
Sbjct  259   TSLNSDDVRHVLKVSLDDKKHDYYLIGTYNDEKDKFVPDKGFEEENIEQILRYDYGKYYA  318

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKTF+D  K RRIL GW+NES    + +K+GWSG+  IPRT+WL K+ KQL+QWPV E+E
Sbjct  319   SKTFFDDGKNRRILLGWVNESSSVADDIKKGWSGIHTIPRTIWLHKSGKQLIQWPVVEVE  378

Query  758   KLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCS  579
             KLR N V+ P+ +LK G +  ++G++AAQAD+E++F++    +AE + ++W TDPQ+LCS
Sbjct  379   KLRVNPVKWPTKILKGGELFPINGVTAAQADVEISFEVNNIREAEVL-DKW-TDPQILCS  436

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDK  399
             QKG SV+ G+GPFGL V AS+  QE+T+VFFR+F+    N +VL CSDQ+RSSL+K  D 
Sbjct  437   QKGTSVKSGLGPFGLLVFASKGLQEFTSVFFRIFIYQQKN-LVLFCSDQSRSSLNKDNDM  495

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
             T+YG F+DV+ + E+LSLR LIDHS+VESFG +GK CITSRVYPT AI +KA +YAFNNG
Sbjct  496   TTYGTFIDVDILHEKLSLRSLIDHSVVESFGGEGKACITSRVYPTLAINDKALIYAFNNG  555

Query  218   VHSIKLSKLTAWSMKKPTIN  159
               ++K+++L+AWSMKK  +N
Sbjct  556   TTNVKITRLSAWSMKKAQLN  575



>ref|XP_010685379.1| PREDICTED: fructan 6-exohydrolase [Beta vulgaris subsp. vulgaris]
 sp|Q70XE6.1|6FEH_BETVU RecName: Full=Fructan 6-exohydrolase; Flags: Precursor [Beta 
vulgaris]
 emb|CAD48404.1| fructan 6-exohydrolase [Beta vulgaris]
Length=606

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/534 (62%), Positives = 422/534 (79%), Gaps = 7/534 (1%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF-GKISWGHSTSKDLVNWRAH  1572
             YRT++HFQ P+NWMNDPNGPM+YKG+YH FYQY P    +  +I WGHSTS DL+NW   
Sbjct  55    YRTAYHFQSPKNWMNDPNGPMIYKGIYHLFYQYYPYDPVWHTEIVWGHSTSTDLINWTQQ  114

Query  1571  IPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEW  1392
               ALSPS+P  DING WSGS TILP N P +LYTG++++N QVQNLA+P+N SDPYL+EW
Sbjct  115   PIALSPSEPY-DINGCWSGSITILPQNKPVILYTGINNKNYQVQNLALPKNLSDPYLKEW  173

Query  1391  VKSPRNPLIA--PNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             +K P+NPL+A  P + N INA+SFRDP+TAW+  DG WR++VG++ G+RGLA+L+ S DF
Sbjct  174   IKLPQNPLMAGTPTNNNNINASSFRDPSTAWQLSDGKWRVIVGTQQGKRGLAVLFTSDDF  233

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVGSKIKHVLKISLDESRHDYY  1041
             V+W    +PLHS EG+G+WECPDF+PV    + G DTS++G  +KHVLK+SL +++++YY
Sbjct  234   VKWNNTGNPLHSTEGNGIWECPDFFPVYVGKSLGADTSIIGDDVKHVLKLSLFDTQYEYY  293

Query  1040  TIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTE  861
             TIG YD  +D Y+PD+GS+++D GLRYDYGKFYASK+F+D    RRILWGW+NES I  +
Sbjct  294   TIGRYDIEKDIYVPDEGSIESDLGLRYDYGKFYASKSFFDDETNRRILWGWVNESSIQAD  353

Query  860   YVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGIS  681
              +K+GWSGVQ IPRTV LDK+ KQLVQWP+ E++ LR N VE+PS ++K GS+ E+S I+
Sbjct  354   DIKKGWSGVQAIPRTVVLDKSGKQLVQWPLAEVDMLRENDVELPSQVIKGGSLVEISQIT  413

Query  680   AAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEY  501
             A+QAD+E++FKI E    E+++    T+PQ+LCSQKGAS++G  GPFGL  LAS   +EY
Sbjct  414   ASQADVEISFKIPESNYVEELDST-CTNPQILCSQKGASIKGRFGPFGLLTLASMGLEEY  472

Query  500   TAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSI  321
             TAVFFR+F G N   VVLMCSDQTRSSL+  TDK S+G FVDV+P+ E+LSLRILIDHSI
Sbjct  473   TAVFFRIFKGPNKY-VVLMCSDQTRSSLNPTTDKLSFGIFVDVDPINEDLSLRILIDHSI  531

Query  320   VESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             VESF AKGK CIT+RVYPT AI +KA LY FNNG   +K++KL+AWSMKK  IN
Sbjct  532   VESFSAKGKSCITARVYPTMAINDKAKLYVFNNGTEDVKITKLSAWSMKKAQIN  585



>ref|NP_566464.1| beta-fructofuranosidase, insoluble isoenzyme CWINV1 [Arabidopsis 
thaliana]
 sp|Q43866.1|INV1_ARATH RecName: Full=Beta-fructofuranosidase, insoluble isoenzyme CWINV1; 
AltName: Full=Cell wall beta-fructosidase 1; Short=AtbetaFRUCT1; 
AltName: Full=Cell wall invertase 1; Short=AtcwINV1; 
AltName: Full=Sucrose hydrolase 1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA52619.1| beta-fructofuranosidase [Arabidopsis thaliana]
 emb|CAA52620.1| beta-fructofuranosidase [Arabidopsis thaliana]
 gb|AAK76450.1| putative beta-fructofuranosidase 1 [Arabidopsis thaliana]
 gb|AAL85153.1| putative beta-fructofuranosidase 1 [Arabidopsis thaliana]
 gb|AEE75414.1| beta-fructofuranosidase, insoluble isoenzyme CWINV1 [Arabidopsis 
thaliana]
Length=584

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/564 (60%), Positives = 429/564 (76%), Gaps = 13/564 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V  +ASH V + L      + P  N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+
Sbjct  24    VNLEASHHVYKRLTQSTNTKSPSVNQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQW  83

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL+NW  H PA+ PS P  DING WSGSATILPN  P +LYT
Sbjct  84    NPKGAVWGNIVWAHSTSTDLINWDPHPPAIFPSAPF-DINGCWSGSATILPNGKPVILYT  142

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL+EW KSP NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  143   GIDPKNQQVQNIAEPKNLSDPYLREWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGQDK  202

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+    NG++
Sbjct  203   KWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSNGVE  262

Query  1112  TSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             TS  G     +KHVLKISLD+++HDYYTIGTYD V+DK++PD G   + +  RYDYGK+Y
Sbjct  263   TSSFGEPNEILKHVLKISLDDTKHDYYTIGTYDRVKDKFVPDNGFKMDGTAPRYDYGKYY  322

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTF+DS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+
Sbjct  323   ASKTFFDSAKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREV  382

Query  761   EKLRSNKVE-MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             E+LR+ +V+ + + +LK GS  EV G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++
Sbjct  383   ERLRTKQVKNLRNKVLKSGSRLEVYGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLI  441

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDK  411
             CS+   SV+ G+GPFGL VLAS+N +EYT+V+FR+F    N+N  VVLMCSDQ+RSSL +
Sbjct  442   CSKMNVSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKARQNSNKYVVLMCSDQSRSSLKE  501

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YGAFVD+NP Q  LSLR LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+A
Sbjct  502   DNDKTTYGAFVDINPHQ-PLSLRALIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFA  560

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN G  S+ +  L AWSM    I+
Sbjct  561   FNYGYQSVDVLNLNAWSMNSAQIS  584



>ref|XP_010534898.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Tarenaya hassleriana]
Length=584

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/552 (61%), Positives = 426/552 (77%), Gaps = 10/552 (2%)
 Frame = -1

Query  1793  LQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISW  1614
              Q+ +A  PP PN  YRT +HFQPP+NWMNDPNGPM+YKG+YH FYQYNP GA +G I W
Sbjct  36    FQSSKAKSPP-PNQPYRTGYHFQPPKNWMNDPNGPMLYKGIYHLFYQYNPNGAVWGNIVW  94

Query  1613  GHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVD-SRNRQVQN  1437
             GHSTS DLVNW  H PA+SPS+P  D  G WSGS TIL +  P +LYTGV  + N Q QN
Sbjct  95    GHSTSTDLVNWVPHPPAISPSEPY-DAGGCWSGSVTILLDGKPVILYTGVHGTDNIQTQN  153

Query  1436  LAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG  1257
             LA P N SDP+L++W KSP NPL+AP   N INATSFRDPTTAW   DG WR+++GSK+ 
Sbjct  154   LAEPTNLSDPFLRQWSKSPANPLMAPTAANSINATSFRDPTTAWLSLDGKWRVIIGSKID  213

Query  1256  RRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVGSK--IK  1086
             RRGLAILY SKDFV W ++  PLHS +G+GMWECPDFYPV+   + G++TS  G    IK
Sbjct  214   RRGLAILYTSKDFVNWTESPEPLHSDDGTGMWECPDFYPVARFGSLGVETSSFGGPPLIK  273

Query  1085  HVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRR  906
             HVLK+SLD+++HDYYTIGTYD V+D Y+PDKG   N S  RYDYGK+YASKTFYD LK R
Sbjct  274   HVLKMSLDDTKHDYYTIGTYDRVKDVYVPDKGFAQNGSAPRYDYGKYYASKTFYDPLKNR  333

Query  905   RILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPS  726
             R+LWGW+NES      V++GWSG+Q IPR +WLD++ KQL+QWP++E+EKLR+ +V+ P 
Sbjct  334   RVLWGWVNESSPVVNDVEKGWSGLQAIPRKIWLDRSGKQLIQWPIKEIEKLRATQVKWPY  393

Query  725   TMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIG  546
              +L+  SV EVSGI+A+QAD+EV+FK+    KA+++E  W TD Q++CS++  SV+ G+G
Sbjct  394   KVLEAESVLEVSGITASQADVEVSFKVRGLEKADEIEPDW-TDAQLICSEQNESVKAGLG  452

Query  545   PFGLKVLASENRQEYTAVFFRVFMGNN--NNPVVLMCSDQTRSSLDKK-TDKTSYGAFVD  375
             PFGL VLAS++ +EYT+V+FR+F  +N  N  VV+MCSDQ+RSSL+++  D+T+YGAFVD
Sbjct  453   PFGLMVLASKSLEEYTSVYFRIFKAHNDSNKYVVVMCSDQSRSSLEQEDNDRTTYGAFVD  512

Query  374   VNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSK  195
             ++P  + LSLR LIDHSIVESFG +G+ CIT+R+YP  AIGE+AHLY FNNG  S+ LS 
Sbjct  513   IDPFLQPLSLRTLIDHSIVESFGGRGEACITARIYPKLAIGEEAHLYVFNNGRQSVHLSS  572

Query  194   LTAWSMKKPTIN  159
             L+AW+M    IN
Sbjct  573   LSAWTMATAHIN  584



>ref|XP_009146448.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1 
[Brassica rapa]
Length=583

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/563 (60%), Positives = 428/563 (76%), Gaps = 12/563 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V+ +ASH V + L     ++ P  N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+
Sbjct  24    VDLEASHHVYKRLTQSTNIKSPSVNQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQW  83

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL+NW  H  A+ PS+P  DING WSGSATILP+  P +LYT
Sbjct  84    NPKGAVWGNIVWAHSTSTDLINWDPHPAAIFPSEPF-DINGCWSGSATILPDGKPVILYT  142

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL EW KSP NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  143   GIDPKNQQVQNIAEPKNLSDPYLVEWTKSPLNPLMAPDAVNGINASSFRDPTTAWLGHDK  202

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ RRGLAI Y SKD ++W ++  PLH  +GSGMWECPDF+PV+     G++
Sbjct  203   KWRVIIGSKIHRRGLAITYTSKDLLKWEKSTEPLHYDDGSGMWECPDFFPVTRFGSKGVE  262

Query  1112  TSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             TS  G     +KHVLK+SLD+++HDYYT+GTYD V DK++PDKG   + S  RYDYGK+Y
Sbjct  263   TSSFGEPNEVLKHVLKVSLDDTKHDYYTLGTYDRVGDKFVPDKGFKMDSSAPRYDYGKYY  322

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+
Sbjct  323   ASKTFYDSAKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREV  382

Query  761   EKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
             E+LR+N+V + + +L   S  EV G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++C
Sbjct  383   ERLRTNQVNLRNKVLDSRSRLEVYGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLIC  441

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDKK  408
             SQ   SV+ G+GPFGL VLAS+N +EYT+V+FR+F    N+N  VV+MCSDQ+RSSL + 
Sbjct  442   SQMNVSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKARQNSNKYVVVMCSDQSRSSLKED  501

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
              DKT+YGAFVDVNP Q  LSLR LID+S+VESFG +G+ CITSRVYP  AIG+ +HLYAF
Sbjct  502   NDKTTYGAFVDVNPRQ-PLSLRALIDNSVVESFGGRGRACITSRVYPKLAIGKGSHLYAF  560

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             N G  S+ +  L+AWSMK   I+
Sbjct  561   NYGSQSVDVLSLSAWSMKSAQIS  583



>ref|XP_010685381.1| PREDICTED: fructan 6-exohydrolase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
 emb|CAD19322.1| exocellular acid invertase 1 [Beta vulgaris]
Length=567

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/546 (61%), Positives = 421/546 (77%), Gaps = 5/546 (1%)
 Frame = -1

Query  1793  LQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISW  1614
             +  L+A + P  N  YRT++HFQP +NW+NDPNGPM+YKGVYH FYQYNP G  +G   W
Sbjct  24    VSELQAARSPPTNQPYRTAYHFQPRKNWINDPNGPMLYKGVYHLFYQYNPNGVIWGPPVW  83

Query  1613  GHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNL  1434
             GHSTSKDLVNW      + P   AA+ING+WSGSATILP N PA+L+TG+D +  QVQ L
Sbjct  84    GHSTSKDLVNWVPQPLTMEPEM-AANINGSWSGSATILPGNKPAILFTGLDPKYEQVQVL  142

Query  1433  AVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGR  1254
             A P++ SDP L+EW  +P+NP++ P   N+INATSFRDPTTAWR PDG WR+L+GSK G+
Sbjct  143   AYPKDTSDPNLKEWFLAPQNPVMFPTPQNQINATSFRDPTTAWRLPDGVWRLLIGSKRGQ  202

Query  1253  RGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN--GLDTSLVGSKIKHV  1080
             RGL++L+RS+DFV WVQAKHPL+S + SGMWECPDF+PV  + +  G+DTS++GS +KHV
Sbjct  203   RGLSLLFRSRDFVHWVQAKHPLYSDKLSGMWECPDFFPVYANGDQMGVDTSIIGSHVKHV  262

Query  1079  LKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRI  900
             LK SLD ++HD YTIG Y+  +D Y PD G + NDS LRYDYGK+YASKTF++  K+ RI
Sbjct  263   LKNSLDITKHDIYTIGDYNIKKDAYTPDIGYM-NDSSLRYDYGKYYASKTFFNDAKKERI  321

Query  899   LWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTM  720
             L GW NES    + +K+GWSG+  IPR +WLDK  KQL+QWP+  +EKLR N V +   +
Sbjct  322   LLGWANESSSVEDDIKKGWSGIHTIPRKIWLDKLGKQLIQWPIANIEKLRQNPVNIFRKV  381

Query  719   LKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPF  540
             LKKGS  EVSGI+AAQAD E++FKI +    EK +  WT+ PQ+LCS+KGASV+GG+GPF
Sbjct  382   LKKGSQIEVSGITAAQADAEISFKIKDLKNVEKFDASWTS-PQLLCSKKGASVKGGLGPF  440

Query  539   GLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQ  360
             GL  LAS+  +EYTAVFFR+F   +N  VVLMCSDQ+RSSL+   DKT+YG FVDVNP++
Sbjct  441   GLLTLASKGLEEYTAVFFRIFKAYDNKFVVLMCSDQSRSSLNPTNDKTTYGTFVDVNPIR  500

Query  359   EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWS  180
             E LSLR+LIDHS+VESFGAKGK  IT+RVYPT AI EKAHLY FN G  +++++ LTAWS
Sbjct  501   EGLSLRVLIDHSVVESFGAKGKNVITARVYPTLAINEKAHLYVFNRGTSNVEITGLTAWS  560

Query  179   MKKPTI  162
             MKK  I
Sbjct  561   MKKANI  566



>gb|KHN11275.1| Beta-fructofuranosidase, cell wall isozyme [Glycine soja]
Length=561

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/553 (60%), Positives = 432/553 (78%), Gaps = 10/553 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
             + A+H V +NL+++     N  YRT++HFQPP NW+N   GP+ Y G+YH FYQYNPKGA
Sbjct  18    SAATHHVYRNLQSVSSDSSNQPYRTAYHFQPPNNWIN---GPLRYGGLYHLFYQYNPKGA  74

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS SKDLVNW    PA+ PSQ ++DING WSGSAT+LP N PA+LYTG+DS 
Sbjct  75    VWGNIVWAHSVSKDLVNWTPLDPAIFPSQ-SSDINGCWSGSATLLPGNKPAILYTGIDSL  133

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             N+QVQN A P+N SDP+L+EWVKSP+NPL+AP   NKIN++SFRDPTTAW G DG+WR+L
Sbjct  134   NQQVQNFAQPKNLSDPFLREWVKSPKNPLMAPTSANKINSSSFRDPTTAWLGKDGHWRVL  193

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLDTSLVG  1098
             VGSK   RG+AILYRSKDFV+WVQAKHPLHS  GSGMWECPDF+PV S    G+DTS+ G
Sbjct  194   VGSKRRTRGMAILYRSKDFVKWVQAKHPLHSTLGSGMWECPDFFPVLSNGQLGVDTSVNG  253

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               ++HVLK+SLD+ +HDYY IG+Y+  +D +IPD+ S  N   LRYDYGK+YASKTF+D 
Sbjct  254   EYVRHVLKVSLDDKKHDYYMIGSYNAAKDAFIPDEES--NIFVLRYDYGKYYASKTFFDD  311

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRIL GW+NES    + +K+GWSG+  IPR +WL K+ +QLVQWPV+E+EKLR+  V
Sbjct  312   GKKRRILLGWVNESSSVADDIKKGWSGIHTIPRAIWLHKSGRQLVQWPVEEVEKLRAYPV  371

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              +   +LK G +  ++G++A+QAD+E++F++ +  KAE ++  + TDPQ+LCS+KG+SV+
Sbjct  372   NLLPQVLKGGKLLPINGVTASQADVEISFEVSKLRKAEVLD--YWTDPQILCSKKGSSVK  429

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
              G+GPFGL V ASE  QEYT+VFFR+F  + +  +VL+CSDQ RSSL+K  D TSYG FV
Sbjct  430   SGLGPFGLLVFASEGLQEYTSVFFRIFR-HQHKYLVLLCSDQNRSSLNKDNDLTSYGTFV  488

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             DV+P+ ++LSLR LIDHS+VESFG +G+ CIT+RVYPT AI +KA LYAFNNG   +K++
Sbjct  489   DVDPLHDKLSLRTLIDHSVVESFGGEGRACITARVYPTLAINDKAQLYAFNNGTADVKIT  548

Query  197   KLTAWSMKKPTIN  159
             +L+AWSMKK  I+
Sbjct  549   RLSAWSMKKAQIH  561



>ref|XP_004510389.1| PREDICTED: beta-fructofuranosidase, cell wall isozyme-like [Cicer 
arietinum]
Length=573

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/561 (58%), Positives = 431/561 (77%), Gaps = 8/561 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEAL--QPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFY  1656
             YG +  +A+H V +NL++L       +  YRTS+HFQPP+NW+NDPNGPM YKG+YH FY
Sbjct  15    YGILPIEATHHVFRNLQSLSSHDSSNDQPYRTSYHFQPPKNWINDPNGPMSYKGLYHLFY  74

Query  1655  QYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALL  1476
             QYNPKGA +G I W HS S DL+NW     A+SPSQP+ DING WSGS TIL    PA+L
Sbjct  75    QYNPKGAVWGNIVWAHSVSTDLINWTPLDQAISPSQPS-DINGCWSGSTTILNGTKPAIL  133

Query  1475  YTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP  1296
             YTG+D  N QVQNLA P+N SDP+L++W+KS +NP++ P   N INA+SFRDPT+ W G 
Sbjct  134   YTGIDQFNHQVQNLAYPKNLSDPFLRDWIKSKKNPVMEPTSINMINASSFRDPTSGWLGK  193

Query  1295  DGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNG  1119
             DG+WR++VGSK   RG+AILYRSKDF+ W++AKHPL+S +G+GMWECPDFYPV   S  G
Sbjct  194   DGHWRVIVGSKRDTRGIAILYRSKDFINWIEAKHPLYSSKGTGMWECPDFYPVLKFSSIG  253

Query  1118  LDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVD-NDSGLRYDYGKFY  942
             +DTSL    ++HVLK+SLD+ +HDYY IG+YD  +D ++PDKG  + ++  LRYDYGK+Y
Sbjct  254   VDTSLNNDDVRHVLKVSLDDKKHDYYLIGSYDDGKDNFVPDKGFQNTSEFFLRYDYGKYY  313

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTF+D  K RRIL GW+NES    + +K+GWSG+  IPR +WL K+ KQLVQWPV E+
Sbjct  314   ASKTFFDDQKNRRILLGWVNESSTVADDIKKGWSGIHTIPRAIWLHKSGKQLVQWPVVEV  373

Query  761   EKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
             EKLR N V +P  +LK G + +++G++AAQAD+E++F++   G+AE ++  W TDPQ+LC
Sbjct  374   EKLRVNLVNLPPKVLKGGELLQINGVTAAQADVEISFEVNNIGEAEVLDN-W-TDPQILC  431

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD  402
             SQKG+SV+ G+GPFGL V AS+  QE+T+VFFR+F   + N +VL CSDQ+RSSL+K  D
Sbjct  432   SQKGSSVKSGLGPFGLLVFASKGLQEFTSVFFRIFRYQHKN-LVLFCSDQSRSSLNKDND  490

Query  401   KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNN  222
              T+YG F+DV+ + E+LSLR LIDHS+VESFG +GK CIT+RVYPT AI +KA LYAFNN
Sbjct  491   MTTYGTFIDVDVVHEKLSLRSLIDHSVVESFGGEGKACITARVYPTLAINDKAQLYAFNN  550

Query  221   GVHSIKLSKLTAWSMKKPTIN  159
             G   +K+++L+AWSMKK  +N
Sbjct  551   GTTDVKINRLSAWSMKKAQLN  571



>ref|XP_004486839.1| PREDICTED: beta-fructofuranosidase, cell wall isozyme-like [Cicer 
arietinum]
Length=578

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/562 (59%), Positives = 429/562 (76%), Gaps = 12/562 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNL-EALQPPYP-NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             +  +A+H V   L E+L   Y  N  YRT++HFQP +NW+NDPNGPM Y G+YH FYQYN
Sbjct  21    IPIEATHHVYTTLDESLSSEYSSNQPYRTAYHFQPLKNWINDPNGPMRYGGLYHLFYQYN  80

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKDLVNW     A+ PSQP+ DING WSGSAT+LP   P +LYTG
Sbjct  81    PKGAVWGNIVWAHSVSKDLVNWTPLDHAIHPSQPS-DINGCWSGSATLLPGGKPVILYTG  139

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             +D  N QVQNLA+P+N SDP L+EW KSP+NPL+ P   NKIN++SFRDPTTAW G DG 
Sbjct  140   IDPNNHQVQNLAIPKNISDPLLREWKKSPKNPLMQPTFSNKINSSSFRDPTTAWLGKDGF  199

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN---GL  1116
             WR+L+GSK+  +G+AILY+SK+FV WV+AKHPLHS EG+GMWECPDFYPV        G+
Sbjct  200   WRVLIGSKINTKGMAILYKSKNFVNWVEAKHPLHSAEGTGMWECPDFYPVLNQNKLTIGV  259

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSG---LRYDYGKF  945
             DTS+ G  +KHVLK+SLD+++HD+Y IGTYD V+D ++PD   ++ +     LRYDYGK+
Sbjct  260   DTSVNGDYVKHVLKVSLDDTKHDHYLIGTYDAVKDIFVPDNHGLEGNHQYFELRYDYGKY  319

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASKTF+D  K RR+L GW+NES    + VK+GWSG+  IPR +WL K+ KQLVQWPV+E
Sbjct  320   YASKTFFDDGKNRRVLLGWVNESSSVADDVKKGWSGIHTIPRAIWLHKSGKQLVQWPVKE  379

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             +E LR N V  P+ ++K G +  ++G++  QAD+E++F++ + GKAE ++     DPQ+L
Sbjct  380   IENLRMNPVNWPTKVIKGGELIPITGVNPVQADVEISFEVNDVGKAEILDH--MIDPQIL  437

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKT  405
             CSQKGA+V+G +GPFGL V+AS+  QEYTAVFFR+F   + N +VLMCSDQ+RSSL+K+ 
Sbjct  438   CSQKGAAVKGRVGPFGLLVVASKGLQEYTAVFFRIFRYQHKN-LVLMCSDQSRSSLNKEN  496

Query  404   DKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFN  225
             D T+YG FVDV+P+ E+LSLR LIDHS+VESFG +G+ CIT+RVYPT AI +KA LYAFN
Sbjct  497   DMTTYGTFVDVDPLHEKLSLRSLIDHSVVESFGGEGRACITARVYPTLAIHDKAMLYAFN  556

Query  224   NGVHSIKLSKLTAWSMKKPTIN  159
             NG  ++K+++L AWSMKK  IN
Sbjct  557   NGTSAVKITRLNAWSMKKAKIN  578



>ref|XP_010542426.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Tarenaya hassleriana]
Length=568

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/540 (61%), Positives = 424/540 (79%), Gaps = 9/540 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             N  YRT +HFQPP+NWMNDPNGPM+YKG+YH FYQ+NP GA +G I WGHSTS DLVNW 
Sbjct  30    NQPYRTGYHFQPPKNWMNDPNGPMLYKGIYHLFYQWNPNGAVWGNIVWGHSTSTDLVNWV  89

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
              H PA+SPSQP+ DING W+GSATILP   P + YTG+D  NRQVQNLAVP+N SDP+L+
Sbjct  90    RHPPAISPSQPS-DINGCWAGSATILPGGKPVVFYTGMDHMNRQVQNLAVPKNLSDPFLR  148

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGR-RGLAILYRSKD  1221
             EW KSP NPL+AP   N I+  +FRDPTTAW G DG+WR+++GSK+ R RGLAILY+SKD
Sbjct  149   EWSKSPENPLLAPTADNGIDPDNFRDPTTAWLGHDGHWRVIIGSKMDRGRGLAILYKSKD  208

Query  1220  FVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGS--KIKHVLKISLDESRH  1050
             F+ WV++  PLHS +G+G+WECPDF+PV+ S   G+DTS  G+  ++KHVLKIS+ E  H
Sbjct  209   FINWVKSPEPLHSDDGTGVWECPDFFPVARSGSTGIDTSSFGTAPRVKHVLKISVAELAH  268

Query  1049  DYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLI  870
             D YT+GTYD  RD Y+PDKG V N S  R+DYGKFYASKTF+D+  RRRILWGW+NES  
Sbjct  269   DCYTVGTYDRTRDVYVPDKGFVRNRSAPRFDYGKFYASKTFFDAATRRRILWGWVNESSP  328

Query  869   DTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPS-TMLKKGSVSEV  693
             + + +++GWSG+Q IPR +WL  + KQL+QWP+ E+EKLR+ +V+  +  +++KGS+ EV
Sbjct  329   EKDDIEKGWSGLQAIPRKIWLGGSGKQLIQWPIMEIEKLRAKQVKWRNKVLMEKGSILEV  388

Query  692   SGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASEN  513
              GI+A+QAD+EV+F+  +  KA+ +E  W TD Q++CSQ+  SV+ G+GPFGL VLAS+N
Sbjct  389   HGITASQADVEVSFEARDLEKADPIEPGW-TDAQLICSQENESVKTGLGPFGLMVLASKN  447

Query  512   RQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRI  339
              +EYT+V+FR+F   N++   VV+MCSDQ+RSSL+K  D+T+YGAFVD+NP  + +SLR 
Sbjct  448   LEEYTSVYFRIFKARNDSDGYVVVMCSDQSRSSLNKNNDRTTYGAFVDINPSYQPISLRT  507

Query  338   LIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             LIDHSIVES+G +GK CITSRVYP  AIGE +HLY FN G  S++LS L+AW+MK   IN
Sbjct  508   LIDHSIVESYGGRGKACITSRVYPKMAIGESSHLYVFNRGSQSVRLSTLSAWNMKTAHIN  567



>gb|ABD28503.1| Sialidase [Medicago truncatula]
 gb|AES67844.2| cell-wall invertase [Medicago truncatula]
Length=572

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/559 (60%), Positives = 430/559 (77%), Gaps = 12/559 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPNHT--YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             +  +A+H V + LE+      +H   YRT++HFQP +NW+N   GPM Y G+YH FYQYN
Sbjct  21    IPIEATHHVYRTLESSSSYSSHHDQPYRTAYHFQPLKNWIN---GPMRYGGLYHLFYQYN  77

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKDLVNW     A+ PSQP+ DI G WSGSATILP   PA+LYTG
Sbjct  78    PKGAVWGNIVWAHSASKDLVNWTPLDHAIHPSQPS-DIKGCWSGSATILPGGKPAILYTG  136

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             +D  N QVQN+A+P+N SDP L+EW KSP+NPL+ P   NKINA+SFRDPTT+W G DG 
Sbjct  137   IDPNNHQVQNIAIPKNMSDPLLREWKKSPKNPLMEPTVANKINASSFRDPTTSWLGKDGY  196

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS---PNGL  1116
             WR+L+GSKV R+G+AI+Y+SK+FV W +AKHPLHS EG+GMWECPDF+PV        GL
Sbjct  197   WRVLIGSKVHRKGIAIMYKSKNFVDWFEAKHPLHSAEGTGMWECPDFFPVLNKNPLTIGL  256

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS+ G  ++HVLK+SLD+++HD+Y IGTYD V+D ++PD G  +N + LRYDYGK+YAS
Sbjct  257   DTSVNGDDVRHVLKVSLDDTKHDHYLIGTYDTVKDVFVPDNGFENNQNVLRYDYGKYYAS  316

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+D  K RRIL GW NES    + VK+GWSG+  IPR +WL K+ KQLVQWPV+ELE 
Sbjct  317   KTFFDDGKNRRILLGWANESSSVVDDVKKGWSGIHTIPRVIWLHKSGKQLVQWPVKELEN  376

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQ  576
             LR N V  P+ ++K G +  ++G+++ QAD+E++F++ +FGKAE + ++W  DPQ+LCSQ
Sbjct  377   LRMNPVNWPTKVIKGGELIPITGVNSVQADVEISFEVKDFGKAELL-DKW-IDPQILCSQ  434

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKT  396
             KGASV+GG+GPFGL V AS+  QEYTAVFFR+F   + N +VLMCSDQ+RSSL+K+ D T
Sbjct  435   KGASVKGGVGPFGLHVFASKGLQEYTAVFFRIFRYQHKN-LVLMCSDQSRSSLNKENDMT  493

Query  395   SYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGV  216
             +YG FVDV+P+ E+LSLR LIDHS+VESFG +G+ CIT+RVYPT AI +KA LYAFNNG 
Sbjct  494   TYGTFVDVDPLHEKLSLRTLIDHSVVESFGGEGRACITARVYPTLAIHDKALLYAFNNGN  553

Query  215   HSIKLSKLTAWSMKKPTIN  159
              ++K+++L AWSMKK  IN
Sbjct  554   SAVKITRLNAWSMKKAKIN  572



>pdb|2AC1|A Chain A, Crystal Structure Of A Cell-Wall Invertase From Arabidopsis 
Thaliana
Length=541

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/543 (61%), Positives = 420/543 (77%), Gaps = 10/543 (2%)
 Frame = -1

Query  1766  PYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLV  1587
             P  N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+NPKGA +G I W HSTS DL+
Sbjct  2     PSVNQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQWNPKGAVWGNIVWAHSTSTDLI  61

Query  1586  NWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDP  1407
             NW  H PA+ PS P  DING WSGSATILPN  P +LYTG+D +N+QVQN+A P+N SDP
Sbjct  62    NWDPHPPAIFPSAPF-DINGCWSGSATILPNGKPVILYTGIDPKNQQVQNIAEPKNLSDP  120

Query  1406  YLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRS  1227
             YL+EW KSP NPL+AP+  N INA+SFRDPTTAW G D  WR+++GSK+ RRGLAI Y S
Sbjct  121   YLREWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGQDKKWRVIIGSKIHRRGLAITYTS  180

Query  1226  KDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGSK---IKHVLKISLDE  1059
             KDF++W ++  PLH  +GSGMWECPDF+PV+    NG++TS  G     +KHVLKISLD+
Sbjct  181   KDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSNGVETSSFGEPNEILKHVLKISLDD  240

Query  1058  SRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINE  879
             ++HDYYTIGTYD V+DK++PD G   + +  RYDYGK+YASKTF+DS K RRILWGW NE
Sbjct  241   TKHDYYTIGTYDRVKDKFVPDNGFKMDGTAPRYDYGKYYASKTFFDSAKNRRILWGWTNE  300

Query  878   SLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE-MPSTMLKKGSV  702
             S    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+E+LR+ +V+ + + +LK GS 
Sbjct  301   SSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVERLRTKQVKNLRNKVLKSGSR  360

Query  701   SEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLA  522
              EV G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++CS+   SV+ G+GPFGL VLA
Sbjct  361   LEVYGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLICSKMNVSVKSGLGPFGLMVLA  419

Query  521   SENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELS  348
             S+N +EYT+V+FR+F    N+N  VVLMCSDQ+RSSL +  DKT+YGAFVD+NP Q  LS
Sbjct  420   SKNLEEYTSVYFRIFKARQNSNKYVVLMCSDQSRSSLKEDNDKTTYGAFVDINPHQ-PLS  478

Query  347   LRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKP  168
             LR LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+AFN G  S+ +  L AWSM   
Sbjct  479   LRALIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFAFNYGYQSVDVLNLNAWSMNSA  538

Query  167   TIN  159
              I+
Sbjct  539   QIS  541



>ref|XP_004297561.1| PREDICTED: fructan 6-exohydrolase-like [Fragaria vesca subsp. 
vesca]
Length=593

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/532 (62%), Positives = 414/532 (78%), Gaps = 5/532 (1%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KISWGHSTSKDLVNWRAH  1572
             YRT +HFQP +NWMNDPNGPMVYK VYH FYQYNP G ++   I W HSTS DLVNW  H
Sbjct  51    YRTGYHFQPCKNWMNDPNGPMVYKNVYHHFYQYNPDGVAWSPNIVWAHSTSTDLVNWTPH  110

Query  1571  IPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEW  1392
               AL PS+P  DING WSGSATILP   PA+ YTG++S+  QVQNLA P+N SDP+L+EW
Sbjct  111   DEALYPSEPF-DINGCWSGSATILPGEKPAMFYTGINSQTEQVQNLAFPKNLSDPFLREW  169

Query  1391  VKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVR  1212
             +K P+NPL+ P   N+I   SFRDPTTAW G D  WR+++GS+  + GLAILY S+DF+ 
Sbjct  170   IKIPQNPLMMPTQANQIIVDSFRDPTTAWLGSDNRWRLVIGSRKNQTGLAILYTSEDFLN  229

Query  1211  WVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYYTI  1035
             W  A HP HS + +GMWECPDF+PVS S P GLDTS  G+ +KHVLKISL +   +YYTI
Sbjct  230   WTMASHPFHSAKENGMWECPDFFPVSKSTPIGLDTSTNGADVKHVLKISLFDIAKEYYTI  289

Query  1034  GTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYV  855
             GTY+  +D YIPD+GSV++DSGLR+DYGKFYASK+F+DS+K RRILWGW NES    + +
Sbjct  290   GTYNLDKDVYIPDQGSVESDSGLRFDYGKFYASKSFFDSVKNRRILWGWSNESSSAEDDI  349

Query  854   KQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAA  675
             K+GWSG+Q IPRT+ LDK+ KQLVQWP++ELEKLR+  V++PS+++K GS+ EV G++  
Sbjct  350   KKGWSGLQTIPRTILLDKSGKQLVQWPIEELEKLRTEHVKLPSSLIKGGSLHEVLGVATT  409

Query  674   QADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTA  495
             QAD+EVTF+I  F KAE +++ W TDPQ+LCS K ASV G +GPFGL VLASE  QEYTA
Sbjct  410   QADVEVTFEISNFEKAEVLDQSW-TDPQILCSNKDASVDGSLGPFGLLVLASEGLQEYTA  468

Query  494   VFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVE  315
             VF+R++  +NN  VVLMCSDQ+RSSL++  DKT+YGAFV+V+P+ E+LSLR LIDHSIVE
Sbjct  469   VFYRIYKSHNNKYVVLMCSDQSRSSLNENNDKTTYGAFVNVDPVHEKLSLRSLIDHSIVE  528

Query  314   SFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             SFG +GKVCIT+RVYPT  +     LYAFN G  S+++S  +AWSM+   IN
Sbjct  529   SFGGEGKVCITARVYPTLVVDGDTRLYAFNYGRESVEISG-SAWSMETAMIN  579



>pdb|2XQR|A Chain A, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|C Chain C, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|E Chain E, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|G Chain G, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|I Chain I, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
 pdb|2XQR|K Chain K, Crystal Structure Of Plant Cell Wall Invertase In Complex 
With A Specific Protein Inhibitor
Length=537

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/540 (61%), Positives = 419/540 (78%), Gaps = 10/540 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+NPKGA +G I W HSTS DL+NW 
Sbjct  1     NQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQWNPKGAVWGNIVWAHSTSTDLINWD  60

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
              H PA+ PS P  DING WSGSATILPN  P +LYTG+D +N+QVQN+A P+N SDPYL+
Sbjct  61    PHPPAIFPSAPF-DINGCWSGSATILPNGKPVILYTGIDPKNQQVQNIAEPKNLSDPYLR  119

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW KSP NPL+AP+  N INA+SFRDPTTAW G D  WR+++GSK+ RRGLAI Y SKDF
Sbjct  120   EWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGQDKKWRVIIGSKIHRRGLAITYTSKDF  179

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGSK---IKHVLKISLDESRH  1050
             ++W ++  PLH  +GSGMWECPDF+PV+    NG++TS  G     +KHVLKISLD+++H
Sbjct  180   LKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSNGVETSSFGEPNEILKHVLKISLDDTKH  239

Query  1049  DYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLI  870
             DYYTIGTYD V+DK++PD G   + +  RYDYGK+YASKTF+DS K RRILWGW NES  
Sbjct  240   DYYTIGTYDRVKDKFVPDNGFKMDGTAPRYDYGKYYASKTFFDSAKNRRILWGWTNESSS  299

Query  869   DTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE-MPSTMLKKGSVSEV  693
               + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+E+LR+ +V+ + + +LK GS  EV
Sbjct  300   VEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVERLRTKQVKNLRNKVLKSGSRLEV  359

Query  692   SGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASEN  513
              G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++CS+   SV+ G+GPFGL VLAS+N
Sbjct  360   YGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLICSKMNVSVKSGLGPFGLMVLASKN  418

Query  512   RQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRI  339
              +EYT+V+FR+F    N+N  VVLMCSDQ+RSSL +  DKT+YGAFVD+NP Q  LSLR 
Sbjct  419   LEEYTSVYFRIFKARQNSNKYVVLMCSDQSRSSLKEDNDKTTYGAFVDINPHQ-PLSLRA  477

Query  338   LIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+AFN G  S+ +  L AWSM    I+
Sbjct  478   LIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFAFNYGYQSVDVLNLNAWSMNSAQIS  537



>pdb|2OXB|A Chain A, Crystal Structure Of A Cell-Wall Invertase (E203q) From 
Arabidopsis Thaliana In Complex With Sucrose
Length=537

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/540 (61%), Positives = 419/540 (78%), Gaps = 10/540 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+NPKGA +G I W HSTS DL+NW 
Sbjct  1     NQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQWNPKGAVWGNIVWAHSTSTDLINWD  60

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
              H PA+ PS P  DING WSGSATILPN  P +LYTG+D +N+QVQN+A P+N SDPYL+
Sbjct  61    PHPPAIFPSAPF-DINGCWSGSATILPNGKPVILYTGIDPKNQQVQNIAEPKNLSDPYLR  119

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW KSP NPL+AP+  N INA+SFRDPTTAW G D  WR+++GSK+ RRGLAI Y SKDF
Sbjct  120   EWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGQDKKWRVIIGSKIHRRGLAITYTSKDF  179

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGSK---IKHVLKISLDESRH  1050
             ++W ++  PLH  +GSGMW+CPDF+PV+    NG++TS  G     +KHVLKISLD+++H
Sbjct  180   LKWEKSPEPLHYDDGSGMWQCPDFFPVTRFGSNGVETSSFGEPNEILKHVLKISLDDTKH  239

Query  1049  DYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLI  870
             DYYTIGTYD V+DK++PD G   + +  RYDYGK+YASKTF+DS K RRILWGW NES  
Sbjct  240   DYYTIGTYDRVKDKFVPDNGFKMDGTAPRYDYGKYYASKTFFDSAKNRRILWGWTNESSS  299

Query  869   DTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE-MPSTMLKKGSVSEV  693
               + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+E+LR+ +V+ + + +LK GS  EV
Sbjct  300   VEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVERLRTKQVKNLRNKVLKSGSRLEV  359

Query  692   SGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASEN  513
              G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++CS+   SV+ G+GPFGL VLAS+N
Sbjct  360   YGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLICSKMNVSVKSGLGPFGLMVLASKN  418

Query  512   RQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRI  339
              +EYT+V+FR+F    N+N  VVLMCSDQ+RSSL +  DKT+YGAFVD+NP Q  LSLR 
Sbjct  419   LEEYTSVYFRIFKARQNSNKYVVLMCSDQSRSSLKEDNDKTTYGAFVDINPHQ-PLSLRA  477

Query  338   LIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+AFN G  S+ +  L AWSM    I+
Sbjct  478   LIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFAFNYGYQSVDVLNLNAWSMNSAQIS  537



>ref|XP_010062633.1| PREDICTED: fructan 6-exohydrolase-like [Eucalyptus grandis]
Length=515

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/518 (63%), Positives = 413/518 (80%), Gaps = 6/518 (1%)
 Frame = -1

Query  1709  MNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADIN  1530
              +DPNGPM+YKG+YH FYQYNPKGA +G I W HSTS DLVNW  H+PA+ PS+   D+N
Sbjct  3     FSDPNGPMIYKGIYHLFYQYNPKGAIWGNIVWAHSTSTDLVNWTPHVPAIVPSE-EYDVN  61

Query  1529  GAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHY  1350
             G WSGSATIL  + PA+LYTGV+ +N+QVQNLAVP+N SDPYL EWVKSP+NPL+ P   
Sbjct  62    GCWSGSATILQEHKPAILYTGVNRQNQQVQNLAVPKNLSDPYLIEWVKSPQNPLMEPTAM  121

Query  1349  NKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGS  1170
             N I+  SFRDPTTAW GPDG WR+++GS+  R G+AILYRS+DFV W +A HPL+S   +
Sbjct  122   NMISPDSFRDPTTAWVGPDGGWRVIIGSRSNRTGMAILYRSEDFVNWTKAGHPLYSANDT  181

Query  1169  GMWECPDFYPVST-SPNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDK  993
             GMWECPDF+PVS  +P GLDTS+ G  +KHVLK+S   S+ DYYTIGTY+ + + Y+P +
Sbjct  182   GMWECPDFFPVSAQAPVGLDTSINGPNVKHVLKVSY--SQQDYYTIGTYNSITNTYVPVE  239

Query  992   GSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTV  813
             GSVD++SGLRYDYGK+YASKTF+DS   RRILW WI ES  + + + +GWSG+Q IPRT+
Sbjct  240   GSVDSNSGLRYDYGKYYASKTFFDSKNNRRILWAWIKESSSEDDDINKGWSGIQAIPRTL  299

Query  812   WLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFG  633
             WLDK+ KQLVQWP+ E+EKLR+N+V++P+ +++ G++ EVSGI+AAQAD+ V+FK+ E  
Sbjct  300   WLDKSGKQLVQWPILEIEKLRTNQVDLPNQLIEGGAILEVSGITAAQADVVVSFKVKELE  359

Query  632   KAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPV  453
             +A+ ++  W TDPQ+LCS+KGA V+G +GPFGL V+AS+  QEYTAVFFR+F G N   V
Sbjct  360   RADSLDPTW-TDPQMLCSRKGALVKGSLGPFGLLVMASKGLQEYTAVFFRIFKGQNKY-V  417

Query  452   VLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRV  273
             VLMCSDQ+RSSL+   DKT+YGAF+DV+P+QE+LSLR LIDHSIVESFG  GK CIT+RV
Sbjct  418   VLMCSDQSRSSLNHSNDKTTYGAFLDVDPLQEKLSLRTLIDHSIVESFGGGGKSCITARV  477

Query  272   YPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             YP  A+ +  HL+ FNNG  S+ + KL+AWSMKK  IN
Sbjct  478   YPLLAVEDGTHLHIFNNGNQSVGVPKLSAWSMKKARIN  515



>pdb|2QQV|A Chain A, Crystal Structure Of A Cell-Wall Invertase (E203a) From 
Arabidopsis Thaliana In Complex With Sucrose
Length=537

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/540 (61%), Positives = 418/540 (77%), Gaps = 10/540 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+NPKGA +G I W HSTS DL+NW 
Sbjct  1     NQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQWNPKGAVWGNIVWAHSTSTDLINWD  60

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
              H PA+ PS P  DING WSGSATILPN  P +LYTG+D +N+QVQN+A P+N SDPYL+
Sbjct  61    PHPPAIFPSAPF-DINGCWSGSATILPNGKPVILYTGIDPKNQQVQNIAEPKNLSDPYLR  119

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW KSP NPL+AP+  N INA+SFRDPTTAW G D  WR+++GSK+ RRGLAI Y SKDF
Sbjct  120   EWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGQDKKWRVIIGSKIHRRGLAITYTSKDF  179

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGSK---IKHVLKISLDESRH  1050
             ++W ++  PLH  +GSGMW CPDF+PV+    NG++TS  G     +KHVLKISLD+++H
Sbjct  180   LKWEKSPEPLHYDDGSGMWACPDFFPVTRFGSNGVETSSFGEPNEILKHVLKISLDDTKH  239

Query  1049  DYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLI  870
             DYYTIGTYD V+DK++PD G   + +  RYDYGK+YASKTF+DS K RRILWGW NES  
Sbjct  240   DYYTIGTYDRVKDKFVPDNGFKMDGTAPRYDYGKYYASKTFFDSAKNRRILWGWTNESSS  299

Query  869   DTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE-MPSTMLKKGSVSEV  693
               + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+E+LR+ +V+ + + +LK GS  EV
Sbjct  300   VEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVERLRTKQVKNLRNKVLKSGSRLEV  359

Query  692   SGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASEN  513
              G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++CS+   SV+ G+GPFGL VLAS+N
Sbjct  360   YGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLICSKMNVSVKSGLGPFGLMVLASKN  418

Query  512   RQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRI  339
              +EYT+V+FR+F    N+N  VVLMCSDQ+RSSL +  DKT+YGAFVD+NP Q  LSLR 
Sbjct  419   LEEYTSVYFRIFKARQNSNKYVVLMCSDQSRSSLKEDNDKTTYGAFVDINPHQ-PLSLRA  477

Query  338   LIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+AFN G  S+ +  L AWSM    I+
Sbjct  478   LIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFAFNYGYQSVDVLNLNAWSMNSAQIS  537



>gb|KHN39312.1| Beta-fructofuranosidase, cell wall isozyme [Glycine soja]
Length=561

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/553 (60%), Positives = 426/553 (77%), Gaps = 10/553 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
             + A+H V +NL++L     N  YRT++HFQPP+NW+N   GP+ Y G+YH FYQYNPKGA
Sbjct  18    SAATHHVYRNLQSLSSDSSNQPYRTAYHFQPPKNWIN---GPLRYAGLYHLFYQYNPKGA  74

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS SKDLVNW    PA+ PSQP+ DING WSGS T+LP N P +LYTG+D  
Sbjct  75    VWGNIVWAHSVSKDLVNWTPLDPAIFPSQPS-DINGCWSGSTTLLPGNKPVILYTGIDLL  133

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             N+QVQNLA P+N SDP+L+EWVKSP+NPL+AP   NKIN++SFRDPTTAW G DG+WR+L
Sbjct  134   NQQVQNLAQPKNLSDPFLREWVKSPKNPLMAPTSANKINSSSFRDPTTAWLGKDGHWRVL  193

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVG  1098
             VGSK   RG+AILYRSKDFV WVQAKHPL+S  GSGMWECPDF+PV  +   G+DTS+ G
Sbjct  194   VGSKRRTRGIAILYRSKDFVNWVQAKHPLYSILGSGMWECPDFFPVLNNDQLGVDTSVNG  253

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               ++HVLK+SLD+ +HDYY IG+Y+  +D +IPD+ S  N+  LRYDYGK+YASKTF+D 
Sbjct  254   YDVRHVLKVSLDDKKHDYYMIGSYNAAKDAFIPDEES--NEFVLRYDYGKYYASKTFFDD  311

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRIL GW NES      +K+GWSG+  IPR +WL K+ KQLVQWPV E+EKLR+  V
Sbjct  312   GKKRRILLGWANESSSVAADIKKGWSGIHTIPRALWLHKSGKQLVQWPVVEVEKLRAYPV  371

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              +P  +LK G +  ++G++A QAD+E++F++    +AE ++  + TDPQ+LCS+KG+S++
Sbjct  372   NLPPQVLKGGKLLPINGVTATQADVEISFEVSNLREAEVLD--YWTDPQILCSKKGSSIK  429

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
              G+GPFGL V ASE  QEYT+VFFR+F  + +  +VL+CSDQ+RSSL+K  D TSYG FV
Sbjct  430   SGLGPFGLLVFASEGLQEYTSVFFRIFR-HQHKYLVLLCSDQSRSSLNKDNDLTSYGTFV  488

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             DV+P+ E+LSLR LIDHS+VESFG +G+ CIT+RVYPT AI ++A LYAFNNG   + ++
Sbjct  489   DVDPLHEKLSLRTLIDHSVVESFGGEGRACITARVYPTLAINDEAQLYAFNNGTADVNIT  548

Query  197   KLTAWSMKKPTIN  159
             KL AWSMKK  IN
Sbjct  549   KLNAWSMKKAQIN  561



>pdb|2QQW|A Chain A, Crystal Structure Of A Cell-Wall Invertase (D23a) From 
Arabidopsis Thaliana In Complex With Sucrose
Length=537

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/540 (61%), Positives = 418/540 (77%), Gaps = 10/540 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             N  YRT FHFQPP+NWMN PNGPM+YKG+YH FYQ+NPKGA +G I W HSTS DL+NW 
Sbjct  1     NQPYRTGFHFQPPKNWMNAPNGPMIYKGIYHLFYQWNPKGAVWGNIVWAHSTSTDLINWD  60

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
              H PA+ PS P  DING WSGSATILPN  P +LYTG+D +N+QVQN+A P+N SDPYL+
Sbjct  61    PHPPAIFPSAPF-DINGCWSGSATILPNGKPVILYTGIDPKNQQVQNIAEPKNLSDPYLR  119

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW KSP NPL+AP+  N INA+SFRDPTTAW G D  WR+++GSK+ RRGLAI Y SKDF
Sbjct  120   EWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGQDKKWRVIIGSKIHRRGLAITYTSKDF  179

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGSK---IKHVLKISLDESRH  1050
             ++W ++  PLH  +GSGMWECPDF+PV+    NG++TS  G     +KHVLKISLD+++H
Sbjct  180   LKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSNGVETSSFGEPNEILKHVLKISLDDTKH  239

Query  1049  DYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLI  870
             DYYTIGTYD V+DK++PD G   + +  RYDYGK+YASKTF+DS K RRILWGW NES  
Sbjct  240   DYYTIGTYDRVKDKFVPDNGFKMDGTAPRYDYGKYYASKTFFDSAKNRRILWGWTNESSS  299

Query  869   DTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE-MPSTMLKKGSVSEV  693
               + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+E+LR+ +V+ + + +LK GS  EV
Sbjct  300   VEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVERLRTKQVKNLRNKVLKSGSRLEV  359

Query  692   SGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASEN  513
              G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++CS+   SV+ G+GPFGL VLAS+N
Sbjct  360   YGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLICSKMNVSVKSGLGPFGLMVLASKN  418

Query  512   RQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRI  339
              +EYT+V+FR+F    N+N  VVLMCSDQ+RSSL +  DKT+YGAFVD+NP Q  LSLR 
Sbjct  419   LEEYTSVYFRIFKARQNSNKYVVLMCSDQSRSSLKEDNDKTTYGAFVDINPHQ-PLSLRA  477

Query  338   LIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+AFN G  S+ +  L AWSM    I+
Sbjct  478   LIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFAFNYGYQSVDVLNLNAWSMNSAQIS  537



>ref|XP_010042359.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Eucalyptus grandis]
Length=564

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/533 (62%), Positives = 414/533 (78%), Gaps = 10/533 (2%)
 Frame = -1

Query  1754  HTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRA  1575
             +T  ++   QP R W      PM+YKG+YH FYQYNP+G   G   W HSTS DLVNW  
Sbjct  41    NTVESTSVLQPYRTW------PMIYKGIYHLFYQYNPQGPVPGHKVWAHSTSTDLVNWTP  94

Query  1574  HIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQE  1395
              +PA+  SQ   DING WSGS T LP + PA+LYTGV+ +++Q QNLAVP+N SDPYL E
Sbjct  95    QVPAIVRSQ-VYDINGCWSGSITFLPGHRPAILYTGVNLQHQQGQNLAVPKNLSDPYLIE  153

Query  1394  WVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFV  1215
             WVKSP NPL+A    N INA+SFRDPTTAW G DG WR+++GSK  R G+A+LYRSKDFV
Sbjct  154   WVKSPLNPLMASTAANGINASSFRDPTTAWVGRDGRWRVIIGSKRDRMGIALLYRSKDFV  213

Query  1214  RWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYYT  1038
              W QA+ PLHS E +GMWECPDF+P+S   P GLDTS  G  +KHVLK+SLD+++HD+YT
Sbjct  214   HWTQAQRPLHSAENTGMWECPDFFPISAQVPVGLDTSSNGPNVKHVLKVSLDDTKHDHYT  273

Query  1037  IGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEY  858
             IGTY+   DKY+PD+GSV++DSGLRYDYGKFYASKTF+DS   RRILW WINES    + 
Sbjct  274   IGTYNSSTDKYVPDEGSVESDSGLRYDYGKFYASKTFFDSKNNRRILWAWINESSSVDDD  333

Query  857   VKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISA  678
             +K+GWSGVQ IPRT+WLDK+ KQLVQWP+ E+EKLR+N+V++P+ ++K G+V EVSGI+A
Sbjct  334   IKKGWSGVQAIPRTLWLDKSGKQLVQWPIVEIEKLRTNQVDLPNKLIKGGTVLEVSGITA  393

Query  677   AQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYT  498
             AQAD+ V+FK+ E  +A+ ++  W TDPQ+LCS+KGA V+G +GPFGL V+AS+  QEYT
Sbjct  394   AQADVVVSFKVKELERADSLDPTW-TDPQMLCSRKGALVKGSLGPFGLLVMASKGLQEYT  452

Query  497   AVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIV  318
             AVFFR+F G N   VVLMCSDQ+RSSL+   DKT+YGAF+DV+P+QE+LSLR LIDHSIV
Sbjct  453   AVFFRIFKGQNKY-VVLMCSDQSRSSLNHSNDKTTYGAFLDVDPLQEKLSLRTLIDHSIV  511

Query  317   ESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             ESFG  GK CIT+RVYP  A+ +  HL+ FNNG  S+ + KL+AWSMKK  IN
Sbjct  512   ESFGGGGKSCITARVYPLLAVEDGTHLHIFNNGNQSVGVPKLSAWSMKKARIN  564



>ref|XP_010501204.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Camelina sativa]
Length=583

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/563 (59%), Positives = 428/563 (76%), Gaps = 12/563 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEAL---QPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V+ +ASH V + L      + P  N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+
Sbjct  24    VDLEASHHVYKRLSQTTNTESPSVNQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQW  83

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL+NW  H PA+ PS+P  DING WSGS TILPN  P +LYT
Sbjct  84    NPKGAVWGNIVWAHSTSTDLINWEPHPPAIFPSEPF-DINGCWSGSVTILPNGKPVILYT  142

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL+EW KS  NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  143   GIDPKNQQVQNIAEPKNISDPYLREWTKSTLNPLMAPDAVNGINASSFRDPTTAWLGQDK  202

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+ S   G++
Sbjct  203   KWRVIIGSKINRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRSGSKGVE  262

Query  1112  TSLVG--SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             TS  G  ++IKHVLK+SLD+++HDYYTIGTYD V+DK++PD G   + +  RYDYGK+YA
Sbjct  263   TSSFGEPNEIKHVLKVSLDDTKHDYYTIGTYDRVKDKFVPDSGFKMDGTAPRYDYGKYYA  322

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+E
Sbjct  323   SKTFYDSAKSRRILWGWTNESSSVDDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVE  382

Query  758   KLRSNKVE-MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
             +LR+ +V+ + + +LK GS  EV G++AAQAD+EV FK+ +  KA+ ++  W TDPQ++C
Sbjct  383   RLRTKEVKNLRNKVLKSGSRLEVYGVTAAQADVEVLFKVRDLEKADVIDPSW-TDPQLIC  441

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDKK  408
             SQ   SV+   GPFGL VLAS+N +EYT+V+FR+F    N+   VV+MCSDQ+RSSL++ 
Sbjct  442   SQMNVSVKSSFGPFGLMVLASKNLEEYTSVYFRIFKARQNSGKFVVVMCSDQSRSSLEED  501

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
              DKT+YGAFVD+NP +  + LR LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+AF
Sbjct  502   NDKTTYGAFVDINPYK-PIPLRALIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFAF  560

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             N G  S+ +  L AWSM    I+
Sbjct  561   NYGSQSVDVLNLNAWSMNSAQIS  583



>emb|CDX97519.1| BnaA05g25600D [Brassica napus]
Length=584

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/564 (59%), Positives = 428/564 (76%), Gaps = 13/564 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMN-DPNGPMVYKGVYHFFYQ  1653
             V+ +ASH V + L     ++ P  N  YRT FHFQPP+NWMN DPNGPM+YKG+YH FYQ
Sbjct  24    VDLEASHHVYKRLTQSTNIKSPSVNQPYRTGFHFQPPKNWMNADPNGPMIYKGIYHLFYQ  83

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             +NPKGA +G I W HSTS DL+NW  H  A+ PS+P  DING WSGSATILP+  P +LY
Sbjct  84    WNPKGAVWGNIVWAHSTSTDLINWDPHPAAIFPSEPF-DINGCWSGSATILPDGKPVILY  142

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D +N+QVQN+A P+N SDPYL EW KSP NPL+AP+  N INA+SFRDPTTAW G D
Sbjct  143   TGIDPKNQQVQNIAEPKNLSDPYLVEWTKSPLNPLMAPDAVNGINASSFRDPTTAWLGHD  202

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
               WR+++GSK+ RRGLAI Y SKD ++W ++  PLH  +GSGMWECPDF+PV+     G+
Sbjct  203   KKWRVIIGSKIHRRGLAITYTSKDLLKWEKSTEPLHYDDGSGMWECPDFFPVTRFGSKGV  262

Query  1115  DTSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKF  945
             +TS  G     +KHVLK+SLD+++HDYYT+GTYD V DK++PDKG   + S  RYDYGK+
Sbjct  263   ETSSFGEPNEVLKHVLKVSLDDTKHDYYTLGTYDRVGDKFVPDKGFKMDSSAPRYDYGKY  322

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASKTFYDS + RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E
Sbjct  323   YASKTFYDSARNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVRE  382

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             +E+LR+N+V + + +L   S  EV G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++
Sbjct  383   VERLRTNQVNLRNKVLDSRSRLEVYGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLI  441

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDK  411
             CSQ   SV+ G+GPFGL VLAS+N +EYT+V+FR+F    N+N  VV+MCSDQ+RSSL +
Sbjct  442   CSQMNVSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKARQNSNKYVVVMCSDQSRSSLKE  501

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YGAFVDVNP Q  LSLR LID+S+VESFG +G+ CITSRVYP  AIG+ +HLYA
Sbjct  502   DNDKTTYGAFVDVNPRQ-PLSLRALIDNSVVESFGGRGRACITSRVYPKLAIGKGSHLYA  560

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN G  S+ +  L+AWSMK   I+
Sbjct  561   FNYGSQSVDVLSLSAWSMKSAQIS  584



>pdb|2QQU|A Chain A, Crystal Structure Of A Cell-Wall Invertase (D239a) From 
Arabidopsis Thaliana In Complex With Sucrose
Length=535

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/534 (62%), Positives = 416/534 (78%), Gaps = 10/534 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+NPKGA +G I W HSTS DL+NW 
Sbjct  1     NQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQWNPKGAVWGNIVWAHSTSTDLINWD  60

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
              H PA+ PS P  DING WSGSATILPN  P +LYTG+D +N+QVQN+A P+N SDPYL+
Sbjct  61    PHPPAIFPSAPF-DINGCWSGSATILPNGKPVILYTGIDPKNQQVQNIAEPKNLSDPYLR  119

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW KSP NPL+AP+  N INA+SFRDPTTAW G D  WR+++GSK+ RRGLAI Y SKDF
Sbjct  120   EWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGQDKKWRVIIGSKIHRRGLAITYTSKDF  179

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGSK---IKHVLKISLDESRH  1050
             ++W ++  PLH  +GSGMWECPDF+PV+    NG++TS  G     +KHVLKISL +++H
Sbjct  180   LKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSNGVETSSFGEPNEILKHVLKISLADTKH  239

Query  1049  DYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLI  870
             DYYTIGTYD V+DK++PD G   + +  RYDYGK+YASKTF+DS K RRILWGW NES  
Sbjct  240   DYYTIGTYDRVKDKFVPDNGFKMDGTAPRYDYGKYYASKTFFDSAKNRRILWGWTNESSS  299

Query  869   DTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE-MPSTMLKKGSVSEV  693
               + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+E+LR+ +V+ + + +LK GS  EV
Sbjct  300   VEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVERLRTKQVKNLRNKVLKSGSRLEV  359

Query  692   SGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASEN  513
              G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++CS+   SV+ G+GPFGL VLAS+N
Sbjct  360   YGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLICSKMNVSVKSGLGPFGLMVLASKN  418

Query  512   RQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRI  339
              +EYT+V+FR+F    N+N  VVLMCSDQ+RSSL +  DKT+YGAFVD+NP Q  LSLR 
Sbjct  419   LEEYTSVYFRIFKARQNSNKYVVLMCSDQSRSSLKEDNDKTTYGAFVDINPHQ-PLSLRA  477

Query  338   LIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSM  177
             LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+AFN G  S+ +  L AWSM
Sbjct  478   LIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFAFNYGYQSVDVLNLNAWSM  531



>ref|XP_010501217.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Camelina sativa]
Length=583

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/563 (59%), Positives = 427/563 (76%), Gaps = 12/563 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V+ +ASH V + L      + P  N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+
Sbjct  24    VDLEASHHVYERLSQSTNTESPSVNQRYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQW  83

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL+NW  H PA+ PS+P  DING WSGS TILPN  P +LYT
Sbjct  84    NPKGAVWGNIVWAHSTSTDLINWEPHPPAIFPSEPF-DINGCWSGSVTILPNGKPVILYT  142

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL+EW KS  NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  143   GIDPKNQQVQNIAEPKNISDPYLREWTKSTLNPLMAPDAVNGINASSFRDPTTAWLGQDK  202

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+ S   G++
Sbjct  203   KWRVIIGSKINRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRSGSKGVE  262

Query  1112  TSLVG--SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             TS  G  ++IKHVLK+SLD+++HDYYTIGTYD V+DK++PD G   + +  RYDYGK+YA
Sbjct  263   TSSFGEPNEIKHVLKVSLDDTKHDYYTIGTYDRVKDKFVPDSGFKMDGTAPRYDYGKYYA  322

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E++
Sbjct  323   SKTFYDSAKSRRILWGWTNESSSVDDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVK  382

Query  758   KLRSNKVE-MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
              LR+ +V+ + + +LK GS  EVSG++AAQAD+EV FK+    KA+ ++  W TDPQ++C
Sbjct  383   GLRTKEVKNLRNEVLKSGSRLEVSGVTAAQADVEVLFKVRGLEKADVIDPSW-TDPQLIC  441

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDKK  408
             SQ   SV+   GPFGL VLAS+N +EYT+V+FR+F    N+   VV+MCSDQ+RSSL++ 
Sbjct  442   SQMNVSVKSSFGPFGLMVLASKNLEEYTSVYFRIFKARQNSGKFVVVMCSDQSRSSLEED  501

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
              DKT+YGAFVD+NP +  + LR LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+AF
Sbjct  502   NDKTTYGAFVDINPYK-PIPLRALIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFAF  560

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             N G  S+ +  L AWSM    I+
Sbjct  561   NYGSQSVDVLNLNAWSMNSAQIS  583



>ref|XP_009117459.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1 
[Brassica rapa]
Length=582

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/563 (59%), Positives = 427/563 (76%), Gaps = 13/563 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V+ +ASH V   L     ++ P  N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+
Sbjct  24    VDLEASHHVYNRLTQSSNIKSPSVNQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQW  83

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL+NW  H PA+ PS+P  DING WSGSATILP+  P +LYT
Sbjct  84    NPKGAVWGNIVWAHSTSTDLINWDPHPPAIFPSEPF-DINGCWSGSATILPDGKPVILYT  142

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P++ SDPYL EW KSP NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  143   GIDPKNQQVQNIAEPKDLSDPYLVEWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGHDK  202

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+     G++
Sbjct  203   KWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSKGVE  262

Query  1112  TSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             TS  G     +KHVLKISLD+++HDYYTIGTYD V DK++PDKG   + +  RYDYGK+Y
Sbjct  263   TSSFGEPNEVLKHVLKISLDDTKHDYYTIGTYDRVGDKFVPDKGFKMDGTAPRYDYGKYY  322

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTFYDS K RR+LWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+EL
Sbjct  323   ASKTFYDSAKNRRVLWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREL  382

Query  761   EKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
             E+LR  +V + + +L +  + EV G++AAQAD+EV FK+    KA+ +E  W TDPQ++C
Sbjct  383   ERLRMKQVNLRNKVLTRSRL-EVYGVTAAQADVEVLFKVRNLEKADVIEPSW-TDPQLIC  440

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDKK  408
             S+   SV+ G+GPFGL VLAS+N +EYT+V+FR+F    N+N   V+MCSDQ+RSSL++ 
Sbjct  441   SKMNMSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKARQNSNKYFVVMCSDQSRSSLEED  500

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
              DKT+YGAFVD+NP Q  LSLR LIDHS+VESFG +G+ CITSRVYP  AIG+ +HL+AF
Sbjct  501   NDKTTYGAFVDINPRQ-PLSLRALIDHSVVESFGGRGRACITSRVYPKLAIGKNSHLFAF  559

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             N G  S+ +  L+AWSMK   I+
Sbjct  560   NYGSQSVDVLSLSAWSMKSAQIS  582



>emb|CDY51739.1| BnaA01g37220D [Brassica napus]
Length=585

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/564 (59%), Positives = 427/564 (76%), Gaps = 13/564 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMN-DPNGPMVYKGVYHFFYQ  1653
             V+ +ASH V   L     ++ P  N  YRT FHFQPP+NWMN DPNGPM+YKG+YH FYQ
Sbjct  25    VDLEASHHVYNRLTQSSNIKSPSVNQPYRTGFHFQPPKNWMNADPNGPMIYKGIYHLFYQ  84

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             +NPKGA +G I W HSTS DL+NW  H PA+ PS+P  DING WSGSATILP+  P +LY
Sbjct  85    WNPKGAVWGNIVWAHSTSTDLINWDPHPPAIFPSEPF-DINGCWSGSATILPDGKPVILY  143

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D +N+QVQN+A P++ SDPYL EW KSP NPL+AP+  N INA+SFRDPTTAW G D
Sbjct  144   TGIDPKNQQVQNIAEPKDLSDPYLVEWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGHD  203

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
               WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+     G+
Sbjct  204   KKWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSKGV  263

Query  1115  DTSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKF  945
             +TS  G     +KHVLKISLD+++HDYYTIGTYD V DK++PDKG   + +  RYDYGK+
Sbjct  264   ETSSFGEPNEVLKHVLKISLDDTKHDYYTIGTYDRVGDKFVPDKGFKMDGTAPRYDYGKY  323

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASKTFYDS K RR+LWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E
Sbjct  324   YASKTFYDSAKNRRVLWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVRE  383

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             LE+LR  +V + + +L   S  EV G++AAQAD+EV FK+    KA+ +E  W TDPQ++
Sbjct  384   LERLRMKQVNLRNKVLNSRSRLEVYGVTAAQADVEVLFKVRNLEKADVIEPSW-TDPQLI  442

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDK  411
             CS+   SV+ G+GPFGL VLAS+N +EYT+V+FR+F    N+N  VV+MCSDQ+RSSL++
Sbjct  443   CSKMNMSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKARQNSNKYVVVMCSDQSRSSLEE  502

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YGAFVD+NP Q  LSLR LIDHS+VESFG +G+ CITSRVYP  AIG+ +HL+A
Sbjct  503   DNDKTTYGAFVDINPRQ-PLSLRALIDHSVVESFGGRGRACITSRVYPKLAIGKNSHLFA  561

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN G  S+ +  L+AWSMK   I+
Sbjct  562   FNYGSQSVDVLSLSAWSMKSAQIS  585



>emb|CDY37487.1| BnaC01g37450D [Brassica napus]
Length=584

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/564 (59%), Positives = 427/564 (76%), Gaps = 13/564 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMN-DPNGPMVYKGVYHFFYQ  1653
             V+ +ASH V   L     ++ P  N  YRT FHFQPP+NWMN DPNGPM+YKG+YH FYQ
Sbjct  24    VDLEASHHVYNRLTQSSNIKSPSVNQPYRTGFHFQPPKNWMNADPNGPMIYKGIYHLFYQ  83

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             +NPKGA +G I W HSTS DL+NW  H PA+ PS+P  DING WSGSATILP+  P +LY
Sbjct  84    WNPKGAVWGNIVWAHSTSTDLINWDPHPPAIFPSEPF-DINGCWSGSATILPDGKPVILY  142

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D +N+QVQN+A P++ SDPYL EW KSP NPL+AP+  N INA+SFRDPTTAW G D
Sbjct  143   TGIDPKNQQVQNIAEPKDLSDPYLVEWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGHD  202

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
               WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+     G+
Sbjct  203   KKWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSKGV  262

Query  1115  DTSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKF  945
             +TS  G     +KHVLKISLD+++HDYYTIGTYD V DK++PDKG   + +  RYDYGK+
Sbjct  263   ETSSFGEPNEVLKHVLKISLDDTKHDYYTIGTYDQVGDKFVPDKGFKMDGTAPRYDYGKY  322

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASKTFYDS K RR+LWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E
Sbjct  323   YASKTFYDSAKNRRVLWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVRE  382

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             LE+LR  +V + + +L   S  EV G++AAQAD+EV FK+    KA+ +E  W TDPQ++
Sbjct  383   LERLRMKQVNLRNKVLNSRSRLEVYGVTAAQADVEVLFKVRNLEKADVIEPSW-TDPQLI  441

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDK  411
             CS+   SV+ G+GPFGL VLAS+N +EYT+V+FR+F    N+N  VV+MCSDQ+RSSL++
Sbjct  442   CSKMNVSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKARQNSNKYVVVMCSDQSRSSLEE  501

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YGAFVD+NP Q  LSLR LIDHS+VESFG +G+ CITSRVYP  A+G+ +HL+A
Sbjct  502   DNDKTTYGAFVDINPRQ-PLSLRALIDHSVVESFGGRGRACITSRVYPKLAMGKNSHLFA  560

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN G  S+ +  L+AWSMK   I+
Sbjct  561   FNYGSQSVDVLSLSAWSMKSAQIS  584



>ref|XP_004141685.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Cucumis sativus]
Length=511

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/513 (63%), Positives = 412/513 (80%), Gaps = 5/513 (1%)
 Frame = -1

Query  1688  MVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSA  1509
             M+YKG+YH FYQYNPKGA +G I W HSTS DL+NW  H  A+ PSQP+ DING WSGSA
Sbjct  1     MIYKGIYHLFYQYNPKGAVWGNIVWAHSTSTDLINWEPHDHAIFPSQPS-DINGCWSGSA  59

Query  1508  TILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATS  1329
             TILP   PA+LYTG++ +N+QVQNLAVP+N SDPYL+EWVKSP+NPL+AP   N+INA+S
Sbjct  60    TILPGEKPAILYTGINPKNQQVQNLAVPKNLSDPYLREWVKSPKNPLMAPTPQNQINASS  119

Query  1328  FRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPD  1149
             FRDPTTAW GP+G WR++VG+KV  RGLA++++SKDF++W Q  HPLH  +GSGMWECPD
Sbjct  120   FRDPTTAWLGPNGEWRVIVGNKVHTRGLALMFQSKDFIKWDQVDHPLHYADGSGMWECPD  179

Query  1148  FYPVS-TSPNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDS  972
             FYPV+ T   G+DT++ G  +KHVLK+SLD++RHD YTIGTYD  +D Y+P+KGS++  S
Sbjct  180   FYPVAKTGRRGVDTTVNGKNVKHVLKVSLDDTRHDVYTIGTYDVEKDIYVPNKGSIEGYS  239

Query  971   GLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRK  792
             GLRYDYGK+YASKTFYD  K+RR+LWGW+NES    + +K+GWSG+QGIPRT+WLD + K
Sbjct  240   GLRYDYGKYYASKTFYDGQKKRRVLWGWVNESSSVEDDIKKGWSGIQGIPRTIWLDASGK  299

Query  791   QLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEE  612
             QL+QWP++E++KLR NKV + + +LKKGS  EV G++ +QAD+EV+FK+    KA+ ++ 
Sbjct  300   QLIQWPIEEIQKLRKNKVTLTNKVLKKGSTIEVKGVTPSQADVEVSFKVKNLKKAQILKP  359

Query  611   RWTTDPQVLCSQKG--ASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCS  438
             ++  +PQVLCSQKG  A+ +GG+GPFGL VLAS + +EYT+V F +F    +  V LMCS
Sbjct  360   QYWENPQVLCSQKGRAATTKGGVGPFGLLVLASNDFKEYTSVSFTIFK-KQSKYVALMCS  418

Query  437   DQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKA  258
             DQ+RSSL+   DKT+YGAF+DV+   E+LSLR LIDHS+VESFG KGK CIT+RVYPT A
Sbjct  419   DQSRSSLNPTNDKTTYGAFLDVDVDSEDLSLRSLIDHSVVESFGLKGKGCITARVYPTLA  478

Query  257   IGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             IG+   LYAFNNG  S+ ++KLTAWSMKK  IN
Sbjct  479   IGDNVGLYAFNNGTESVTITKLTAWSMKKARIN  511



>ref|XP_006407167.1| hypothetical protein EUTSA_v10020376mg [Eutrema salsugineum]
 gb|ESQ48620.1| hypothetical protein EUTSA_v10020376mg [Eutrema salsugineum]
Length=580

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/563 (59%), Positives = 426/563 (76%), Gaps = 15/563 (3%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V+ +ASH V   L      +PP  N  YRT FHFQPP+NWMN   GPM+YKG+YH FYQ+
Sbjct  24    VDLEASHHVYNRLSQSTNTKPPSVNQPYRTGFHFQPPKNWMN---GPMIYKGIYHLFYQW  80

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL++W  H PA+ PSQP+ DING WSGS TILP+  P +LYT
Sbjct  81    NPKGAVWGNIVWAHSTSTDLISWAPHPPAIFPSQPS-DINGCWSGSVTILPDGKPVILYT  139

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL EW+KSP NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  140   GIDPKNQQVQNIAEPKNLSDPYLVEWIKSPLNPLMAPDAVNGINASSFRDPTTAWLGHDK  199

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+     G++
Sbjct  200   KWRVIIGSKIHRRGLAITYTSKDFLKWEKSAEPLHYDDGSGMWECPDFFPVTRFGSKGVE  259

Query  1112  TSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             TS  G     +KHVLK+SLD+++HDYYTIGTYD V DK++PD G   + +  RYDYGK+Y
Sbjct  260   TSSFGEPNEILKHVLKVSLDDTKHDYYTIGTYDRVGDKFVPDNGFKMDGTAPRYDYGKYY  319

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQLVQWPV+E+
Sbjct  320   ASKTFYDSAKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLVQWPVREV  379

Query  761   EKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
             E+LR+ +V + + +L   S  EV G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++C
Sbjct  380   ERLRTKQVNIRNKVLNSRSRLEVYGVTAAQADVEVVFKVRDLEKADVIEPSW-TDPQLIC  438

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDKK  408
             SQ   SV+ G+GPFGL VLAS+N +EYT+V+FR+F    N N  VV+MCSDQ+RSSL++ 
Sbjct  439   SQMNVSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKTRQNRNKYVVVMCSDQSRSSLEED  498

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
              DKT+YGAFVD+NP++  LSLR LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+AF
Sbjct  499   NDKTTYGAFVDINPLR-PLSLRALIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFAF  557

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             N G  S+ +  L+AWSMK   I+
Sbjct  558   NYGSQSVDVVSLSAWSMKSAQIS  580



>gb|KHN30053.1| Beta-fructofuranosidase, cell wall isozyme [Glycine soja]
Length=571

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/560 (59%), Positives = 428/560 (76%), Gaps = 11/560 (2%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             G +  +A+H V +NL+ L     +  YRT++HFQP +NW+N   GPM YKG+YH FYQYN
Sbjct  19    GVLPIEATHHVYRNLQTLSSDSSDQPYRTAYHFQPRKNWIN---GPMRYKGLYHLFYQYN  75

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS S DLVNW     A+ PSQP+ DING WSGSATILP   PA+LYTG
Sbjct  76    PKGAVWGNIVWAHSISNDLVNWTPLDHAIYPSQPS-DINGCWSGSATILPGGKPAILYTG  134

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             ++    QVQNLA+P+N SDP L+EWVKSP+NPL+AP   N IN++SFRDPTTAW G DG 
Sbjct  135   INPNKHQVQNLAIPKNMSDPLLREWVKSPKNPLMAPTSSNNINSSSFRDPTTAWLGKDGY  194

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV----STSPNG  1119
             WR+L+GSK+  RG+AILY+SK+FV WVQAK PLHS EG+GMWECPDFYPV      S  G
Sbjct  195   WRVLIGSKIHTRGMAILYKSKNFVNWVQAKQPLHSAEGTGMWECPDFYPVLDNKGPSTIG  254

Query  1118  LDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             LDTS+ G  ++HVLK+SLD+++HD+Y IGTYD  +D + PD G  D+ + LRYDYGK+YA
Sbjct  255   LDTSVNGDNVRHVLKVSLDDTKHDHYLIGTYDIAKDIFTPDNGFEDSQTVLRYDYGKYYA  314

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKT ++  K RR+L GW+NES    + +K+GW+G+  IPR +WL K+ KQLVQWPV ELE
Sbjct  315   SKTIFEDGKNRRVLLGWVNESSSVPDDIKKGWAGIHTIPRAIWLHKSGKQLVQWPVVELE  374

Query  758   KLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCS  579
              LR N V  P+ ++K G + +V+G++AAQAD+E++F++ EFGKAE + ++W  DPQ+LCS
Sbjct  375   SLRVNPVHWPTKVVKGGEMLQVTGVTAAQADVEISFEVNEFGKAEVL-DKW-VDPQILCS  432

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDK  399
             +KGA+V+GG+GPFGL V AS   QEYTAVFFR+F   N N +VLMCSDQ+RSSL+K  D 
Sbjct  433   RKGAAVKGGLGPFGLLVFASRGLQEYTAVFFRIFRYQNKN-LVLMCSDQSRSSLNKDNDM  491

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
             T+YG FVD++P+ E+LSLR LID S+VESFG +G  CIT+RVYPT AI +KA LYAFNNG
Sbjct  492   TTYGTFVDMDPLHEKLSLRTLIDRSVVESFGGEGMACITARVYPTIAINKKAQLYAFNNG  551

Query  218   VHSIKLSKLTAWSMKKPTIN  159
               ++K+++L+AWSMKK  IN
Sbjct  552   TAAVKITRLSAWSMKKAKIN  571



>emb|CDX97518.1| BnaA05g25610D [Brassica napus]
Length=572

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/548 (60%), Positives = 423/548 (77%), Gaps = 13/548 (2%)
 Frame = -1

Query  1787  NLEALQPPYP---NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA--SFGK  1623
             N+EAL+  +    N  YRT +HFQPP+NWMNDPNGPM+Y GVYH FYQ+ P GA     +
Sbjct  25    NIEALKHSHSRITNQPYRTGYHFQPPKNWMNDPNGPMIYNGVYHLFYQWYPNGAVMKVNE  84

Query  1622  ISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQV  1443
             I WGH+TSKDL+NW  H PA+ PS+P+ DING WSGS TILP+  P +LYTG D  NRQV
Sbjct  85    IVWGHATSKDLINWTPHSPAIKPSRPS-DINGCWSGSVTILPSGKPVILYTGNDVNNRQV  143

Query  1442  QNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSK  1263
             QNLA P+N SDPYL+ W KSP NPL+ PN  N IN+TSFRDPTTAW G +G WR++ GS+
Sbjct  144   QNLAKPKNLSDPYLRHWTKSPVNPLVTPNAVNHINSTSFRDPTTAWLGRNGRWRMITGSQ  203

Query  1262  VGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLDTSLVGSKIK  1086
              GRRGLA+LY S+DFV W Q+  PLH  +GSGMWECPDF+PV +T+ +G+DTS     +K
Sbjct  204   EGRRGLALLYTSRDFVSWKQSAKPLHYNDGSGMWECPDFFPVGTTTSHGVDTSSFSVSVK  263

Query  1085  HVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRR  906
             HVLK+SL ++ HDYYTIGTYD VRD+Y+PD G V + +  RYDYGKFYASKTFYDS+ RR
Sbjct  264   HVLKVSLSDTSHDYYTIGTYDQVRDQYVPDDGFVQDVTAPRYDYGKFYASKTFYDSVNRR  323

Query  905   RILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPS  726
             RILWGW+NES  + + +K+GW+G+Q IPR +WLD++ K+L+QWPV+E+E+LR+ +V+  +
Sbjct  324   RILWGWVNESSPEKDNIKKGWAGLQAIPRKIWLDESGKRLMQWPVKEIERLRTTQVKWEN  383

Query  725   TMLK-KGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA-SVRGG  552
              +LK  GS+ +V G++A+QAD+EV FK+    KA+ +E  W TDPQ++CSQK A SV  G
Sbjct  384   KVLKGGGSLLDVHGVTASQADVEVLFKVSGLEKADVIEPGW-TDPQLICSQKNALSVNSG  442

Query  551   IGPFGLKVLASENRQEYTAVFFRVFMGN--NNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             +GPFGL VLAS N +EYT+V+ R+F  +  + + VV+MCSDQ+RSSLDK+ DKTSYGAF+
Sbjct  443   LGPFGLMVLASRNLEEYTSVYLRIFKASQKSKDHVVVMCSDQSRSSLDKENDKTSYGAFL  502

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             DV+P Q  +SLR LID+SIVESFG +GK CITSRVYP  AIGE  HL+ FNNG  ++ + 
Sbjct  503   DVSPYQ-PISLRTLIDNSIVESFGGRGKTCITSRVYPKLAIGENTHLFVFNNGSQNVNVL  561

Query  197   KLTAWSMK  174
              L+AWSMK
Sbjct  562   SLSAWSMK  569



>ref|XP_010487155.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Camelina sativa]
Length=583

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/563 (59%), Positives = 424/563 (75%), Gaps = 12/563 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V+ +ASH V + L      + P  N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+
Sbjct  24    VDLEASHHVYERLSQSTNTESPSVNQRYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQW  83

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DLVNW  H PA+ PS+P  DING WSGS TILPN  P +LYT
Sbjct  84    NPKGAVWGNIVWAHSTSTDLVNWDPHPPAIFPSEPF-DINGCWSGSVTILPNGKPVILYT  142

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL+EW KS  NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  143   GIDPKNQQVQNIAEPKNLSDPYLREWTKSTLNPLMAPDAVNGINASSFRDPTTAWLGEDK  202

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+ S   G++
Sbjct  203   KWRVIIGSKINRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRSGSKGVE  262

Query  1112  TSLVG--SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             TS  G  ++IKHVLK+SLD+++HDYYTIGTYD V+DK++PD G   + +  RYDYGK+YA
Sbjct  263   TSSFGEPNEIKHVLKVSLDDTKHDYYTIGTYDRVKDKFVPDSGFKMDGTAPRYDYGKYYA  322

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E++
Sbjct  323   SKTFYDSGKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVK  382

Query  758   KLRSNKVE-MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
              LR+ +V+ + + +LK GS  EVSG++AAQAD+EV FK+ +  KA+ ++  W TDPQ++C
Sbjct  383   GLRTKEVKNLRNEVLKSGSRLEVSGVTAAQADVEVLFKVRDLEKADVIDPSW-TDPQLIC  441

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDKK  408
             SQ   S +   GPFGL VLAS+N +EYT+V+FR+F    N+   VV+MCSDQ+RSSL+K 
Sbjct  442   SQMNVSAKSSFGPFGLMVLASKNLEEYTSVYFRIFKARQNSGKFVVVMCSDQSRSSLEKD  501

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
              DKT+YGAFVD+NP Q  + LR LID S+VESFG KG+ CITSRVYP  AIG+ +HL+ F
Sbjct  502   NDKTTYGAFVDINPYQ-PIPLRALIDQSVVESFGGKGRACITSRVYPKLAIGKSSHLFVF  560

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             N G  S+    L AWSM    I+
Sbjct  561   NYGSQSVDALNLNAWSMNSAQIS  583



>ref|NP_001189881.1| beta-fructofuranosidase, insoluble isoenzyme CWINV1 [Arabidopsis 
thaliana]
 dbj|BAB01930.1| beta-fructofuranosidase (EC 3.2.1.26) [Arabidopsis thaliana]
 gb|AEE75415.1| beta-fructofuranosidase, insoluble isoenzyme CWINV1 [Arabidopsis 
thaliana]
Length=581

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/564 (59%), Positives = 426/564 (76%), Gaps = 16/564 (3%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V  +ASH V + L      + P  N  YRT FHFQPP+NWMN   GPM+YKG+YH FYQ+
Sbjct  24    VNLEASHHVYKRLTQSTNTKSPSVNQPYRTGFHFQPPKNWMN---GPMIYKGIYHLFYQW  80

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL+NW  H PA+ PS P  DING WSGSATILPN  P +LYT
Sbjct  81    NPKGAVWGNIVWAHSTSTDLINWDPHPPAIFPSAPF-DINGCWSGSATILPNGKPVILYT  139

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL+EW KSP NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  140   GIDPKNQQVQNIAEPKNLSDPYLREWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGQDK  199

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+    NG++
Sbjct  200   KWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSNGVE  259

Query  1112  TSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             TS  G     +KHVLKISLD+++HDYYTIGTYD V+DK++PD G   + +  RYDYGK+Y
Sbjct  260   TSSFGEPNEILKHVLKISLDDTKHDYYTIGTYDRVKDKFVPDNGFKMDGTAPRYDYGKYY  319

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTF+DS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+
Sbjct  320   ASKTFFDSAKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREV  379

Query  761   EKLRSNKVE-MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             E+LR+ +V+ + + +LK GS  EV G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++
Sbjct  380   ERLRTKQVKNLRNKVLKSGSRLEVYGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLI  438

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDK  411
             CS+   SV+ G+GPFGL VLAS+N +EYT+V+FR+F    N+N  VVLMCSDQ+RSSL +
Sbjct  439   CSKMNVSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKARQNSNKYVVLMCSDQSRSSLKE  498

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YGAFVD+NP Q  LSLR LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+A
Sbjct  499   DNDKTTYGAFVDINPHQ-PLSLRALIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFA  557

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN G  S+ +  L AWSM    I+
Sbjct  558   FNYGYQSVDVLNLNAWSMNSAQIS  581



>ref|XP_010487154.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Camelina sativa]
Length=585

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/564 (59%), Positives = 425/564 (75%), Gaps = 13/564 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V+ +ASH V + L     ++ P  N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+
Sbjct  25    VDLEASHHVYKRLSQSTNIESPSVNQRYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQW  84

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DLVNW  H PA+ PS+P  DING WSGS TILPN  P +LYT
Sbjct  85    NPKGAVWGNIVWAHSTSTDLVNWDPHPPAIFPSEPF-DINGCWSGSVTILPNGKPVILYT  143

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL+EW KS  NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  144   GIDPKNQQVQNIAEPKNLSDPYLREWTKSTLNPLMAPDAVNGINASSFRDPTTAWLGHDK  203

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
              WR+++GSK+ R GLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+ S   G++
Sbjct  204   KWRVIIGSKIHRCGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRSGSKGVE  263

Query  1112  TSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             TS  G     +KHVLKISLD+++HDYYTIGTYD V+DK++PD G   + +  RYDYGK+Y
Sbjct  264   TSSFGEPNEILKHVLKISLDDTKHDYYTIGTYDRVKDKFVPDSGFKMDGTAPRYDYGKYY  323

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WL ++ KQL+QWPV+E+
Sbjct  324   ASKTFYDSAKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLYRSGKQLIQWPVREV  383

Query  761   EKLRSNKVE-MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             E+LR+ +V+ + + +LK GS  EV G++AAQAD+EV FK+ +  KA+ ++  W TDPQ++
Sbjct  384   ERLRTKEVKNLRNKVLKSGSRLEVYGVTAAQADVEVLFKVRDLEKADVIDPSW-TDPQLI  442

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDK  411
             CSQ   SV+   GPFGL VLAS+N +EYT+V+FR+F    N+   VV+MCSDQ+RSSL+K
Sbjct  443   CSQMNVSVKSSFGPFGLMVLASKNLEEYTSVYFRIFKARQNSGKFVVVMCSDQSRSSLEK  502

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YGAFVD+NP Q  + LR LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+A
Sbjct  503   DNDKTTYGAFVDINPYQ-PIPLRALIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFA  561

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN G  S+ +  L AWSM    I+
Sbjct  562   FNYGSQSVDVLNLNAWSMNSAQIS  585



>ref|XP_007135539.1| hypothetical protein PHAVU_010G137900g [Phaseolus vulgaris]
 gb|ESW07533.1| hypothetical protein PHAVU_010G137900g [Phaseolus vulgaris]
Length=562

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/533 (59%), Positives = 420/533 (79%), Gaps = 7/533 (1%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             +  YRT++HFQPP+NW+NDPNGP+ + G+YH FYQYNPKGA +G I W HS SKDLVNW 
Sbjct  35    DQPYRTAYHFQPPKNWINDPNGPLRFGGLYHLFYQYNPKGAVWGNIVWAHSVSKDLVNWT  94

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
                PA+ PSQP+ DI G WSGSAT+LP N PA+LYTG++  N+QVQNLA+P+N SDP+L+
Sbjct  95    PLEPAIFPSQPS-DIKGCWSGSATVLPGNKPAILYTGINQLNQQVQNLAMPKNLSDPFLR  153

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EWVKSP+NP +AP   NKIN++SFRDPTTAW G DG+WR+LVGSK G RG+A+LYRSKDF
Sbjct  154   EWVKSPKNPKMAPTSANKINSSSFRDPTTAWLGQDGDWRVLVGSKRGTRGMALLYRSKDF  213

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLDTSLVGSKIKHVLKISLDESRHDYY  1041
             + W + KHPLHS  GSGMWECPDF+PV      G+DTS+ G  ++HVLK SLD+ +HDYY
Sbjct  214   LDWDEVKHPLHSTLGSGMWECPDFFPVLKNGQKGVDTSVNGDHVRHVLKASLDDKKHDYY  273

Query  1040  TIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTE  861
              IG+Y+  +DK+IPDK  V +D  +RYD+GK+YASKTF+D  K+RR+L GW+NES    +
Sbjct  274   MIGSYNAAKDKFIPDK--VFDDFIIRYDFGKYYASKTFFDDGKKRRVLLGWVNESSSVAD  331

Query  860   YVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGIS  681
              +K+GWSG+  IPR +WL K+ KQLVQWPV+E+EKLR+  V++    LK G++ +++G++
Sbjct  332   DIKKGWSGIHTIPRAIWLHKSGKQLVQWPVEEIEKLRAKPVKLAPQDLKGGNLLQINGVT  391

Query  680   AAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEY  501
             A QAD+EV+F++ E  KAE++  ++  DPQ+LCS+KG+S+R G+GPFGL V ASE  QE+
Sbjct  392   ATQADVEVSFEVSELRKAERL--KYWIDPQILCSRKGSSLRSGLGPFGLLVFASEGLQEF  449

Query  500   TAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSI  321
             T+VFFR+F   +   +V +CSDQ+RSSL+K  D T+YG FVDV+P++E+LSLR LIDHS+
Sbjct  450   TSVFFRIFRYQHKY-LVFLCSDQSRSSLNKNNDLTTYGTFVDVDPLKEKLSLRTLIDHSV  508

Query  320   VESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTI  162
             VESFG +G+ CIT+RVYPT AI +KA +Y FNNG   +K+++L AWSMKK  I
Sbjct  509   VESFGGEGRGCITARVYPTLAINDKAKIYVFNNGTSEVKITRLHAWSMKKAHI  561



>ref|XP_010465245.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV5 
[Camelina sativa]
Length=573

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/552 (61%), Positives = 419/552 (76%), Gaps = 13/552 (2%)
 Frame = -1

Query  1799  IVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA--SFG  1626
             +VL  L  +     N  YRT +HFQ P+NWMNDPNGPMVYKG+YH FYQ+NP GA     
Sbjct  22    VVLDALHNVPSNIKNQPYRTGYHFQAPKNWMNDPNGPMVYKGIYHLFYQWNPNGALMEVN  81

Query  1625  KISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQ  1446
                WGH+TS DL+NW  H PA+ PS+P+ DING WSGS TILPN  P LLYTG D  NRQ
Sbjct  82    DTVWGHATSTDLINWITHSPAIKPSRPS-DINGCWSGSVTILPNGKPVLLYTGNDRYNRQ  140

Query  1445  VQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGS  1266
             VQNLAVP+N +DPYL+ W KSP NPL+ P   N IN+T+FRDPTTAW G DG WRI  GS
Sbjct  141   VQNLAVPKNLTDPYLRHWTKSPENPLVTPGDANHINSTAFRDPTTAWLGRDGRWRITTGS  200

Query  1265  KVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLV-GSK  1092
             + GRRGLAIL+ S+DFVRW Q+  PLH  +G+GMWECPDF+PV+ T   G+DT+   G  
Sbjct  201   QDGRRGLAILHTSRDFVRWKQSPKPLHYHDGTGMWECPDFFPVARTDSRGVDTTAFNGKM  260

Query  1091  IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLK  912
             +KHVLK+SL ++ HDYYTIGTYD VRD Y+PD G V +++  RYDYGKFYASKTFYDS+ 
Sbjct  261   VKHVLKVSLTDTFHDYYTIGTYDQVRDVYVPDNGFVQDETAPRYDYGKFYASKTFYDSVY  320

Query  911   RRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEM  732
             +RRILWGW+NES  D + V  GW+G+Q IPR VWLD++ K LVQWPV+E+E+LR+ +V+ 
Sbjct  321   QRRILWGWVNESSTDKDIVNMGWAGLQAIPRKVWLDESGKSLVQWPVKEIERLRTTQVKW  380

Query  731   PSTMLK-KGSVSEVSGISAAQADMEVTFKI--MEFGKAEKMEERWTTDPQVLCSQKGAS-  564
              + +LK  GSV EV G++A+QAD+EV+FK+  ++  KA+ +E  W TDPQ++CSQK AS 
Sbjct  381   GNKVLKGGGSVMEVHGVTASQADVEVSFKVSGLDLEKADVIEPGW-TDPQLICSQKNASL  439

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDKKTDKTSY  390
             V+ G+GPFGL VLAS+N +EYT+V+ R+F    N+   VV+MCSDQ++SSL+K  DKT+Y
Sbjct  440   VKSGLGPFGLMVLASKNLEEYTSVYLRIFKARENSKEHVVVMCSDQSKSSLEKGNDKTTY  499

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
             GAFVDV+P Q  +SLR LID+SIVESFG +GK CITSRVYP  AIGE+ HL+AFN G  S
Sbjct  500   GAFVDVSPYQ-TISLRTLIDNSIVESFGGEGKACITSRVYPKLAIGERTHLFAFNKGSQS  558

Query  209   IKLSKLTAWSMK  174
             + +  L+AWSMK
Sbjct  559   VDVLSLSAWSMK  570



>ref|XP_010271619.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Nelumbo nucifera]
Length=573

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/553 (60%), Positives = 401/553 (73%), Gaps = 6/553 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH +    ++L     N   RT +HFQPP+NW+NDPNGPM Y GVYH FYQYNPKGA
Sbjct  26    VEASHRIFPEYQSLAAAKVNQLQRTGYHFQPPKNWINDPNGPMYYNGVYHLFYQYNPKGA  85

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S DL+NW    PA+ PS+P  DING WSGSATILP N P +LYTG+D++
Sbjct  86    VWGNIVWAHSISFDLINWVPLEPAIFPSEPF-DINGCWSGSATILPGNKPVILYTGIDTQ  144

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             NRQVQN+AVP+N SDPYL+EWVK   NPL+AP     +NA++FRDPTTAW G DG WR+L
Sbjct  145   NRQVQNIAVPKNLSDPYLREWVKPRYNPLMAP--VQGVNASAFRDPTTAWMGKDGRWRVL  202

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG  1098
             VG K G RG+A+LYRS++FV W +A+HPLHS    GMWECPDF+PVS    +GLDTS  G
Sbjct  203   VGHKRGSRGMALLYRSRNFVTWTKAQHPLHSVAKIGMWECPDFFPVSLEGEDGLDTSRGG  262

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               +KHV K+SLD +R +YYT+G Y   +D+Y+PD  S DN  GLRYDYG FYASKTF+D+
Sbjct  263   HGVKHVFKVSLDVTRFEYYTVGKYFPEKDRYVPDNTSPDNAMGLRYDYGNFYASKTFFDA  322

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRILWGW NES    + + +GW+G+Q IPR +WLDK+ KQL+QWP+QE+E LR N V
Sbjct  323   GKKRRILWGWANESDTAADDIAKGWAGIQTIPRKLWLDKSGKQLIQWPIQEVESLRLNGV  382

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              M    L KG + EV GIS AQAD+EVTF      KAE  +  W  DPQ LC  KGA+V 
Sbjct  383   HMSKVNLNKGGIVEVKGISVAQADVEVTFSFKNLDKAEPFDPNW-VDPQQLCGHKGATVE  441

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             GG+GPFGL  LAS N  EYT+VFFR+F     + VVLMCSDQTRSSL  +  K S+G FV
Sbjct  442   GGVGPFGLLTLASSNLDEYTSVFFRIFKAQKKH-VVLMCSDQTRSSLRTEVYKPSFGGFV  500

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             DV+     LSLR LIDHS+VESFGA GK CITSRVYP  A+ E AHLYAFNNG  +I++ 
Sbjct  501   DVDLEDGVLSLRSLIDHSVVESFGAGGKTCITSRVYPLHAVAENAHLYAFNNGTEAIQIV  560

Query  197   KLTAWSMKKPTIN  159
             KL AWSM +P +N
Sbjct  561   KLEAWSMFRPRMN  573



>ref|XP_002884989.1| beta-fructofuranosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61248.1| beta-fructofuranosidase [Arabidopsis lyrata subsp. lyrata]
Length=581

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/563 (59%), Positives = 426/563 (76%), Gaps = 16/563 (3%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V  +ASH V + L     ++ P  N  YRT FHFQPP+NWMN   GPM+YKG+YH FYQ+
Sbjct  24    VNLEASHHVYKRLTQSTNIKSPSVNQPYRTGFHFQPPKNWMN---GPMIYKGIYHLFYQW  80

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL+NW  H PA+ PS P  DING WSGSATILPN  P +LYT
Sbjct  81    NPKGAVWGNIVWAHSTSTDLINWYPHPPAIFPSAPF-DINGCWSGSATILPNGKPVILYT  139

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL+EW KSP NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  140   GIDPKNQQVQNIAEPKNLSDPYLREWKKSPLNPLMAPDAVNGINASSFRDPTTAWLGQDK  199

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+    NG++
Sbjct  200   KWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSNGVE  259

Query  1112  TSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             TS  G     +KHVLK+SLD+++HDYYTIGTYD V+DK++PD G   + +  RYDYGK+Y
Sbjct  260   TSSFGGPNEILKHVLKVSLDDTKHDYYTIGTYDRVKDKFVPDNGFKMDSTAPRYDYGKYY  319

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+
Sbjct  320   ASKTFYDSGKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREV  379

Query  761   EKLRSNKVE-MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             E+LR+ +V+ + + +LK GS  EV G++AAQAD+EV FK+ +  KA+ ++  W TDPQ++
Sbjct  380   ERLRTKQVKNLRNKVLKSGSRLEVYGVTAAQADVEVLFKVRDLEKADVIKPSW-TDPQLI  438

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDK  411
             CSQ   SV+ G+GPFGL VLAS+N +EYT+V+FR+F    N+   VV+MCSDQ+RSSL++
Sbjct  439   CSQMNVSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKARQNSDKYVVVMCSDQSRSSLEE  498

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YGAFVD+NP Q  LSLR LIDHS+VESFG KG+ CITSRVYP  AIG+ +HL+A
Sbjct  499   DNDKTTYGAFVDINPHQ-PLSLRSLIDHSVVESFGGKGRACITSRVYPKLAIGKSSHLFA  557

Query  230   FNNGVHSIKLSKLTAWSMKKPTI  162
             FN G  S+ L  L AWSM    I
Sbjct  558   FNYGYQSVDLLNLNAWSMNSAQI  580



>ref|XP_007024491.1| Glycosyl hydrolases family 32 protein isoform 2 [Theobroma cacao]
 gb|EOY27113.1| Glycosyl hydrolases family 32 protein isoform 2 [Theobroma cacao]
Length=534

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/504 (64%), Positives = 410/504 (81%), Gaps = 5/504 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQP-PYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQ  1653
             +G VE +ASH V +NL+  Q     N  YRT +HFQPP+NW+NDPNGPMVYKG+YH FYQ
Sbjct  21    HGVVELEASHHVYKNLQTDQSTASANQPYRTGYHFQPPKNWINDPNGPMVYKGLYHLFYQ  80

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             YNPKGA +G I W HSTSKDLVNW  H PA+ PSQP+ DING WSGSATILP+  PA+LY
Sbjct  81    YNPKGAVWGNIVWAHSTSKDLVNWTPHDPAIYPSQPS-DINGCWSGSATILPDGKPAILY  139

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D +++QVQNLA+P+N SDPYL+EW+KS +NPL+ P   N+INA+SFRDPTTAW GPD
Sbjct  140   TGIDPQDKQVQNLAMPKNLSDPYLREWIKSSKNPLMQPTAQNQINASSFRDPTTAWLGPD  199

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
               WR+++GSK+ R+GLAILY+S+DFV W+QA+ PLHS + +GMWECPDF+PVS    NG+
Sbjct  200   KKWRLIIGSKIHRQGLAILYKSEDFVHWIQAQSPLHSAKDTGMWECPDFFPVSVRGQNGV  259

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             D S+ G  +KHVLK+SLD+++H+YYT+G+YD V+D Y PDKGSV++DSGLRYDYGKFYAS
Sbjct  260   DISVNGPFVKHVLKVSLDDTKHEYYTLGSYDIVKDIYTPDKGSVESDSGLRYDYGKFYAS  319

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+D+ K RRILWGWINES    + VK+GW+GVQ IPR +WL K+ KQLVQWP+ E++K
Sbjct  320   KTFFDTAKHRRILWGWINESSSVHDDVKKGWAGVQAIPRKLWLSKSGKQLVQWPIVEIQK  379

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQ  576
             LRSN + +PS +LK GS  EVSG++AAQAD++++FK+ +F KAE ++  W T+PQ+LCSQ
Sbjct  380   LRSNHLRLPSKLLKGGSEIEVSGVTAAQADVDISFKVTDFEKAEVLKPSW-TNPQLLCSQ  438

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKT  396
             +GASV+GG+GPFGL VLASE  +E TAVFFR+F G N   VVLMCSDQ+RSSL++  DKT
Sbjct  439   QGASVKGGLGPFGLLVLASEGLKENTAVFFRIFKGQNKY-VVLMCSDQSRSSLNEDNDKT  497

Query  395   SYGAFVDVNPMQEELSLRILIDHS  324
             +YGAF+DV+P  + LSLR L  HS
Sbjct  498   TYGAFLDVDPEHQYLSLRSLSFHS  521



>ref|XP_009146452.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV5 
[Brassica rapa]
Length=572

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/548 (59%), Positives = 422/548 (77%), Gaps = 13/548 (2%)
 Frame = -1

Query  1787  NLEALQPPYP---NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA--SFGK  1623
             N+EAL+  +    N  YRT +HFQPP+NWMNDPNGPM+Y GVYH FYQ+ P GA     +
Sbjct  25    NIEALKHSHSRITNQPYRTGYHFQPPKNWMNDPNGPMIYNGVYHLFYQWYPNGAVMKVNE  84

Query  1622  ISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQV  1443
             I WGH+TSKDL+NW  H PA+ PS+P+ DING WSGS T+LP+  P +LYTG D  N QV
Sbjct  85    IVWGHATSKDLINWTPHSPAIKPSRPS-DINGCWSGSVTVLPSGKPVILYTGNDVNNHQV  143

Query  1442  QNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSK  1263
             QNLA P+N SDPYL+ W KSP NPL+ PN  N +N+TSFRDPTTAW G +G WR++ GS+
Sbjct  144   QNLAKPKNLSDPYLRHWTKSPVNPLVTPNAVNHVNSTSFRDPTTAWLGRNGRWRMITGSQ  203

Query  1262  VGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLDTSLVGSKIK  1086
              GRRGLA+LY S+DF+ W Q+  PLH  +GSGMWECPDF+PV +T+ +G+DTS     +K
Sbjct  204   EGRRGLALLYTSRDFISWKQSAKPLHYNDGSGMWECPDFFPVGTTTSHGVDTSSFSVSVK  263

Query  1085  HVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRR  906
             HVLK+SL ++ HDYYTIGTYD V+D+Y+PD G V + +  RYDYGKFYASKTFYDS+ RR
Sbjct  264   HVLKVSLSDTSHDYYTIGTYDQVKDQYVPDDGFVQDVTAPRYDYGKFYASKTFYDSVNRR  323

Query  905   RILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPS  726
             RILWGW+NES  + + +K+GW+G+Q IPR +WLD++ K+L+QWPV+E+E+LR+ +V+  S
Sbjct  324   RILWGWVNESSPEKDNIKKGWAGLQAIPRKIWLDESGKRLMQWPVKEIERLRTTQVKWES  383

Query  725   TMLK-KGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA-SVRGG  552
              +LK  GS+  V G++A+QAD+EV FK+    KA+ +E  W TDPQ++CSQK A SV  G
Sbjct  384   KVLKGGGSLVNVHGVTASQADVEVLFKVSGLEKADVIEPGW-TDPQLICSQKNASSVNSG  442

Query  551   IGPFGLKVLASENRQEYTAVFFRVFMGN--NNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             +GPFGL VLAS+N +EYT+V+ R+F  +  + + VV+MCSDQ+RSSLDK+ DKTSYGAF+
Sbjct  443   LGPFGLMVLASKNLEEYTSVYLRIFKASQKSKDHVVVMCSDQSRSSLDKENDKTSYGAFL  502

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             DV+P Q  +SLR LID+SIVESFG +GK CITSRVYP  AIGE  HL+ FNNG  ++ + 
Sbjct  503   DVSPYQ-PISLRTLIDNSIVESFGGRGKTCITSRVYPKIAIGENTHLFVFNNGSQNVNVL  561

Query  197   KLTAWSMK  174
              L+AWSMK
Sbjct  562   SLSAWSMK  569



>emb|CAA84527.1| cell wall invertase II; beta-furanofructosidase [Vicia faba var. 
minor]
Length=581

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/563 (58%), Positives = 425/563 (75%), Gaps = 11/563 (2%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPY--PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQ  1653
             G +  +A+H V + LE+L       N  YRT +HFQPP+NW+NDPNGP++YKGVYH FYQ
Sbjct  20    GVLPIEATHHVYRELESLSSDEYSTNQPYRTGYHFQPPKNWINDPNGPLIYKGVYHLFYQ  79

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             YNPKGA +G I W HS S DL+NW    PA+ PSQP+ DING WSGS TIL  N P++LY
Sbjct  80    YNPKGAQWGNIVWAHSVSTDLINWIPLDPAIFPSQPS-DINGCWSGSTTILHGNKPSILY  138

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG++  N QVQNLA P++ SDP+L+EW+KSP NP+I P   NKINA+SFRDPTT W G D
Sbjct  139   TGINKLNHQVQNLAYPKDFSDPFLREWIKSPENPVIEPTSENKINASSFRDPTTGWLGKD  198

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNGL  1116
             G WR +VGSK   RG+AILY+SKDFV+W ++KHPLHS +G+GMWECPDF+PV      G+
Sbjct  199   GKWRGIVGSKRSTRGIAILYKSKDFVKWKKSKHPLHSAKGTGMWECPDFFPVLKNGIKGV  258

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKG--SVDNDSGLRYDYGKFY  942
             DTSL    ++HVLK+SLD+ +HDYY IG+YD  +D+++PD+G   V+ +   RYDYGK+Y
Sbjct  259   DTSLNDDYVRHVLKVSLDDKKHDYYLIGSYDEEKDRFVPDRGFEEVEIEEVFRYDYGKYY  318

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTF+D  K RRIL GW+NES    + +K+GWSG+  IPRT+WL ++ KQLVQWPV E+
Sbjct  319   ASKTFFDYEKNRRILLGWVNESSSIPDDIKKGWSGIHTIPRTIWLHESGKQLVQWPVVEI  378

Query  761   EKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIME--FGKAEKMEERWTTDPQV  588
             EKLR N V +P+ +LK   + +++G++A+QAD+E+ F++ +   G+AE +E+    DPQ+
Sbjct  379   EKLRVNHVNLPTKLLKGAELLQINGVTASQADVEIAFEVNKNTIGEAEVLEK--LPDPQI  436

Query  587   LCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKK  408
             LCSQKG SV+ G+GPFGL V AS+  QE+T+VFFR+F G  N  +VL CSDQ+RSSL+K 
Sbjct  437   LCSQKGTSVKSGLGPFGLFVFASKGLQEFTSVFFRIF-GFQNKNIVLFCSDQSRSSLNKD  495

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
              D TSYG F+DV+ + E+LSLR LIDHS+VESFG +GK CIT+RVYPT A+ +KA +YAF
Sbjct  496   NDLTSYGTFIDVDVLHEKLSLRTLIDHSVVESFGGEGKACITARVYPTLAVNDKALIYAF  555

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             NNG   +K++ L AWSMKK  +N
Sbjct  556   NNGTTDVKITSLNAWSMKKARLN  578



>ref|XP_010465247.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Camelina sativa]
Length=583

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/563 (58%), Positives = 425/563 (75%), Gaps = 12/563 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNL---EALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V+ +ASH V + L      + P  N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+
Sbjct  24    VDLEASHHVYERLLQSTNTESPSVNQRYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQW  83

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL+NW  H PA+ PS+P  DING WSGS TILP+  P +LYT
Sbjct  84    NPKGAVWGNIVWAHSTSTDLINWEPHPPAIFPSEPF-DINGCWSGSVTILPDGKPVILYT  142

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL+EW KS  NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  143   GIDPKNQQVQNIAEPKNLSDPYLREWTKSTLNPLMAPDAVNGINASSFRDPTTAWLGQDK  202

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+ S   G++
Sbjct  203   KWRVIIGSKIDRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRSGSKGVE  262

Query  1112  TSLVG--SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             TS  G  ++IKHV K+SLD+++HDYYTIGTYD V+DK++PD G   + +  RYDYGK+YA
Sbjct  263   TSSFGEPNEIKHVFKVSLDDTKHDYYTIGTYDRVKDKFVPDSGFKMDATAPRYDYGKYYA  322

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E++
Sbjct  323   SKTFYDSGKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREVK  382

Query  758   KLRSNKVE-MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
              LR+ +V+ + + +LK GS  EVSG++AAQAD+EV FK+ +  KA+ ++  W TDPQ++C
Sbjct  383   GLRTKEVKNLRNEVLKSGSRLEVSGVTAAQADVEVLFKVRDLEKADVIDPSW-TDPQLIC  441

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDKK  408
             SQ   S +   GPFGL VLAS+N +EYT+V+FR+F    N+   VV+MCSDQ+RSSL++ 
Sbjct  442   SQMNVSAKSSFGPFGLMVLASKNLEEYTSVYFRIFKARQNSGKFVVVMCSDQSRSSLEED  501

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
              DKT+YGAFVD+NP +  + LR LID S+VESFG KG+ CITSRVYP  AIG+ +HL+AF
Sbjct  502   NDKTTYGAFVDINPYK-PIPLRALIDQSVVESFGGKGRACITSRVYPKLAIGKSSHLFAF  560

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             N G  S+ +  L AWSM    I+
Sbjct  561   NYGSQSVDVLNLNAWSMNSAQIS  583



>gb|AIQ77652.1| cell wall invertase FCw-Inv [Elsholtzia haichowensis]
Length=556

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/536 (61%), Positives = 418/536 (78%), Gaps = 11/536 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             +  YRT++HFQPP+NWMNDPNGPM+YKG+YH FYQYNPKGA +G I W HSTSKDL+NW 
Sbjct  29    DQPYRTAYHFQPPKNWMNDPNGPMIYKGIYHLFYQYNPKGAVWGNIVWAHSTSKDLINWS  88

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
              H  A+ PS   +DING WSGSATIL    PA+LYTG++ +N+QVQNLA+P+N SDPYL 
Sbjct  89    PHPIAIYPS-IQSDINGCWSGSATILSKGKPAILYTGINPQNQQVQNLAIPKNLSDPYLI  147

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW+K   NP++AP   N+INA+SFRDPTTAW G DG WR++VG+K+GRRG A+++RSKDF
Sbjct  148   EWIKPQSNPMMAPTEQNQINASSFRDPTTAWLGRDGRWRVIVGNKIGRRGRALMFRSKDF  207

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYY  1041
             V W +AKHPL+S  G+GMWECPDF+PVSTS  +G+DTS VG  +KHVLK S+++   D Y
Sbjct  208   VHWTEAKHPLYSLRGTGMWECPDFFPVSTSGEDGVDTSKVGKGLKHVLKASINDGFFDSY  267

Query  1040  TIGTYDH--VRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLID  867
              IGTY +   +D ++P+KGS+  DS  +YD+GKFYASKTF+DS  +RRILWGWINES   
Sbjct  268   AIGTYKYNLGKDVFVPEKGSLRLDSQSKYDHGKFYASKTFFDSSTKRRILWGWINESTDA  327

Query  866   TEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSG  687
                +K+GWSGVQ IPR +WLDK+  QLVQWPV+E+EKLR  +V   +T LK GSV E+SG
Sbjct  328   ATDIKKGWSGVQAIPRKIWLDKSGNQLVQWPVKEIEKLRKGQVISSNTELKGGSVLEISG  387

Query  686   ISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQ  507
             ++A+QAD+E++F++  F   E+++ RW +DPQ +CS+ GA    G G FGL VLAS+  +
Sbjct  388   VTASQADVEISFEMSTFKNVEELDPRW-SDPQAICSKNGA----GKG-FGLLVLASKKLE  441

Query  506   EYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDH  327
             EYTAV+ RVF   N   VVLMCSDQ+RSSL    DKT+YGAFVDVNP++E+LSLR LIDH
Sbjct  442   EYTAVYLRVFRAKNRY-VVLMCSDQSRSSLHLDYDKTTYGAFVDVNPVKEKLSLRTLIDH  500

Query  326   SIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             SIVESFG +GK CIT+RVYP+ AI  +A LYAFNNG H++K+SKL A+S+K   I+
Sbjct  501   SIVESFGGEGKACITARVYPSIAIDGEARLYAFNNGTHNVKISKLAAYSIKDARIS  556



>gb|AFV59226.1| cell wall invertase CcwINV [Elsholtzia haichowensis]
Length=556

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/536 (61%), Positives = 418/536 (78%), Gaps = 11/536 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             +  YRT++HFQPP+NWMNDPNGPM+YKG+YH FYQYNPKGA +G I W HSTSKDL+NW 
Sbjct  29    DQPYRTAYHFQPPKNWMNDPNGPMIYKGIYHLFYQYNPKGAVWGNIVWAHSTSKDLINWS  88

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
              H  A+ PS   +DING WSGSATIL    PA+LYTG++ +N+QVQNLA+P+N SDPYL 
Sbjct  89    PHPIAIYPS-IQSDINGCWSGSATILSKGKPAILYTGINPQNQQVQNLAIPKNLSDPYLI  147

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW+K   NP++AP   N+INA+SFRDPTTAW G DG WR++VG+K+GRRG A+++RSKDF
Sbjct  148   EWIKPQSNPMMAPTEQNQINASSFRDPTTAWLGRDGRWRVIVGNKIGRRGRALMFRSKDF  207

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYY  1041
             V W +AKHPL+S  G+GMWECPDF+PVSTS  +G+DTS VG  +KHVLK S+++   D Y
Sbjct  208   VHWTEAKHPLYSLRGTGMWECPDFFPVSTSGEDGVDTSKVGKGLKHVLKASINDGFFDSY  267

Query  1040  TIGTYDH--VRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLID  867
              IGTY +   +D ++P+KGS+  DS  +YD+GKFYASKTF+DS  +RRILWGWINES   
Sbjct  268   AIGTYKYNLGKDVFVPEKGSLRLDSQSKYDHGKFYASKTFFDSSTKRRILWGWINESTDA  327

Query  866   TEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSG  687
                +K+GWSGVQ IPR +WLDK+  QLVQWPV+E+EKLR  +V   +T LK GSV E+SG
Sbjct  328   ATDIKKGWSGVQAIPRKIWLDKSGNQLVQWPVKEIEKLRKGQVISSNTELKGGSVLEISG  387

Query  686   ISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQ  507
             ++A+QAD+E++F++  F   E+++ RW +DPQ +CS+ GA    G G FGL VLAS+  +
Sbjct  388   VTASQADVEISFEMSTFKNVEELDPRW-SDPQAICSKNGA----GKG-FGLPVLASKKLE  441

Query  506   EYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDH  327
             EYTAV+ RVF   N   VVLMCSDQ+RSSL    DKT+YGAFVDVNP++E+LSLR LIDH
Sbjct  442   EYTAVYLRVFRAKNRY-VVLMCSDQSRSSLHLDYDKTTYGAFVDVNPVKEKLSLRTLIDH  500

Query  326   SIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             SIVESFG +GK CIT+RVYP+ AI  +A LYAFNNG H++K+SKL A+S+K   I+
Sbjct  501   SIVESFGGEGKACITARVYPSIAIDGEARLYAFNNGTHNVKISKLAAYSIKDARIS  556



>emb|CAA57389.1| beta-fructofuranosidase [Oxybasis rubra]
Length=573

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/549 (61%), Positives = 422/549 (77%), Gaps = 11/549 (2%)
 Frame = -1

Query  1784  LEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF-GKISWGH  1608
             L+A Q P  N  YRT++HFQP +NW+NDPNGPM++KG+YH FYQYNP G    G   WGH
Sbjct  27    LQAAQSPPSNQPYRTAYHFQPRKNWINDPNGPMLFKGIYHLFYQYNPNGVKLRGPPVWGH  86

Query  1607  STSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAV  1428
             STSKDLVNW      + P   AA+ING+WSGSATILP N PA+L+TG+D    QVQ LA 
Sbjct  87    STSKDLVNWMPQPLTMEPEM-AANINGSWSGSATILPGNKPAILFTGLDPNYEQVQVLAY  145

Query  1427  PRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVG-SKVGRR  1251
             P++ +DPYL+EW  +P+NP++ P   N+INATS+RDPTTAW  PDGNWR+L+G SK  +R
Sbjct  146   PKDLNDPYLKEWFLAPKNPVMFPTPQNQINATSYRDPTTAWMLPDGNWRVLIGKSKRRQR  205

Query  1250  GLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN--GLDTSLVGSKIKHVL  1077
             GL++LYRS+DFV WV+AKHPL+S E SGMWECPDF+PV  + N  G+DTS++G  IKHVL
Sbjct  206   GLSLLYRSRDFVHWVKAKHPLYSYERSGMWECPDFFPVYKNGNTMGIDTSVIGPNIKHVL  265

Query  1076  KISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRIL  897
             K+SLD S+HD YTIG YD  +D Y PD G + NDS LRYDYGK+YASKTFYD  K+ RIL
Sbjct  266   KVSLDVSKHDVYTIGGYDTKKDAYTPDVGFM-NDSSLRYDYGKYYASKTFYDGAKKERIL  324

Query  896   WGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR--SNKVEMPST  723
              GW NES  + +  K+GWSG+  IPRT+WLDK+  QL+QWP+  +EKLR  S   ++   
Sbjct  325   LGWANESSSEEDDAKKGWSGIHTIPRTIWLDKSGNQLIQWPISNIEKLRQKSPVFKLYGK  384

Query  722   MLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGP  543
             ++K GS++EVSGI+AAQAD+E++FKI +    EK +  WT +PQ+LCSQKG SV+GG+GP
Sbjct  385   LIKGGSLNEVSGITAAQADVEISFKIKDLENVEKFDASWT-NPQLLCSQKGGSVKGGLGP  443

Query  542   FGLKVL-ASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNP  366
             FGL    AS+  +EYTAVFFR+F   +N  VVLMCSDQ+RSSL+   DKT+YG+FVDVNP
Sbjct  444   FGLMTFQASKGLEEYTAVFFRIFKAYDNKYVVLMCSDQSRSSLNPTNDKTTYGSFVDVNP  503

Query  365   MQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKA-HLYAFNNGVHSIKLSKLT  189
             ++E+LSLR+LIDHS+VESFGAK K C+T+RVYPT AI EKA +LY FNNG   ++++ LT
Sbjct  504   VREDLSLRVLIDHSVVESFGAKRKECVTARVYPTLAINEKACNLYVFNNGKSDVEITGLT  563

Query  188   AWSMKKPTI  162
             AWSMKK +I
Sbjct  564   AWSMKKASI  572



>gb|KFK38729.1| hypothetical protein AALP_AA3G153000 [Arabis alpina]
Length=583

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/563 (57%), Positives = 422/563 (75%), Gaps = 12/563 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNL---EALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V  +ASH V + L      + P     YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+
Sbjct  24    VNLEASHHVYKRLIQSTNTKAPSVKQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQW  83

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL+NW  H PA+ PS+P  DING WSGS TILPN  P +LYT
Sbjct  84    NPKGAVWGNIVWAHSTSTDLINWVPHSPAIFPSEPF-DINGCWSGSVTILPNGKPVILYT  142

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P++ +DPYL+EW KS  NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  143   GIDPKNQQVQNIAEPKDLNDPYLKEWKKSTLNPLMAPDAVNGINASSFRDPTTAWLGHDK  202

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+    NG++
Sbjct  203   KWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRVGSNGVE  262

Query  1112  TSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             TS  G     +KHVLKISLD+++HDYYTIGTYD V DK++PD G   + + LRYDYGK+Y
Sbjct  263   TSSFGGPNEVLKHVLKISLDDTKHDYYTIGTYDRVGDKFVPDHGFTMDSTALRYDYGKYY  322

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTFYDS   RR+LWGW NES    + V++GWSG+Q IPR +WLD+  +QL+QWPV+E+
Sbjct  323   ASKTFYDSANNRRVLWGWTNESSSVQDDVEKGWSGIQTIPRKIWLDRLGRQLIQWPVREV  382

Query  761   EKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLC  582
             ++LR+ +V + + +LK GS  EV G++AAQAD++V FK+ +  KA+ ++  W TDPQ++C
Sbjct  383   QRLRTKQVNLRNKVLKSGSRLEVYGVTAAQADVDVLFKVRDLEKADVIDPSW-TDPQLIC  441

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGN--NNNPVVLMCSDQTRSSLDKK  408
             S+   SV+ G+GPFGL  LAS+N +EYT+V+FR+F     +   VV+MCSDQ+RSSL++ 
Sbjct  442   SKMNTSVKSGLGPFGLMALASKNLEEYTSVYFRIFKARQYSKKHVVVMCSDQSRSSLNED  501

Query  407   TDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAF  228
              DKT+YGAFV++NP Q  LSLR LIDHS+VESFG KG+ CITSRVYP  AIG+  HL+AF
Sbjct  502   NDKTTYGAFVNINPHQ-PLSLRALIDHSVVESFGGKGRACITSRVYPKLAIGKSTHLFAF  560

Query  227   NNGVHSIKLSKLTAWSMKKPTIN  159
             N G   + +  L+AWSMK   ++
Sbjct  561   NYGSQDVDVLSLSAWSMKSAQLS  583



>gb|AEB66647.1| cell wall invertase [Rumex dentatus]
Length=576

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/534 (59%), Positives = 415/534 (78%), Gaps = 6/534 (1%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGAS-FGKISWGHSTSKDLVNWRAH  1572
             YRT++HFQPP+NW+NDPNGP+VYKG+YH FYQ NP+GA+   +I WGHSTS DL+NW   
Sbjct  33    YRTAYHFQPPKNWINDPNGPLVYKGIYHLFYQQNPQGANWIQQIVWGHSTSTDLINWTEE  92

Query  1571  IPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEW  1392
               A+ PS P  DING WSGSATILP+  PA+LYTG++ +  QVQNLA P+N  DPYL+EW
Sbjct  93    PIAIEPSMPF-DINGCWSGSATILPDGNPAMLYTGLNQQAHQVQNLATPKNACDPYLREW  151

Query  1391  VKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVR  1212
             VKSP NPL+ PN    I   SFRDP+TAW  PDG+WR++VGSK G RGLA LY+SKDFV 
Sbjct  152   VKSPNNPLMTPNVGKNIETDSFRDPSTAWLLPDGSWRVIVGSKNGTRGLASLYKSKDFVH  211

Query  1211  WVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLDTSLVGSKIKHVLKISLDESRHDYYTI  1035
             W++ +HPLH  +G+G+WECPDFYPV      G DTSL+G  +KHVLK+SL +++H+YYT+
Sbjct  212   WIEVEHPLHYADGTGIWECPDFYPVYRNGVLGADTSLIGPNVKHVLKLSLFDTQHEYYTV  271

Query  1034  GTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYV  855
             G YD   D Y+PD GS+++D GLRYDYGKFYASK+F+DS+ +RR+LWGW+NES    + V
Sbjct  272   GMYDVDEDVYVPDYGSIESDLGLRYDYGKFYASKSFFDSVLKRRVLWGWVNESCTAIDDV  331

Query  854   KQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAA  675
             K+GWSG+Q IPR+V LDK+  QLVQWP++E+E LR ++V++P +++  GS   V GI+++
Sbjct  332   KKGWSGLQAIPRSVVLDKSGNQLVQWPIKEVETLRESQVDVPCSVINGGSFVVVEGITSS  391

Query  674   QADMEVTFKI--MEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEY  501
             QAD+EV+FK+    +   EK++   + +PQ+LCS+ G S  G IGPFGL VL+S+N +EY
Sbjct  392   QADIEVSFKLDSHHYKNVEKLDVS-SANPQLLCSKNGESKIGRIGPFGLLVLSSKNLEEY  450

Query  500   TAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSI  321
             TAV+FRVF  + +  VVLMCSDQ+RSSL+   DKT+YG+FVDV+P+++++ LR LIDH I
Sbjct  451   TAVYFRVFHDHKDKLVVLMCSDQSRSSLNPTNDKTTYGSFVDVDPLEDQIHLRTLIDHPI  510

Query  320   VESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             +ESFGA+GK CIT+RVYP  AIG  AHL+ FNNG  ++K++ L+AWSMKK  IN
Sbjct  511   IESFGAEGKTCITARVYPVLAIGNNAHLFVFNNGTETVKITGLSAWSMKKAYIN  564



>ref|XP_010501163.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV5-like 
[Camelina sativa]
Length=573

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/551 (60%), Positives = 416/551 (75%), Gaps = 13/551 (2%)
 Frame = -1

Query  1796  VLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA--SFGK  1623
             VL  L  +     N  YRT +HFQ P+NWMNDPNGPMVYKG+YH FYQ+NP GA      
Sbjct  23    VLDALHNVPNHIKNQPYRTGYHFQAPKNWMNDPNGPMVYKGIYHLFYQWNPHGALMEVND  82

Query  1622  ISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQV  1443
               WGH+TS DL+NW  H PA+ PS+P+ DING WSGS TILPN  P LLYTG D  NRQV
Sbjct  83    TVWGHATSTDLINWITHSPAIKPSRPS-DINGCWSGSVTILPNGKPVLLYTGNDRYNRQV  141

Query  1442  QNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSK  1263
             QNLA+P+N +DPYL+ W KSP NPL+ P   N IN+T+FRDPTTAW G DG WRI  GS+
Sbjct  142   QNLAIPKNLTDPYLRHWTKSPENPLVTPGDANHINSTAFRDPTTAWLGRDGRWRITTGSQ  201

Query  1262  VGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLV-GSKI  1089
              GRRGLAIL+ S+DFVRW Q+  PLH  +G+GMWECPDF+PV+ T   G+DT+   G  +
Sbjct  202   DGRRGLAILHTSRDFVRWKQSPKPLHYHDGTGMWECPDFFPVARTDSRGVDTTAFNGKMV  261

Query  1088  KHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKR  909
             KHVLK+SL ++ HDYYTIGTYD VRD Y+PD G V +++  RYDYGKFYASKTFYDS+ +
Sbjct  262   KHVLKVSLTDTFHDYYTIGTYDQVRDVYVPDNGFVQDETAPRYDYGKFYASKTFYDSVYQ  321

Query  908   RRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMP  729
             RRILWGW+NES  D + V  GW+G+Q IPR +WLD++ K LVQWPV+E+E+LR+ +V+  
Sbjct  322   RRILWGWVNESSTDKDIVNMGWAGLQAIPRKIWLDESGKSLVQWPVKEIERLRTTQVKWG  381

Query  728   STMLK-KGSVSEVSGISAAQADMEVTFKI--MEFGKAEKMEERWTTDPQVLCSQKGAS-V  561
             + +LK  GSV EV G++A+QAD+EV FK+  ++  KA+ +E  W TDPQ++CSQK AS V
Sbjct  382   NKVLKGGGSVMEVHGVTASQADVEVFFKVSGLDLEKADVIEPGW-TDPQLICSQKNASLV  440

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDKKTDKTSYG  387
             + G+GPFGL VLAS+N +EYT+V+ R+F    N+   VV+MCSDQ+RSSL+K  DKT YG
Sbjct  441   KSGLGPFGLMVLASKNLEEYTSVYLRIFKARENSKEHVVVMCSDQSRSSLEKGNDKTPYG  500

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
             AFVDV+P Q  +SLR LID+SIVESFG KGK CITSRVYP  A G++ HL+AFN G  S+
Sbjct  501   AFVDVSPYQ-TISLRTLIDNSIVESFGGKGKACITSRVYPKLATGKRTHLFAFNKGSQSV  559

Query  206   KLSKLTAWSMK  174
              + +L+AWSMK
Sbjct  560   NVLRLSAWSMK  570



>gb|KGN45521.1| hypothetical protein Csa_7G450780 [Cucumis sativus]
Length=511

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/514 (62%), Positives = 405/514 (79%), Gaps = 7/514 (1%)
 Frame = -1

Query  1688  MVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSA  1509
             M+YKG+YHFFYQYNPKGA +G I W HSTS DL+NW  H  A+ PSQP+ DING WSGSA
Sbjct  1     MIYKGIYHFFYQYNPKGAVWGNIVWAHSTSTDLINWEPHDHAIFPSQPS-DINGCWSGSA  59

Query  1508  TILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATS  1329
             TILP   PA+LYTG++ +N+QVQNLAVP+N SDPYL+EWVKSP+NPL+AP   N IN +S
Sbjct  60    TILPGEKPAILYTGINPKNQQVQNLAVPKNLSDPYLREWVKSPKNPLMAPTPQNHINVSS  119

Query  1328  FRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPD  1149
             FRDPTTAW G DG WR+++GSK+  RGLAI+YRSKDFVRW Q  HPL   +  GMWECPD
Sbjct  120   FRDPTTAWLGRDGEWRVIIGSKIDARGLAIMYRSKDFVRWNQVDHPLRYKDDMGMWECPD  179

Query  1148  FYPVS-TSPNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDS  972
             F+PV+ T   G++  + GS +KH+LK+SLD+++HD YT+GTY+  +D YIP+KGS++  +
Sbjct  180   FFPVAKTGRTGVEMKVSGSHVKHILKVSLDDTKHDVYTVGTYNWKKDIYIPNKGSIEGYN  239

Query  971   GLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRK  792
             GLRYDYGK+YASKTF+DS K+RR+LWGW+NES    + +K+GWSGVQ IPR +WLD + K
Sbjct  240   GLRYDYGKYYASKTFFDSQKKRRVLWGWVNESSSVDDDIKKGWSGVQAIPRAIWLDASGK  299

Query  791   QLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEE  612
             QL+QWP+ E++KLR+NKV++ + +LKKGS  EV G++AAQAD+E++FK+    KAE ++ 
Sbjct  300   QLIQWPIVEIQKLRNNKVKLTNEVLKKGSTIEVKGVTAAQADVEISFKVENLKKAEILKP  359

Query  611   RWTTDPQVLCSQKGASVR---GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMC  441
              W  DPQ+LCSQKG S     G +GPFGL VLAS + +EYT+VFF VF    +  VVLMC
Sbjct  360   EW-KDPQLLCSQKGTSSTTEGGSVGPFGLLVLASNDLKEYTSVFFTVFK-KPHKYVVLMC  417

Query  440   SDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTK  261
             SDQ+RSSL    DKT+YGAF+DV+P +E +SLR LIDHSIVESFG KGK CIT+RVYPT 
Sbjct  418   SDQSRSSLHSNNDKTTYGAFLDVDPTRENISLRSLIDHSIVESFGIKGKGCITARVYPTL  477

Query  260   AIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             AIG+   LYAFNNG  S+ ++KLTAWSMKK  IN
Sbjct  478   AIGDNVSLYAFNNGTDSVTITKLTAWSMKKAHIN  511



>ref|XP_010465246.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1 
[Camelina sativa]
Length=584

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/564 (58%), Positives = 421/564 (75%), Gaps = 13/564 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V+ +ASH V + L      + P  N  YRT FHFQPP+NWMNDPNGPM+YKG+YH FYQ+
Sbjct  24    VDLEASHHVYKRLSQSTNTESPSVNQPYRTGFHFQPPKNWMNDPNGPMIYKGIYHLFYQW  83

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DLVNW  H PA+ PS P  DING WSGS TILPN  P +LYT
Sbjct  84    NPKGAVWGNIVWAHSTSTDLVNWEPHPPAIFPSAPF-DINGCWSGSVTILPNGKPVILYT  142

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P+N SDPYL+EW KS  NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  143   GIDPKNQQVQNIAEPKNLSDPYLREWTKSTLNPLMAPDAINGINASSFRDPTTAWLGQDK  202

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+     G++
Sbjct  203   KWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSKGVE  262

Query  1112  TSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             TS  G     +KHV KISLD+++HDYYTIGTYD ++DK++PD G   + +  RYDYGK+Y
Sbjct  263   TSSFGEPNEILKHVFKISLDDTKHDYYTIGTYDRMKDKFVPDSGFKMDATAPRYDYGKYY  322

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E+
Sbjct  323   ASKTFYDSAKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVREV  382

Query  761   EKLRSNKVE-MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             E+LR+ +V+ + + +LK GS  EV G++A+QAD+EV FK+ +  KA+ ++  W TDPQ++
Sbjct  383   ERLRTKEVKNLRNKVLKSGSRLEVYGVTASQADVEVLFKVRDLEKADVIDPSW-TDPQLI  441

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDK  411
             CSQ   S +   GPFGL VLAS+N +EYT+V+FR+F    N+   VVLMCSDQ+RSSL++
Sbjct  442   CSQMNVSAKSSFGPFGLMVLASKNLEEYTSVYFRIFKARQNSSKFVVLMCSDQSRSSLEE  501

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YGAFVD+NP +  + LR LIDHS+VESFG  G+ CITSRVYP  AIG+ +HL+A
Sbjct  502   DNDKTTYGAFVDINPYK-PIPLRALIDHSVVESFGGNGRACITSRVYPKLAIGKSSHLFA  560

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN G  ++ +  L AWSM    I+
Sbjct  561   FNYGSQNVDVLNLNAWSMNSAQIS  584



>gb|AFV59225.1| cell wall invertase NcwINV [Elsholtzia haichowensis]
Length=556

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/536 (61%), Positives = 418/536 (78%), Gaps = 11/536 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             +  YRT++HFQPP+NWMNDPNGPM+YKG+YH FYQYNPKGA +G I W HSTSKDL+NW 
Sbjct  29    DQPYRTAYHFQPPKNWMNDPNGPMIYKGIYHLFYQYNPKGAVWGNIVWAHSTSKDLINWS  88

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
              H  A+ PS   +DING WSGSATIL    PA+LYTG++ +N+QVQNLA+P+N SDPYL 
Sbjct  89    PHPIAIYPS-IQSDINGCWSGSATILSKGKPAILYTGINPQNQQVQNLAIPKNLSDPYLI  147

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW+K   NP++AP   N+INA+SFRDPTTAW G DG WR++VG+K+GRRG A+++RSKDF
Sbjct  148   EWIKPQSNPMMAPTEQNQINASSFRDPTTAWLGRDGRWRVIVGNKIGRRGRALMFRSKDF  207

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYY  1041
             V W +AKHPL+S  G+GMWECPDF+PVSTS  +G+DTS VG  +KHVLK S+++   D Y
Sbjct  208   VHWTEAKHPLYSLRGTGMWECPDFFPVSTSGEDGVDTSKVGKGLKHVLKASINDGFFDSY  267

Query  1040  TIGTYDH--VRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLID  867
              IGTY +   +D ++P+KGS+  DS  +YD+GKFYASKTF+DS  +RRILWGWINES   
Sbjct  268   AIGTYKYNLGKDVFVPEKGSLRLDSQSKYDHGKFYASKTFFDSSTKRRILWGWINESTDA  327

Query  866   TEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSG  687
                +K+GWSGVQ IPR +WLDK+  QLVQWPV+E+EKLR  +V   +T LK GSV E+SG
Sbjct  328   ATDIKKGWSGVQAIPRKIWLDKSGNQLVQWPVKEIEKLRKGQVISSNTELKGGSVLEISG  387

Query  686   ISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQ  507
             ++A+QAD+E++F++  F   E+++ RW +DPQ +CS+ GA    G G FGL VLAS+  +
Sbjct  388   VTASQADVEISFEMSTFKNVEELDPRW-SDPQAICSKNGA----GKG-FGLLVLASKKLE  441

Query  506   EYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDH  327
             EYTAV+ RVF   N   VVLMCSDQ+RSSL    DKT+YGAFVDVNP++E+LSLR LIDH
Sbjct  442   EYTAVYLRVFRAKNRY-VVLMCSDQSRSSLHLDYDKTTYGAFVDVNPVKEKLSLRTLIDH  500

Query  326   SIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             SIVESFG +GK CIT+RVYP+ AI  +A LYAFNNG +++K+SKL A+S+K   I+
Sbjct  501   SIVESFGGEGKACITARVYPSIAIDGEARLYAFNNGTYNVKISKLAAYSIKDARIS  556



>gb|AEB66646.1| cell wall invertase [Rumex dentatus]
Length=577

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/535 (59%), Positives = 416/535 (78%), Gaps = 7/535 (1%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGAS-FGKISWGHSTSKDLVNWRAH  1572
             YRT++HFQPP+NW+NDPN P+VYKG+YH FYQ NP+GA+   +I WGHSTS DL+NW   
Sbjct  33    YRTAYHFQPPKNWINDPNAPLVYKGIYHLFYQQNPQGANWIQQIVWGHSTSTDLINWTEE  92

Query  1571  IPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEW  1392
               A+ PS P  DING WSGSA+ILP+  PA+LYTG++ +  QVQNLA  +N +DPYL+EW
Sbjct  93    PIAIEPSMPF-DINGCWSGSASILPDGNPAMLYTGLNQQAHQVQNLATSKNAADPYLREW  151

Query  1391  VKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVR  1212
             VKSP NPL+ PN    I   SFRDP+TAW  PDG+WR++VGSK G +GLA LY+SKDFV 
Sbjct  152   VKSPNNPLMTPNVGKNIETDSFRDPSTAWLLPDGSWRVIVGSKNGTQGLASLYKSKDFVH  211

Query  1211  WVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLDTSLVGSKIKHVLKISLDESRHDYYTI  1035
             W++ +HPLH  +G+G WECPDFYPV      G DTSL+G  +KHVLK+SL +++H+YYT+
Sbjct  212   WIEVEHPLHYADGTGNWECPDFYPVYRNGALGADTSLIGPNVKHVLKVSLFDTQHEYYTV  271

Query  1034  GTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYV  855
             G Y+   D Y+PD GS+++D GLRYDYGKFYASK+F+DS+ +RR+LWGW+NES    + V
Sbjct  272   GMYNVDEDVYVPDYGSIESDLGLRYDYGKFYASKSFFDSVSKRRVLWGWVNESCTAIDDV  331

Query  854   KQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAA  675
             K+GWSG+Q IPR+V LDK+ KQLVQWP++E+E L  ++V++P ++   GS+ EV GI+++
Sbjct  332   KKGWSGLQAIPRSVVLDKSGKQLVQWPIKEVETLHESQVDVPCSVTNGGSIVEVEGITSS  391

Query  674   QADMEVTFKI--MEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEY  501
             QAD+E++ K+    +   EK+    +T+PQ+LCS+ GAS  G IGPFGL VL+S+N +EY
Sbjct  392   QADIEISIKLDSHHYKNVEKLNVS-STNPQLLCSENGASKNGEIGPFGLLVLSSKNLEEY  450

Query  500   TAVFFRVFMGNNNNP-VVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHS  324
             TAV+FRVF  + +N  VVLMCSDQTRSSL+   DKT+YG+FVDV+P++E++ LR LIDHS
Sbjct  451   TAVYFRVFHDHKDNKLVVLMCSDQTRSSLNPTNDKTTYGSFVDVDPLEEQIHLRTLIDHS  510

Query  323   IVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             I+ESFGA+GK CIT+RVYP  AIG  AHL+ FNNG  ++K++ L+AWSMKK  IN
Sbjct  511   IIESFGAEGKTCITARVYPVLAIGNDAHLFIFNNGTETVKITGLSAWSMKKAHIN  565



>ref|XP_004515311.1| PREDICTED: beta-fructofuranosidase, cell wall isozyme-like isoform 
X1 [Cicer arietinum]
Length=603

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/560 (59%), Positives = 424/560 (76%), Gaps = 14/560 (3%)
 Frame = -1

Query  1793  LQNLEALQPPYP-NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA--SFGK  1623
             + ++EA    +  N TY+ SFHFQP +NWMNDPNGPM YKG+YH FYQ+NPKGA  S   
Sbjct  46    VAHIEAFHQTHSLNQTYKPSFHFQPHKNWMNDPNGPMRYKGLYHMFYQHNPKGAIWSNNS  105

Query  1622  ISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQV  1443
             I WGHS SKDLVNW +   AL PS+ + DING WSGS+T+LPN+ P +LYTG+D    Q 
Sbjct  106   IVWGHSISKDLVNWLSLQHALIPSE-SYDINGCWSGSSTLLPNDKPKILYTGIDINQHQT  164

Query  1442  QNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP-DGNWRILVGS  1266
             QNLA+P+N SDP L+EW+KSP NPL+ PN+ NKINATSFRDPTTAW G  DG WR+L+GS
Sbjct  165   QNLAIPKNVSDPLLREWIKSPNNPLMEPNNVNKINATSFRDPTTAWIGHHDGFWRVLIGS  224

Query  1265  KVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLV-GSK  1092
             +   +G+ IL++SKDF  W+Q K+P +S + +GMWECPDF+PV  + + GLD S+  G  
Sbjct  225   QKKDKGILILFKSKDFFNWIQDKNPFYSAKNTGMWECPDFFPVLINGSIGLDISINNGYG  284

Query  1091  IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKG--SVDNDSGL--RYDYGKFYASKTFY  924
             I+HV+K+SL +  HDYY IGTYD ++D ++PDKG   ++N+  L  RYDYGKFYASKTFY
Sbjct  285   IRHVVKVSLIDVSHDYYFIGTYDTIKDVFVPDKGFDKINNELSLVLRYDYGKFYASKTFY  344

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             D  K+RR+LWGWINES I  + VK+GWSG+Q IPRT+WL K+ KQL+QWP+ E+EKLRSN
Sbjct  345   DGEKKRRVLWGWINESSIQEDDVKKGWSGIQAIPRTLWLHKSGKQLIQWPIVEIEKLRSN  404

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
              V + S +LK G + E+ G++AAQAD+E++F++ E  KA+ ++  W  DPQ LC + G+ 
Sbjct  405   HVNLHSKVLKGGKMLEIFGVTAAQADVEISFEVKELEKAQVLDPSWKLDPQHLCKENGSK  464

Query  563   VRG--GIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSY  390
             V+G  G+GPFGL VLAS++ +EYT +FF+VF GN  + VVLMC D  RSSL+   D  +Y
Sbjct  465   VKGVVGLGPFGLLVLASKDMKEYTTIFFKVFRGNKKH-VVLMCCDTRRSSLNHNNDLANY  523

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
             GAFVDV+P+ EELS+R LIDHS+VESFGA+GK CIT+RVYPT AI +KAHL+ FNNG   
Sbjct  524   GAFVDVDPINEELSIRSLIDHSVVESFGAQGKACITTRVYPTLAINDKAHLHVFNNGTID  583

Query  209   IKLSKLTAWSMKKPTIN*LH  150
             +K+ KL AWSMKK  IN +H
Sbjct  584   VKIKKLNAWSMKKAKINEMH  603



>gb|AFJ21580.1| cell wall invertase [Agave tequilana]
Length=575

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/558 (58%), Positives = 412/558 (74%), Gaps = 7/558 (1%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             G V+ + SH V Q L ++     ++ YRT FHFQPPRNW+NDPNGPM Y G+YH FYQYN
Sbjct  21    GVVDVEGSHDVYQELMSVPAEVVDNKYRTQFHFQPPRNWINDPNGPMYYNGIYHLFYQYN  80

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             P GA +G I W HS S D++NW+A  PA+ PS+P  D+NG WSGSATILP N PA+LYTG
Sbjct  81    PYGAVWGNIVWAHSVSTDMINWKALEPAIYPSKPF-DVNGCWSGSATILPGNKPAILYTG  139

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             +D +NRQVQN+A P+N SDPYL+EWVK   NP+IAP   N INA++FRDPTTAW GPDG+
Sbjct  140   IDPQNRQVQNIAFPKNLSDPYLREWVKPDYNPIIAP--VNGINASAFRDPTTAWHGPDGH  197

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDT  1110
             WR+++GSK   RG+AI+YRS+DF+ W++AKHPLHS  G+GMWECPDFYPV+T    G+DT
Sbjct  198   WRLVIGSKRKHRGMAIMYRSRDFIHWIRAKHPLHSANGTGMWECPDFYPVATQGKLGVDT  257

Query  1109  SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKT  930
             S  G+ +K+VLK SLD +R++YYT+G Y    DKY+PD  S D+ SGLRYDYG FYASKT
Sbjct  258   SEYGAGLKYVLKASLDLTRYEYYTLGYYLRDVDKYVPDGTSADDGSGLRYDYGNFYASKT  317

Query  929   FYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR  750
             FYD+ K+RR+L GW NES    + V +GW+G+Q IPR V LD   +QL+QWP++ELE LR
Sbjct  318   FYDAGKKRRVLLGWSNESDSRQDDVSKGWAGIQIIPRVVLLDSNERQLIQWPIKELETLR  377

Query  749   SNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKG  570
                V +    +K G   E+SGI A+QAD+EV F++    KAE  +  W TDPQ LC  KG
Sbjct  378   GKLVSVQKKKIKSGGSLEISGIMASQADVEVAFELSSLEKAELFDASW-TDPQKLCELKG  436

Query  569   ASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSY  390
             A V+GG+GPFGL  LAS NRQE TAVFFR+F G N+  V LMC D ++SSL     K  Y
Sbjct  437   ADVKGGVGPFGLLALASANRQEQTAVFFRIFKGLNSF-VALMCHDPSKSSLRPGLYKPIY  495

Query  389   GAFVDVNPMQE-ELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             G +VDV+  +  +LSLR LIDHS+VESFGA+G+ CITSRVYP+ A+G  AHL+ FNNG  
Sbjct  496   GGWVDVDIQKNGKLSLRSLIDHSVVESFGAEGRTCITSRVYPSLAVGNAAHLFVFNNGEE  555

Query  212   SIKLSKLTAWSMKKPTIN  159
              +K+S+L AW M+KP +N
Sbjct  556   DVKVSELKAWEMRKPLMN  573



>ref|XP_010685380.1| PREDICTED: beta-fructofuranosidase, cell wall isozyme-like [Beta 
vulgaris subsp. vulgaris]
Length=584

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/565 (58%), Positives = 424/565 (75%), Gaps = 12/565 (2%)
 Frame = -1

Query  1829  YGGVETQASHIV---LQNLEALQPPYPN-HTYRTSFHFQPPRNWMNDPNGPMVYKGVYHF  1662
             YG +E QASH V   LQ++   Q  + +   YRT++HFQP +NWMNDP GPM+YKG+YH 
Sbjct  22    YGVIELQASHHVSNHLQDVATSQSLFSDDQPYRTAYHFQPLKNWMNDPCGPMIYKGIYHL  81

Query  1661  FYQYNP--KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNM  1488
             FYQYNP   G+  G   WGHSTS DL+NW      L      A++N +W+GS TIL +  
Sbjct  82    FYQYNPIGNGSPDGPRVWGHSTSLDLINWTPQPLTLLLQL-EANMNSSWTGSITILQDYK  140

Query  1487  PALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTA  1308
             PA+L+TG+  +N QVQ+LA P++ SDPYL+EW+  P+NP+++P   NKINATSFRDPTTA
Sbjct  141   PAILFTGITPKNEQVQDLAFPKDLSDPYLKEWILVPQNPVMSPTQENKINATSFRDPTTA  200

Query  1307  WRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS  1128
             WR PDG+WR+++GSK+ RRGLA+L+RSKDF+ WVQA HPL+S E +GMWECPDF+PV+ +
Sbjct  201   WRLPDGSWRVVIGSKIERRGLALLFRSKDFINWVQADHPLYSYELTGMWECPDFFPVNVN  260

Query  1127  --PNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDY  954
               P G++TS +G  +KHVLK+SLD+++HD YTIGTYD  +D YIPD G   NDS LRYDY
Sbjct  261   GIPIGVETSAIGPNVKHVLKLSLDDTKHDIYTIGTYDVFKDAYIPDVG-FQNDSSLRYDY  319

Query  953   GKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWP  774
             GK+YASKTFYDS K +R+L  W+NES    + +K+GWSG+  +PR VWLD + KQL+QWP
Sbjct  320   GKYYASKTFYDSSKMQRLLLSWVNESSSLADDIKKGWSGIHAVPRRVWLDISGKQLIQWP  379

Query  773   VQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDP  594
             + E+E LR N V +P  ++K GSV E+ GISAAQAD+E++F + +    EK E  W T+P
Sbjct  380   IPEIESLRVNPVILPIQLIKGGSVIEIPGISAAQADVELSFGLRDLSNIEKFEASW-TNP  438

Query  593   QVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP-VVLMCSDQTRSSL  417
             Q+LCSQKGA V GG+GPFGL  LAS   +EYTAVFFR+F   +N+  VVLMCSDQ+RSSL
Sbjct  439   QLLCSQKGALVSGGLGPFGLLTLASMGLEEYTAVFFRIFKDYDNDKFVVLMCSDQSRSSL  498

Query  416   DKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHL  237
             +  TDKT+YG FV+VNP+ E LSLRILIDHS++ESFG KGK  IT+RVYPT A  +KA L
Sbjct  499   NPTTDKTTYGTFVNVNPIYEGLSLRILIDHSVIESFGGKGKNVITARVYPTLATNDKARL  558

Query  236   YAFNNGVHSIKLSKLTAWSMKKPTI  162
             Y FN G  S++++ LTAWSMKK  I
Sbjct  559   YVFNYGRGSVQITWLTAWSMKKANI  583



>ref|XP_010487151.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV5-like 
[Camelina sativa]
Length=576

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/552 (60%), Positives = 413/552 (75%), Gaps = 13/552 (2%)
 Frame = -1

Query  1799  IVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA--SFG  1626
             +VL  L  +     N  YRT +HFQ P+NWMNDPNGPMVYKG+YH FYQ+NP GA     
Sbjct  25    VVLDALHNVPNHIKNQPYRTGYHFQAPKNWMNDPNGPMVYKGIYHLFYQWNPNGALMEVN  84

Query  1625  KISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQ  1446
                WGH+TS DL+NW  H PA+ PS+P+ DING WSGS TILPN  P LLYTG D  NRQ
Sbjct  85    DTVWGHATSTDLINWITHSPAIKPSRPS-DINGCWSGSVTILPNGKPVLLYTGNDRYNRQ  143

Query  1445  VQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGS  1266
             VQNLA+P+N +DPYL+ W KSP NPL+ P   N IN+T+FRDPTTAW G DG WRI  GS
Sbjct  144   VQNLAIPKNLTDPYLRHWTKSPENPLVTPGDANHINSTAFRDPTTAWLGRDGRWRITTGS  203

Query  1265  KVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLV-GSK  1092
             + GRRGLAIL+ S+DFVRW Q+  PLH  +G+GMWECPDF+PV+ T   G+DT+   G  
Sbjct  204   QDGRRGLAILHTSRDFVRWKQSMKPLHYHDGTGMWECPDFFPVARTDSRGVDTTAFNGKM  263

Query  1091  IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLK  912
             +KHVLK+SL ++ HDYYTIGTYD VRD Y+PD G V +++  RYDYGKFYASKTFYDS+ 
Sbjct  264   VKHVLKVSLTDTFHDYYTIGTYDQVRDVYVPDNGFVQDETAPRYDYGKFYASKTFYDSVY  323

Query  911   RRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEM  732
             +RRILWGW+NES  D + V  GW+ +Q IPR VWLD++ K LVQWPV+E+E LR+ +V+ 
Sbjct  324   QRRILWGWVNESSTDKDIVNMGWARLQAIPRKVWLDESGKSLVQWPVKEIESLRTTQVKW  383

Query  731   PSTMLK-KGSVSEVSGISAAQADMEVTFKI--MEFGKAEKMEERWTTDPQVLCSQKGAS-  564
              + +LK  GSV EV G++A+QAD+EV FK+  ++  KA+ +E  W TDPQ++CSQK AS 
Sbjct  384   GNKVLKGGGSVMEVHGVTASQADVEVFFKVSGLDLEKADVIEPGW-TDPQLICSQKNASL  442

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDKKTDKTSY  390
             V+ G+GPFGL VL S+N +EYT+V+ R+F    N+   VV+MCSDQ+RSSL+K  DKT Y
Sbjct  443   VKSGLGPFGLMVLVSKNLEEYTSVYLRIFKARENSKEHVVVMCSDQSRSSLEKGNDKTPY  502

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
             GAFVDV+P Q  +SLR LID+SIVESFG KGK CITSRVYP  A G++ HL+AFN G  S
Sbjct  503   GAFVDVSPYQ-TISLRTLIDNSIVESFGGKGKACITSRVYPKLATGKRTHLFAFNKGSQS  561

Query  209   IKLSKLTAWSMK  174
             + +  L+AWSMK
Sbjct  562   VDVLSLSAWSMK  573



>gb|KDO65253.1| hypothetical protein CISIN_1g008242mg [Citrus sinensis]
 gb|KDO65254.1| hypothetical protein CISIN_1g008242mg [Citrus sinensis]
Length=511

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/470 (66%), Positives = 388/470 (83%), Gaps = 3/470 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             +G VE QASH V +NL+  Q   PN  YRT +HFQPP+NW+NDPNG M+YKG+YH FYQY
Sbjct  18    HGVVELQASHHVYRNLQTSQSTSPNQPYRTGYHFQPPKNWINDPNGVMIYKGIYHLFYQY  77

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTSKDL+NW  H PA+ PSQ  +DING WSGSATILP   PA+ YT
Sbjct  78    NPKGAVWGNIVWAHSTSKDLINWIPHDPAIYPSQ-QSDINGCWSGSATILPGEKPAIFYT  136

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D  NRQVQNLAVP+N SDPYL+EWVKSP+NPL+AP+  N+IN +SFRDPTTAW GPD 
Sbjct  137   GIDPHNRQVQNLAVPKNLSDPYLREWVKSPKNPLMAPDAMNQINTSSFRDPTTAWLGPDK  196

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ R+GLAILYRSKDFV W++AKHPLHS +G+GMWECPDF+PVST   NGLD
Sbjct  197   RWRVIIGSKINRKGLAILYRSKDFVHWIKAKHPLHSVKGTGMWECPDFFPVSTYGLNGLD  256

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS +G   KHVLK+SLD+++H+YYT+GTY   +D+Y+PD+GSV++DSGLR+DYGK+YASK
Sbjct  257   TSDMGPNTKHVLKVSLDDTKHEYYTVGTYSTAKDRYVPDEGSVESDSGLRFDYGKYYASK  316

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             TF+D  K RR+LWGW+NES    + VK+GW+G+Q IPR +WLDK+ K LVQWPV E+EKL
Sbjct  317   TFFDGAKNRRVLWGWVNESSSVNDDVKKGWAGIQAIPRKLWLDKSGKHLVQWPVVEIEKL  376

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQK  573
             R N+V++PS +LK GSV EV+G++AAQAD+E++F + +F KAEK++  W T+PQ+LCSQK
Sbjct  377   RVNQVQVPSKLLKGGSVIEVTGVTAAQADVEISFDVSDFKKAEKLDPGW-TNPQLLCSQK  435

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRS  423
             GASV+G +GPFGL  LAS++ +EYTAVFFR+F G +N  VVLMCSDQ+RS
Sbjct  436   GASVKGALGPFGLLALASKDLKEYTAVFFRIFKGEDNKFVVLMCSDQSRS  485



>gb|AFJ21574.1| cell wall invertase [Agave tequilana]
Length=575

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/558 (58%), Positives = 410/558 (73%), Gaps = 7/558 (1%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             G V+ + SH V Q L ++     +  YRT FHFQPPRNW+NDPNGPM Y G+YH FYQYN
Sbjct  21    GVVDVEGSHDVYQELMSVPAEVVDSKYRTQFHFQPPRNWINDPNGPMYYNGIYHLFYQYN  80

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             P GA +G I W HS S D++NW+A  PA+ PS+P   +NG WSGSATILP N PA+LYTG
Sbjct  81    PYGAVWGNIVWAHSVSTDMINWKALEPAIYPSKPFG-VNGCWSGSATILPGNKPAILYTG  139

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             +D +NRQVQN+A P+N SDPYL+EWVK   NP+IAP   N INA++FRDPTTAW GPDG+
Sbjct  140   IDPQNRQVQNIAFPKNLSDPYLREWVKPDYNPIIAP--VNGINASAFRDPTTAWHGPDGH  197

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDT  1110
             WR+++GSK   RG+AI+YRS+DF+ W++AKHPLHS  G+GMWECPDFYPV+T    G+DT
Sbjct  198   WRLVIGSKRKHRGMAIMYRSRDFIHWIRAKHPLHSANGTGMWECPDFYPVATQGKLGVDT  257

Query  1109  SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKT  930
             S  G+ +K+VLK SLD +R++YYT+G Y    DKY+PD  S D+ SGLRYDYG FYASKT
Sbjct  258   SEYGAGLKYVLKASLDLTRYEYYTLGYYLRDVDKYVPDGTSADDGSGLRYDYGNFYASKT  317

Query  929   FYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR  750
             FYD+ K+RR+L GW NES    + V +GW+G+Q IPR V LD   +QL+QWP++ELE LR
Sbjct  318   FYDAGKKRRVLLGWSNESDSRQDDVSKGWAGIQIIPRVVLLDSNERQLIQWPIKELETLR  377

Query  749   SNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKG  570
                V +    +K G   E+SGI A+QAD+EV F++    KAE  +  W TDPQ LC  KG
Sbjct  378   GKLVSVQKKKIKSGGSLEISGIMASQADVEVAFELSSLEKAEPFDASW-TDPQKLCELKG  436

Query  569   ASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSY  390
             A V+GG+GPFGL  LAS NRQE TAVFFR+F G N+  V LMC D ++SSL     K  Y
Sbjct  437   ADVKGGVGPFGLLALASANRQEQTAVFFRIFKGLNSF-VALMCHDPSKSSLRPGLSKPIY  495

Query  389   GAFVDVNPMQE-ELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             G +VDV+  +  +LSLR LIDHS+VESFGA+G+ CITSRVYP+ A+G  AHL+ FNNG  
Sbjct  496   GGWVDVDIQKNGKLSLRSLIDHSVVESFGAEGRTCITSRVYPSLAVGNAAHLFVFNNGEE  555

Query  212   SIKLSKLTAWSMKKPTIN  159
              +K+S+L AW M+KP +N
Sbjct  556   DVKVSELKAWEMRKPLMN  573



>ref|XP_010245596.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1 isoform 
X1 [Nelumbo nucifera]
Length=573

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/556 (59%), Positives = 408/556 (73%), Gaps = 7/556 (1%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             GV  +ASH V    + L     +  YRT +HFQP ++W+NDPNGPM Y G+YH FYQYNP
Sbjct  24    GVFVEASHRVFPQYQPLAVSKVSQRYRTGYHFQPSKHWINDPNGPMYYNGIYHLFYQYNP  83

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
             +GA +G I W HS S DL+NW    PAL P++P  DING WSGSATILP N P +LYTG+
Sbjct  84    RGAVWGNIVWAHSVSTDLINWAPLEPALYPTEPF-DINGCWSGSATILPGNKPVILYTGI  142

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             D++NRQVQN+AVP+N SDPYL+EW K   NPL+ P     IN +SFRDPTTAW G +G+W
Sbjct  143   DTQNRQVQNIAVPKNLSDPYLREWTKPGHNPLMVPA--GDINVSSFRDPTTAWWG-NGHW  199

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTS  1107
             ++LVG+K GRRG+A+LYRS+DFV W ++ HPLHS  G+GMWECPDF+PVS +   GLD S
Sbjct  200   KVLVGNKRGRRGMALLYRSRDFVTWKKSPHPLHSAPGTGMWECPDFFPVSLAGEEGLDAS  259

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
               G  +KHVLK+SLD SR +YYT+G Y   +D+YIPD  S DN  GLR+DYG FYASKTF
Sbjct  260   RTGVGVKHVLKVSLDSSRFEYYTVGRYFPEKDRYIPDNTSADNAMGLRFDYGNFYASKTF  319

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +D+ K+RRILWGW NES    + V +GW+G+Q IPR +WLDK+ +Q+VQWP+QELE LR 
Sbjct  320   FDAGKKRRILWGWTNESDTAADDVAKGWAGIQTIPRKLWLDKSGRQIVQWPIQELEALRQ  379

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
             N V +    L+KG + EV GI+AAQAD+EVTF +    KAE  +  W  DPQ  CS++GA
Sbjct  380   NGVHLRKVHLRKGGIVEVKGITAAQADVEVTFSLPNLKKAEPFDPSW-DDPQQQCSRRGA  438

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
             +V GG+GPFGL  LAS N  EYT++FFRVF   + + VVLMCSDQTRSSL  +  K ++G
Sbjct  439   TVEGGVGPFGLLALASRNLDEYTSIFFRVFKAQDKH-VVLMCSDQTRSSLRTEVYKPAFG  497

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
              FV V+    +LSLR LID+S+VESFGA GK CITSRVYP  A+ E AHLYAFNNG   +
Sbjct  498   GFVYVDLEDGKLSLRSLIDNSVVESFGAGGKTCITSRVYPILAVAEGAHLYAFNNGSEPV  557

Query  206   KLSKLTAWSMKKPTIN  159
             +L KL AWSM++P +N
Sbjct  558   QLVKLKAWSMRRPRMN  573



>emb|CDY23644.1| BnaC05g39500D [Brassica napus]
Length=605

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/548 (59%), Positives = 418/548 (76%), Gaps = 13/548 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMN-DPNGPMVYKGVYHFFYQ  1653
             V+ +ASH V + L     ++ P  N  YRTSFHFQPP+NWMN DPNGPM+YKG+YH FYQ
Sbjct  24    VDLEASHHVYKRLTQSTNIKSPSVNQPYRTSFHFQPPKNWMNADPNGPMIYKGIYHLFYQ  83

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             +NP GA +G I W HSTS DL+NW  H  A+ PS+P  DI G WSGSATILP+  P +LY
Sbjct  84    WNPNGAVWGNIVWAHSTSTDLINWDPHPAAIFPSEPF-DIKGCWSGSATILPDGKPVILY  142

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D +N+QVQN+A P+N SDPYL EW KSP NPL+AP+  N INA+SFRDPTTAW G D
Sbjct  143   TGIDPKNQQVQNIAEPKNLSDPYLVEWTKSPLNPLMAPDAVNGINASSFRDPTTAWLGHD  202

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
               WR+++GSK+ RRGLAI Y SKD ++W ++  PLH  +GSGMWECPDF+PV+     G+
Sbjct  203   NKWRVIIGSKIHRRGLAITYTSKDLLKWEKSTEPLHYDDGSGMWECPDFFPVTRFGSKGV  262

Query  1115  DTSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKF  945
             +TS  G     +KHVLK+SLD+++HDYYT+GTYD V DK++PDKG   + S  RYDYGK+
Sbjct  263   ETSSFGEPNEVLKHVLKVSLDDTKHDYYTLGTYDRVGDKFVPDKGFKMDSSAPRYDYGKY  322

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ KQL+QWPV+E
Sbjct  323   YASKTFYDSAKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKQLIQWPVRE  382

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             +E+LR+N+V + + +L   S  EV G++AAQAD+EV FK+ +  KA+ ++  W TDPQ++
Sbjct  383   VERLRTNQVNLRNKVLDSRSRLEVYGVTAAQADVEVLFKVRDLEKADVIQPSW-TDPQLI  441

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDK  411
             CSQ   SV+ G+GPFGL VLAS+N +E+T+V+FR+F    N+NN VV+MCSDQ+RSSL +
Sbjct  442   CSQMNVSVKSGLGPFGLMVLASKNLEEFTSVYFRIFKARRNSNNYVVVMCSDQSRSSLKE  501

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YGAFVD+NP Q  LSLR LID+S+VESFG +G+ CITSRVYP  AIG+ +HLYA
Sbjct  502   GNDKTTYGAFVDINPRQ-PLSLRALIDNSVVESFGGRGRACITSRVYPKLAIGKGSHLYA  560

Query  230   FNNGVHSI  207
             FN G  S+
Sbjct  561   FNYGSQSV  568



>ref|XP_004303654.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Fragaria vesca subsp. vesca]
Length=565

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/555 (60%), Positives = 414/555 (75%), Gaps = 13/555 (2%)
 Frame = -1

Query  1805  SHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKG--AS  1632
             S+ VLQ  E        H YRT +HFQP RNWMNDPNGP++YKG+YH FYQYNP+G  A 
Sbjct  18    SYGVLQTSELTSA----HHYRTGYHFQPRRNWMNDPNGPLIYKGIYHLFYQYNPRGTGAG  73

Query  1631  FGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRN  1452
             +  I W HSTS DL+NW  H  A+ PS+   DING WSGS TILP   PA+ YTGV+S+N
Sbjct  74    YRHIVWAHSTSTDLINWIPHNDAIYPSE-TFDINGCWSGSVTILPGGKPAIFYTGVNSQN  132

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              Q QNLA PRN SDP+L+EWVK P+NPLI+    N INA+SFRDP+TAW GPD  WR++V
Sbjct  133   EQAQNLAFPRNLSDPFLKEWVKIPQNPLISATPANHINASSFRDPSTAWLGPDHRWRLIV  192

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGS  1095
             GS+ G+ GLAILYRS+DF++W +AKHPLHS + +GMWECPDF+PVS T   GLDTS  G 
Sbjct  193   GSRKGKTGLAILYRSRDFLKWTKAKHPLHSTKENGMWECPDFFPVSKTKLLGLDTSATGP  252

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDND-SGLRYDYGKFYASKTFYDS  918
              +KHV K+SLD ++ +YYT GTY+  +D YIPDKGSV++D SGLRYDYGKFYASKTF+DS
Sbjct  253   NVKHVFKVSLDNTKKEYYTTGTYNVEKDIYIPDKGSVESDNSGLRYDYGKFYASKTFFDS  312

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K RRILWGWINES      + +GWSG+Q +PRTV LDK+ K+LVQWP+ ELEKLR+  V
Sbjct  313   AKNRRILWGWINESSSVKGDINKGWSGLQAVPRTVLLDKSGKELVQWPIVELEKLRTKHV  372

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
             ++P+ +LK+GS+  V G++ AQA +E+TF+I +  KAE  +  W TDPQ LCS+KGASV+
Sbjct  373   KLPNIVLKEGSLHRVLGVTPAQAVVEITFEISDLKKAEVFDPSW-TDPQTLCSKKGASVK  431

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNN--NPVVLMCSDQTRSSLDKKTDKTSYGA  384
             GG+GPFGL VLAS+  +E TAVF+R+F   NN    VVLMCSDQ+RSSL++  D  +YG 
Sbjct  432   GGLGPFGLLVLASKGLKENTAVFYRIFKSQNNKYKYVVLMCSDQSRSSLNQDNDMITYGT  491

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             FV+V+P+ E+LSLR LIDHSIVESFG  GK CIT+RVYP   +     LY FN G  S++
Sbjct  492   FVNVDPVHEKLSLRSLIDHSIVESFGGLGKACITARVYPKLTVDGDTRLYIFNYGNESVE  551

Query  203   LSKLTAWSMKKPTIN  159
             ++    WSMK   +N
Sbjct  552   ITG-DVWSMKTAKMN  565



>ref|XP_006297301.1| hypothetical protein CARUB_v10013316mg [Capsella rubella]
 gb|EOA30199.1| hypothetical protein CARUB_v10013316mg [Capsella rubella]
Length=581

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/564 (58%), Positives = 420/564 (74%), Gaps = 16/564 (3%)
 Frame = -1

Query  1820  VETQASHIVLQNLEA---LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             V+ +ASH V + L      + P     YRT FHFQPP+NWMN   GPM+YKG+YH FYQ+
Sbjct  24    VDLEASHHVYKRLSQSTNTKSPSVTQPYRTGFHFQPPKNWMN---GPMIYKGIYHLFYQW  80

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HSTS DL+NW  H PA+ PS P  DING WSGS TILP+  P +LYT
Sbjct  81    NPKGAVWGNIVWAHSTSTDLINWEPHPPAIFPSAPF-DINGCWSGSVTILPSGKPVILYT  139

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D +N+QVQN+A P++ SDPYL+EW KS  NPL+AP+  N INA+SFRDPTTAW G D 
Sbjct  140   GIDPKNQQVQNIAEPKDLSDPYLREWKKSTLNPLMAPDAVNGINASSFRDPTTAWLGQDK  199

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLD  1113
              WR+++GSK+ RRGLAI Y SKDF++W ++  PLH  +GSGMWECPDF+PV+    NG++
Sbjct  200   KWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDDGSGMWECPDFFPVTRFGSNGVE  259

Query  1112  TSLVGSK---IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFY  942
             TS  G     +KHVLKISLD+++HDYYTIGTYD V+DK++PD G   + S  RYDYGK+Y
Sbjct  260   TSSFGKPNEILKHVLKISLDDTKHDYYTIGTYDRVKDKFVPDSGFKMDASAPRYDYGKYY  319

Query  941   ASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQEL  762
             ASKTFYDS K RRILWGW NES    + V++GWSG+Q IPR +WLD++ K+L+QWPV+E+
Sbjct  320   ASKTFYDSAKNRRILWGWTNESSSVEDDVEKGWSGIQTIPRKIWLDRSGKRLIQWPVREV  379

Query  761   EKLRSNKVE-MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             E+LRS +V+ + + +LK GS  EV G++AAQAD+EV FK+ +  KA+ +E  W TDPQ++
Sbjct  380   ERLRSKQVKNLRNKVLKSGSRLEVYGVTAAQADVEVLFKVRDLEKADVIEPSW-TDPQLI  438

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDK  411
             CS+   SV+   GPFGL V AS+N +EYT+V+FR+F    N+   VV+MCSDQ+RSSL++
Sbjct  439   CSKMNVSVKSSFGPFGLMVFASKNLEEYTSVYFRIFKSRQNSSKYVVVMCSDQSRSSLEE  498

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YGAFVD+NP Q  +SLR LIDHS+VESFG KG+ CITSRVYP  AIG+  HL+A
Sbjct  499   DNDKTTYGAFVDINPYQ-PISLRALIDHSVVESFGGKGRACITSRVYPKLAIGKSTHLFA  557

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN G  S+ +  L AWSM    I+
Sbjct  558   FNYGSQSVDVLNLNAWSMNSAQIS  581



>gb|KDO65258.1| hypothetical protein CISIN_1g008686mg [Citrus sinensis]
Length=557

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/553 (58%), Positives = 411/553 (74%), Gaps = 22/553 (4%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
             +Q  +  LQ  ++      +  YRT +HFQPP +WMNDPNGPM+YKG+YHFFYQY     
Sbjct  26    SQHVYRTLQTCQSFSSSITSQPYRTGYHFQPPSSWMNDPNGPMIYKGIYHFFYQYK----  81

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +  + WGHSTS D+VNW  H  A+ PSQP  D N  WSGS TILP   PA+LYTG+D+ 
Sbjct  82    LWDTVVWGHSTSTDMVNWTPHDAAIYPSQPF-DANSCWSGSVTILPGGNPAVLYTGIDAG  140

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             N+QVQNLAVP+N SDPYL+EW+K P NPL+ P   ++I+  SFRDPTTAW GPD  WR++
Sbjct  141   NKQVQNLAVPKNLSDPYLKEWIKPPENPLMVPA--DQIDPGSFRDPTTAWIGPDKIWRVI  198

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVG  1098
             +GSK+   GLAILYRSKDFV W +A+  L+S   SGMWECPDF+PVST SP G+DTS++G
Sbjct  199   IGSKINDTGLAILYRSKDFVNWTKAEQSLYSTNQSGMWECPDFFPVSTKSPKGVDTSVIG  258

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               IKHVLK+SL   + DYYTIGTY+   D YI ++GS D++SGLRYDYGKFY SKTF+DS
Sbjct  259   PNIKHVLKVSLSNYQQDYYTIGTYNITTDTYIAEEGSFDDNSGLRYDYGKFYGSKTFFDS  318

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K RRILWGWINES   ++ +K+GW+G+Q  PR +WLDK+ +QL+QWP+ E+EKLR N+V
Sbjct  319   AKNRRILWGWINESSTRSDNLKKGWAGLQATPRNLWLDKSGRQLMQWPISEIEKLRGNQV  378

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
             + P+ +L++GS+  ++GI+AAQAD+E++F+   F KAE ++  W T+PQ LC        
Sbjct  379   KWPAKLLERGSMVGITGITAAQADVEISFQTTAFEKAEVLDSIW-TNPQFLC--------  429

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
                 PFGL VLAS   QEYTAVFFR+F G + + +VLMCSDQ+RSS++   DKTSYGAF+
Sbjct  430   ----PFGLLVLASNGLQEYTAVFFRIFKGQDRH-IVLMCSDQSRSSINDDNDKTSYGAFL  484

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             D++P+ E+LS+R LID SIVESFG  GK CIT+R+YPT AI +KAHLYAFNNG   + ++
Sbjct  485   DLDPVHEKLSIRSLIDRSIVESFGGGGKACITARIYPTLAIHDKAHLYAFNNGTEKVNIT  544

Query  197   KLTAWSMKKPTIN  159
              L AWSMKK  IN
Sbjct  545   SLRAWSMKKAQIN  557



>ref|XP_009147526.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV3 
[Brassica rapa]
Length=578

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/536 (59%), Positives = 402/536 (75%), Gaps = 6/536 (1%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KISWGHSTSKDLVNW  1581
             N  YRT +HFQPP NWMNDPNGPMVYKG+YH FYQYNP GA +  +I WGHSTS DLVNW
Sbjct  27    NQPYRTGYHFQPPSNWMNDPNGPMVYKGIYHLFYQYNPYGAVWDVRIVWGHSTSLDLVNW  86

Query  1580  RAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYL  1401
                 PA SPSQP+ DING WSGS TILPN  P +LYTG+D    QVQN+AVP N SDPYL
Sbjct  87    TPQPPAFSPSQPS-DINGCWSGSVTILPNGTPVILYTGIDQNKSQVQNVAVPVNISDPYL  145

Query  1400  QEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG-RRGLAILYRSK  1224
             +EW KSP NPL+APN  N IN   FRDPTTAW G DG WR++VGS    RRGLA+LY+S+
Sbjct  146   REWSKSPANPLMAPNAVNGINPDRFRDPTTAWMGHDGEWRVIVGSSTDDRRGLAVLYKSR  205

Query  1223  DFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSKIKHVLKISLDESRHD  1047
             DF  W QA  PLH  + +GMWECPDF+PVS T  + L+TS  G ++KHVLK+SL E+ HD
Sbjct  206   DFFNWTQATKPLHHEDLTGMWECPDFFPVSITGTDCLETSSFG-EVKHVLKVSLIETLHD  264

Query  1046  YYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLID  867
             YYTIG+YD  +D Y+PD G V + S  R DYGKFYASKTFYD +K+RRILWGW+NES   
Sbjct  265   YYTIGSYDREKDVYVPDHGFVQDGSAPRLDYGKFYASKTFYDDVKKRRILWGWVNESSPA  324

Query  866   TEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSG  687
              + +++GWSG+Q  PR +WL ++  +L+QWP++E+E LR  +V+  + +LK GS  +V G
Sbjct  325   KDDIEKGWSGLQSFPRKIWLGESGNELLQWPIEEIETLRETQVKWDNKVLKAGSTIQVHG  384

Query  686   ISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQ  507
             ++AAQAD++V+FK+ +  KA+ +E  W TDPQ +CS++  SV+ G+GPFGL VL S + +
Sbjct  385   VTAAQADVDVSFKVKDLEKADVIEPSW-TDPQKICSEEDLSVKSGLGPFGLMVLTSNDME  443

Query  506   EYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDH  327
             EYT+V+FR+F  N+   VVLMCSDQ+RSSL+++ DK ++GAFV ++P QE LSLR LIDH
Sbjct  444   EYTSVYFRIFKSNDTKYVVLMCSDQSRSSLNEENDKATFGAFVAIDPSQETLSLRTLIDH  503

Query  326   SIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             SIVES+G  GKVCITSRVYP  AIGE  +L+ FN G  S+ +  L+AWS+K   IN
Sbjct  504   SIVESYGGGGKVCITSRVYPKLAIGENTNLFVFNKGTQSVDVLSLSAWSLKSAQIN  559



>ref|XP_007135538.1| hypothetical protein PHAVU_010G137800g [Phaseolus vulgaris]
 gb|ESW07532.1| hypothetical protein PHAVU_010G137800g [Phaseolus vulgaris]
Length=562

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/551 (58%), Positives = 421/551 (76%), Gaps = 10/551 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             A+H   +NL+ L     +  YRT++HFQPP+NW+NDPNGPM Y G+YH FYQYNP+ A +
Sbjct  21    ATHHFSRNLQTLSSDSNDQPYRTAYHFQPPKNWINDPNGPMRYGGLYHLFYQYNPQAAVW  80

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNR  1449
             G I WGHS SKDLVNW    PA+ PSQP+ DI G WSGS T+LP N PA+LYTG+DS   
Sbjct  81    GNIVWGHSVSKDLVNWTTLDPAIFPSQPS-DIKGCWSGSTTLLPGNKPAILYTGIDSMGH  139

Query  1448  QVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVG  1269
             QVQNLA P+N SDP+L+EWVK P+NPL+A    N I  + FRDPTTAW G DG+WR+LVG
Sbjct  140   QVQNLAKPKNLSDPFLKEWVKFPQNPLMAATSDNNIE-SDFRDPTTAWLGQDGHWRVLVG  198

Query  1268  SKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVGSK  1092
             SK   RG+A+LYRSKDFV WVQAKHPL+S + SGMWECPDF+PV  +   G+DTS+ G  
Sbjct  199   SKRRTRGMALLYRSKDFVNWVQAKHPLYSTKDSGMWECPDFFPVLKNGQLGVDTSVNGDH  258

Query  1091  IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLK  912
             ++HVLK S+     DYY IG+Y+  +D ++PDKG  +  S  RYDYGK+YASK+F+D  K
Sbjct  259   VRHVLKASM--KSQDYYMIGSYNAAKDVFLPDKGFDEFVS--RYDYGKYYASKSFFDDGK  314

Query  911   RRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEM  732
             +RR+L+GW++ES I+ + +K+GWSG+ GIPR +W+  + KQLVQWPV E+E+LR+N V +
Sbjct  315   KRRVLFGWVDESSIEADDIKKGWSGIIGIPRAMWVHDSGKQLVQWPVVEIEELRTNPVNL  374

Query  731   PSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGG  552
             P  +LK G + +++G++A QAD+E++F++ +  +AE ++  WT DP++LCSQKG+S++  
Sbjct  375   PPQVLKGGQLLQINGVTATQADVEISFEVSKLIEAEVLDN-WT-DPKILCSQKGSSIKSE  432

Query  551   IGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDV  372
             +GPFGL V ASE  QE+T+VFFR+F   N N +VL+CSDQ+RSSL+K  D T+YGAFVDV
Sbjct  433   LGPFGLLVFASEGLQEFTSVFFRIFKYQNKN-LVLLCSDQSRSSLNKNNDLTTYGAFVDV  491

Query  371   NPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKL  192
              P+ E+LSLR LIDHS+VESFG +G+ CIT+RVYPT AI +KA LYAFNNG   + +++L
Sbjct  492   EPLHEKLSLRTLIDHSVVESFGGEGRACITARVYPTLAINDKAQLYAFNNGTSDVNITRL  551

Query  191   TAWSMKKPTIN  159
             +AWSMKK  IN
Sbjct  552   SAWSMKKAQIN  562



>gb|AAC17166.1| cell wall invertase [Pisum sativum]
Length=582

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/558 (59%), Positives = 423/558 (76%), Gaps = 12/558 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPN----HTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQ  1653
             +  +A+H V Q LE L   + +      YRT++HFQP +NW+NDPNGPM Y G YH FYQ
Sbjct  18    IPIEATHHVYQTLETLSSHHSSKSNHQPYRTAYHFQPLKNWINDPNGPMRYGGFYHLFYQ  77

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             YNPKGA +G I W HS SKDLVNW     A+ PSQP+ DI G WSGSATILP   PA+LY
Sbjct  78    YNPKGAVWGNIVWAHSVSKDLVNWTPLDHAIHPSQPS-DIKGCWSGSATILPGGKPAILY  136

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D  N QVQN+A+P+N SDP L+EW KSP+NPL+ P   NKIN++SFRDPTT+W G D
Sbjct  137   TGIDPNNHQVQNIAIPKNMSDPLLREWKKSPKNPLMEPTIANKINSSSFRDPTTSWLGKD  196

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV---STSPN  1122
             G WR+L+GSK+  +G+AILY+SK+FV WV+AKHPLHS EG+GMWECPDFYPV   +    
Sbjct  197   GFWRVLIGSKIDTKGMAILYKSKNFVDWVEAKHPLHSAEGTGMWECPDFYPVLDKNLLRT  256

Query  1121  GLDTSLVG-SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKF  945
             G+DTS  G   ++HVLK+SLD+++HD+Y IG+YD V+D ++P+ G  DN   LRYDYGK+
Sbjct  257   GVDTSRNGDDDVRHVLKVSLDDTKHDHYLIGSYDVVKDVFVPENGFEDNGFVLRYDYGKY  316

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASKTF+D  K RRIL GW+NES    + VK+GWSG+  IPR +WL ++ KQLVQWPV+E
Sbjct  317   YASKTFFDDGKNRRILLGWVNESSSVADDVKKGWSGIHTIPREIWLHESGKQLVQWPVKE  376

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             +E LR N V  P+ ++K G    ++G+ + QAD+E++F+I + GK E +  +W  DPQ+L
Sbjct  377   IENLRMNPVNWPTKVIKGGERISITGVDSVQADVEISFEISDLGKVESL-RKW-IDPQLL  434

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKT  405
             CSQKGA V+GG+GPFGL V AS+  +EYTAVFFR+F   + N +VLMCSDQ+RSSL+K  
Sbjct  435   CSQKGAGVKGGVGPFGLLVFASQGLKEYTAVFFRIFKYQDKN-LVLMCSDQSRSSLNKDN  493

Query  404   DKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFN  225
             D TSYG FVDV+P+ E+LSLR LIDHS+VESFG +G+ C+T+RVYPT AI +KA LYAFN
Sbjct  494   DMTSYGTFVDVDPLHEKLSLRTLIDHSVVESFGGEGRACVTARVYPTLAIHDKAMLYAFN  553

Query  224   NGVHSIKLSKLTAWSMKK  171
             NG  ++K++ L+AWSMKK
Sbjct  554   NGTSAVKITSLSAWSMKK  571



>ref|XP_006342970.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Solanum tuberosum]
Length=571

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/540 (60%), Positives = 406/540 (75%), Gaps = 10/540 (2%)
 Frame = -1

Query  1760  PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNW  1581
             P+  YRT +HFQP + WMNDPNGPM+Y G+YHFFYQYNP  A  G I WGHSTS DLVNW
Sbjct  36    PDQIYRTGYHFQPAKYWMNDPNGPMIYMGIYHFFYQYNPYDAQAGNIVWGHSTSTDLVNW  95

Query  1580  RAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYL  1401
                 PAL  S+P  D  G +SGS T+L    PA+LYTGVD  + QVQNLAVP+N +DPYL
Sbjct  96    TPQPPALLRSEPY-DFKGCFSGSTTLLSGGKPAILYTGVDFSDNQVQNLAVPKNLADPYL  154

Query  1400  QEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKD  1221
              EWVKSP NPLIAPN  NKI+  +FRDPTTAW  PDGNWR++VG++    G+ +LYRSK+
Sbjct  155   TEWVKSPYNPLIAPNSVNKIDGQNFRDPTTAWLNPDGNWRMVVGNQQDGNGIGLLYRSKN  214

Query  1220  FVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGSKIKHVLKISLDESRHDY  1044
             F+ W+QA++PLH    SGMWECPDF+PVST S NGL+TS +G  +KHV K S  ++  D+
Sbjct  215   FIDWIQAENPLHFMNYSGMWECPDFFPVSTISQNGLETSTMGPNVKHVFKAS--KASTDF  272

Query  1043  YTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDT  864
             YT+GTY+  +D +IPD  S+D   G RYDYGKFYASK+F++S   RRIL+GW+NES+ + 
Sbjct  273   YTVGTYNPNKDIFIPDNKSLDIGLGFRYDYGKFYASKSFFESSTSRRILFGWVNESVNNL  332

Query  863   EYVK-QGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSG  687
             E    +GW+G+QGIPR +WL K+  QL+QWP+ E+EKLR N V   +++L  GS+ E+SG
Sbjct  333   EMNSIRGWAGLQGIPRRIWLHKSGNQLLQWPIVEIEKLRMNPVIEDTSVLMPGSIREISG  392

Query  686   ISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQ  507
             ++A QAD+E++F      KAEK E  W T+PQ +CS KGASV+GGIGPFGL VLAS++ Q
Sbjct  393   VNATQADIEMSFSAKTLEKAEKWEANW-TNPQQVCSTKGASVKGGIGPFGLLVLASKDMQ  451

Query  506   EYTAVFFRVFMGNNNNPVVLMCSDQTRSSL---DKKTDKTSYGAFVDVNPMQEELSLRIL  336
             EYTA+FFR+F G+NNN +VLMCSDQTRSSL       DKT+YGA ++V+P+QE+LSLR L
Sbjct  452   EYTAIFFRIFRGDNNNFIVLMCSDQTRSSLHLPSSDYDKTTYGALLNVDPLQEKLSLRTL  511

Query  335   IDHSIVESFGAKGKVCITSRVYPTK-AIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             IDHSIVESFG +GK CIT+RVYPT  A+    HLY FNNG  S+ +SKLTAWSMK   IN
Sbjct  512   IDHSIVESFGGEGKACITARVYPTNLAVDGATHLYVFNNGSQSVDISKLTAWSMKTAQIN  571



>gb|KEH39515.1| cell-wall invertase [Medicago truncatula]
Length=509

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/513 (61%), Positives = 402/513 (78%), Gaps = 7/513 (1%)
 Frame = -1

Query  1688  MVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSA  1509
             M Y G+YH FYQYNPKGA +G I W HS SKDLVNW     A+ PSQP+ DI G WSGSA
Sbjct  1     MRYGGLYHLFYQYNPKGAVWGNIVWAHSASKDLVNWTPLDHAIHPSQPS-DIKGCWSGSA  59

Query  1508  TILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATS  1329
             TILP   PA+LYTG+D  N QVQN+A+P+N SDP L+EW KSP+NPL+ P   NKINA+S
Sbjct  60    TILPGGKPAILYTGIDPNNHQVQNIAIPKNMSDPLLREWKKSPKNPLMEPTVANKINASS  119

Query  1328  FRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPD  1149
             FRDPTT+W G DG WR+L+GSKV R+G+AI+Y+SK+FV W +AKHPLHS EG+GMWECPD
Sbjct  120   FRDPTTSWLGKDGYWRVLIGSKVHRKGIAIMYKSKNFVDWFEAKHPLHSAEGTGMWECPD  179

Query  1148  FYPVSTS---PNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDN  978
             F+PV        GLDTS+ G  ++HVLK+SLD+++HD+Y IGTYD V+D ++PD G  +N
Sbjct  180   FFPVLNKNPLTIGLDTSVNGDDVRHVLKVSLDDTKHDHYLIGTYDTVKDVFVPDNGFENN  239

Query  977   DSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKT  798
              + LRYDYGK+YASKTF+D  K RRIL GW NES    + VK+GWSG+  IPR +WL K+
Sbjct  240   QNVLRYDYGKYYASKTFFDDGKNRRILLGWANESSSVVDDVKKGWSGIHTIPRVIWLHKS  299

Query  797   RKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKM  618
              KQLVQWPV+ELE LR N V  P+ ++K G +  ++G+++ QAD+E++F++ +FGKAE +
Sbjct  300   GKQLVQWPVKELENLRMNPVNWPTKVIKGGELIPITGVNSVQADVEISFEVKDFGKAELL  359

Query  617   EERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCS  438
              ++W  DPQ+LCSQKGASV+GG+GPFGL V AS+  QEYTAVFFR+F   + N +VLMCS
Sbjct  360   -DKW-IDPQILCSQKGASVKGGVGPFGLHVFASKGLQEYTAVFFRIFRYQHKN-LVLMCS  416

Query  437   DQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKA  258
             DQ+RSSL+K+ D T+YG FVDV+P+ E+LSLR LIDHS+VESFG +G+ CIT+RVYPT A
Sbjct  417   DQSRSSLNKENDMTTYGTFVDVDPLHEKLSLRTLIDHSVVESFGGEGRACITARVYPTLA  476

Query  257   IGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             I +KA LYAFNNG  ++K+++L AWSMKK  IN
Sbjct  477   IHDKALLYAFNNGNSAVKITRLNAWSMKKAKIN  509



>emb|CDY33067.1| BnaC06g07120D [Brassica napus]
Length=579

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/537 (60%), Positives = 401/537 (75%), Gaps = 7/537 (1%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KISWGHSTSKDLVNW  1581
             N  YRT +HFQPP NWMNDPNGPMVYKG+YH FYQYNP GA +  +I WGHSTS DLVNW
Sbjct  27    NQPYRTGYHFQPPSNWMNDPNGPMVYKGIYHLFYQYNPYGAVWDVRIVWGHSTSLDLVNW  86

Query  1580  RAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYL  1401
                 PA SPSQP+ DING WSGS TILPN  P +LYTG+D    QVQN+AVP N SDPYL
Sbjct  87    TPQPPAFSPSQPS-DINGCWSGSVTILPNGTPVILYTGIDQNKSQVQNVAVPVNISDPYL  145

Query  1400  QEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG-RRGLAILYRSK  1224
             +EW KSP NPL+APN  N IN   FRDPTTAW G DG WR++VGS    RRGLA+LY+S+
Sbjct  146   REWSKSPANPLMAPNAVNGINPDRFRDPTTAWIGHDGEWRVIVGSSTDDRRGLAVLYKSR  205

Query  1223  DFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSKIKHVLKISLDESRHD  1047
             DF  W QA  PLH  E +GMWECPDF+PVS T   GL+TS  G ++KHVLK+SL E+ HD
Sbjct  206   DFFNWTQATKPLHHEELTGMWECPDFFPVSITGTEGLETSSSG-EVKHVLKMSLIETLHD  264

Query  1046  YYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLID  867
             YYTIG YD  +D Y+PD G V + S  R DYGKFYASK FYD +K+RRILWGW+NES   
Sbjct  265   YYTIGCYDREKDVYVPDHGFVQDGSAPRLDYGKFYASKAFYDDVKKRRILWGWVNESSPA  324

Query  866   TEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSG  687
              + +++GWSG+Q  PR +WL ++  +L+QWP++E+E LR  +V   + +LK GS  +V G
Sbjct  325   KDDIEKGWSGLQSFPRKIWLGESGNELLQWPIEEIETLRETQVNWYNKVLKAGSTIQVHG  384

Query  686   ISAAQ-ADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENR  510
             ++AAQ AD++V+FK+ +  KA+ +E  WT DPQ +CS++  SV+ G+GPFGL VLAS + 
Sbjct  385   VTAAQQADVDVSFKVKDLEKADVIEPSWT-DPQKICSEEDLSVKSGLGPFGLMVLASNDM  443

Query  509   QEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILID  330
             +EYT+V+FR+F  N+   VVLMCSDQ+RSSL+++ DK ++GAFV ++P  E LSLR LID
Sbjct  444   EEYTSVYFRIFKSNDTKYVVLMCSDQSRSSLNEENDKATFGAFVAIDPSHETLSLRTLID  503

Query  329   HSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             HSIVES+G  GKVC+TSRVYP  AIGEKA+L+ FN G  S+ +  L+AWS+K   IN
Sbjct  504   HSIVESYGGGGKVCVTSRVYPKLAIGEKANLFVFNKGTQSVDVLSLSAWSLKSAQIN  560



>sp|Q9LIB9.2|INV5_ARATH RecName: Full=Beta-fructofuranosidase, insoluble isoenzyme CWINV5; 
AltName: Full=Cell wall beta-fructosidase 5; AltName: 
Full=Cell wall invertase 5; Short=AtcwINV5; AltName: Full=Sucrose 
hydrolase 5; Flags: Precursor [Arabidopsis thaliana]
Length=572

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/555 (59%), Positives = 416/555 (75%), Gaps = 13/555 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
             T  + +VL  L+ +     N  YRT +HFQPP+NWMNDPNGPM+YKG+YH FYQ+N  GA
Sbjct  20    TDDAVVVLDALDNVPNNIKNQPYRTGYHFQPPKNWMNDPNGPMIYKGIYHLFYQWNQNGA  79

Query  1634  --SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVD  1461
                  K  WGH+TS DL+NW    PA+ PS+P+ DING WSGS TILPN  P +LYTG D
Sbjct  80    VMDVNKTVWGHATSTDLINWITLSPAIRPSRPS-DINGCWSGSVTILPNGKPVILYTGND  138

Query  1460  SRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
               NRQVQNL  P+N +DPYL+ W KSP NPL+ P+  N IN+++FRDPTTAW G DG WR
Sbjct  139   RYNRQVQNLVKPKNLTDPYLRHWTKSPENPLVTPSPVNHINSSAFRDPTTAWFGRDGRWR  198

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSL  1104
             I  GS+ GRRGLAIL+ SKDFV W Q+  PLH  +G+GMWECPDF+PV+ T   GLDTS 
Sbjct  199   ITTGSQEGRRGLAILHTSKDFVIWKQSPKPLHYHDGTGMWECPDFFPVARTDSRGLDTSF  258

Query  1103  V-GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
               G  +KHVLK+SL ++ +DYYTIGTYD VRD Y+PDKG V +++  RYDYGKFYASKTF
Sbjct  259   SSGPMVKHVLKVSLTDTFNDYYTIGTYDEVRDVYVPDKGFVQDETAPRYDYGKFYASKTF  318

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             YDS+ +RRILWGW+NES  + + +K+GW+G+Q IPR VWLD++ K+LVQWPV+E+E+LR+
Sbjct  319   YDSVNQRRILWGWVNESSPEKDNIKKGWAGLQAIPRKVWLDESGKRLVQWPVKEIERLRT  378

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFG--KAEKMEERWTTDPQVLCSQK  573
              +V+  + +LK GSV EV G++A QAD+EV FK+  F   KA+ +E  W TDPQ++CSQ+
Sbjct  379   TQVKWGNKLLKGGSVMEVHGVTAPQADVEVFFKVSGFDLEKADVIEPGW-TDPQLICSQR  437

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDKKTDK  399
              AS   G+GPFGL VLAS+N +EYT+V  R+F    N+   VV+MCSDQ+ SSL+K  DK
Sbjct  438   NAS--SGLGPFGLMVLASKNMEEYTSVNIRIFRAGENSKEHVVVMCSDQSTSSLEKGNDK  495

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
             T+YGAF+D++P Q  +SLR LID SIVESFG KGK CITSRVYP  AIGE+ HL+AFN G
Sbjct  496   TTYGAFLDISPYQ-PISLRTLIDKSIVESFGGKGKTCITSRVYPKLAIGERTHLFAFNKG  554

Query  218   VHSIKLSKLTAWSMK  174
               ++ +  L+AWSMK
Sbjct  555   SQNVNVLSLSAWSMK  569



>gb|AES98262.2| cell-wall invertase [Medicago truncatula]
Length=577

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/572 (58%), Positives = 422/572 (74%), Gaps = 22/572 (4%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             YG    +A H    ++  L     N TY+ SFHFQP +NWMN   GPM YKG+YH FYQ+
Sbjct  16    YGFAHIEAFHQTHSSIFNL-----NQTYKPSFHFQPSKNWMN---GPMRYKGLYHMFYQH  67

Query  1649  NPKGASFGK--ISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALL  1476
             NPKGA++    I WGHS SKDLVNW     AL+PSQP  DING WSGS T + N+ P +L
Sbjct  68    NPKGATWSNNSIVWGHSVSKDLVNWFPLQHALTPSQPY-DINGCWSGSTTFVSNDKPTIL  126

Query  1475  YTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP  1296
             YTG+D    Q QNLA+P+N SDP+L+EW+KSP+NP++ PN  NKINATSFRDPTTAW G 
Sbjct  127   YTGIDIHQHQTQNLAIPKNVSDPFLREWIKSPKNPIMLPNIVNKINATSFRDPTTAWIGH  186

Query  1295  -DGNWRILVGSKV-GRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN  1122
              DG WR+LVGS+    RG+ +L++SKDF+ W+QAK+P +S +  GM ECPDF+PV  +  
Sbjct  187   HDGLWRVLVGSQQKDNRGITLLFKSKDFINWIQAKYPFYSAKKIGMLECPDFFPVLINGT  246

Query  1121  -GLDTSLV--GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGL----R  963
              GLDTS+      I++VLK+SL +  HDYY IGTYD ++D YIP  G   N++ L    R
Sbjct  247   FGLDTSIKYDHDSIRYVLKVSLIDVSHDYYLIGTYDTIKDVYIPKNGFEQNNNELTLVIR  306

Query  962   YDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLV  783
             YDYGKFYASKTFYD  K+RR+LWGWINES I  + V++GWSG+Q IPRT+WLDK+ KQL+
Sbjct  307   YDYGKFYASKTFYDDAKKRRVLWGWINESSIREDDVQKGWSGIQAIPRTLWLDKSGKQLI  366

Query  782   QWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT  603
             QWP+ E+EKLR+N +   S +LK G++ E+ G++AAQAD+E++F++ E  KA+ ++  W 
Sbjct  367   QWPIVEIEKLRTNPINFNSKVLKGGTLLEIVGVTAAQADVEISFEVNELEKAQALDPSWK  426

Query  602   TDPQVLCSQKGASVRG-GIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTR  426
              DPQ LC++  A V+G G+GPFGL VLAS+  QEYT +FF+VF  N  + VVLMCSDQ R
Sbjct  427   MDPQHLCNENDAKVKGVGLGPFGLLVLASKGMQEYTRIFFKVFRANKKH-VVLMCSDQCR  485

Query  425   SSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEK  246
             SSL+ K D T+YGAFVDV+P+ EELS+R LIDHS+VESFGAKGK CIT+RVYPT AI +K
Sbjct  486   SSLNHKNDLTTYGAFVDVDPIHEELSIRSLIDHSVVESFGAKGKTCITARVYPTLAINDK  545

Query  245   AHLYAFNNGVHSIKLSKLTAWSMKKPTIN*LH  150
             AHL+AFNNG   +K+ KL+AWSM K  IN +H
Sbjct  546   AHLHAFNNGTVDVKIKKLSAWSMNKANINEIH  577



>ref|XP_002891812.1| beta-fructofuranosidase 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68071.1| beta-fructofuranosidase 5 [Arabidopsis lyrata subsp. lyrata]
Length=592

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/542 (59%), Positives = 401/542 (74%), Gaps = 11/542 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KISWGHSTSKDLVNW  1581
             N  YRT +HFQPPRNWMNDPNGPM+YKG+YH FYQYNP GA +  +I WGHSTS DLVNW
Sbjct  34    NQPYRTGYHFQPPRNWMNDPNGPMIYKGIYHLFYQYNPYGAVWDVRIVWGHSTSVDLVNW  93

Query  1580  RAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYL  1401
              +  PA +PSQP+ D NG WSGS TILPN  P +LYTG+D    QVQN+AVP N SDPYL
Sbjct  94    ISQPPAFNPSQPS-DTNGCWSGSVTILPNGKPVILYTGIDQNKSQVQNVAVPVNVSDPYL  152

Query  1400  QEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG-RRGLAILYRSK  1224
             +EW K PRNPL+ PN  N IN   FRDPTTAW G DG WR++VGS    RRGLAILY SK
Sbjct  153   REWSKPPRNPLMTPNAVNGINPDRFRDPTTAWLGRDGEWRVIVGSSTDDRRGLAILYNSK  212

Query  1223  DFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSK-IKHVLKISLDESRH  1050
             DF  W Q+  PLH  + +GMWECPDF+PVS T  +G++TS      IKHVLK+SL E+ H
Sbjct  213   DFFNWTQSTKPLHYEDLTGMWECPDFFPVSITGSDGVETSSFSENGIKHVLKVSLIETLH  272

Query  1049  DYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLI  870
             DYYTIG+YD  +D Y+PD G V N S  R DYGK+YASKTFYD +K+RRILWGW+NES  
Sbjct  273   DYYTIGSYDREKDVYVPDLGFVQNGSAPRLDYGKYYASKTFYDDVKKRRILWGWVNESSP  332

Query  869   DTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVS  690
               + +K+GWSG+Q  PR +WLD++ KQL+QWP++E+E LR  +V     +LK GS  +V 
Sbjct  333   AKDDIKKGWSGLQSFPRKIWLDESGKQLLQWPIEEIETLRGTQVNWHKKVLKAGSTLQVH  392

Query  689   GISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENR  510
             G++AAQAD+EV+FK+ E  KA+ +E  W TDPQ +CS+   SV  G+GPFGL VLAS++ 
Sbjct  393   GVTAAQADVEVSFKVKELEKADVIEPSW-TDPQKICSEGDFSVNSGLGPFGLMVLASKDM  451

Query  509   QEYTAVFFRVFMGN-----NNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSL  345
             +EYT+V+FR+F  N     NN  VVLMCSDQ+RSSL+++ DK+++GAFV ++P  + +SL
Sbjct  452   EEYTSVYFRIFKSNDDTNKNNKYVVLMCSDQSRSSLNEENDKSTFGAFVAIDPSHQTVSL  511

Query  344   RILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPT  165
             R LIDHSIVES+G  G  CITSRVYP  AIGE A+L+AFN G  S+ +  L+AWS+K   
Sbjct  512   RTLIDHSIVESYGGGGGTCITSRVYPKLAIGENANLFAFNKGTQSVDVLSLSAWSLKSAQ  571

Query  164   IN  159
             IN
Sbjct  572   IN  573



>ref|XP_006481745.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Citrus sinensis]
Length=577

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/555 (59%), Positives = 409/555 (74%), Gaps = 11/555 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH +    ++L        +RT+FHFQPP++W+NDPNGPM YKG+YH FYQYNPKGA
Sbjct  25    VEASHKIYPEFQSLAAVKVKQLHRTAFHFQPPKHWINDPNGPMYYKGIYHLFYQYNPKGA  84

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS SKDL+NW A  PAL PS+P  DING WSGSAT+LP N P +LYTGVD +
Sbjct  85    VWGNIVWAHSVSKDLINWEALEPALYPSKPF-DINGCWSGSATVLPGNKPIILYTGVDHK  143

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
              RQVQN AVP NPSDPYL++W+K   NP++ P     +NA++FRDPTTAW   DG+WR+L
Sbjct  144   ERQVQNYAVPANPSDPYLRKWIKPDNNPVVFPG--PDVNASAFRDPTTAWWSNDGHWRML  201

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG  1098
             VGS+   RG+A LYRS+DF++W +AKHP+HS   +GMWECPDFYPVS S  NGLDTS  G
Sbjct  202   VGSRRKHRGMAYLYRSRDFMKWTKAKHPIHSLANTGMWECPDFYPVSISGKNGLDTSFAG  261

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
                K VLK+SLD +R+DYYTIGTY+  +D+Y+PDK SVD   GLRYDYG FYASKTF+DS
Sbjct  262   GNEKFVLKVSLDLTRYDYYTIGTYNRDKDRYVPDKDSVDGWRGLRYDYGNFYASKTFFDS  321

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K RRILWGW NES    + + +GW+GVQ IPR VWLD + KQL+QWP++ELE LR   V
Sbjct  322   RKNRRILWGWANESDSTFDDMAKGWAGVQTIPREVWLDGSGKQLLQWPIEELETLRGKNV  381

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERW-TTDPQVLCSQKGASV  561
              + +  LKKG   EV G++AAQAD+EVTFK+    KAEK +  W   D + LC + G+ V
Sbjct  382   HISNQELKKGHHVEVKGVTAAQADVEVTFKLPSLDKAEKFDPSWKNLDAEHLCGKIGSKV  441

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD---KTSY  390
             +GG+GPFGL  LAS+N +E+T VFFR+F   + + +VLMCSD + S+L  KT+   K S+
Sbjct  442   QGGVGPFGLLTLASKNLEEFTPVFFRIFKDGHKH-LVLMCSDASSSTL--KTEGLYKPSF  498

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
               FV+V+   ++LSLR LIDHS+VESFGA GK CITSRVYPT A+ + AHLYAFNNG  +
Sbjct  499   AGFVNVDLSDKKLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAVFDDAHLYAFNNGTET  558

Query  209   IKLSKLTAWSMKKPT  165
             + + KL AWSMKKP 
Sbjct  559   VTVEKLNAWSMKKPV  573



>ref|XP_004515313.1| PREDICTED: beta-fructofuranosidase, cell wall isozyme-like isoform 
X3 [Cicer arietinum]
Length=572

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/560 (58%), Positives = 421/560 (75%), Gaps = 17/560 (3%)
 Frame = -1

Query  1793  LQNLEALQPPYP-NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA--SFGK  1623
             + ++EA    +  N TY+ SFHFQP +NWMN   GPM YKG+YH FYQ+NPKGA  S   
Sbjct  18    VAHIEAFHQTHSLNQTYKPSFHFQPHKNWMN---GPMRYKGLYHMFYQHNPKGAIWSNNS  74

Query  1622  ISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQV  1443
             I WGHS SKDLVNW +   AL PS+ + DING WSGS+T+LPN+ P +LYTG+D    Q 
Sbjct  75    IVWGHSISKDLVNWLSLQHALIPSE-SYDINGCWSGSSTLLPNDKPKILYTGIDINQHQT  133

Query  1442  QNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP-DGNWRILVGS  1266
             QNLA+P+N SDP L+EW+KSP NPL+ PN+ NKINATSFRDPTTAW G  DG WR+L+GS
Sbjct  134   QNLAIPKNVSDPLLREWIKSPNNPLMEPNNVNKINATSFRDPTTAWIGHHDGFWRVLIGS  193

Query  1265  KVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLV-GSK  1092
             +   +G+ IL++SKDF  W+Q K+P +S + +GMWECPDF+PV  + + GLD S+  G  
Sbjct  194   QKKDKGILILFKSKDFFNWIQDKNPFYSAKNTGMWECPDFFPVLINGSIGLDISINNGYG  253

Query  1091  IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKG--SVDNDSGL--RYDYGKFYASKTFY  924
             I+HV+K+SL +  HDYY IGTYD ++D ++PDKG   ++N+  L  RYDYGKFYASKTFY
Sbjct  254   IRHVVKVSLIDVSHDYYFIGTYDTIKDVFVPDKGFDKINNELSLVLRYDYGKFYASKTFY  313

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             D  K+RR+LWGWINES I  + VK+GWSG+Q IPRT+WL K+ KQL+QWP+ E+EKLRSN
Sbjct  314   DGEKKRRVLWGWINESSIQEDDVKKGWSGIQAIPRTLWLHKSGKQLIQWPIVEIEKLRSN  373

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
              V + S +LK G + E+ G++AAQAD+E++F++ E  KA+ ++  W  DPQ LC + G+ 
Sbjct  374   HVNLHSKVLKGGKMLEIFGVTAAQADVEISFEVKELEKAQVLDPSWKLDPQHLCKENGSK  433

Query  563   VRG--GIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSY  390
             V+G  G+GPFGL VLAS++ +EYT +FF+VF GN  + VVLMC D  RSSL+   D  +Y
Sbjct  434   VKGVVGLGPFGLLVLASKDMKEYTTIFFKVFRGNKKH-VVLMCCDTRRSSLNHNNDLANY  492

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
             GAFVDV+P+ EELS+R LIDHS+VESFGA+GK CIT+RVYPT AI +KAHL+ FNNG   
Sbjct  493   GAFVDVDPINEELSIRSLIDHSVVESFGAQGKACITTRVYPTLAINDKAHLHVFNNGTID  552

Query  209   IKLSKLTAWSMKKPTIN*LH  150
             +K+ KL AWSMKK  IN +H
Sbjct  553   VKIKKLNAWSMKKAKINEMH  572



>emb|CDY24053.1| BnaA06g00510D [Brassica napus]
Length=579

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/537 (59%), Positives = 401/537 (75%), Gaps = 7/537 (1%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KISWGHSTSKDLVNW  1581
             N  YRT +HFQPP NWMNDPNGPMVYKG+YH FYQYNP GA +  +I WGHSTS DLVNW
Sbjct  27    NQPYRTGYHFQPPSNWMNDPNGPMVYKGIYHLFYQYNPYGAVWDVRIVWGHSTSLDLVNW  86

Query  1580  RAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYL  1401
                 PA SPSQP+ DING WSGS TILPN  P +LYTG+D    QVQN+AVP N SDPYL
Sbjct  87    TPQPPAFSPSQPS-DINGCWSGSVTILPNGTPVILYTGIDQNKSQVQNVAVPVNISDPYL  145

Query  1400  QEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG-RRGLAILYRSK  1224
             +EW KSP NPL+APN  N IN   FRDPTTAW G DG WR++VGS    RRGLA+LY+S+
Sbjct  146   REWSKSPANPLMAPNAVNGINPDRFRDPTTAWMGHDGEWRVIVGSSTDDRRGLAVLYKSR  205

Query  1223  DFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSKIKHVLKISLDESRHD  1047
             DF  W QA  PLH  + +GMWECPDF+PVS T  + L+TS  G ++KHVLK+SL E+ HD
Sbjct  206   DFFNWTQATKPLHHEDLTGMWECPDFFPVSITGTDCLETSSFG-EVKHVLKVSLIETLHD  264

Query  1046  YYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLID  867
             YYTIG+YD  +D Y+PD G V + S  R DYGKFYASKTFYD +K+RRILWGW+NES   
Sbjct  265   YYTIGSYDREKDVYVPDHGFVQDGSAPRLDYGKFYASKTFYDDVKKRRILWGWVNESSPA  324

Query  866   TEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSG  687
              + +++GWSG+Q  PR +WL ++  +L+QWP++E+E LR  +V+  + +LK GS  +V G
Sbjct  325   KDDIEKGWSGLQSFPRKIWLGESGNELLQWPIEEIETLRETQVKWDNKVLKAGSTIQVHG  384

Query  686   ISAA-QADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENR  510
             ++AA QAD++V+FK+ +  KA+ +E  W TDPQ +CS++  SV+ G+GPFGL VL S + 
Sbjct  385   VTAAQQADVDVSFKVKDLEKADVIEPSW-TDPQKICSEEDLSVKSGLGPFGLMVLTSNDM  443

Query  509   QEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILID  330
             +EYT+V+FR+F  N+   VVLMCSDQ+RSSL+++ DK ++GAFV ++P QE LSLR LID
Sbjct  444   EEYTSVYFRIFKSNDTKYVVLMCSDQSRSSLNEENDKATFGAFVAIDPSQETLSLRTLID  503

Query  329   HSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             HSIVES+G  GKVCITSRVYP  AIGE  +L+ FN G  S+ +  L AWS+K   IN
Sbjct  504   HSIVESYGGGGKVCITSRVYPKLAIGENTNLFVFNKGTQSVDVLGLNAWSLKSAQIN  560



>gb|KEH18388.1| cell-wall invertase [Medicago truncatula]
Length=532

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/518 (60%), Positives = 405/518 (78%), Gaps = 7/518 (1%)
 Frame = -1

Query  1703  DPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGA  1524
             DPNGP+ YKG+YH FYQYNPKGA +G I W HS S DLVNW    PA+ PSQP+ DING 
Sbjct  16    DPNGPLSYKGLYHLFYQYNPKGAVWGNIVWAHSVSTDLVNWTPLDPAIFPSQPS-DINGC  74

Query  1523  WSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNK  1344
             WSGSATIL  N PA+LYTG+D  N QVQN+A P+N SDP+L+EW+KSP+NPL+ P   NK
Sbjct  75    WSGSATILHGNKPAILYTGIDPMNHQVQNIAYPKNLSDPFLREWIKSPKNPLMEPTSENK  134

Query  1343  INATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGM  1164
             INA+SFRDPT+ W G DGNWRI++GSK   RG+AILY+SKDF+ W+++KHPLHS +G+GM
Sbjct  135   INASSFRDPTSGWLGKDGNWRIIIGSKRNTRGIAILYKSKDFINWIKSKHPLHSAKGTGM  194

Query  1163  WECPDFYPV-STSPNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGS  987
             WECPDF+PV      G+DTSL    ++HVLK+SLD+ +HDYY IGTY+  +DK++PDKG 
Sbjct  195   WECPDFFPVLKIGRFGVDTSLNSDDVRHVLKVSLDDKKHDYYLIGTYNDEKDKFVPDKGF  254

Query  986   VDN--DSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTV  813
              +   +  LRYDYGK+YASKTF+D  K RRIL GW+NES    + +K+GWSG+  IPRT+
Sbjct  255   EEENIEQILRYDYGKYYASKTFFDDGKNRRILLGWVNESSSVADDIKKGWSGIHTIPRTI  314

Query  812   WLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFG  633
             WL K+ KQL+QWPV E+EKLR N V+ P+ +LK G +  ++G++AAQAD+E++F++    
Sbjct  315   WLHKSGKQLIQWPVVEVEKLRVNPVKWPTKILKGGELFPINGVTAAQADVEISFEVNNIR  374

Query  632   KAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPV  453
             +AE + ++W TDPQ+LCSQKG SV+ G+GPFGL V AS+  QE+T+VFFR+F+    N +
Sbjct  375   EAEVL-DKW-TDPQILCSQKGTSVKSGLGPFGLLVFASKGLQEFTSVFFRIFIYQQKN-L  431

Query  452   VLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRV  273
             VL CSDQ+RSSL+K  D T+YG F+DV+ + E+LSLR LIDHS+VESFG +GK CITSRV
Sbjct  432   VLFCSDQSRSSLNKDNDMTTYGTFIDVDILHEKLSLRSLIDHSVVESFGGEGKACITSRV  491

Query  272   YPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             YPT AI +KA +YAFNNG  ++K+++L+AWSMKK  +N
Sbjct  492   YPTLAINDKALIYAFNNGTTNVKITRLSAWSMKKAQLN  529



>ref|XP_008779528.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 3-like, 
partial [Phoenix dactylifera]
Length=573

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/554 (57%), Positives = 403/554 (73%), Gaps = 8/554 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
               ASH+V  +L++L  P  N   +T +HFQPPRNWMNDPNGPM Y G+YH FYQYNPKGA
Sbjct  26    VDASHVVYSHLQSLHVPVVNSLLKTGYHFQPPRNWMNDPNGPMYYNGIYHLFYQYNPKGA  85

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S D++NW    PA+ PS+P  DING WSGSATILP N PA++YTG+D  
Sbjct  86    VWGNIVWAHSISTDMINWIPLEPAIYPSKPF-DINGTWSGSATILPGNKPAIMYTGIDGA  144

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
              RQ+QN+A P++ SDPYL+EW K   NP+I P+    +NA++FRDPTTAW GPDG+WR+ 
Sbjct  145   GRQLQNVAFPKDLSDPYLREWTKPDYNPVIFPS---GVNASAFRDPTTAWLGPDGHWRVT  201

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVG  1098
             VGSK  +RG+A LYRS+DFVRW +AKHPLHS + +GMWECPDF+PV+ +   GLDTS  G
Sbjct  202   VGSKRSKRGMAYLYRSRDFVRWTKAKHPLHSSKDTGMWECPDFFPVAPAGKLGLDTSARG  261

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               +K+V K+SLD +R +YYT+G YD  RD+Y+PD  S DN +GLR+DYG FYASKTF+D 
Sbjct  262   KGLKYVFKVSLDLTRFEYYTVGRYDLARDRYVPDNTSPDNSTGLRFDYGNFYASKTFFDP  321

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRILWGW NES I      +GW+G+Q IPR +WLD  ++Q+VQWP++ELE LR+ + 
Sbjct  322   AKQRRILWGWSNESDIAQNETTKGWAGIQAIPRVLWLDSNQRQVVQWPIEELESLRTKQA  381

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              +   ++K G   EV GI  +QAD+EVTF I    KAE+    W TDPQ LC +K A VR
Sbjct  382   YIHDKLVKSGHYFEVKGIQYSQADVEVTFDISSLEKAERFNHTW-TDPQKLCGRKDAEVR  440

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             GG+GPFGL VLAS   +E TAVFFRVF   N + VVLMC D  RSSL  +  + ++  FV
Sbjct  441   GGVGPFGLLVLASAKMEEKTAVFFRVFKAQNKH-VVLMCHDPKRSSLVPRVYEPTFAGFV  499

Query  377   DVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             D++    + +SLR LID+S+VESFGA GK CITSRVYPT A+G  AHL+ FNNG+  IK+
Sbjct  500   DIDIANTKRISLRSLIDNSVVESFGAGGKTCITSRVYPTLAVGPDAHLFVFNNGLEDIKV  559

Query  200   SKLTAWSMKKPTIN  159
             S+L AW +++P +N
Sbjct  560   SELKAWEIRRPLMN  573



>ref|XP_010912308.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 3-like 
isoform X1 [Elaeis guineensis]
Length=579

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/554 (58%), Positives = 400/554 (72%), Gaps = 8/554 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
               ASH+V  +L+ LQ P+ N  +RT +HFQPPRNWMNDPNGPM Y GVYHFFYQYNPKGA
Sbjct  30    VDASHVVYPHLQNLQVPFVNPLWRTGYHFQPPRNWMNDPNGPMYYNGVYHFFYQYNPKGA  89

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S D++NW+A  PA+ PS+P  DING WSGSATILP + P +LYTGVD  
Sbjct  90    VWGNIVWAHSVSVDMINWKALEPAIYPSKPF-DINGTWSGSATILPGDSPVILYTGVDRA  148

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
               Q+QN+A P+N SDPYL+EW+K   NP+I P     +NA++ RDPTTAW GPD +WRI 
Sbjct  149   GNQLQNIAFPKNLSDPYLREWIKPDYNPIIFPV---GVNASAIRDPTTAWLGPDKHWRIT  205

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG  1098
             +GS+  RRG+A LYRS+DFV W++AKHPLHS + +GMWECPDF+PV+     GLDTS  G
Sbjct  206   IGSRRARRGMAYLYRSRDFVHWIKAKHPLHSSKDTGMWECPDFFPVALEGKKGLDTSAYG  265

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               +KHVLK+SLD +R +YYT+G Y H  DKY+PD  S D+ +GLR DYG FYASKTFYD 
Sbjct  266   EGLKHVLKVSLDATRFEYYTVGKYHHDHDKYVPDVTSPDDSTGLRLDYGNFYASKTFYDP  325

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRILWGW NES        +GWSG+Q IPR +WLD   +Q+VQWP++ELE LR NKV
Sbjct  326   AKQRRILWGWSNESDRAANETTKGWSGIQAIPRVLWLDSNHRQVVQWPIEELESLRKNKV  385

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              +    +K G   EV GI  +QAD+EV F +    KAE     W T+PQ LC  K A V+
Sbjct  386   YIHDKEVKTGHYFEVKGIQTSQADVEVMFDVSSLEKAEAWNPAW-TNPQELCGIKKAEVK  444

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             GG+GPFGL VLAS   +E TAVFFRVF   N + VVLMC D TRS+L     + ++  FV
Sbjct  445   GGVGPFGLLVLASARMEEKTAVFFRVFKAQNKH-VVLMCHDPTRSALVPNVYEPTFAGFV  503

Query  377   DVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             D+N  + +++SLR LID+S+VESFGA GK CITSRVYPT AIG  AHL+ FNNG+ +IK+
Sbjct  504   DINIAKTKKISLRSLIDNSVVESFGAGGKTCITSRVYPTLAIGSDAHLFVFNNGLENIKV  563

Query  200   SKLTAWSMKKPTIN  159
             S+L AW ++KP +N
Sbjct  564   SELKAWEIRKPLMN  577



>emb|CAC81824.1| invertase [Beta vulgaris]
Length=556

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/532 (60%), Positives = 404/532 (76%), Gaps = 5/532 (1%)
 Frame = -1

Query  1793  LQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISW  1614
             +  L+A + P  N  YRT++HFQP +NW+NDPNGPM+YKGVYH FYQ NP G  +G   W
Sbjct  24    VSELQAARSPPTNQPYRTAYHFQPRKNWINDPNGPMLYKGVYHLFYQDNPNGVIWGPPVW  83

Query  1613  GHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNL  1434
             GHS SKDLVNW      + P   AA+ING+WSGSATILP N PA+L+TG+D +  QVQ L
Sbjct  84    GHSPSKDLVNWVPQPLTMEPEM-AANINGSWSGSATILPGNKPAILFTGLDPKYEQVQVL  142

Query  1433  AVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGR  1254
             A P++ SDP L+EW  +P+NP++ P   N+INATSFRDPTTAWR PDG WR+L+GSK G+
Sbjct  143   AYPKDTSDPNLKEWFLAPQNPVMFPTPQNQINATSFRDPTTAWRLPDGVWRLLIGSKRGQ  202

Query  1253  RGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN--GLDTSLVGSKIKHV  1080
             RGL++L+RS+DFV WVQAKHPL+S + SGMWECPDF+PV  + +  G+DTS++GS +KHV
Sbjct  203   RGLSLLFRSRDFVHWVQAKHPLYSDKLSGMWECPDFFPVYANGDQMGVDTSIIGSHVKHV  262

Query  1079  LKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRI  900
             LK SLD  +HD YTIG Y+  +D Y PD G + NDS LRYDYGK+YASK F+   K+ RI
Sbjct  263   LKNSLDIPKHDIYTIGDYNIKKDAYPPDIGYM-NDSSLRYDYGKYYASKPFFADAKKERI  321

Query  899   LWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTM  720
             L GW NES    + +K+GWSG+  IPR +WLDK  KQL+QWP+  +EKLR   V +   +
Sbjct  322   LLGWANESSSVEDDIKKGWSGIHTIPRKIWLDKLGKQLIQWPIANIEKLRQKPVNIYRKV  381

Query  719   LKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPF  540
             LK GS  EVSGI+AAQAD+E++FKI +    EK +  WT+ PQ+LCS+KGASV+GG+GPF
Sbjct  382   LKGGSQIEVSGITAAQADVEISFKIKDLKNVEKFDASWTS-PQLLCSKKGASVKGGLGPF  440

Query  539   GLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQ  360
             GL  LAS+  +EYTAVFFR+F   +N  VVLMCSDQ+RSSL+   DKT+YG FVDVNP++
Sbjct  441   GLLTLASKGLEEYTAVFFRIFKAYDNKFVVLMCSDQSRSSLNPTNDKTTYGTFVDVNPIR  500

Query  359   EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             E LSLR+LIDHS+VESFGAKGK  IT+RVYPT AI EKAHLY FN G  +++
Sbjct  501   EGLSLRVLIDHSVVESFGAKGKNVITARVYPTLAINEKAHLYVFNRGTSNVE  552



>ref|NP_564676.1| beta-fructofuranosidase 5 [Arabidopsis thaliana]
 sp|Q67XZ3.2|INV3_ARATH RecName: Full=Beta-fructofuranosidase, insoluble isoenzyme CWINV3; 
AltName: Full=6-fructan exohydrolase; Short=6-FEH; AltName: 
Full=Beta-fructofuranosidase 5; Short=AtFruct5; AltName: 
Full=Cell wall beta-fructosidase 3; AltName: Full=Cell wall 
invertase 3; Short=AtcwINV3; AltName: Full=Sucrose hydrolase 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE33186.1| beta-fructofuranosidase, insoluble isoenzyme CWINV3 [Arabidopsis 
thaliana]
Length=594

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/554 (58%), Positives = 407/554 (73%), Gaps = 11/554 (2%)
 Frame = -1

Query  1793  LQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KIS  1617
             + +LEA      N  YRT +HFQP +NWMNDPNGPM+YKG+YH FYQYNP GA +  +I 
Sbjct  23    ITDLEASSHQDLNQPYRTGYHFQPLKNWMNDPNGPMIYKGIYHLFYQYNPYGAVWDVRIV  82

Query  1616  WGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQN  1437
             WGHSTS DLVNW +  PA +PSQP+ DING WSGS TILPN  P +LYTG+D    QVQN
Sbjct  83    WGHSTSVDLVNWISQPPAFNPSQPS-DINGCWSGSVTILPNGKPVILYTGIDQNKGQVQN  141

Query  1436  LAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG  1257
             +AVP N SDPYL+EW K P+NPL+  N  N IN   FRDPTTAW G DG WR++VGS   
Sbjct  142   VAVPVNISDPYLREWSKPPQNPLMTTNAVNGINPDRFRDPTTAWLGRDGEWRVIVGSSTD  201

Query  1256  -RRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSK-IK  1086
              RRGLAILY+S+DF  W Q+  PLH  + +GMWECPDF+PVS T  +G++TS VG   IK
Sbjct  202   DRRGLAILYKSRDFFNWTQSMKPLHYEDLTGMWECPDFFPVSITGSDGVETSSVGENGIK  261

Query  1085  HVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRR  906
             HVLK+SL E+ HDYYTIG+YD  +D Y+PD G V N+S  R DYGK+YASKTFYD +K+R
Sbjct  262   HVLKVSLIETLHDYYTIGSYDREKDVYVPDLGFVQNESAPRLDYGKYYASKTFYDDVKKR  321

Query  905   RILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPS  726
             RILWGW+NES    + +++GWSG+Q  PR +WLD++ K+L+QWP++E+E LR  +V    
Sbjct  322   RILWGWVNESSPAKDDIEKGWSGLQSFPRKIWLDESGKELLQWPIEEIETLRGQQVNWQK  381

Query  725   TMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIG  546
              +LK GS  +V G++AAQAD+EV+FK+ E  KA+ +E  W TDPQ +CSQ   SV  G+G
Sbjct  382   KVLKAGSTLQVHGVTAAQADVEVSFKVKELEKADVIEPSW-TDPQKICSQGDLSVMSGLG  440

Query  545   PFGLKVLASENRQEYTAVFFRVFMGNNNNP-----VVLMCSDQTRSSLDKKTDKTSYGAF  381
             PFGL VLAS + +EYT+V+FR+F  N++       VVLMCSDQ+RSSL+ + DK+++GAF
Sbjct  441   PFGLMVLASNDMEEYTSVYFRIFKSNDDTNKKTKYVVLMCSDQSRSSLNDENDKSTFGAF  500

Query  380   VDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             V ++P  + +SLR LIDHSIVES+G  G+ CITSRVYP  AIGE A+L+ FN G  S+ +
Sbjct  501   VAIDPSHQTISLRTLIDHSIVESYGGGGRTCITSRVYPKLAIGENANLFVFNKGTQSVDI  560

Query  200   SKLTAWSMKKPTIN  159
               L+AWS+K   IN
Sbjct  561   LTLSAWSLKSAQIN  574



>dbj|BAD44438.1| beta-fructofuranosidase (AtFruct5) [Arabidopsis thaliana]
Length=594

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/554 (58%), Positives = 407/554 (73%), Gaps = 11/554 (2%)
 Frame = -1

Query  1793  LQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KIS  1617
             + +LEA      N  YRT +HFQP +NWMNDPNGPM+YKG+YH FYQYNP GA +  +I 
Sbjct  23    ITDLEASSHQDLNQPYRTGYHFQPLKNWMNDPNGPMIYKGIYHLFYQYNPYGAVWDVRIV  82

Query  1616  WGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQN  1437
             WGHSTS DLVNW +  PA +PSQP+ DING WSGS TILPN  P +LYTG+D    QVQN
Sbjct  83    WGHSTSVDLVNWISQPPAFNPSQPS-DINGCWSGSVTILPNGKPVILYTGIDQNKGQVQN  141

Query  1436  LAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG  1257
             +AVP N SDPYL+EW K P+NPL+  N  N IN   FRDPTTAW G DG WR++VGS   
Sbjct  142   VAVPVNISDPYLREWSKPPQNPLMTTNAVNGINPDRFRDPTTAWLGRDGEWRVIVGSSTD  201

Query  1256  -RRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSK-IK  1086
              RRGLAILY+S+DF  W Q+  PLH  + +GMWECPDF+PVS T  +G++TS VG   IK
Sbjct  202   DRRGLAILYKSRDFFNWTQSMKPLHYEDLTGMWECPDFFPVSITGSDGVETSSVGENGIK  261

Query  1085  HVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRR  906
             HVLK+SL E+ HDYYTIG+YD  +D Y+PD G V N+S  R DYGK+YASKTFYD +K+R
Sbjct  262   HVLKVSLIETLHDYYTIGSYDREKDVYVPDLGFVQNESAPRLDYGKYYASKTFYDDVKKR  321

Query  905   RILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPS  726
             RILWGW+NES    + +++GWSG+Q  PR +WLD++ K+L+QWP++E+E LR  +V    
Sbjct  322   RILWGWVNESSPAKDDIEKGWSGLQSFPRKIWLDESGKELLQWPIEEIETLRGQQVNWQK  381

Query  725   TMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIG  546
              +LK GS  +V G++AAQAD+EV+FK+ E  KA+ +E  W TDPQ +CSQ   SV  G+G
Sbjct  382   KVLKAGSTLQVHGVTAAQADVEVSFKVKELEKADVIEPSW-TDPQKVCSQGDLSVMSGLG  440

Query  545   PFGLKVLASENRQEYTAVFFRVFMGNNNNP-----VVLMCSDQTRSSLDKKTDKTSYGAF  381
             PFGL VLAS + +EYT+V+FR+F  N++       VVLMCSDQ+RSSL+ + DK+++GAF
Sbjct  441   PFGLMVLASNDMEEYTSVYFRIFKSNDDTNKKTKYVVLMCSDQSRSSLNDENDKSTFGAF  500

Query  380   VDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             V ++P  + +SLR LIDHSIVES+G  G+ CITSRVYP  AIGE A+L+ FN G  S+ +
Sbjct  501   VAIDPSHQTISLRTLIDHSIVESYGGGGRTCITSRVYPKLAIGENANLFVFNKGTQSVDI  560

Query  200   SKLTAWSMKKPTIN  159
               L+AWS+K   IN
Sbjct  561   LTLSAWSLKSAQIN  574



>ref|XP_009404354.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 3-like 
[Musa acuminata subsp. malaccensis]
Length=583

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/557 (57%), Positives = 408/557 (73%), Gaps = 6/557 (1%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             GV  +ASH+V ++L+++     +   RT +HFQPP++W+NDPNGPM Y G+YH FYQYNP
Sbjct  29    GVVVEASHVVYESLQSVPASVVDSKLRTGYHFQPPKHWINDPNGPMYYNGLYHLFYQYNP  88

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
              G+ +G I W HS S DL+NW A  PA+ PS+P  DI G WSGSATILP N P +LYTG+
Sbjct  89    SGSVWGNIVWAHSVSTDLINWVALEPAIYPSKPF-DIKGCWSGSATILPGNRPVILYTGL  147

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             D R RQVQN+A P+N SDPYL+EWVK   NP+IAP+  + +N ++FRDPTTAWRGP G+W
Sbjct  148   DPRERQVQNIAYPKNLSDPYLREWVKPDFNPVIAPD--DGVNGSAFRDPTTAWRGPSGHW  205

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTS  1107
             +++VGSK  +RG AILYRS+DFV WV+AKH LHS   +GMWECPDFYPV+     GLDTS
Sbjct  206   KLVVGSKWNKRGKAILYRSRDFVHWVKAKHSLHSARDTGMWECPDFYPVALKGTRGLDTS  265

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
             + G  +K+VLKISLD +R++YYT+G Y H +DKY+PD  S D+++GLRYDYG FYASKTF
Sbjct  266   VYGHGVKYVLKISLDITRYEYYTVGKYYHDKDKYVPDATSADDNTGLRYDYGNFYASKTF  325

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +D  K+RRILWGW NES        +GW+G+Q IPRT+ LD + +QLVQWP++E+E LR 
Sbjct  326   FDGKKQRRILWGWANESDTSDVDKAKGWAGIQMIPRTILLDSSGRQLVQWPIEEIESLRG  385

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
               V +    +  G   EV+GI ++QAD+EV+F +    KAE  +  W TD + LC +K A
Sbjct  386   KHVVVEHKRIPSGGFFEVTGIDSSQADVEVSFDVSGLEKAEDFDPSWATDAEALCGRKTA  445

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
              V+GG+GPFG+ VLAS N +E TAVFFRVF   + + VVLMC D TRSSL     K ++ 
Sbjct  446   DVKGGVGPFGVLVLASANMEEKTAVFFRVFKAYHKH-VVLMCHDPTRSSLRAGLYKPTFA  504

Query  386   AFVDVNPMQE-ELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              FVDV+  +  ++SLR LID S+VESFGAKGK CITSRVYP+ AIGE AHL+ FNNG   
Sbjct  505   GFVDVDIAKTGKISLRTLIDSSVVESFGAKGKTCITSRVYPSLAIGEDAHLFVFNNGSTD  564

Query  209   IKLSKLTAWSMKKPTIN  159
             +K+S+L AW MKKP +N
Sbjct  565   VKVSELNAWEMKKPLMN  581



>ref|XP_006858327.1| hypothetical protein AMTR_s00064p00137280 [Amborella trichopoda]
 gb|ERN19794.1| hypothetical protein AMTR_s00064p00137280 [Amborella trichopoda]
Length=580

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/559 (58%), Positives = 411/559 (74%), Gaps = 16/559 (3%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH+  + L  ++P   +  YRT++HFQPP+NWMN   GPM Y G+YH FYQYNP GA +
Sbjct  29    ASHLFYEELNTVEPTSVSEQYRTAYHFQPPKNWMN---GPMYYNGLYHLFYQYNPYGAVW  85

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNR  1449
             G I W HS S DLVNW+    A+ P+ P  DI G WSGSATILPNN P +LYTG+D++ R
Sbjct  86    GNIVWAHSVSTDLVNWQPLEHAIYPTAPF-DIKGCWSGSATILPNNKPIILYTGIDTQGR  144

Query  1448  QVQNLAVPRNPSDPYLQEWVK-SPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
             QVQNLA+P+N SDP L+EWVK +  NP + PN    +NA+SFRDPTTAW G DG+WR+LV
Sbjct  145   QVQNLAMPKNLSDPLLREWVKPAQHNPTMVPN---GLNASSFRDPTTAWLGKDGHWRVLV  201

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVGS  1095
             G+K  +RG+A+LYRS+DFV WV+AKHPLHS + +GMWECPDF+PV      G+DTS+ G 
Sbjct  202   GNKRHKRGMALLYRSRDFVWWVKAKHPLHSSKDTGMWECPDFFPVLKKGQLGIDTSVNGP  261

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +KHVLK+SLD+ +H+YYT+GTY   +D+Y+PD  S D+ +GLRYDYGKFYASKTF+D L
Sbjct  262   HVKHVLKVSLDDLKHEYYTVGTYFPNKDRYMPDNTSADDGTGLRYDYGKFYASKTFFDGL  321

Query  914   KRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE  735
             + RRILWGW+NES    + V +GWSGVQ IPRT+WLDK+ KQLVQWPV E+E LR  KV+
Sbjct  322   QNRRILWGWMNESDSVNDDVAKGWSGVQAIPRTLWLDKSGKQLVQWPVVEIESLRGKKVD  381

Query  734   MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR-  558
             +   +L  GSV EV  ++AAQ D+EVTF++    +A++++    T PQ+LCS+ G S   
Sbjct  382   IVDKVLASGSVVEVPNVTAAQVDVEVTFELPSLDQADRLDSASLTYPQLLCSKLGHSNTK  441

Query  557   ---GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
                GGIGPFGL VLAS++ +E TAVFFR+F    N  VVLMCSDQ+RSSL +  DKT+YG
Sbjct  442   QEGGGIGPFGLLVLASKDYEERTAVFFRIFKKAENQHVVLMCSDQSRSSLQEDVDKTTYG  501

Query  386   AFVDVNPM---QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGV  216
               VDV+     +  LSLR L+D SIVESFG  GK CITSRVYP KA+GE AHLYAFN   
Sbjct  502   GLVDVDLAHGSKPTLSLRTLVDRSIVESFGEGGKTCITSRVYPVKAVGENAHLYAFNYAS  561

Query  215   HSIKLSKLTAWSMKKPTIN  159
               I +SKL+AW+M K  IN
Sbjct  562   APITISKLSAWAMSKAKIN  580



>ref|XP_007027801.1| Cell wall invertase 2 isoform 1 [Theobroma cacao]
 gb|EOY08303.1| Cell wall invertase 2 isoform 1 [Theobroma cacao]
Length=575

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/557 (58%), Positives = 406/557 (73%), Gaps = 9/557 (2%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GGV+  ASH V    ++L        +RT +HFQPP+NW+NDPN PM Y G+YHFFYQYN
Sbjct  26    GGVD--ASHKVFPQFQSLNAVSVQQIHRTGYHFQPPKNWINDPNAPMYYDGIYHFFYQYN  83

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKD++NW+A  PAL PSQ   DING WSGSAT+LP+N P +LYTG
Sbjct  84    PKGAVWGNIVWAHSVSKDMINWQALEPALYPSQ-HFDINGCWSGSATVLPSNKPIILYTG  142

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             +D ++RQ+QN AVP N SDPYL++W+K   NP++ P     +NA++FRDPTTAW   +G+
Sbjct  143   LDPKDRQIQNYAVPANLSDPYLRKWIKPGNNPVVDPEQ--GVNASAFRDPTTAW-WLNGH  199

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDT  1110
             WR+LVGSK   RG+A LYRS+DF+ W +AKHPLHS   +GMWECPDFYPV  S   GLD 
Sbjct  200   WRMLVGSKRNHRGMAYLYRSRDFIYWTKAKHPLHSAPHTGMWECPDFYPVLLSGKKGLDP  259

Query  1109  SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKT  930
             S++G  +KHVLK+SLD +R+DYYT+GTY   +D+Y+PD  SVD  +GLRYDYG FYASKT
Sbjct  260   SVLGKHVKHVLKVSLDVTRYDYYTVGTYLSDKDRYVPDNTSVDGWAGLRYDYGNFYASKT  319

Query  929   FYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR  750
             F+D  K+RRILWGW+NES    + VK+GW+G+Q IPR VWLD  ++QL+QWP++ELE LR
Sbjct  320   FFDPAKKRRILWGWVNESDTTEDDVKKGWAGLQAIPRIVWLDPNQRQLMQWPIEELETLR  379

Query  749   SNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKG  570
                V+M    LKKG   EV GI+AAQAD++VTF I    KAE  +  W TD Q LC +KG
Sbjct  380   GKNVKMSHQQLKKGEHIEVKGITAAQADVDVTFHIPNLDKAEPFDHSW-TDAQELCVKKG  438

Query  569   ASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSY  390
             + V+G +GPFGL  LAS+N +EYT V FRVF  +  + VVL+CSD   SSL     K S+
Sbjct  439   SKVKGEVGPFGLLTLASKNLEEYTPVSFRVFQTSKKH-VVLLCSDARSSSLKDGLYKPSF  497

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
               FVDV+   ++LSLR LIDHS+VESFGA GK CITSRVYPT A+ + AHLYAFN+G   
Sbjct  498   AGFVDVDLADKKLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAVLDNAHLYAFNHGTEP  557

Query  209   IKLSKLTAWSMKKPTIN  159
             I +  L AWSMKKP +N
Sbjct  558   INVENLNAWSMKKPRMN  574



>ref|XP_002278880.2| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1 
isoform X1 [Vitis vinifera]
 ref|XP_010648343.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1 
isoform X1 [Vitis vinifera]
Length=574

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/554 (57%), Positives = 415/554 (75%), Gaps = 10/554 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             G+E +AS+   +NL++     P   YRT++HFQPP+NWMNDPNGPM Y GVYH FYQYNP
Sbjct  19    GIEAEASYPSCRNLQSNPTEQP---YRTAYHFQPPKNWMNDPNGPMYYNGVYHLFYQYNP  75

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
               A +G I+W HS S DLVNW     AL+P+ P  DING W+GSATILP   P ++YTG 
Sbjct  76    YAAVWGNITWAHSISYDLVNWVHLDHALNPTDPF-DINGCWTGSATILPGEEPVIIYTGA  134

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             D++NRQVQN+AVP+N SDP L+EW+KSPRNPL++P   N I+A +FRDPTTAW+GPD  W
Sbjct  135   DTQNRQVQNMAVPKNISDPLLREWIKSPRNPLMSPT--NGIDANNFRDPTTAWQGPDKVW  192

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPNGLDTSL  1104
             RI+VGS +   G A+LYRS+DFV W +++ PLHS   +GMWECPDFYPVST   G++TS+
Sbjct  193   RIIVGSLINDHGTALLYRSRDFVNWTKSQTPLHSSNKTGMWECPDFYPVSTR-TGVETSV  251

Query  1103  VGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFY  924
               +  +HVLK S +   +DYY IG Y    D Y+ +   +D  S LRYDYG+FYASKTF+
Sbjct  252   QNADTQHVLKASFNG--NDYYIIGKYVPETDTYLVETDFLDAGSDLRYDYGEFYASKTFF  309

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             D+ K+RRILW WI ES   +  +++GWSG+Q IPR+V LD+T +QLVQWP++E+E+LR N
Sbjct  310   DAAKKRRILWAWIQESDSSSADIEKGWSGLQSIPRSVLLDQTGRQLVQWPIKEIEELREN  369

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
             +V + +  ++ GSV EV GI+A+Q D+EV+F    F +AE ++  W  DPQ+LC+QK AS
Sbjct  370   QVTLLNKEVRGGSVLEVPGITASQVDVEVSFDFPHFKEAEVLDPSWV-DPQLLCTQKNAS  428

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
             V+G IGPFGL VLAS++  E TA+FF +F  +N   VVLMCSDQ+RSS+ +  DKTSYGA
Sbjct  429   VKGSIGPFGLLVLASKDLTEQTAIFFHIFKTHNKKYVVLMCSDQSRSSVRQDVDKTSYGA  488

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             FVD++P++E++SLR LIDHSIVESFG +G+ CIT+RVYP  AI ++AHLY FNNG  S+K
Sbjct  489   FVDIDPLREKISLRGLIDHSIVESFGGEGRSCITARVYPELAINKEAHLYVFNNGTQSVK  548

Query  203   LSKLTAWSMKKPTI  162
             +S+L AWSMKK  I
Sbjct  549   ISRLDAWSMKKAEI  562



>gb|AEX15264.1| cell wall invertase [Musa acuminata AAA Group]
Length=583

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/556 (57%), Positives = 407/556 (73%), Gaps = 6/556 (1%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPK  1641
             V  +ASH+V ++L+++     +   RT +HFQPP++W+NDPNGPM Y G+YH FYQYNP 
Sbjct  30    VVVEASHVVYESLQSVPASVVDSKLRTGYHFQPPKHWINDPNGPMYYNGLYHLFYQYNPS  89

Query  1640  GASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVD  1461
             G+ +G I W HS S DL+NW A  PA+ PS+P  DI G WSGSATILP N P +LYTG+D
Sbjct  90    GSVWGNIVWAHSVSTDLINWVALEPAIYPSKPF-DIKGCWSGSATILPGNRPVILYTGLD  148

Query  1460  SRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
              R RQVQN+A P+N SDPYL+EWVK   NP+IAP+  + +N ++FRDPTTAWRGP G+W+
Sbjct  149   PRERQVQNIAYPKNLSDPYLREWVKPDFNPVIAPD--DGVNGSAFRDPTTAWRGPSGHWK  206

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSL  1104
             ++VGSK  +RG AILYRS+DFV WV+AKH LHS   +GMWECPDFYPV+     GLDTS+
Sbjct  207   LVVGSKWNKRGKAILYRSRDFVHWVKAKHSLHSARDTGMWECPDFYPVALKGTRGLDTSV  266

Query  1103  VGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFY  924
              G  +K+VLK+SLD +R++YYT+G Y H +DKY+PD  S D+++GLRYDYG FYASKTF+
Sbjct  267   YGHGVKYVLKVSLDITRYEYYTVGKYYHDKDKYVPDATSADDNTGLRYDYGNFYASKTFF  326

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             D  K+RRILWGW NES        +GW+G+Q IPRT+ LD + +QLVQWP++E+E LR  
Sbjct  327   DGKKQRRILWGWANESDTSDVDKAKGWAGIQMIPRTILLDSSGRQLVQWPIEEIESLRGK  386

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
              V +    +  G   EV+GI ++QAD+EV+F +    KAE  +  W TD + LC +K A 
Sbjct  387   HVVVEHKRIPSGGFFEVTGIDSSQADVEVSFDVSGLEKAEDFDPSWATDAEALCGRKTAD  446

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
             V+GG+GPFG+ VLAS N +E TAVFFRVF   + + VVLMC D TRSSL     K ++  
Sbjct  447   VKGGVGPFGVLVLASANMEEKTAVFFRVFKAYHKH-VVLMCHDPTRSSLRAGLYKPTFAG  505

Query  383   FVDVNPMQE-ELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
             FVDV+  +  ++SLR LID S+VESFGAKGK CITSRVYP+ AIGE AHL+ FNNG   +
Sbjct  506   FVDVDIAKTGKISLRTLIDSSVVESFGAKGKTCITSRVYPSLAIGEDAHLFVFNNGSTDV  565

Query  206   KLSKLTAWSMKKPTIN  159
             K+S+L AW MKKP +N
Sbjct  566   KVSELNAWEMKKPLMN  581



>ref|XP_009626391.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Nicotiana tomentosiformis]
Length=569

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/543 (60%), Positives = 405/543 (75%), Gaps = 14/543 (3%)
 Frame = -1

Query  1760  PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNW  1581
             P+  YRT+FHFQP + WMNDPNGPM+Y G+YHFFYQYNP  A  G I WGHSTS DL+NW
Sbjct  32    PDQIYRTAFHFQPAKYWMNDPNGPMIYMGIYHFFYQYNPYDAQSGNIVWGHSTSTDLINW  91

Query  1580  RAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYL  1401
                 PAL  S+P  D  G +SGS TIL    PA+LYTGVD  + QVQNLAVP+N  DPYL
Sbjct  92    TPQPPALLRSEP-YDFKGCFSGSTTILSGGKPAILYTGVDFSDIQVQNLAVPKNLLDPYL  150

Query  1400  QEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP-DGNWRILVGSKVGRRGLAILYRSK  1224
              EWVKSP NPLI PN  NKI+  +FRDPTTAW  P DGNWR++VG+K    G+ +LY+SK
Sbjct  151   IEWVKSPYNPLITPNSVNKIDGQNFRDPTTAWVNPTDGNWRMVVGNKKNNTGIGLLYKSK  210

Query  1223  DFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGSKIKHVLKISLDESRHD  1047
             +F+ W+Q + PLH    SGMWECPDF+PVST S  GLDTS++G  +KHV K+S+  S  D
Sbjct  211   NFIDWIQTEQPLHFLNNSGMWECPDFFPVSTISQIGLDTSIMGPNVKHVFKVSVANS--D  268

Query  1046  YYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINES--L  873
             YYTIG Y+  +D ++PD  S+D   G RYDYGK+YASKTF+DS   RRIL+GW++E+  +
Sbjct  269   YYTIGIYNPNKDIFVPDNESLDIGLGFRYDYGKYYASKTFFDSATNRRILFGWVSEAVNI  328

Query  872   IDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR-SNKVEMPSTMLKKGSVSE  696
             +D   ++ GW+G+QGIPR +WL K+  QL+QWP+ E+EKLR +N V   +T L  GSV E
Sbjct  329   VDINSIR-GWAGLQGIPRRIWLQKSGNQLLQWPIVEIEKLRINNPVVEGTTALMAGSVRE  387

Query  695   VSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASE  516
             +SG++A QAD+E++F      KAE  E  W T+PQ +CS KGASV+GGIGPFGL VLAS+
Sbjct  388   ISGVTATQADVEISFAAKTLEKAEIWEANW-TNPQQVCSIKGASVKGGIGPFGLLVLASK  446

Query  515   NRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL---DKKTDKTSYGAFVDVNPMQEELSL  345
             + QEYTAVFFR+F GNNNN +VLMCSDQ+RSSL       DKT+YGAF++V+P+QE+LSL
Sbjct  447   DMQEYTAVFFRIFKGNNNNFIVLMCSDQSRSSLHLPSTDYDKTTYGAFLNVDPVQEKLSL  506

Query  344   RILIDHSIVESFGAKGKVCITSRVYPTK-AIGEKAHLYAFNNGVHSIKLSKLTAWSMKKP  168
             R LIDHSIVESFG +GK CIT+RVYPT  A+   +HLY FNNG  ++++S LTAWSMK  
Sbjct  507   RTLIDHSIVESFGGEGKACITARVYPTNLAVDGGSHLYVFNNGSENVEISNLTAWSMKTA  566

Query  167   TIN  159
              IN
Sbjct  567   QIN  569



>ref|XP_002884988.1| ATCWINV5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61247.1| ATCWINV5 [Arabidopsis lyrata subsp. lyrata]
Length=573

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/552 (59%), Positives = 414/552 (75%), Gaps = 16/552 (3%)
 Frame = -1

Query  1799  IVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA--SFG  1626
             +VL  L  +     N  YRT +HFQPP+NWMN   GPM+YKG+YH FYQ+N  GA     
Sbjct  25    VVLDALHNVPNNIKNQPYRTGYHFQPPKNWMN---GPMIYKGIYHLFYQWNQNGAVMDVN  81

Query  1625  KISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQ  1446
             +  WGH+TS DL+NW    PA+ PS+P+ DING WSGS TIL N  P ++YTG D  NRQ
Sbjct  82    ETVWGHATSTDLINWITLSPAIKPSRPS-DINGCWSGSVTILTNGKPVIIYTGNDRYNRQ  140

Query  1445  VQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGS  1266
             VQNLA P+N +DPYL+ W KSP NPL+ PN  N IN+T+FRDPTTAW G D  WRI  GS
Sbjct  141   VQNLAKPKNLTDPYLRHWTKSPENPLVTPNAANHINSTAFRDPTTAWLGRDKRWRITTGS  200

Query  1265  KVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDT-SLVGSK  1092
             + GRRGLAIL+ S+DFVRW Q+  PLH  EG+G+WECPDF+PVS T   GLDT S  G  
Sbjct  201   QEGRRGLAILHTSRDFVRWKQSPKPLHYHEGTGIWECPDFFPVSRTDSRGLDTSSSAGPM  260

Query  1091  IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLK  912
             IKHVLK+SL ++  DYYTIGTYD VRD Y+PDKG V +++  RYDYGKFYASKTFYDS+ 
Sbjct  261   IKHVLKVSLTDTFRDYYTIGTYDEVRDVYVPDKGFVQDETAPRYDYGKFYASKTFYDSVN  320

Query  911   RRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEM  732
             +RRILWGW+NES  + + +K+GW+G+Q IPR VWLDK+ K+LVQWPV+E+E+LR+ +V+ 
Sbjct  321   QRRILWGWVNESSPEKDNIKKGWAGLQAIPREVWLDKSGKRLVQWPVKEIERLRTTQVKW  380

Query  731   PSTMLK-KGSVSEVSGISAAQADMEVTFKI--MEFGKAEKMEERWTTDPQVLCSQKGAS-  564
              + +LK  GSV EV G++A+QAD+EV FK+  ++  KA+ +E  W TDPQ++CS+K AS 
Sbjct  381   VNKVLKGGGSVIEVHGVTASQADVEVFFKVSGLDLEKADVIEPGW-TDPQLICSEKNASF  439

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVF--MGNNNNPVVLMCSDQTRSSLDKKTDKTSY  390
             V  G+GPFGL VLAS++ +EYT+V FR+F   GNN   +V+MCSDQ+RSSL+K  DKT+Y
Sbjct  440   VNSGLGPFGLMVLASKDMEEYTSVNFRIFRARGNNKEHLVVMCSDQSRSSLEKGNDKTTY  499

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
             GAF+D++P Q  +SLR LID SIVESFG KGK CITSRVYP  A GE+ HL+AFN G  +
Sbjct  500   GAFMDISPYQ-PISLRTLIDKSIVESFGGKGKTCITSRVYPKLATGERTHLFAFNKGSQN  558

Query  209   IKLSKLTAWSMK  174
             + +  L+AWSMK
Sbjct  559   VDILSLSAWSMK  570



>gb|AEX15263.1| cell wall invertase [Musa acuminata AAA Group]
Length=586

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/557 (56%), Positives = 408/557 (73%), Gaps = 6/557 (1%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             G   +ASH+   +L+++     ++  RT +HFQPPRNW+NDPNGPM + GVYH FYQYNP
Sbjct  32    GAVVEASHVEFASLQSVPASVVDNRLRTGYHFQPPRNWINDPNGPMYFNGVYHLFYQYNP  91

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
              G+ +G I W HS S DLVNW A  PA+ PS+P  DING WSGSAT+LP N PA+ YTG+
Sbjct  92    NGSVWGNIVWAHSVSTDLVNWIALDPAIRPSKPF-DINGCWSGSATVLPGNRPAIFYTGI  150

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             D + RQ+QN+A P++ SDPYL+EWVK   NP+IAP   + INA++FRDPTTAWRGP  +W
Sbjct  151   DPQQRQLQNVAYPKDLSDPYLREWVKPDYNPVIAPG--DGINASAFRDPTTAWRGPGTHW  208

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTS  1107
             +++VGSK  RRG AILYRS+DFV WV+AKHPLH+ + +GMWECPDFYPV+     GLDTS
Sbjct  209   KLVVGSKWNRRGKAILYRSRDFVHWVKAKHPLHTVKDTGMWECPDFYPVAVKGRRGLDTS  268

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
               G  +KHVLK+SLD  R++YYT+G Y H +DKY+PD  S D+ +GLRYDYG FYASKTF
Sbjct  269   AYGDGMKHVLKVSLDLRRYEYYTLGKYYHYQDKYVPDNTSADDHTGLRYDYGNFYASKTF  328

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +D  K+RRILWGW NES      V +GW+G+Q IPRT+WLD + +QL+QWP++ELE LR 
Sbjct  329   FDPKKQRRILWGWANESDAKDVDVAKGWAGIQAIPRTIWLDSSGRQLIQWPIEELESLRG  388

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
               V +    +  G+  EV GI+++QAD+EV F++    KAE  +  W TD + LC +K A
Sbjct  389   KHVVVEHKKVSGGNSFEVEGINSSQADVEVAFEVSGLEKAEAFDPSWATDAEALCGRKRA  448

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
              V+GG+GPFGL VLAS N +E TAVFFR+F   + + VVLMC D TRSS+     + ++ 
Sbjct  449   DVKGGVGPFGLLVLASANMEEKTAVFFRIFKAEHKH-VVLMCHDPTRSSMRPNLYRPTFA  507

Query  386   AFVDVNPMQE-ELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              +VDV+  +  ++SLR LIDHS+VESFGA GK CITSRVYP+ AIG+ AHL+ FNNG   
Sbjct  508   GYVDVDIAKTGKISLRSLIDHSVVESFGADGKTCITSRVYPSLAIGKDAHLFVFNNGSAD  567

Query  209   IKLSKLTAWSMKKPTIN  159
             +K+S+L AW +++P +N
Sbjct  568   VKVSELKAWEIRRPLMN  584



>ref|XP_006392688.1| hypothetical protein EUTSA_v10011339mg [Eutrema salsugineum]
 gb|ESQ29974.1| hypothetical protein EUTSA_v10011339mg [Eutrema salsugineum]
Length=589

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/550 (57%), Positives = 409/550 (74%), Gaps = 11/550 (2%)
 Frame = -1

Query  1787  NLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KISWG  1611
             +LEA Q    N  YRT +HFQPPRNWMNDPNGPM+YKG+YH FYQYNP GA +  +I WG
Sbjct  25    DLEASQQDL-NQPYRTGYHFQPPRNWMNDPNGPMIYKGIYHLFYQYNPYGAVWDVRIVWG  83

Query  1610  HSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLA  1431
             HSTS DLVNW    PA +PSQP+ D+NG WSGS TILP+  P +LYTG+D    QVQN+A
Sbjct  84    HSTSADLVNWTPQPPAFNPSQPS-DVNGCWSGSVTILPDGKPVILYTGIDQNKSQVQNIA  142

Query  1430  VPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG-R  1254
             VP N SDPYL+EW K   NPL+APN  N I+   FRDPTTAW G DG WR++VGS    R
Sbjct  143   VPVNVSDPYLREWSKPTLNPLLAPNAVNGIDPDRFRDPTTAWLGRDGEWRVIVGSSTDDR  202

Query  1253  RGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSKIKHVL  1077
             RGLAILY+S+DF  W Q+  PLH  + +GMWECPDF+PV+ T   G++TS  G  +KHVL
Sbjct  203   RGLAILYKSRDFFNWTQSTKPLHYEDLTGMWECPDFFPVAITGSEGVETSSFGD-VKHVL  261

Query  1076  KISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRIL  897
             K+SL E+ HDYYTIGTYD  +D Y+PD G V N+S  R DYGK+YASKTF+D +K+RR+L
Sbjct  262   KVSLIETLHDYYTIGTYDREKDVYVPDLGFVQNESAPRLDYGKYYASKTFFDDVKKRRVL  321

Query  896   WGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTML  717
             WGW+NES    + +++GWSG+Q  PR +WL ++ K+L+QWP++E+E LR ++V   + +L
Sbjct  322   WGWVNESSPAKDDIEKGWSGLQSFPRKIWLGESGKELLQWPIEEIETLRGSQVSWHNKVL  381

Query  716   KKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFG  537
             K GS  +V G++AAQAD+EV+FK+    KA+ M+  W TDPQ +CSQ+ +SV+ G+GPFG
Sbjct  382   KAGSTLQVHGVTAAQADVEVSFKVRNLEKADVMKPSW-TDPQKICSQEDSSVKSGLGPFG  440

Query  536   LKVLASENRQEYTAVFFRVFMGNNNNP----VVLMCSDQTRSSLDKKTDKTSYGAFVDVN  369
             L VLAS + +E+T+V+F++F  N+ N     VVLMC+DQ+RSSL+ + DKT++GAF+ ++
Sbjct  441   LIVLASNDMEEHTSVYFKIFKSNDTNKNTKYVVLMCTDQSRSSLNDENDKTTFGAFLAID  500

Query  368   PMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLT  189
             P  + +SLR LIDHSIVE++G  GKVCITSRVYP  AIGE  +L+AFN G  S+ +  L+
Sbjct  501   PSNQAISLRTLIDHSIVENYGGGGKVCITSRVYPKLAIGENTNLFAFNRGTQSVDVLSLS  560

Query  188   AWSMKKPTIN  159
             AWS+K   IN
Sbjct  561   AWSLKSAQIN  570



>ref|XP_004235589.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1 
[Solanum lycopersicum]
Length=571

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/540 (59%), Positives = 399/540 (74%), Gaps = 10/540 (2%)
 Frame = -1

Query  1760  PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNW  1581
             P+H YRT++HFQP + WMNDPNGP++Y G+YH FYQYN   A    I WGHSTS DLVNW
Sbjct  36    PDHIYRTAYHFQPAKYWMNDPNGPVIYMGIYHLFYQYNLYDAQTSNIVWGHSTSTDLVNW  95

Query  1580  RAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYL  1401
                 PAL  S+P  D  G ++GS T+L    PA+LYTG+D    QVQNLAVP+N +DPYL
Sbjct  96    TPQPPALLRSEPY-DFKGCFTGSTTLLSGGKPAVLYTGLDFSGIQVQNLAVPKNVADPYL  154

Query  1400  QEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKD  1221
              EWVKSP NPLIAPN  NKI+  +FRDP+TAW  PDGNWR++VG++    G+ +LYRSK+
Sbjct  155   TEWVKSPYNPLIAPNSVNKIDGQNFRDPSTAWLNPDGNWRMVVGNQQNGSGIGLLYRSKN  214

Query  1220  FVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSKIKHVLKISLDESRHDY  1044
             F+ W+QA++PLH    SGMWECPDF+PVS  S NGL+TS +G  +KHV K S   +  DY
Sbjct  215   FIDWIQAENPLHFLNNSGMWECPDFFPVSKISKNGLETSTIGQNVKHVFKAS--TANTDY  272

Query  1043  YTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDT  864
             YTIGTY+   D +IPD  S+D   G RYDYGKFYASKTF+DS   RRIL+GW+NES+ + 
Sbjct  273   YTIGTYNPTNDIFIPDNRSLDIGLGFRYDYGKFYASKTFFDSSTSRRILFGWVNESVNNL  332

Query  863   EY-VKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSG  687
             E    +GW+G+QGIPR +WL K+  QL+QWP+ E+EKLR N V   +T+L  GS+ E+SG
Sbjct  333   EINSMRGWAGLQGIPRRIWLHKSGNQLLQWPIVEIEKLRMNPVIEDTTVLMPGSIREISG  392

Query  686   ISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQ  507
             ++A QAD+E++F       AEK E  W  +PQ++CS KGA+V+GG+GPFGL VLAS++ Q
Sbjct  393   VNATQADVEMSFSAKTLENAEKWEANW-NNPQLVCSIKGATVKGGLGPFGLLVLASKDMQ  451

Query  506   EYTAVFFRVFMGNNNNPVVLMCSDQTRSSL---DKKTDKTSYGAFVDVNPMQEELSLRIL  336
             EYTA+FFR+F G+NNN +VLMCSDQTRSSL       DKT+YG  ++V+P+QE+LSLR L
Sbjct  452   EYTAIFFRIFKGDNNNFIVLMCSDQTRSSLRLPSSDYDKTTYGVLLNVDPLQEKLSLRTL  511

Query  335   IDHSIVESFGAKGKVCITSRVYPTK-AIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             IDHSIVESFG +GK CIT+RVYPT  A+    HLY FNNG  S+ +SKLTAWSMK   IN
Sbjct  512   IDHSIVESFGGEGKACITTRVYPTNLAVDGSTHLYVFNNGSQSVDISKLTAWSMKTAQIN  571



>ref|NP_187994.1| beta-fructofuranosidase, insoluble isoenzyme CWINV5 [Arabidopsis 
thaliana]
 dbj|BAB01929.1| beta-fructofuranosidase (invertase) [Arabidopsis thaliana]
 gb|AEE75413.1| beta-fructofuranosidase, insoluble isoenzyme CWINV5 [Arabidopsis 
thaliana]
Length=569

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/555 (59%), Positives = 413/555 (74%), Gaps = 16/555 (3%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
             T  + +VL  L+ +     N  YRT +HFQPP+NWMN   GPM+YKG+YH FYQ+N  GA
Sbjct  20    TDDAVVVLDALDNVPNNIKNQPYRTGYHFQPPKNWMN---GPMIYKGIYHLFYQWNQNGA  76

Query  1634  --SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVD  1461
                  K  WGH+TS DL+NW    PA+ PS+P+ DING WSGS TILPN  P +LYTG D
Sbjct  77    VMDVNKTVWGHATSTDLINWITLSPAIRPSRPS-DINGCWSGSVTILPNGKPVILYTGND  135

Query  1460  SRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
               NRQVQNL  P+N +DPYL+ W KSP NPL+ P+  N IN+++FRDPTTAW G DG WR
Sbjct  136   RYNRQVQNLVKPKNLTDPYLRHWTKSPENPLVTPSPVNHINSSAFRDPTTAWFGRDGRWR  195

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSL  1104
             I  GS+ GRRGLAIL+ SKDFV W Q+  PLH  +G+GMWECPDF+PV+ T   GLDTS 
Sbjct  196   ITTGSQEGRRGLAILHTSKDFVIWKQSPKPLHYHDGTGMWECPDFFPVARTDSRGLDTSF  255

Query  1103  V-GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
               G  +KHVLK+SL ++ +DYYTIGTYD VRD Y+PDKG V +++  RYDYGKFYASKTF
Sbjct  256   SSGPMVKHVLKVSLTDTFNDYYTIGTYDEVRDVYVPDKGFVQDETAPRYDYGKFYASKTF  315

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             YDS+ +RRILWGW+NES  + + +K+GW+G+Q IPR VWLD++ K+LVQWPV+E+E+LR+
Sbjct  316   YDSVNQRRILWGWVNESSPEKDNIKKGWAGLQAIPRKVWLDESGKRLVQWPVKEIERLRT  375

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFG--KAEKMEERWTTDPQVLCSQK  573
              +V+  + +LK GSV EV G++A QAD+EV FK+  F   KA+ +E  W TDPQ++CSQ+
Sbjct  376   TQVKWGNKLLKGGSVMEVHGVTAPQADVEVFFKVSGFDLEKADVIEPGW-TDPQLICSQR  434

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP--VVLMCSDQTRSSLDKKTDK  399
              AS   G+GPFGL VLAS+N +EYT+V  R+F    N+   VV+MCSDQ+ SSL+K  DK
Sbjct  435   NAS--SGLGPFGLMVLASKNMEEYTSVNIRIFRAGENSKEHVVVMCSDQSTSSLEKGNDK  492

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
             T+YGAF+D++P Q  +SLR LID SIVESFG KGK CITSRVYP  AIGE+ HL+AFN G
Sbjct  493   TTYGAFLDISPYQ-PISLRTLIDKSIVESFGGKGKTCITSRVYPKLAIGERTHLFAFNKG  551

Query  218   VHSIKLSKLTAWSMK  174
               ++ +  L+AWSMK
Sbjct  552   SQNVNVLSLSAWSMK  566



>ref|XP_010683702.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1 [Beta 
vulgaris subsp. vulgaris]
Length=577

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/555 (58%), Positives = 407/555 (73%), Gaps = 9/555 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQ--PPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             +  QASH V Q  ++LQ      +  +RT+FHFQPPR+W+NDPNGPM+YKG+YHFFYQYN
Sbjct  23    LHVQASHKVYQQYQSLQVEANQVDRVHRTAFHFQPPRHWINDPNGPMIYKGLYHFFYQYN  82

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             P GA++G I WGHS S+DL+NW A  PAL  S P  D NG WSGSATILP+N P +LYTG
Sbjct  83    PWGATWGNIVWGHSVSRDLINWEALEPALYESAPF-DTNGVWSGSATILPDNRPVMLYTG  141

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             V ++N QVQN+A+P N SD YL++WVK   NP+I P     +N + FRDPTTAW   +G+
Sbjct  142   VTAKNEQVQNIAIPANLSDSYLRKWVKPDYNPIITPTF--DMNVSYFRDPTTAWWS-NGH  198

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDT  1110
             W+ILVG +   RG+A LYRS+DF  W+++KHPLHS   +GMWECPDF+PV      GLDT
Sbjct  199   WKILVGGRRKNRGMAYLYRSRDFKNWIKSKHPLHSAPNTGMWECPDFFPVLIQGKYGLDT  258

Query  1109  SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKT  930
             S +GS +KHVLK+SLD +R +YYTIG YD V+DKY PD  ++D  +GLRYDYG FYASK+
Sbjct  259   SKMGSNMKHVLKVSLDVTRFEYYTIGRYDPVKDKYFPDNVAIDGWNGLRYDYGNFYASKS  318

Query  929   FYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR  750
             F+DS K RRILWGW NES        +GW+G+Q IPR+VWLD   KQL+QWPV+E+E+LR
Sbjct  319   FFDSKKSRRILWGWANESWTPDIAAVKGWAGIQAIPRSVWLDPNGKQLLQWPVEEVERLR  378

Query  749   SNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKG  570
             +NKV++ + +LK G   E++GI++AQAD+EV F+I    KAE  + +W  DPQ LC+QKG
Sbjct  379   ANKVDVGNYLLKPGKHFEINGITSAQADVEVAFRIPNLEKAEAFDPKW-VDPQDLCAQKG  437

Query  569   ASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSY  390
             ++VRG IGPFG+  LAS N +EYT VFFRVF    N  VVLMCSD + SS++K   K ++
Sbjct  438   STVRGRIGPFGILTLASNNLEEYTPVFFRVFKAQKNKHVVLMCSDASSSSMEKGLYKPTF  497

Query  389   GAFVDVN-PMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             G FVDV+    ++LSLR LIDHS+VESFGA GK CI SRVYP  AI   AHL+ FNNG  
Sbjct  498   GGFVDVDLTADKKLSLRTLIDHSVVESFGAGGKTCILSRVYPNLAIMNNAHLHVFNNGTE  557

Query  212   SIKLSKLTAWSMKKP  168
              + +  LTAW+MK+P
Sbjct  558   PVIVEHLTAWTMKRP  572



>ref|XP_006356523.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV3-like 
[Solanum tuberosum]
Length=549

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/533 (58%), Positives = 396/533 (74%), Gaps = 9/533 (2%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHI  1569
             YRT++HFQPP+NWMNDPNGPM+YKG+YH FYQYNP+ A +G I+WGHSTS DLVNW  H 
Sbjct  23    YRTAYHFQPPKNWMNDPNGPMIYKGIYHLFYQYNPESAEWGNIAWGHSTSTDLVNWTIHP  82

Query  1568  PALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWV  1389
             PAL PS    DING WSGSATIL +  PA+LYTG DS+N Q+QNLAVP++PSDPYL EWV
Sbjct  83    PALLPSD-TYDINGCWSGSATILQDGTPAILYTGGDSQNVQLQNLAVPKDPSDPYLVEWV  141

Query  1388  KSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRW  1209
             KSP NP++ PN   K    SFRDPTTAW GPDG WR+++G++   RG ++LY+SKDFV W
Sbjct  142   KSPHNPIMTPNEEEK---ESFRDPTTAWLGPDGIWRVVIGNERKNRGTSVLYKSKDFVHW  198

Query  1208  VQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYYTIG  1032
              +A+ PLHS   + MWECPD +PV     N LD S + S IKHVLK S+  S  DYYT+G
Sbjct  199   TEAERPLHSSSETTMWECPDLFPVLIDGENALDISEIFSGIKHVLKNSVARSFVDYYTVG  258

Query  1031  TYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVK  852
              YDH  D Y PD+GSVDN+SGLR DYG++YASK+F+DS K+RRI   W+NES      + 
Sbjct  259   VYDHHNDVYTPDEGSVDNESGLRLDYGRYYASKSFFDSEKKRRIFIAWVNESTSREIDLI  318

Query  851   QGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQ  672
             +GWSG+Q  PR +WLDK  KQL+QWPV+E+E LR+NKV++ +  L+ GS  E+SG++AAQ
Sbjct  319   KGWSGLQSFPRKIWLDKGGKQLIQWPVEEIETLRTNKVDLQNITLEAGSKREISGVTAAQ  378

Query  671   ADMEVTFK--IMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYT  498
             AD+E++F   I    +AE +E  W T+PQ +  + G+S   G+GPFGL VLAS N +EYT
Sbjct  379   ADVEISFSIPIAVLEQAEVLESSW-TNPQEMAKKSGSSANTGVGPFGLLVLASNNIEEYT  437

Query  497   AVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIV  318
             A+FFR+F   N+  VVLM  DQ RSS+  + DKT+YGAF+D++P+ E+LSLR LIDHSIV
Sbjct  438   AIFFRIFK-KNDKFVVLMGCDQKRSSVGLEYDKTNYGAFLDIDPLTEKLSLRTLIDHSIV  496

Query  317   ESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             ESFG  GK CIT+R YPT AI + AH++ FNNG   + +S L+AWS+ +  IN
Sbjct  497   ESFGGGGKACITTRAYPTLAINDNAHIFVFNNGSQHVDISTLSAWSLNQAHIN  549



>ref|XP_006407168.1| hypothetical protein EUTSA_v10020395mg [Eutrema salsugineum]
 gb|ESQ48621.1| hypothetical protein EUTSA_v10020395mg [Eutrema salsugineum]
Length=567

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/548 (58%), Positives = 410/548 (75%), Gaps = 13/548 (2%)
 Frame = -1

Query  1799  IVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA--SFG  1626
             +VL+ L        +  YRT +HFQPP+NWMN   GPM+YKG+YH FYQ+ P G    F 
Sbjct  24    LVLEALHHAPNRIKDQPYRTGYHFQPPKNWMN---GPMIYKGIYHLFYQWYPNGVVTDFN  80

Query  1625  KISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQ  1446
             KI WGH+TS DL+NW  H PA+ PS+P+ DING WSGS TILPN  P +LYTG D  N Q
Sbjct  81    KIVWGHATSTDLINWTPHSPAIKPSRPS-DINGCWSGSVTILPNGKPVILYTGNDRNNHQ  139

Query  1445  VQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGS  1266
             VQNLA P+N SDPYL+ W KSP NPL+ PN  N IN+T+FRDPTTAW G +G WR++ GS
Sbjct  140   VQNLARPKNLSDPYLRHWTKSPANPLVTPNAVNHINSTAFRDPTTAWLGRNGRWRVITGS  199

Query  1265  KVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGSKI  1089
             + GRRGLA+L+ S+DF  W Q+  PLH  +G+GMWECPDF+PV+  +P GLDTS  G  I
Sbjct  200   QEGRRGLALLHTSRDFTSWKQSTKPLHYNDGTGMWECPDFFPVARFNPQGLDTSSFGESI  259

Query  1088  KHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKR  909
             KHVLK+SL E+ HDYYTIGTYD +RD Y+PD G V + +  RYDYGKFYASKTFYDS+ R
Sbjct  260   KHVLKVSLSETSHDYYTIGTYDRMRDVYVPDDGFVQDGTAPRYDYGKFYASKTFYDSVYR  319

Query  908   RRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMP  729
             RRILWGW+NES    + V +GW+G+Q IPR VWLD++ K+L+ WPV+E+E+LR+ +V++ 
Sbjct  320   RRILWGWVNESSPVKDNVDKGWAGLQAIPRKVWLDESGKRLMLWPVKEIERLRAKQVKLE  379

Query  728   STMLK-KGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGG  552
             + +L+  GSV +V G++A+QAD+EV FK+    +A+ +E  W TDPQ++CSQ   +   G
Sbjct  380   NKVLEGGGSVLDVHGVTASQADVEVFFKVTGLEEADVIEPGW-TDPQLICSQN-KTASSG  437

Query  551   IGPFGLKVLASENRQEYTAVFFRVFMG--NNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             +GPFGL VLAS+N +EYT+V+ R+F    N+ + VV+MCSDQ+RSSL+K  DKT +GAF+
Sbjct  438   LGPFGLMVLASKNLEEYTSVYLRIFKARQNSKDHVVVMCSDQSRSSLEKGNDKTPFGAFL  497

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             D++P Q  +SLR LID+SIVESF  KGK CITSRVYP  AIG+ AHL+AFNNG  ++ + 
Sbjct  498   DISPYQ-PISLRTLIDNSIVESFVGKGKTCITSRVYPKLAIGKNAHLFAFNNGSQNVDVL  556

Query  197   KLTAWSMK  174
              L+AWSMK
Sbjct  557   SLSAWSMK  564



>gb|KDO70479.1| hypothetical protein CISIN_1g008189mg [Citrus sinensis]
Length=574

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/555 (58%), Positives = 406/555 (73%), Gaps = 14/555 (3%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH +    ++L        +RT+FHFQPP++W+N   GPM YKG+YH FYQYNPKGA
Sbjct  25    VEASHKIYPEFQSLAAVKVKQLHRTAFHFQPPKHWIN---GPMYYKGIYHLFYQYNPKGA  81

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS SKDL+NW A  PAL PS+P  DING WSGSAT+LP N P +LYTGVD +
Sbjct  82    VWGNIVWAHSVSKDLINWEALEPALYPSKPF-DINGCWSGSATVLPGNKPIILYTGVDHK  140

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
              RQVQN AVP NPSDPYL++W+K   NP++ P     +NA++FRDPTTAW   DG+WR+L
Sbjct  141   ERQVQNYAVPANPSDPYLRKWIKPDNNPVVFPG--PDVNASAFRDPTTAWWSNDGHWRML  198

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG  1098
             VGS+   RG+A LYRS+DF++W +AKHP+HS   +GMWECPDFYPVS S  NGLDTS  G
Sbjct  199   VGSRRKHRGMAYLYRSRDFMKWTKAKHPIHSLANTGMWECPDFYPVSISGKNGLDTSFAG  258

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
                K VLK+SLD +R+DYYTIGTY+  +D+Y+PDK SVD   GLRYDYG FYASKTF+DS
Sbjct  259   GNEKFVLKVSLDLTRYDYYTIGTYNRDKDRYVPDKDSVDGWRGLRYDYGNFYASKTFFDS  318

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K RRILWGW NES    + + +GW+GVQ IPR VWLD + KQL+QWP++ELE LR   V
Sbjct  319   RKNRRILWGWANESDSTFDDMAKGWAGVQTIPREVWLDGSGKQLLQWPIEELETLRGKNV  378

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERW-TTDPQVLCSQKGASV  561
              + +  LKKG   EV G++AAQAD+EVTFK+    KAEK +  W   D + LC + G+ V
Sbjct  379   HISNQELKKGHHVEVKGVTAAQADVEVTFKLPSLDKAEKFDPSWKNLDAEHLCGKIGSKV  438

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD---KTSY  390
             +GG+GPFGL  LAS+N +E+T VFFR+F   + + +VLMCSD + S+L  KT+   K S+
Sbjct  439   QGGVGPFGLLTLASKNLEEFTPVFFRIFKDGHKH-LVLMCSDASSSTL--KTEGLYKPSF  495

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
               FV+V+   ++LSLR LIDHS+VESFGA GK CITSRVYPT A+ + AHLYAFNNG  +
Sbjct  496   AGFVNVDLSDKKLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAVFDDAHLYAFNNGTET  555

Query  209   IKLSKLTAWSMKKPT  165
             + + KL AWSMKKP 
Sbjct  556   VTVEKLNAWSMKKPV  570



>gb|AAO21213.1| cell wall invertase [Musa acuminata]
Length=586

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/557 (55%), Positives = 408/557 (73%), Gaps = 6/557 (1%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             G   +ASH+   +L+++     ++  RT +HFQPPRNW+NDPNGPM + GVYH FYQYNP
Sbjct  32    GAVVEASHVEFASLQSVPASVVDNRLRTGYHFQPPRNWINDPNGPMYFNGVYHLFYQYNP  91

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
              G+ +G I W HS S DLVNW A  PA+ PS+P  DING WSGSAT+LP N P ++YTG+
Sbjct  92    NGSVWGNIVWAHSVSTDLVNWIALDPAIRPSKPF-DINGCWSGSATVLPGNRPVIVYTGI  150

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             D + RQ+QN+A P++ SDPYL+EWVK   NP+IAP   + INA++FRDPTTAWRGP  +W
Sbjct  151   DPQQRQLQNVAYPKDLSDPYLREWVKPDYNPVIAPG--DGINASAFRDPTTAWRGPGTHW  208

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTS  1107
             +++VGSK  RRG AILYRS+DFV WV+AKHPLH+ + +GMWECPDFYPV+     GLDTS
Sbjct  209   KLVVGSKWNRRGKAILYRSRDFVHWVKAKHPLHTVKDTGMWECPDFYPVAVKGRRGLDTS  268

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
               G  +KHVLK+SLD  +++YYT+G Y H +DKY+PD  S D+ +GLRYDYG FYASKTF
Sbjct  269   AYGDGVKHVLKVSLDLRKYEYYTLGKYYHYQDKYVPDNTSADDHTGLRYDYGNFYASKTF  328

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +D  K+RRILWGW  ES  +   V +GW+G+Q IPRT+WLD + +QL+QWP++ELE LR 
Sbjct  329   FDPKKQRRILWGWAKESDAEDVDVAKGWAGIQAIPRTIWLDSSGRQLIQWPIEELESLRG  388

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
               V +    +  G+  EV GI+++QAD+EV F++    KAE  +  W TD + LC QK A
Sbjct  389   KHVVVEHKKVSGGNSFEVEGINSSQADVEVAFEVSGLEKAEAFDPSWATDAEALCGQKRA  448

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
              V+GG+GPFGL VLAS   +E TAVFFR+F   + + VVLMC D +RSS+     + ++ 
Sbjct  449   DVKGGVGPFGLLVLASAKMEEKTAVFFRIFKAEHKH-VVLMCHDPSRSSMRPNLYRPTFA  507

Query  386   AFVDVNPMQE-ELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              +VDV+  +  ++SLR LIDHS+VESFGA+GK CITSRVYP+ AIG+ AHL+ FNNG   
Sbjct  508   GYVDVDIAKTGKISLRSLIDHSVVESFGAEGKTCITSRVYPSLAIGKDAHLFVFNNGSAD  567

Query  209   IKLSKLTAWSMKKPTIN  159
             +K+S+L AW +++P +N
Sbjct  568   VKVSELKAWEIRRPLMN  584



>ref|XP_010262079.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV3-like 
isoform X1 [Nelumbo nucifera]
Length=567

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/554 (58%), Positives = 408/554 (74%), Gaps = 10/554 (2%)
 Frame = -1

Query  1817  ETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKG  1638
             E + S     +L  LQ       YRT +HFQPPRNWMNDPN PM YKG YH FYQYNP G
Sbjct  21    EVEDSRRTHGDLYPLQITSIKQPYRTLYHFQPPRNWMNDPNAPMYYKGYYHLFYQYNPYG  80

Query  1637  ASFG-KISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVD  1461
             A +   I W HS S DLVNW     A+ P++   DING WSGSATILP N P +LYTG D
Sbjct  81    AVWRPDIIWAHSVSTDLVNWVHLDHAIYPTE-TFDINGCWSGSATILPGNKPVILYTGGD  139

Query  1460  SRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
             S+N QVQNLA+P N SDP LQ WVK P+NPLI P +   I+  +FRDPTTAW+GPDG WR
Sbjct  140   SKNHQVQNLALPVNLSDPLLQSWVKLPQNPLITPIN-GGIDPENFRDPTTAWQGPDGEWR  198

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSL  1104
             +LVG++    G+AILYRS+DFV W ++++P  S E + +WECPDFYPVS  + NG+DTS+
Sbjct  199   VLVGTQGEHGGMAILYRSRDFVNWTESQYPFRSREKTSIWECPDFYPVSLNTTNGVDTSV  258

Query  1103  VGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFY  924
                 +KHVLK++ +   HDYYT+G+Y    D+YIPD   +D+D  LRYDYGKFYASK+F+
Sbjct  259   NNPSVKHVLKVNFNS--HDYYTLGSYSSYTDEYIPDTDFMDSD--LRYDYGKFYASKSFF  314

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             D  K RRILW W+NES  ++E +K+GWSG+Q IPR+ WL KT +QLVQWPV+E+EKLR N
Sbjct  315   DPAKNRRILWAWVNESDSESEDIKRGWSGLQSIPRSAWLGKTGRQLVQWPVEEIEKLRIN  374

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
             +V      L+  +V EVSG++A+QAD+EV+F++ +   AE M+  W  DPQ+LCS KGAS
Sbjct  375   EVNFKGENLRSETVFEVSGVTASQADIEVSFELPKLAYAELMDPSW-VDPQLLCSDKGAS  433

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
             V+GG+GPFGL VLASE+ +E+TA+FFRVF  N +  VVLMCSDQ+RSSL ++ DKT+YGA
Sbjct  434   VKGGVGPFGLLVLASEDLKEHTAIFFRVFK-NKDRYVVLMCSDQSRSSLSEEIDKTTYGA  492

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             FVDV+P  E +SLR LIDHSIVESFG +G+ CIT+RVYP  AI E+A LYAFNNG  ++ 
Sbjct  493   FVDVDPRHENISLRSLIDHSIVESFGGEGRACITARVYPKLAIDEEARLYAFNNGTENVI  552

Query  203   LSKLTAWSMKKPTI  162
             +S+L AWSMK   I
Sbjct  553   ISRLRAWSMKSALI  566



>dbj|BAA89048.1| beta-fructofuranosidase [Arabidopsis thaliana]
Length=595

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/554 (57%), Positives = 403/554 (73%), Gaps = 10/554 (2%)
 Frame = -1

Query  1793  LQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KIS  1617
             + +LEA      N  YRT +HFQP +NWMNDPNGPM+YKG+YH FYQYNP GA +  +I 
Sbjct  23    ITDLEASSHQDLNQPYRTGYHFQPLKNWMNDPNGPMIYKGIYHLFYQYNPYGAVWDVRIV  82

Query  1616  WGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQN  1437
             WGHSTS DLVNW +  PA +PSQP+ DING WSGS TILPN  P +LYTG+D    QVQN
Sbjct  83    WGHSTSVDLVNWISQPPAFNPSQPS-DINGCWSGSVTILPNGKPVILYTGIDQNKGQVQN  141

Query  1436  LAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG  1257
             +AVP N SDPYL+EW K P+NPL+  N  N IN   FRDPTTAW G DG WR++VGS   
Sbjct  142   VAVPVNISDPYLREWSKPPQNPLMTTNAVNGINPDRFRDPTTAWLGRDGEWRVIVGSSTD  201

Query  1256  -RRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSK-IK  1086
              RRGLAILY+S+DF  W Q+  PLH  + +GMWECPDF+PVS T  +G++TS VG   IK
Sbjct  202   DRRGLAILYKSRDFFNWTQSMKPLHYEDLTGMWECPDFFPVSITGSDGVETSSVGENGIK  261

Query  1085  HVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRR  906
             HVLK+SL E+ HDYYTIG+YD  +D Y+PD G V N+S  R DYGK+YASKTFYD +K+R
Sbjct  262   HVLKVSLIETLHDYYTIGSYDREKDVYVPDLGFVQNESAPRLDYGKYYASKTFYDDVKKR  321

Query  905   RILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPS  726
             RILWGW+NES    + +++GWSG+Q  PR +WLD++ K+L+QWP++E+E LR  +V    
Sbjct  322   RILWGWVNESSPAKDDIEKGWSGLQSFPRKIWLDESGKELLQWPIEEIETLRGQQVNWQK  381

Query  725   TMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIG  546
              +LK GS  +V G++AAQAD+EV+FK+ E  KA+ +       PQ +CSQ   SV  G+G
Sbjct  382   KVLKAGSTLQVHGVTAAQADVEVSFKVKELEKADVIGPELDPIPQKICSQGDLSVMSGLG  441

Query  545   PFGLKVLASENRQEYTAVFFRVFMGNNNNP-----VVLMCSDQTRSSLDKKTDKTSYGAF  381
             PFGL VLAS + +EYT+V+FR+F  N++       VVLMCSDQ+RSSL+ + DK+++GAF
Sbjct  442   PFGLMVLASNDMEEYTSVYFRIFKSNDDTNKKTKYVVLMCSDQSRSSLNDENDKSTFGAF  501

Query  380   VDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             V ++P  + +SLR LIDHSIVES+G  G+ CITSRVYP  AIGE A+L+ FN G  S+ +
Sbjct  502   VAIDPSHQTISLRTLIDHSIVESYGGGGRTCITSRVYPKLAIGENANLFVFNKGTQSVDI  561

Query  200   SKLTAWSMKKPTIN  159
               L+AWS+K   IN
Sbjct  562   LTLSAWSLKSAQIN  575



>ref|XP_009372510.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Pyrus x bretschneideri]
Length=582

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/555 (58%), Positives = 396/555 (71%), Gaps = 8/555 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +A H V    ++L        +RT+FHFQPPRNW+NDPNGPM + G+YH FYQYNP+GA
Sbjct  30    VEALHNVYPEFQSLAAVKVKQVHRTAFHFQPPRNWINDPNGPMYFGGLYHLFYQYNPEGA  89

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS SKDL+NW A  PA+ PS+P  D+NG WSGSAT+LP N P +LYTG+DS+
Sbjct  90    VWGNIVWAHSVSKDLINWEALEPAIHPSKPF-DVNGCWSGSATVLPGNKPIILYTGIDSQ  148

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             NRQVQN A+P N SDPYL++W+K   NPL+ P+    INAT+FRDPTTAW G +G+W++L
Sbjct  149   NRQVQNYAIPENASDPYLRKWIKPDNNPLVIPDL--GINATAFRDPTTAWWG-NGHWKML  205

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVG  1098
             VG K   RG+A LYRSKDFV WV+A HPLHS   +GMWECPDFYPV      GLDTS VG
Sbjct  206   VGGKRKHRGMAYLYRSKDFVHWVKAHHPLHSAPQTGMWECPDFYPVPLVGKLGLDTSKVG  265

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               +KHVLK+SLDE+R++YYT+GTY   +D+Y+PDK  VD  SGLRYDYG FYASKTF+D 
Sbjct  266   RDVKHVLKVSLDETRYEYYTVGTYFPEKDRYVPDKELVDGWSGLRYDYGNFYASKTFFDP  325

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRILWGW NES   +    +GW+G+Q IPR VWL    KQL++WPV ELE LR  KV
Sbjct  326   AKKRRILWGWANESDTASNDAAKGWAGIQTIPRDVWLSPDGKQLLKWPVVELETLRGKKV  385

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQKGASV  561
              +   +LK+G   EV GI+AAQAD+EV F +    KAE+    W+  D Q LC +KG+ +
Sbjct  386   GINKQILKQGDHVEVKGITAAQADVEVIFTLPSLAKAEEFNPSWSNLDAQTLCGKKGSKI  445

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAF  381
             +GGIGPFGL  LAS+N +E+T VFFRVF     + VVLMCSD T SSL     + S+  F
Sbjct  446   QGGIGPFGLLTLASKNLEEFTPVFFRVFKAKGRH-VVLMCSDATSSSLQDNLYRPSFAGF  504

Query  380   VDVN-PMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             VDV+    ++LSLR LIDHS+VES+GA GK CITSRVYPT A+   AHLY FNNG   + 
Sbjct  505   VDVDLSHSKKLSLRSLIDHSVVESYGAGGKTCITSRVYPTLAVNNGAHLYVFNNGTQPVT  564

Query  203   LSKLTAWSMKKPTIN  159
                L AWSM  PT+N
Sbjct  565   AESLNAWSMNAPTMN  579



>ref|XP_008387018.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
isoform X1 [Malus domestica]
Length=581

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/555 (58%), Positives = 396/555 (71%), Gaps = 8/555 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +A H V    ++L        +RT+FHFQPPRNW+NDPNGPM + G+YH FYQYNP+GA
Sbjct  29    VEALHNVYPEFQSLAAVKVKQIHRTAFHFQPPRNWINDPNGPMYFGGLYHLFYQYNPEGA  88

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS SKDL+NW A  PA+ PS+P  D+NG WSGSAT LP N P +LYTGVDS+
Sbjct  89    VWGNIVWAHSVSKDLINWEALEPAIYPSKPF-DVNGCWSGSATXLPGNKPIMLYTGVDSQ  147

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             NRQVQN A+P+N SDPYL++W+K   NPL+ P+    INAT+FRDPTTAW G +G+W++L
Sbjct  148   NRQVQNYAIPKNASDPYLRKWIKPDNNPLVIPD--TGINATAFRDPTTAWWG-NGHWKML  204

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVG  1098
             VG K   RG+A LYRSKDFV WV+A HPLHS   +GMWECPDFYPV      GLDTS VG
Sbjct  205   VGGKRKHRGMAHLYRSKDFVHWVKAHHPLHSAPQTGMWECPDFYPVPLVGKLGLDTSKVG  264

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               +KHVLK+SLDE+R++YYT+G Y   +D Y+PDK  VD  SGLRYDYG FYASKTF+D 
Sbjct  265   GDVKHVLKVSLDETRYEYYTVGKYFPEKDTYVPDKELVDGWSGLRYDYGNFYASKTFFDP  324

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRILWGW NES   +  V +GW+G+Q IPR VWL    KQL+QWPV ELE LR  KV
Sbjct  325   AKKRRILWGWANESDTASNDVAKGWAGIQTIPRDVWLSPDGKQLLQWPVVELETLRGKKV  384

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQKGASV  561
              + + +L++GS  EV G++AAQAD+EV F +    KAE+    W+  D Q LC +KG+ +
Sbjct  385   GINNQILQQGSHVEVKGLTAAQADVEVIFSLPSLAKAEEFNPSWSNLDAQTLCGKKGSKI  444

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAF  381
             +GGIGPFGL  LASEN +E+T VFFRVF     + VVLMCS  T SSL     + S+  F
Sbjct  445   QGGIGPFGLLTLASENLEEFTPVFFRVFKAKGRH-VVLMCSXATSSSLQDNLYRPSFAGF  503

Query  380   VDVN-PMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             VDV+    ++LSLR LIDHS+VES+GA GK CITSRVYPT A+   AHLY FNNG   + 
Sbjct  504   VDVDLSHSKKLSLRSLIDHSVVESYGAGGKTCITSRVYPTLAVNNGAHLYVFNNGTQPVT  563

Query  203   LSKLTAWSMKKPTIN  159
                L AWSM  PT+N
Sbjct  564   AESLNAWSMNAPTMN  578



>ref|XP_010480033.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV3 
[Camelina sativa]
Length=593

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/541 (57%), Positives = 403/541 (74%), Gaps = 10/541 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KISWGHSTSKDLVNW  1581
             +  YRT +HFQPPRNWMNDPNGPM+YKG+YH FYQYNP GA +  +I WGHSTS DLVNW
Sbjct  36    DQPYRTGYHFQPPRNWMNDPNGPMIYKGIYHLFYQYNPYGAVWDVRIVWGHSTSVDLVNW  95

Query  1580  RAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYL  1401
                 PA SPSQP+ DING WSGS TILP+  P +LYTG+D    QVQN+AVP N SDPYL
Sbjct  96    TPQPPAFSPSQPS-DINGCWSGSVTILPDGKPVILYTGIDENKSQVQNVAVPVNVSDPYL  154

Query  1400  QEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG-RRGLAILYRSK  1224
              EW K P NPL+ PN  N I+   FRDPTTAW G DG WR++VGS    RRGL +LY+S+
Sbjct  155   LEWSKPPLNPLMTPNAVNGIDPDRFRDPTTAWLGLDGEWRVIVGSSTDERRGLVLLYKSR  214

Query  1223  DFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG-SKIKHVLKISLDESRH  1050
             DF  W Q+  PLH  + +GMWECPDF+PVST+  +G++TS  G  ++K+VLK+SL E+ H
Sbjct  215   DFFNWTQSTTPLHYEDLTGMWECPDFFPVSTTGSDGVETSSFGQDEVKYVLKVSLIETLH  274

Query  1049  DYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLI  870
             DYYTIG+YD  +D Y+PD G V +++  R DYGK+YASKTFYD  K+RRILWGW+NES  
Sbjct  275   DYYTIGSYDREKDLYVPDLGFVQDETAPRLDYGKYYASKTFYDDDKKRRILWGWVNESSP  334

Query  869   DTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVS  690
               + +K+GW+G+Q  PR +WLD++ K+L+QWP++E+E LR  +V   + +L+ GS  +V 
Sbjct  335   AKDDIKKGWAGLQSFPRKIWLDESGKELLQWPIEEIETLRGKQVNWHNKVLEAGSTLQVH  394

Query  689   GISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENR  510
             G++AAQAD+EV FK+ E  KA+ ++  W TDPQ +C Q  +SV+ GIGPFGLKVLAS++ 
Sbjct  395   GVTAAQADVEVLFKVNEIEKADVIDPSW-TDPQKICGQDESSVKSGIGPFGLKVLASKDM  453

Query  509   QEYTAVFFRVFMGNNNNP----VVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLR  342
             +EYT+V+FR+F  N+ N     +VLMCS+Q RSSL+ + DK+++GAFV ++P  + +SLR
Sbjct  454   EEYTSVYFRIFKSNDTNKNTKYLVLMCSNQNRSSLNDENDKSAFGAFVAIDPSHQTISLR  513

Query  341   ILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTI  162
              LIDHSIVES+G  G+ CITSRVYP  AIGE A+L+AFN G  S+ +  L+AWS+K   I
Sbjct  514   TLIDHSIVESYGGGGRKCITSRVYPKLAIGENANLFAFNKGTQSVDVLSLSAWSLKSAQI  573

Query  161   N  159
             N
Sbjct  574   N  574



>ref|XP_006854303.1| hypothetical protein AMTR_s00039p00100360 [Amborella trichopoda]
 gb|ERN15770.1| hypothetical protein AMTR_s00039p00100360 [Amborella trichopoda]
Length=572

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/558 (59%), Positives = 413/558 (74%), Gaps = 16/558 (3%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASHI L+ L  ++P Y N  +RT++HFQPP+NWMN   GPM Y GVYH FYQYNP GA +
Sbjct  23    ASHI-LEELNTMEPTYVNQQHRTTYHFQPPKNWMN---GPMYYNGVYHLFYQYNPYGAVW  78

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNR  1449
             G I W HS S DLVNW+   PA+ P+ P  DI G WSGSATILPN+ P +LYTG+D++ R
Sbjct  79    GNIVWAHSVSTDLVNWQPLEPAIYPTAPF-DIKGCWSGSATILPNHTPVILYTGIDTQGR  137

Query  1448  QVQNLAVPRNPSDPYLQEWVKSPR-NPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
             QVQNLA+P+N SDP L++WVK  + NP+I PN    +NA+SFRDPT+AW G DG+WR+LV
Sbjct  138   QVQNLALPKNLSDPLLRQWVKPAQYNPIIVPN---GLNASSFRDPTSAWLGKDGHWRVLV  194

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVGS  1095
             G+K G+RG+A+LYRS+DFV WV+AKHPLHS + +GMWECPDF+PV      GLDTS+ G 
Sbjct  195   GNKRGKRGMALLYRSRDFVWWVKAKHPLHSSKDTGMWECPDFFPVLKKGQLGLDTSVNGL  254

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +KHVLK+SLD+ +HDYYT+GTY   +D+Y+PD  SVD+ + LRYDYGKFYASKTF+D  
Sbjct  255   HVKHVLKVSLDDLKHDYYTVGTYLPYKDRYVPDNSSVDDGTSLRYDYGKFYASKTFFDGA  314

Query  914   KRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE  735
             K RRILWGW+NES      V +GWSGVQ IPRT+WLDK+ KQLVQWP+ E+E LR  KV+
Sbjct  315   KHRRILWGWMNESDSVNNDVAKGWSGVQAIPRTLWLDKSGKQLVQWPIVEIESLRGKKVD  374

Query  734   MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS---  564
             +   +L  GSV EV G++ AQAD+EVTF++    +A+ ++    T PQ++CS+ G S   
Sbjct  375   IIDKVLGSGSVVEVLGVTTAQADVEVTFELHSLDQADILDSMSLTQPQLVCSKLGCSNTK  434

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
               GG GPFGL VLAS++++E TAVFFR+F    N  VVLMCSD +RSSL +  DKT+YG 
Sbjct  435   QGGGFGPFGLFVLASKDQEERTAVFFRIFKKAGNQHVVLMCSDHSRSSLKEDVDKTAYGG  494

Query  383   FVDVNPM---QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             FVDV+     +  LSLR LIDHS+VESFG  GK CI+SR+YP KA+GE AHLYAFN    
Sbjct  495   FVDVDLAHGPKPTLSLRTLIDHSVVESFGEGGKTCISSRIYPVKALGENAHLYAFNYAPA  554

Query  212   SIKLSKLTAWSMKKPTIN  159
              I +SKL+AW M    IN
Sbjct  555   PITISKLSAWDMSTAKIN  572



>ref|XP_007024492.1| Glycosyl hydrolases family 32 protein isoform 3 [Theobroma cacao]
 gb|EOY27114.1| Glycosyl hydrolases family 32 protein isoform 3 [Theobroma cacao]
Length=490

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/472 (65%), Positives = 386/472 (82%), Gaps = 5/472 (1%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQP-PYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQ  1653
             +G VE +ASH V +NL+  Q     N  YRT +HFQPP+NW+NDPNGPMVYKG+YH FYQ
Sbjct  21    HGVVELEASHHVYKNLQTDQSTASANQPYRTGYHFQPPKNWINDPNGPMVYKGLYHLFYQ  80

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             YNPKGA +G I W HSTSKDLVNW  H PA+ PSQP+ DING WSGSATILP+  PA+LY
Sbjct  81    YNPKGAVWGNIVWAHSTSKDLVNWTPHDPAIYPSQPS-DINGCWSGSATILPDGKPAILY  139

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D +++QVQNLA+P+N SDPYL+EW+KS +NPL+ P   N+INA+SFRDPTTAW GPD
Sbjct  140   TGIDPQDKQVQNLAMPKNLSDPYLREWIKSSKNPLMQPTAQNQINASSFRDPTTAWLGPD  199

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
               WR+++GSK+ R+GLAILY+S+DFV W+QA+ PLHS + +GMWECPDF+PVS    NG+
Sbjct  200   KKWRLIIGSKIHRQGLAILYKSEDFVHWIQAQSPLHSAKDTGMWECPDFFPVSVRGQNGV  259

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             D S+ G  +KHVLK+SLD+++H+YYT+G+YD V+D Y PDKGSV++DSGLRYDYGKFYAS
Sbjct  260   DISVNGPFVKHVLKVSLDDTKHEYYTLGSYDIVKDIYTPDKGSVESDSGLRYDYGKFYAS  319

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+D+ K RRILWGWINES    + VK+GW+GVQ IPR +WL K+ KQLVQWP+ E++K
Sbjct  320   KTFFDTAKHRRILWGWINESSSVHDDVKKGWAGVQAIPRKLWLSKSGKQLVQWPIVEIQK  379

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQ  576
             LRSN + +PS +LK GS  EVSG++AAQAD++++FK+ +F KAE ++  W T+PQ+LCSQ
Sbjct  380   LRSNHLRLPSKLLKGGSEIEVSGVTAAQADVDISFKVTDFEKAEVLKPSW-TNPQLLCSQ  438

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSS  420
             +GASV+GG+GPFGL VLASE  +E TAVFFR+F G N   VVLMCSDQ+RSS
Sbjct  439   QGASVKGGLGPFGLLVLASEGLKENTAVFFRIFKGQNKY-VVLMCSDQSRSS  489



>ref|XP_010912309.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 3-like 
isoform X2 [Elaeis guineensis]
Length=576

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/554 (57%), Positives = 397/554 (72%), Gaps = 11/554 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
               ASH+V  +L+ LQ P+ N  +RT +HFQPPRNWMN   GPM Y GVYHFFYQYNPKGA
Sbjct  30    VDASHVVYPHLQNLQVPFVNPLWRTGYHFQPPRNWMN---GPMYYNGVYHFFYQYNPKGA  86

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S D++NW+A  PA+ PS+P  DING WSGSATILP + P +LYTGVD  
Sbjct  87    VWGNIVWAHSVSVDMINWKALEPAIYPSKPF-DINGTWSGSATILPGDSPVILYTGVDRA  145

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
               Q+QN+A P+N SDPYL+EW+K   NP+I P     +NA++ RDPTTAW GPD +WRI 
Sbjct  146   GNQLQNIAFPKNLSDPYLREWIKPDYNPIIFPV---GVNASAIRDPTTAWLGPDKHWRIT  202

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG  1098
             +GS+  RRG+A LYRS+DFV W++AKHPLHS + +GMWECPDF+PV+     GLDTS  G
Sbjct  203   IGSRRARRGMAYLYRSRDFVHWIKAKHPLHSSKDTGMWECPDFFPVALEGKKGLDTSAYG  262

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               +KHVLK+SLD +R +YYT+G Y H  DKY+PD  S D+ +GLR DYG FYASKTFYD 
Sbjct  263   EGLKHVLKVSLDATRFEYYTVGKYHHDHDKYVPDVTSPDDSTGLRLDYGNFYASKTFYDP  322

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRILWGW NES        +GWSG+Q IPR +WLD   +Q+VQWP++ELE LR NKV
Sbjct  323   AKQRRILWGWSNESDRAANETTKGWSGIQAIPRVLWLDSNHRQVVQWPIEELESLRKNKV  382

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              +    +K G   EV GI  +QAD+EV F +    KAE     W T+PQ LC  K A V+
Sbjct  383   YIHDKEVKTGHYFEVKGIQTSQADVEVMFDVSSLEKAEAWNPAW-TNPQELCGIKKAEVK  441

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             GG+GPFGL VLAS   +E TAVFFRVF   N + VVLMC D TRS+L     + ++  FV
Sbjct  442   GGVGPFGLLVLASARMEEKTAVFFRVFKAQNKH-VVLMCHDPTRSALVPNVYEPTFAGFV  500

Query  377   DVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             D+N  + +++SLR LID+S+VESFGA GK CITSRVYPT AIG  AHL+ FNNG+ +IK+
Sbjct  501   DINIAKTKKISLRSLIDNSVVESFGAGGKTCITSRVYPTLAIGSDAHLFVFNNGLENIKV  560

Query  200   SKLTAWSMKKPTIN  159
             S+L AW ++KP +N
Sbjct  561   SELKAWEIRKPLMN  574



>ref|XP_006297319.1| hypothetical protein CARUB_v10013339mg [Capsella rubella]
 gb|EOA30217.1| hypothetical protein CARUB_v10013339mg [Capsella rubella]
Length=570

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/551 (58%), Positives = 412/551 (75%), Gaps = 17/551 (3%)
 Frame = -1

Query  1799  IVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA--SFG  1626
             +VL     +     N  YRT +HFQPP+NWMN   GPMVYKG+YH FYQ+NP GA     
Sbjct  25    VVLDAFHHVPNKIKNQPYRTGYHFQPPKNWMN---GPMVYKGIYHLFYQWNPNGAVMEVN  81

Query  1625  KISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQ  1446
                WGH+TS DL+NW  H PA+ PS+P+ DING WSGS TILP+  P +LYTG D  NRQ
Sbjct  82    DTVWGHATSTDLINWITHSPAIKPSRPS-DINGCWSGSVTILPDGKPVILYTGNDRYNRQ  140

Query  1445  VQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGS  1266
             VQNLA P+N +DPYL+ W KSP NPL+ PN  N IN+T+FRDPTTAW G DG WRI  GS
Sbjct  141   VQNLAKPKNLTDPYLRHWTKSPENPLVTPNAVNHINSTAFRDPTTAWIGRDGQWRITTGS  200

Query  1265  KVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSK-  1092
             + GRRGLAIL+ S+DFVRW ++  PLH  +G+GMWECPDF+PV+ S  +G+DT+    K 
Sbjct  201   QEGRRGLAILHTSRDFVRWKKSPKPLHYHDGTGMWECPDFFPVARSDSHGVDTTTFREKM  260

Query  1091  IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLK  912
             IKHVLK+SL ++  DYYTIGTYD VRD Y+PD G V + +  RYDYGKFYASKTFYDS+ 
Sbjct  261   IKHVLKVSLSDTYFDYYTIGTYDQVRDVYVPDNGFVQDKTAPRYDYGKFYASKTFYDSVN  320

Query  911   RRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEM  732
             +RRILWGW+NES  + +   +GW+G+Q IPR VWL ++ K+LVQWPV+E+E+LR+ +V+ 
Sbjct  321   QRRILWGWVNESSPEKDNANKGWAGLQAIPRKVWLGESGKRLVQWPVKEIERLRTTQVKW  380

Query  731   PSTMLK-KGSVSEVSGISAAQADMEVTFKI--MEFGKAEKMEERWTTDPQVLCSQKGASV  561
              + +LK  G+V EV G++A+QAD+EV FK+  ++  KA+ +E  W TDPQ++CS K AS 
Sbjct  381   GNKVLKGGGTVMEVHGVTASQADVEVFFKVSGLDLEKADVIEPGW-TDPQMICSLKNAS-  438

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVF--MGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
               G+GPFGL V+AS+N +EYT+V+FR+F    ++   VV+MCSDQ+RSSL+K  DKT+YG
Sbjct  439   -SGLGPFGLMVMASKNLEEYTSVYFRIFKVREDSKEHVVVMCSDQSRSSLEKGNDKTTYG  497

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
             AFVD++P Q  LSLR LID+SIVE+FG KGK CITSRVYP  A+GE+ HL+AFN G  ++
Sbjct  498   AFVDISPYQ-TLSLRTLIDNSIVENFGGKGKACITSRVYPKLAVGERTHLFAFNKGSQNV  556

Query  206   KLSKLTAWSMK  174
              +  L+AWSMK
Sbjct  557   DVLSLSAWSMK  567



>ref|XP_010654109.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Vitis vinifera]
Length=572

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/556 (56%), Positives = 405/556 (73%), Gaps = 9/556 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             GVE   SH +    + +        +RT +HFQPPRNW+NDPNGPM Y G+YH FYQYNP
Sbjct  25    GVE--GSHKIHHEYQCVPDTKVRQVHRTGYHFQPPRNWINDPNGPMYYNGIYHLFYQYNP  82

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
             KGA +G I W HS S++L++W A  PA+ PS+P  DING WSGSATILP N PA+LYTG+
Sbjct  83    KGAVWGNIVWAHSVSRNLIDWEALEPAIYPSKPF-DINGCWSGSATILPGNKPAILYTGI  141

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             D++ RQVQN+A P N SDPYL++WVK   NPL+ P+    +NA++FRDPTTAWR  +G+W
Sbjct  142   DTQQRQVQNIAFPANLSDPYLRKWVKPDSNPLVVPD--VGMNASTFRDPTTAWR-VNGHW  198

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTS  1107
             R+LVG++   RG+  LYRS+DF+ W+++KHPLHS + +GMWECPDF+PVS  S  GLDTS
Sbjct  199   RMLVGARKKHRGIVYLYRSRDFMTWIKSKHPLHSAQNTGMWECPDFFPVSLYSERGLDTS  258

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
             + G  ++HVLK+SLD +R++YYTIG Y    D+YIP   S D  SGLRYDYG FYASKTF
Sbjct  259   VTGKNVRHVLKVSLDRTRYEYYTIGRYYPEIDRYIPGNTSADGWSGLRYDYGNFYASKTF  318

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +D+ ++RRILWGW NES        +GW+G+Q IPRT+WLDK +KQL+QWP++EL  LR 
Sbjct  319   FDAEQKRRILWGWANESDTADNDTAKGWAGIQTIPRTLWLDKGKKQLLQWPIEELNTLRG  378

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
              K+++ +  LK G   E++GI+AAQAD+EVTF +    KAE+ +  W  + Q LC  KG+
Sbjct  379   QKIQVRNQELKIGENVEITGITAAQADVEVTFSLPSLDKAEEFDPSW-VNAQDLCGMKGS  437

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
             +V+GG+GPFGL  LASE+ +EYT VFFR+F     + VVLMCSD   SSL  +  K S+ 
Sbjct  438   TVQGGVGPFGLLTLASEHLEEYTPVFFRIFKAKGKH-VVLMCSDAKSSSLRTELYKPSFA  496

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
              FVDV+     LSLR LIDHS+VESFGA GK CITSRVYPT A+ +KAHLYAFNNG  ++
Sbjct  497   GFVDVDLKDGMLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAVSKKAHLYAFNNGTEAV  556

Query  206   KLSKLTAWSMKKPTIN  159
              + KL AW+M +P +N
Sbjct  557   TIKKLNAWTMHRPQMN  572



>ref|XP_010931117.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 3-like 
[Elaeis guineensis]
Length=575

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/554 (56%), Positives = 399/554 (72%), Gaps = 8/554 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
               ASH V  +L++LQ P  +   +T +HFQPPRNWMNDPNGPM YKG+YH FYQYNPKGA
Sbjct  26    VDASHAVYPHLQSLQVPAVDSLLKTGYHFQPPRNWMNDPNGPMYYKGIYHLFYQYNPKGA  85

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S D++NW    PA+ PS+ + DING WSGSATILP + P +LYTG+D  
Sbjct  86    VWGNIVWAHSISIDMMNWIPLEPAIYPSK-SFDINGTWSGSATILPGSKPVILYTGIDGA  144

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
              RQVQN+A P++ SDPYL+EW K   NP+I P     +NA++FRDPTTAW GPDG WR+ 
Sbjct  145   GRQVQNVAFPKDLSDPYLREWTKPDYNPIIFPC---GVNASAFRDPTTAWLGPDGIWRVT  201

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVG  1098
             VGSK  +RG+A L+RSKDFVRW +AKHPLHS + +GMWECPDF+PVS     GLDTS  G
Sbjct  202   VGSKREKRGMAYLFRSKDFVRWTKAKHPLHSSKDTGMWECPDFFPVSPEGRLGLDTSARG  261

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               +KHVLK+SLD +R +YYT+G YD+ +D Y+PD  S DN +GLR+DYG FYASKTF+D 
Sbjct  262   KGLKHVLKVSLDLTRFEYYTVGKYDYAKDTYVPDNTSPDNSTGLRFDYGNFYASKTFFDP  321

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             +K RRILWGW NES        +GW+G+Q IPR +WLD  ++Q+V+WP++ELE LR+ + 
Sbjct  322   VKHRRILWGWSNESDRAQNETIKGWAGIQTIPRVLWLDSNQRQVVEWPIEELESLRTKQA  381

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              +   ++K  +  EV GI  +QAD+EVTF +    +AE  +  W TDPQ LC  K A V+
Sbjct  382   YIHDKLVKSANYFEVEGIQTSQADVEVTFDVSSLERAENFDPAW-TDPQKLCGLKDAEVK  440

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             GG+GPFGL VLAS   +E TAVFFRVF   N + VVLMC D  RSSL  +  + ++  FV
Sbjct  441   GGVGPFGLLVLASAKMEEKTAVFFRVFKAQNKH-VVLMCQDPKRSSLVPRVYEPTFAGFV  499

Query  377   DVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             DV+  + + +SLR LID+S+VESFGA GK CITSRVYPT AIG  AHL+ FNNG+  IK+
Sbjct  500   DVDIAKTKRISLRSLIDNSVVESFGAGGKTCITSRVYPTLAIGPNAHLFVFNNGLEDIKV  559

Query  200   SKLTAWSMKKPTIN  159
             S+L AW ++ P +N
Sbjct  560   SELKAWEIRTPLMN  573



>gb|AAG50837.1|AC073944_4 beta-fructofuranosidase, putative [Arabidopsis thaliana]
Length=591

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/554 (57%), Positives = 404/554 (73%), Gaps = 14/554 (3%)
 Frame = -1

Query  1793  LQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KIS  1617
             + +LEA      N  YRT +HFQP +NWMN   GPM+YKG+YH FYQYNP GA +  +I 
Sbjct  23    ITDLEASSHQDLNQPYRTGYHFQPLKNWMN---GPMIYKGIYHLFYQYNPYGAVWDVRIV  79

Query  1616  WGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQN  1437
             WGHSTS DLVNW +  PA +PSQP+ DING WSGS TILPN  P +LYTG+D    QVQN
Sbjct  80    WGHSTSVDLVNWISQPPAFNPSQPS-DINGCWSGSVTILPNGKPVILYTGIDQNKGQVQN  138

Query  1436  LAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG  1257
             +AVP N SDPYL+EW K P+NPL+  N  N IN   FRDPTTAW G DG WR++VGS   
Sbjct  139   VAVPVNISDPYLREWSKPPQNPLMTTNAVNGINPDRFRDPTTAWLGRDGEWRVIVGSSTD  198

Query  1256  -RRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSK-IK  1086
              RRGLAILY+S+DF  W Q+  PLH  + +GMWECPDF+PVS T  +G++TS VG   IK
Sbjct  199   DRRGLAILYKSRDFFNWTQSMKPLHYEDLTGMWECPDFFPVSITGSDGVETSSVGENGIK  258

Query  1085  HVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRR  906
             HVLK+SL E+ HDYYTIG+YD  +D Y+PD G V N+S  R DYGK+YASKTFYD +K+R
Sbjct  259   HVLKVSLIETLHDYYTIGSYDREKDVYVPDLGFVQNESAPRLDYGKYYASKTFYDDVKKR  318

Query  905   RILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPS  726
             RILWGW+NES    + +++GWSG+Q  PR +WLD++ K+L+QWP++E+E LR  +V    
Sbjct  319   RILWGWVNESSPAKDDIEKGWSGLQSFPRKIWLDESGKELLQWPIEEIETLRGQQVNWQK  378

Query  725   TMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIG  546
              +LK GS  +V G++AAQAD+EV+FK+ E  KA+ +E  W TDPQ +CSQ   SV  G+G
Sbjct  379   KVLKAGSTLQVHGVTAAQADVEVSFKVKELEKADVIEPSW-TDPQKICSQGDLSVMSGLG  437

Query  545   PFGLKVLASENRQEYTAVFFRVFMGNNNNP-----VVLMCSDQTRSSLDKKTDKTSYGAF  381
             PFGL VLAS + +EYT+V+FR+F  N++       VVLMCSDQ+RSSL+ + DK+++GAF
Sbjct  438   PFGLMVLASNDMEEYTSVYFRIFKSNDDTNKKTKYVVLMCSDQSRSSLNDENDKSTFGAF  497

Query  380   VDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             V ++P  + +SLR LIDHSIVES+G  G+ CITSRVYP  AIGE A+L+ FN G  S+ +
Sbjct  498   VAIDPSHQTISLRTLIDHSIVESYGGGGRTCITSRVYPKLAIGENANLFVFNKGTQSVDI  557

Query  200   SKLTAWSMKKPTIN  159
               L+AWS+K   IN
Sbjct  558   LTLSAWSLKSAQIN  571



>ref|XP_004241885.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV3-like 
isoform X1 [Solanum lycopersicum]
Length=531

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/533 (58%), Positives = 396/533 (74%), Gaps = 9/533 (2%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHI  1569
             YRT++HFQPP+NW+NDPNGPM+YKG+YH FYQYNP+ A +G I+WGHSTS DLVNW  H 
Sbjct  5     YRTAYHFQPPKNWINDPNGPMIYKGIYHLFYQYNPESAEWGNIAWGHSTSTDLVNWTIHP  64

Query  1568  PALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWV  1389
             PAL PS  A DING WSGSATIL +  PA+LYTG +S+  Q+QNLAVP++PSDPYL EWV
Sbjct  65    PALLPSD-AYDINGCWSGSATILQDGTPAILYTGGNSQKVQLQNLAVPKDPSDPYLVEWV  123

Query  1388  KSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRW  1209
             KSP NP++ PN   K    SFRDPTTAW GPDG WR+++G++   RG A+LY+S+DF+RW
Sbjct  124   KSPDNPIMIPNEDEK---ESFRDPTTAWLGPDGIWRVVIGNERENRGTAVLYKSEDFIRW  180

Query  1208  VQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYYTIG  1032
              +A+ PLHS   + MWECPDF+PV     NGLD S + S IKHVLK S+  S  DYYT+G
Sbjct  181   TEAERPLHSSSETTMWECPDFFPVLVDGENGLDISEIFSGIKHVLKNSVARSFVDYYTVG  240

Query  1031  TYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVK  852
              YDH  D Y PD+GSVDN+SGLR DYG++YASK+F+DS K+RRI   W+NES      + 
Sbjct  241   AYDHHNDVYTPDEGSVDNESGLRLDYGRYYASKSFFDSEKKRRIFIAWVNESTSKEIDLI  300

Query  851   QGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQ  672
             +GWSG+Q  PR +WLDK  KQLVQWPV+E+E LR+NKV++ +  L+ G   E+ G++AAQ
Sbjct  301   KGWSGLQSFPRKIWLDKGGKQLVQWPVEEIEMLRTNKVDLQNITLEAGLKREICGVTAAQ  360

Query  671   ADMEVTFK--IMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYT  498
             AD+E++F   I    +AE +E  W T+PQ + +Q G+    G+GPFGL VLAS   +EYT
Sbjct  361   ADVEISFSIPIAVLEQAEVLESNW-TNPQEIANQSGSLANTGVGPFGLLVLASNKIEEYT  419

Query  497   AVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIV  318
             A+FFR+F   N+  VVLM  DQ RSS+  + DKT+YGAF+D++P+ E+LSLR LIDHSIV
Sbjct  420   AIFFRIFK-KNDKFVVLMGCDQKRSSVGLEYDKTNYGAFLDIDPLTEKLSLRTLIDHSIV  478

Query  317   ESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             ESFG  GK CIT+R YPT AI + AH++ FNNG   + +S L+AWS+ +  IN
Sbjct  479   ESFGGGGKACITTRAYPTLAINDNAHIFVFNNGSQHVDISTLSAWSLNQAHIN  531



>ref|XP_009397581.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 3-like 
[Musa acuminata subsp. malaccensis]
Length=585

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/556 (55%), Positives = 397/556 (71%), Gaps = 10/556 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              + SHIV + L+++ P   N   +  +HF+  RNW+NDPNGPM YKG+YHFFYQYNP G+
Sbjct  31    VEPSHIVYEELQSVSPALVNDELKPRYHFRSARNWLNDPNGPMYYKGIYHFFYQYNPYGS  90

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S DL+NW+A  PA+ PS+P  DI G WSGSAT+LP + P +LYTGVD  
Sbjct  91    VWGNIVWAHSVSTDLINWKALAPAIYPSEPF-DIYGCWSGSATVLPGDKPVILYTGVDPE  149

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
              RQVQN+A P N SDPYL+EW K   NP+I P     +NA++FRDPTTAW  P+ +W ++
Sbjct  150   QRQVQNIAFPANLSDPYLREWTKPDYNPVIPPEL--GVNASAFRDPTTAWYAPNKHWTLV  207

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG  1098
             VGSK  RRG+AILYRSKDFV W++AKHPLHS +  GMWECPDF+PV+     GLDTS  G
Sbjct  208   VGSKRDRRGMAILYRSKDFVHWIKAKHPLHSSKDIGMWECPDFFPVAAKGRQGLDTSACG  267

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               +KHVLK+SLD +R++YYT+G Y H  DKY+PD  S D+ +GLRYDYG FYASKTFYD 
Sbjct  268   DGVKHVLKVSLDATRYEYYTLGKYFHYMDKYVPDVTSTDDHTGLRYDYGNFYASKTFYDP  327

Query  917   LKRRRILWGWINESLIDTEYVKQ--GWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
              K+RRILWGW NES  D+ Y  +  GW+GVQ IPR++WLD + +QLVQWP++E E LR  
Sbjct  328   AKKRRILWGWANES--DSAYTDKDKGWAGVQAIPRSIWLDDSGRQLVQWPIEEFETLRDK  385

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
              + + +  +  G   E+  I  AQAD+EVTF +    KAE+ +  +  D +  C++K A 
Sbjct  386   HIFVKNKNIPSGGFLEIKEIQTAQADVEVTFDVASLEKAEEFDPYYVDDAEAFCAKKTAE  445

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
              +GG+GPFGL VLAS NR+E TAVFFR+F   +   +VLMC D TRSS  + T K ++  
Sbjct  446   TKGGVGPFGLLVLASANREERTAVFFRIFKAQSKY-MVLMCHDPTRSSKRESTYKPTFAG  504

Query  383   FVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
             FVD++  +  ++SLR LIDHS+VESFGA GK CITSRVYP+ AIGEKAHL+ FNNG   +
Sbjct  505   FVDIDVTKTRKISLRSLIDHSVVESFGAGGKTCITSRVYPSVAIGEKAHLFVFNNGAQDV  564

Query  206   KLSKLTAWSMKKPTIN  159
             KLS+L AW + +P +N
Sbjct  565   KLSELNAWEITEPEMN  580



>ref|XP_011094304.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
isoform X1 [Sesamum indicum]
 ref|XP_011094305.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
isoform X2 [Sesamum indicum]
Length=590

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/565 (57%), Positives = 403/565 (71%), Gaps = 20/565 (4%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYP-NHTY---RTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
              +ASH V  NL++L  P P NH Y   RT +HFQP +NW+NDPNGPM Y G+YH FYQYN
Sbjct  25    VEASHEVFLNLQSLSLPAPLNHVYHLHRTRYHFQPRKNWINDPNGPMYYNGIYHLFYQYN  84

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKDLVNW+    A+ PS+P  D  G WSGSAT+LP N P +LYTG
Sbjct  85    PKGAVWGNIVWAHSVSKDLVNWKKLEHAIYPSKPF-DQYGCWSGSATVLPGNKPVILYTG  143

Query  1466  -VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
              VD +  QVQN AVP N SDPYL+ W+K   NPLI  +++  +N T+FRDPTTAW G DG
Sbjct  144   IVDDKQTQVQNYAVPANLSDPYLRLWIKPDNNPLIVADNW--VNKTAFRDPTTAWFGKDG  201

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
              WR+ +G +   RG+A LYRSKDF+RW +AKHPLHS  G+G WECPDF+PV  +  NGLD
Sbjct  202   KWRVTIGGRRKHRGMAFLYRSKDFMRWTKAKHPLHSAAGTGNWECPDFFPVQVNGKNGLD  261

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS+ G  +K+V K+SLD +R++YYTIGTYD  +DKYIP+K  +D  +GLRYDYG FYASK
Sbjct  262   TSVTGRNVKYVFKVSLDVTRYEYYTIGTYDIKKDKYIPEKDMIDGWNGLRYDYGNFYASK  321

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             +F+D  K RRILWGW NES      VK+GW+G+Q IPRTV LD + KQL+QWPV+ELE L
Sbjct  322   SFFDPGKNRRILWGWANESDTTDNDVKKGWAGIQLIPRTVVLDPSGKQLLQWPVEELETL  381

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQ  576
             R  KVE+ +  L KG   E+ GI+AAQ+D++VTF      KAE  +  W   D Q LCSQ
Sbjct  382   RGKKVELSNQNLNKGEKIEIKGITAAQSDVDVTFSFNSLDKAETFDPSWDRYDAQKLCSQ  441

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL-------  417
             KG++V GG+GPFGL  LASEN +EYT VFFRVF   + + +VLMCSD +RS+L       
Sbjct  442   KGSTVEGGLGPFGLLTLASENLEEYTPVFFRVFKAQDKH-LVLMCSDASRSTLMNGNSSM  500

Query  416   --DKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKA  243
                K   + S+  FV+V+   ++LSLR LIDHS+VESFGA G+ CITSRVYP  A+ +KA
Sbjct  501   KDGKDAYRPSFAGFVNVDLNDKKLSLRSLIDHSVVESFGAGGRTCITSRVYPILAVCDKA  560

Query  242   HLYAFNNGVHSIKLSKLTAWSMKKP  168
             HLYAFNNG  ++K+  L AWSM +P
Sbjct  561   HLYAFNNGTETVKIDTLKAWSMNRP  585



>ref|XP_006430160.1| hypothetical protein CICLE_v10013701mg [Citrus clementina]
 gb|ESR43400.1| hypothetical protein CICLE_v10013701mg [Citrus clementina]
Length=574

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/555 (57%), Positives = 403/555 (73%), Gaps = 14/555 (3%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH +    ++L        +RT+FHFQPP++W+N   GPM YKGVYH FYQYNPKGA
Sbjct  25    VEASHKIYPKFQSLAAVKVKQLHRTAFHFQPPKHWIN---GPMYYKGVYHLFYQYNPKGA  81

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS SKDL+NW A  PAL PS+P  DING WSGSAT+LP N P +LYTG+D +
Sbjct  82    VWGNIVWAHSVSKDLINWEALEPALYPSKPF-DINGCWSGSATVLPGNKPIILYTGIDYK  140

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
              RQVQN AVP NPSDPYL++W+K   NP++ P     +NA++FRDPTTAW   DG+WR+L
Sbjct  141   ERQVQNYAVPANPSDPYLRKWIKPDNNPVVFPG--PDVNASAFRDPTTAWWSNDGHWRML  198

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG  1098
             VGS+   RG+A LYRS+DF++W +AK P+HS   +GMWECPDFYPVS S  NGLDTS  G
Sbjct  199   VGSRRKHRGIAYLYRSRDFMKWTKAKQPIHSLANTGMWECPDFYPVSISGKNGLDTSFAG  258

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
                K+V K+SLD +R+DYYTIGTY+  +D+Y+PDK SVD   GLRYDYG FYASKTF+DS
Sbjct  259   GNEKYVFKVSLDLTRYDYYTIGTYNRDKDRYVPDKDSVDGWRGLRYDYGNFYASKTFFDS  318

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K RRILWGW NES    + + +GW+GVQ IPR VWLD   KQL+QWP++ELE LR   V
Sbjct  319   RKNRRILWGWANESDSTFDDMAKGWAGVQTIPREVWLDGGTKQLLQWPIEELETLRGKNV  378

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERW-TTDPQVLCSQKGASV  561
              + +  LKKG   EV G++AAQAD+EVTFK+    KA+K +  W   D + LC + G+ V
Sbjct  379   HISNQELKKGHHVEVKGVTAAQADVEVTFKLPSLDKADKFDPSWKNLDAEHLCGKIGSKV  438

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD---KTSY  390
             +GG+GPFGL  LAS+N +E+T VFFR+F   + + +VLMCSD + S+L  KT+   K S+
Sbjct  439   QGGVGPFGLLTLASKNLEEFTPVFFRIFKDGHKH-LVLMCSDASSSTL--KTEGLYKPSF  495

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
               FV+V+   + LSLR LIDHS+VESFGA GK CITSRVYPT A+ + AH+YAFNNG  +
Sbjct  496   AGFVNVDLSDKRLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAVFDDAHMYAFNNGTET  555

Query  209   IKLSKLTAWSMKKPT  165
             + + KL AWSMKKP 
Sbjct  556   VTVEKLNAWSMKKPA  570



>ref|XP_009758023.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Nicotiana sylvestris]
Length=573

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/543 (59%), Positives = 401/543 (74%), Gaps = 14/543 (3%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             +  YRT+FHFQP + WMNDPNGPM+Y G+YHFFYQYNP  A FG I WGHSTS DLVNW 
Sbjct  35    DQIYRTAFHFQPAKYWMNDPNGPMIYMGIYHFFYQYNPYDAQFGNIVWGHSTSTDLVNWT  94

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
                PAL  S+P  D  G +SGS TIL    PA+LYTGVD  + QVQNLAVP+N  DPYL 
Sbjct  95    PQPPALLRSEP-YDFKGCFSGSTTILSGGKPAILYTGVDFSDIQVQNLAVPKNLLDPYLI  153

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP-DGNWRILVGSKVGRRGLAILYRSKD  1221
             EWVKSP NP+I PN  NKI+  +FRDPTTAW  P DG WR++VG+K    G+ +LY+SK+
Sbjct  154   EWVKSPFNPIITPNSVNKIDGQNFRDPTTAWLNPTDGYWRMVVGNKKNDTGIGLLYKSKN  213

Query  1220  FVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGSKIKHVLKISLDESRHDY  1044
             F+ W+Q + PLH    SGM ECPDF+PVST S  GLDTS +G+ +KHV K S+  S  DY
Sbjct  214   FIDWIQTEQPLHFLNNSGMLECPDFFPVSTISQIGLDTSSMGTNVKHVFKASVANS--DY  271

Query  1043  YTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDT  864
             YTIG YD  +D +IPD  S+D   G RYDYGK+YASKTF+DS   RRIL+GW+NES+ + 
Sbjct  272   YTIGKYDPNKDIFIPDNESLDIGLGFRYDYGKYYASKTFFDSATNRRILFGWVNESVNNL  331

Query  863   EYVK--QGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR-SNKVEMPSTMLKKGSVSEV  693
             + +   +GW+G+QGIPR +WL K+  QL+QWP+ E+EKLR +N V   +T+L  GSV E+
Sbjct  332   DDINSIRGWAGLQGIPRRIWLQKSGNQLLQWPIVEIEKLRMNNPVVEGNTVLMSGSVREI  391

Query  692   SGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASEN  513
             SG++A QAD+E++F      KAE  E  W T+PQ +CS KGA+V+GGIGPFGL VLAS++
Sbjct  392   SGVTATQADVEISFAAKTLEKAEIWEANW-TNPQKICSIKGATVKGGIGPFGLLVLASDD  450

Query  512   RQEYTAVFFRVFMG-NNNNPVVLMCSDQTRSSL---DKKTDKTSYGAFVDVNPMQEELSL  345
              QEYTA+FFR+F G NNNN +VLMCSDQ+RSSL       DKT+YGAF++V+P+QE+LSL
Sbjct  451   MQEYTAIFFRIFKGENNNNFIVLMCSDQSRSSLHLPSSDYDKTTYGAFLNVDPVQEKLSL  510

Query  344   RILIDHSIVESFGAKGKVCITSRVYPTK-AIGEKAHLYAFNNGVHSIKLSKLTAWSMKKP  168
             R LIDHSIVESFG +GK CIT+RVYPT  A+    HLY FNNG  ++ +S LTAWSMK  
Sbjct  511   RTLIDHSIVESFGGEGKACITARVYPTNLAVDGGTHLYVFNNGSENVDISNLTAWSMKTA  570

Query  167   TIN  159
              IN
Sbjct  571   QIN  573



>gb|KFK38674.1| hypothetical protein AALP_AA3G145300 [Arabis alpina]
Length=587

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/540 (58%), Positives = 402/540 (74%), Gaps = 12/540 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KISWGHSTSKDLVNW  1581
             N  YRT +HFQPP+NWMNDPNGPM+YKG+YH FYQYNP GA +  +I WGHSTS DLVNW
Sbjct  34    NQPYRTGYHFQPPKNWMNDPNGPMIYKGIYHIFYQYNPYGAVWDERIVWGHSTSLDLVNW  93

Query  1580  RAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYL  1401
                 PA +PSQP+ DING WSGS TILPNN P +LYTG+D    QVQN+AVP N +DP+L
Sbjct  94    TPQPPAFNPSQPS-DINGCWSGSVTILPNNTPVILYTGIDQNKSQVQNVAVPVNITDPFL  152

Query  1400  QEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG-RRGLAILYRSK  1224
             +EW K   NPLI     N I    FRDPTTAW G DG WR++VGS    RRGLAILY+SK
Sbjct  153   KEWSKPTLNPLITTP--NGIKPDRFRDPTTAWLGHDGEWRVIVGSSTDDRRGLAILYKSK  210

Query  1223  DFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSKIKHVLKISLDESRHD  1047
             DF++W Q+  PLH  + +GMWECPDF+PVS T    +DTSLV S++K+VLK+SL E+ HD
Sbjct  211   DFLKWTQSVKPLHYQDLTGMWECPDFFPVSITGSEVVDTSLV-SEVKYVLKVSLIETLHD  269

Query  1046  YYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLID  867
             YYTIG+YD+ +D Y+PD G V N S  R DYGKFYASKTF+D +K+RRILWGW+NES   
Sbjct  270   YYTIGSYDYEKDVYVPDLGFVQNGSAPRLDYGKFYASKTFFDDVKKRRILWGWVNESSPA  329

Query  866   TEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSG  687
              + +++GWSG+Q  PR +WLD++ K+L+QWP++E+E LR ++V   + +LK  S  +V G
Sbjct  330   KDDIEKGWSGLQSFPRKIWLDESGKELLQWPIEEIETLRGSQVNWHNRVLKAESSLQVHG  389

Query  686   ISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQ  507
             ++A QAD++VTFK+ +  KA+ +E  W TDPQ +CSQ  +SV+ G+GPFGL VLAS + +
Sbjct  390   VTATQADVDVTFKVKDLEKADVIEPSW-TDPQKICSQGVSSVKSGLGPFGLMVLASNDME  448

Query  506   EYTAVFFRVFMGNNNNP----VVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRI  339
             E T V+FR+F  N+ N     VVLMCSDQ+RSSL+++ DK ++GAF+ ++P  + +SLR 
Sbjct  449   ESTLVYFRIFKSNDTNTNTKYVVLMCSDQSRSSLNEENDKATFGAFMAIDPSHQTVSLRT  508

Query  338   LIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             LIDHSIVES+G  GKVCITSRVYP  AIGE A+L+ FN G  S+ +  L+AWS+K   IN
Sbjct  509   LIDHSIVESYGGGGKVCITSRVYPKLAIGENANLFVFNKGTQSVDVLSLSAWSLKSAQIN  568



>ref|XP_011094306.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
isoform X3 [Sesamum indicum]
Length=592

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/567 (57%), Positives = 404/567 (71%), Gaps = 22/567 (4%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYP-NHTY---RTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
              +ASH V  NL++L  P P NH Y   RT +HFQP +NW+NDPNGPM Y G+YH FYQYN
Sbjct  25    VEASHEVFLNLQSLSLPAPLNHVYHLHRTRYHFQPRKNWINDPNGPMYYNGIYHLFYQYN  84

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKDLVNW+    A+ PS+P  D  G WSGSAT+LP N P +LYTG
Sbjct  85    PKGAVWGNIVWAHSVSKDLVNWKKLEHAIYPSKPF-DQYGCWSGSATVLPGNKPVILYTG  143

Query  1466  -VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
              VD +  QVQN AVP N SDPYL+ W+K   NPLI  +++  +N T+FRDPTTAW G DG
Sbjct  144   IVDDKQTQVQNYAVPANLSDPYLRLWIKPDNNPLIVADNW--VNKTAFRDPTTAWFGKDG  201

Query  1289  NWRILVGSKVGR--RGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNG  1119
              WR+ +G +  R  RG+A LYRSKDF+RW +AKHPLHS  G+G WECPDF+PV  +  NG
Sbjct  202   KWRVTIGGRRKRKHRGIAYLYRSKDFMRWTKAKHPLHSAAGTGNWECPDFFPVQVNGKNG  261

Query  1118  LDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             LDTS+ G  +K+V K+SLD +R++YYTIGTYD  +DKYIP+K  +D  +GLRYDYG FYA
Sbjct  262   LDTSVTGRNVKYVFKVSLDVTRYEYYTIGTYDIKKDKYIPEKDMIDGWNGLRYDYGNFYA  321

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SK+F+D  K RRILWGW NES      VK+GW+G+Q IPRTV LD + KQL+QWPV+ELE
Sbjct  322   SKSFFDPGKNRRILWGWANESDTTDNDVKKGWAGIQLIPRTVVLDPSGKQLLQWPVEELE  381

Query  758   KLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLC  582
              LR  KVE+ +  L KG   E+ GI+AAQ+D++VTF      KAE  +  W   D Q LC
Sbjct  382   TLRGKKVELSNQNLNKGEKIEIKGITAAQSDVDVTFSFNSLDKAETFDPSWDRYDAQKLC  441

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL-----  417
             SQKG++V GG+GPFGL  LASEN +EYT VFFRVF   + + +VLMCSD +RS+L     
Sbjct  442   SQKGSTVEGGLGPFGLLTLASENLEEYTPVFFRVFKAQDKH-LVLMCSDASRSTLMNGNS  500

Query  416   ----DKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGE  249
                  K   + S+  FV+V+   ++LSLR LIDHS+VESFGA G+ CITSRVYP  A+ +
Sbjct  501   SMKDGKDAYRPSFAGFVNVDLNDKKLSLRSLIDHSVVESFGAGGRTCITSRVYPILAVCD  560

Query  248   KAHLYAFNNGVHSIKLSKLTAWSMKKP  168
             KAHLYAFNNG  ++K+  L AWSM +P
Sbjct  561   KAHLYAFNNGTETVKIDTLKAWSMNRP  587



>gb|AFR69123.1| cell wall invertase [Manihot esculenta]
Length=575

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/552 (57%), Positives = 401/552 (73%), Gaps = 7/552 (1%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
              SH +    + L+    N  +RT +HFQPP NW+NDPNGPM YKG+YH FYQYNPKG  +
Sbjct  24    GSHKIYPQYQNLKVHKVNQVHRTGYHFQPPMNWINDPNGPMYYKGLYHLFYQYNPKGVVW  83

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNR  1449
             G I W HS SKDL+NW A   A+ PS+   DING WSGSATILP N P +LYTG+D + R
Sbjct  84    GNIVWAHSVSKDLINWEALDHAIYPSK-WFDINGCWSGSATILPGNKPMILYTGIDPKQR  142

Query  1448  QVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVG  1269
             QVQN AVP+N +DPYL+EWVK   NP++ P+  N +NA++FRDPTTAW   DG+WRILVG
Sbjct  143   QVQNYAVPKNLTDPYLREWVKPDDNPIVDPD--NTVNASAFRDPTTAWWA-DGHWRILVG  199

Query  1268  SKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSK  1092
             SK   RG+A LYRS+DF +WV+AKHPLHS   +GMWECPDF+PVS S  NGL+TS+VG  
Sbjct  200   SKRKHRGIAYLYRSRDFKQWVKAKHPLHSSPKTGMWECPDFFPVSLSGQNGLETSVVGQN  259

Query  1091  IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLK  912
             +KHVLK+SLD +R++YYT+GTYD  +D+Y PD  SVD   GLR+DYG FYASKTF+D  K
Sbjct  260   VKHVLKVSLDLTRYEYYTVGTYDKKKDRYTPDNTSVDGWGGLRFDYGNFYASKTFFDPSK  319

Query  911   RRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEM  732
              RRILWGW NES    + +++GW+G+Q IPR + LD +RKQ++QWPV+ELE LR  KV++
Sbjct  320   NRRILWGWANESDSVKDDMQKGWAGIQAIPRRISLDASRKQVIQWPVEELETLRGQKVQL  379

Query  731   PSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASVRG  555
              +  L++G   EV GI+A QAD++VTF      KAE  + +W   D   +C+QKG+  +G
Sbjct  380   NNQKLQQGEHFEVKGITAVQADVDVTFSFPSLDKAEPFDPKWAELDALDVCAQKGSKAQG  439

Query  554   GIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVD  375
             G+GPFGL  LASEN +E+T VFFR+F     + VVL+CSD T SSL     K S+  FVD
Sbjct  440   GLGPFGLLTLASENLEEFTPVFFRIFKAPTKH-VVLLCSDATSSSLGNGLYKPSFAGFVD  498

Query  374   VNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSK  195
             V+  +++LSLR LIDHS+VE+FGA GK+ I SRVYP   + +KAHL+ FNNG  +I +  
Sbjct  499   VDLTKKQLSLRSLIDHSVVETFGAGGKIVILSRVYPKLGVFDKAHLFVFNNGSETITVEN  558

Query  194   LTAWSMKKPTIN  159
             L AWSMK+P +N
Sbjct  559   LNAWSMKQPLMN  570



>ref|XP_011019433.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Populus euphratica]
Length=570

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/551 (58%), Positives = 401/551 (73%), Gaps = 13/551 (2%)
 Frame = -1

Query  1811  QASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGAS  1632
             QASH   +NL+    PY     RT +HFQPP+NWMNDPNGPM YKGVYH FYQYNP GA 
Sbjct  21    QASHQSSRNLQETDQPY-----RTGYHFQPPKNWMNDPNGPMYYKGVYHLFYQYNPDGAV  75

Query  1631  FGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRN  1452
             +G I W HS S DLVNW     A+ P+QP+ DING WSGS TILP   PA+LYTG+D++N
Sbjct  76    WGNIIWAHSVSYDLVNWVHIDHAIYPTQPS-DINGCWSGSTTILPGEKPAILYTGIDTKN  134

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQNLAVP+N SDP L+EW+KSP NPL+ P   + I+   +RDPTTAW+GPD  WR++V
Sbjct  135   HQVQNLAVPKNLSDPLLREWIKSPYNPLMTP--IDGIDPDLYRDPTTAWQGPDKIWRVIV  192

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSP-NGLDTSLVGS  1095
             GS++   G AILYRSKDFV W +   PLHS   + MWECPDF+PVSTS  NG+DTS    
Sbjct  193   GSQINGHGRAILYRSKDFVNWTRMDSPLHSSGKTEMWECPDFFPVSTSSTNGVDTSSQDK  252

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
               KHVLK S +   HDYY +G+Y    DK+  +   +D+   LRYDYGKFYASKTF+D  
Sbjct  253   STKHVLKASFNH--HDYYILGSYMPENDKFSVETNFMDSGVDLRYDYGKFYASKTFFDGA  310

Query  914   KRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE  735
               RRILWGWINES  +++ +K+GWSG+Q IPRTV L K  KQLVQWPV+E+EKLRS  V 
Sbjct  311   MNRRILWGWINESDSESDDIKKGWSGLQSIPRTVLLSKNGKQLVQWPVKEIEKLRSKNVS  370

Query  734   MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRG  555
                  LK GSV EV GI+A+QAD++V+F+++    AE ++  W TD Q+LCSQK ASVRG
Sbjct  371   FHDKKLKSGSVLEVPGITASQADVDVSFELLNLEDAEILDPSW-TDAQLLCSQKKASVRG  429

Query  554   GIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVD  375
              +GPFGL   A+++ +E TA++FR+F  N+   +VLMCSDQ+RSS+ ++ DKT+YGAFVD
Sbjct  430   KLGPFGLLAFATKDLKEQTAIYFRIFRSNHKY-IVLMCSDQSRSSVREELDKTTYGAFVD  488

Query  374   VNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSK  195
             ++P  E ++LR LIDHSIVESFG +G+ CIT+R Y   AI ++A+L+AFNNG  S+K+S+
Sbjct  489   MDPRHENITLRSLIDHSIVESFGGEGRACITARTYAKLAIHKQAYLFAFNNGTSSVKISR  548

Query  194   LTAWSMKKPTI  162
             L AWSMK   I
Sbjct  549   LNAWSMKNAQI  559



>ref|XP_011077846.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Sesamum indicum]
Length=579

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/558 (58%), Positives = 408/558 (73%), Gaps = 14/558 (3%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPY-PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GVE  ASH +  +L++ +PP   N  +RT +HFQPPRNW+NDPNGPM Y G+YH FYQYN
Sbjct  25    GVE--ASHNLYMHLQSSRPPVNVNQLHRTGYHFQPPRNWINDPNGPMYYNGIYHLFYQYN  82

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKDL+NW+    A+ PS+P  D  G WSGSATILP N P +LYTG
Sbjct  83    PKGAVWGNIVWAHSVSKDLINWKTLPNAIYPSKPF-DKYGCWSGSATILPGNKPVILYTG  141

Query  1466  -VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
              VD +N QVQN AVP N SDPYL+EW+K   NPLI  +    IN T+FRDPTTAW G D 
Sbjct  142   IVDEKNTQVQNYAVPANLSDPYLREWIKPDNNPLIVAD--KSINKTAFRDPTTAWLGRDR  199

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
             +WR+ +G +   RG+A LYRSKDF+ WV+AKHPLHS   +G WECPDF+PVS S  NGL+
Sbjct  200   HWRLSMGGRRRHRGIAYLYRSKDFIHWVKAKHPLHSTARTGNWECPDFFPVSVSGKNGLE  259

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS++   +KHVLK+SLD +R++YYT+GTY +  DKYIPDK  +D  +GLRYDYG FYASK
Sbjct  260   TSVMDPNVKHVLKVSLDVTRYEYYTLGTYKN--DKYIPDKNMIDGWNGLRYDYGNFYASK  317

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             +F+D  K RRILWGW NES    + +K+GW+G+Q IPRT+WLD + KQLVQWPV+E+E L
Sbjct  318   SFFDPSKNRRILWGWANESSSTADDIKKGWAGIQLIPRTIWLDSSGKQLVQWPVEEVETL  377

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQ  576
             R  KVE+ +  L KG   E+ GI+AAQAD++VTF      KAE  +  W   D Q LC  
Sbjct  378   RGKKVELKNKKLVKGERIEIKGITAAQADVDVTFLFDSLDKAEPFDPSWDRHDAQKLCGH  437

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD--  402
             KG++V+GG+GPFGL  LAS+N +EYT VFFRVF  +++  +VLMCSD +RS+L       
Sbjct  438   KGSTVQGGLGPFGLLTLASKNLEEYTPVFFRVFK-DHDKYLVLMCSDASRSTLRDGAGAY  496

Query  401   KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNN  222
             + S+  FVDV+  +++LSLR LID+S+VESFGA+GK CI+SRVYPT AI + AHLYAFNN
Sbjct  497   RPSFAGFVDVDLTEKKLSLRSLIDNSVVESFGARGKTCISSRVYPTLAIYDNAHLYAFNN  556

Query  221   GVHSIKLSKLTAWSMKKP  168
             G  ++K+  L AWSM +P
Sbjct  557   GTQTVKIDSLNAWSMNRP  574



>ref|XP_002530337.1| Beta-fructofuranosidase, insoluble isoenzyme 3 precursor, putative 
[Ricinus communis]
 gb|EEF32053.1| Beta-fructofuranosidase, insoluble isoenzyme 3 precursor, putative 
[Ricinus communis]
Length=578

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/554 (56%), Positives = 397/554 (72%), Gaps = 7/554 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              + SH +    ++LQ       +RT FHFQPP++W+NDPNGPM Y G+YH FYQYNPKGA
Sbjct  25    VEGSHRIYPEYQSLQANNVKLVHRTGFHFQPPKHWINDPNGPMYYNGLYHLFYQYNPKGA  84

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS SKDL+NW A  PA+ PS+   DING WSGSATILP N P +LYTG+D +
Sbjct  85    VWGNIVWAHSVSKDLINWEALEPAIYPSE-WFDINGCWSGSATILPGNKPVILYTGIDPK  143

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
              RQ+QN A+P+N SDPYL+EWVK   NP++ P+  +K+NA++FRDPTTAW   DG+WRIL
Sbjct  144   QRQIQNYAIPKNLSDPYLREWVKPKDNPVVDPD--SKVNASAFRDPTTAWYA-DGHWRIL  200

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG  1098
             VGSK   RG+A LYRSK+F +WV+A+HPLHS   +GMWECPDF+PVS S  NGLDTS++ 
Sbjct  201   VGSKRKHRGIAYLYRSKNFKKWVKAEHPLHSKAKTGMWECPDFFPVSLSGENGLDTSVIN  260

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               +KHVLK+SLD +R++YYT+GTYD  +D+Y PD   VD   GLRYDYG FYASKTF+D 
Sbjct  261   QNVKHVLKVSLDLTRYEYYTLGTYDKRKDRYYPDSNLVDGWGGLRYDYGNFYASKTFFDP  320

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K RRILWGW NES    +   +GW+G+Q IPR +WLD +  QL+QWP++ELE LR   V
Sbjct  321   SKNRRILWGWANESDAIQDDKNKGWAGIQLIPRKLWLDPSGNQLIQWPIEELESLRGQSV  380

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQKGASV  561
             ++ S  +KKG   EV GI+AAQAD++VTF      KAE  + +W     Q +C+ KG+  
Sbjct  381   QLTSKQIKKGEHVEVKGITAAQADVDVTFSFASLDKAEPFDPKWENLVAQDVCAAKGSKA  440

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAF  381
             +GG+GPFGL  LASEN +E+  VFFRVF  ++    VL+CSD   SSL     K S+  F
Sbjct  441   QGGLGPFGLLTLASENLEEFNPVFFRVFKASDKYK-VLLCSDARSSSLGSGLYKPSFSGF  499

Query  380   VDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             VDV+   ++LSLR LIDHS+VESFGAKGK  +TSRVYPT A+ +KAHL+ FNNG  ++ +
Sbjct  500   VDVDLADKKLSLRSLIDHSVVESFGAKGKTVVTSRVYPTIAVFDKAHLFVFNNGSETVTV  559

Query  200   SKLTAWSMKKPTIN  159
               L AW M KP +N
Sbjct  560   ETLKAWRMNKPVMN  573



>ref|XP_010245601.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1 isoform 
X2 [Nelumbo nucifera]
Length=539

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/516 (60%), Positives = 385/516 (75%), Gaps = 7/516 (1%)
 Frame = -1

Query  1703  DPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGA  1524
             DPNGPM Y G+YH FYQYNP+GA +G I W HS S DL+NW    PAL P++P  DING 
Sbjct  30    DPNGPMYYNGIYHLFYQYNPRGAVWGNIVWAHSVSTDLINWAPLEPALYPTEPF-DINGC  88

Query  1523  WSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNK  1344
             WSGSATILP N P +LYTG+D++NRQVQN+AVP+N SDPYL+EW K   NPL+ P     
Sbjct  89    WSGSATILPGNKPVILYTGIDTQNRQVQNIAVPKNLSDPYLREWTKPGHNPLMVPA--GD  146

Query  1343  INATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGM  1164
             IN +SFRDPTTAW G +G+W++LVG+K GRRG+A+LYRS+DFV W ++ HPLHS  G+GM
Sbjct  147   INVSSFRDPTTAWWG-NGHWKVLVGNKRGRRGMALLYRSRDFVTWKKSPHPLHSAPGTGM  205

Query  1163  WECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGS  987
             WECPDF+PVS +   GLD S  G  +KHVLK+SLD SR +YYT+G Y   +D+YIPD  S
Sbjct  206   WECPDFFPVSLAGEEGLDASRTGVGVKHVLKVSLDSSRFEYYTVGRYFPEKDRYIPDNTS  265

Query  986   VDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWL  807
              DN  GLR+DYG FYASKTF+D+ K+RRILWGW NES    + V +GW+G+Q IPR +WL
Sbjct  266   ADNAMGLRFDYGNFYASKTFFDAGKKRRILWGWTNESDTAADDVAKGWAGIQTIPRKLWL  325

Query  806   DKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKA  627
             DK+ +Q+VQWP+QELE LR N V +    L+KG + EV GI+AAQAD+EVTF +    KA
Sbjct  326   DKSGRQIVQWPIQELEALRQNGVHLRKVHLRKGGIVEVKGITAAQADVEVTFSLPNLKKA  385

Query  626   EKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVL  447
             E  +  W  DPQ  CS++GA+V GG+GPFGL  LAS N  EYT++FFRVF   + + VVL
Sbjct  386   EPFDPSW-DDPQQQCSRRGATVEGGVGPFGLLALASRNLDEYTSIFFRVFKAQDKH-VVL  443

Query  446   MCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYP  267
             MCSDQTRSSL  +  K ++G FV V+    +LSLR LID+S+VESFGA GK CITSRVYP
Sbjct  444   MCSDQTRSSLRTEVYKPAFGGFVYVDLEDGKLSLRSLIDNSVVESFGAGGKTCITSRVYP  503

Query  266   TKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
               A+ E AHLYAFNNG   ++L KL AWSM++P +N
Sbjct  504   ILAVAEGAHLYAFNNGSEPVQLVKLKAWSMRRPRMN  539



>ref|XP_004975576.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 3-like 
[Setaria italica]
Length=581

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/564 (54%), Positives = 403/564 (71%), Gaps = 16/564 (3%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH+V   L++L+    + T RT +HFQPP++W+NDPNGPM YKG+YH FYQYNPKGA
Sbjct  18    VRASHVVYPELQSLEATQIDETSRTGYHFQPPKHWINDPNGPMYYKGLYHLFYQYNPKGA  77

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S DL++W A  P + PS+P  DING WSGSAT+LP+ +P ++YTG+D  
Sbjct  78    VWGNIVWAHSVSTDLIDWTALDPGIYPSKPF-DINGCWSGSATLLPSGVPVMMYTGIDPD  136

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
               QVQN+A P+N SDP+L+EWVK   NP+I+P+    INA++FRDPTTAW GPD +WR+L
Sbjct  137   EHQVQNVAYPKNLSDPFLREWVKPDYNPIISPD--GGINASAFRDPTTAWYGPDRHWRLL  194

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN------GLD  1113
             VGSKVG +GLA+LYRS+DF RWV+A HPLHSG  +GMWECPDF+PV+          G+D
Sbjct  195   VGSKVGDKGLAVLYRSRDFKRWVKAHHPLHSGL-TGMWECPDFFPVAVHGGSRHHRRGVD  253

Query  1112  TS-----LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGK  948
             T+      V  ++K+VLK+SLD +R++YYT+G+YDH  D+Y PD G  DND GLRYDYG 
Sbjct  254   TAELRDAAVAEEVKYVLKVSLDLTRYEYYTVGSYDHATDRYTPDAGFPDNDYGLRYDYGD  313

Query  947   FYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQ  768
             FYASK+FYD  KRRRILWGW NES    +  K+GW+G+Q IPR +WL    KQL+QWPV+
Sbjct  314   FYASKSFYDPAKRRRILWGWANESDTVPDDRKKGWAGIQAIPRKLWLSPRGKQLIQWPVE  373

Query  767   ELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQV  588
             E++ LR+  V +   ++K     EV+G  + Q+D+EV F I +  KAE+    W  DPQ 
Sbjct  374   EIKALRAKHVNVSDKVVKSDQYFEVTGFKSVQSDVEVAFAIKDLSKAEQFNPAWLRDPQA  433

Query  587   LCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKK  408
             LC ++GA V G +GPFGL VLA+ +  E TAVFFRVF    +  VVLMC+D T S+ + +
Sbjct  434   LCKKRGARVTGEVGPFGLWVLAAGDLTERTAVFFRVFKTTGSKHVVLMCNDPTNSTFESQ  493

Query  407   TDKTSYGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               + ++  FVDV+  Q + ++LR LIDHS+VESFGA GK CI +RVYP KA+G+ AHL+ 
Sbjct  494   VYRPTFAGFVDVDIAQTKTIALRTLIDHSVVESFGAGGKTCILTRVYPKKAVGDDAHLFV  553

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN  159
             FN+G   IK+ KL AW MK P +N
Sbjct  554   FNHGEVDIKVVKLDAWEMKTPKMN  577



>ref|XP_002309496.1| invertase family protein [Populus trichocarpa]
 gb|EEE93019.1| invertase family protein [Populus trichocarpa]
Length=570

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/552 (57%), Positives = 401/552 (73%), Gaps = 13/552 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              QASH   +NL+    PY     RT +HFQPP+NWMNDPNGPM YKGVYH FYQYNP GA
Sbjct  20    VQASHQSSRNLQETDQPY-----RTGYHFQPPKNWMNDPNGPMYYKGVYHLFYQYNPDGA  74

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S DLVNW     A+ P+QP+ DING WSGS TILP   PA+LYTG+D++
Sbjct  75    VWGNIIWAHSVSYDLVNWVHIDHAIYPTQPS-DINGCWSGSTTILPGEKPAILYTGIDTK  133

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             N QVQNLAVP+N SDP L+EW KSP NPL+ P   + I+   +RDPTTAW+GPD  WR++
Sbjct  134   NHQVQNLAVPKNLSDPLLKEWKKSPYNPLMTP--IDGIDPDLYRDPTTAWQGPDKIWRVI  191

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSP-NGLDTSLVG  1098
             VGS++   G AILYRSKDFV W +   PLHS   + MWECPDF+PVSTS  NG+DTS   
Sbjct  192   VGSQINGHGRAILYRSKDFVNWTRIDSPLHSSGKTEMWECPDFFPVSTSSTNGVDTSSQD  251

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
                KHVLK S +   HDYY +G+Y    DK+  +   +D+   LRYDYGKFYASKTF+D 
Sbjct  252   KSTKHVLKASFNH--HDYYILGSYMPENDKFSVETNFMDSGVDLRYDYGKFYASKTFFDG  309

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
                RRILWGWINES  +++ +K+GWSG+Q IPRTV L K  KQ+VQWPV+E+EKLRS  V
Sbjct  310   AMNRRILWGWINESDSESDDIKKGWSGLQSIPRTVLLSKNGKQIVQWPVKEIEKLRSKNV  369

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
                   LK GSV EV GI+A+QAD++V+F+++    AE ++  W TDPQ+LCSQK ASVR
Sbjct  370   SFHDKKLKSGSVLEVPGITASQADVDVSFELLNLEDAEILDPSW-TDPQLLCSQKKASVR  428

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             G +GPFGL   A+++ +E TA++FR+F  N+   +VLMCSDQ+RSS+ ++ DKT+YGAFV
Sbjct  429   GKLGPFGLLAFATKDLKEQTAIYFRIFRSNHKY-IVLMCSDQSRSSVREELDKTTYGAFV  487

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             D++P  E ++LR LIDHSIVESFG +G+ CIT+R Y   AI ++A+L+AFNNG  S+K+S
Sbjct  488   DMDPRHEIITLRSLIDHSIVESFGGEGRACITTRAYAKLAIHKQAYLFAFNNGTSSVKIS  547

Query  197   KLTAWSMKKPTI  162
             +L AWSMK   I
Sbjct  548   RLNAWSMKNAQI  559



>ref|XP_009388284.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 3-like 
[Musa acuminata subsp. malaccensis]
Length=557

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/554 (55%), Positives = 400/554 (72%), Gaps = 6/554 (1%)
 Frame = -1

Query  1811  QASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGAS  1632
             +ASH+V ++L+++ P   N   +  +HF+PPR+W+NDPNGP+ YKG+YH FYQYNP G+ 
Sbjct  2     EASHVVYEDLQSISPTLVNDELKPVYHFRPPRHWINDPNGPLYYKGIYHLFYQYNPYGSV  61

Query  1631  FGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRN  1452
             +G I W HS S D++NW+A  PA+ PSQP  DI G WSGSATILP + P ++YTG+D + 
Sbjct  62    WGNIVWAHSVSADMINWKALDPAIYPSQPF-DIYGCWSGSATILPGDKPVIVYTGIDPQK  120

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP-DGNWRIL  1275
             RQ+QN+A P N SDPYL+EW K   NP+I P+  + +NA++FRDPTTAW  P D +W ++
Sbjct  121   RQIQNIAFPSNLSDPYLREWTKPDHNPVIDPSD-SAVNASAFRDPTTAWYTPHDQHWSLV  179

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVG  1098
             +G++ G RG+A+LY+SKDFV+W +A+HPLHS +G+GMWECPD YPV+   N GLDT  VG
Sbjct  180   IGTRRGSRGVAVLYKSKDFVKWTKARHPLHSAKGTGMWECPDVYPVALEGNQGLDTGEVG  239

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
             + +KHV K+SLDE+R DYYT+GTY    DKYIPD  S DN +GLRYDYG FYASK+FYD 
Sbjct  240   AGVKHVFKVSLDETRFDYYTLGTYYPKADKYIPDANSTDNRNGLRYDYGNFYASKSFYDP  299

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K+RRILWGW NES        +GW+GVQ IPR VWLD   +QLVQWP++ELE LR    
Sbjct  300   AKKRRILWGWANESDSANADKDKGWAGVQAIPRAVWLDSNGRQLVQWPIEELETLRHKHG  359

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              + +  +  G+  EV  I  AQAD+EVTF++     AE  +  + TD Q LC++  A  +
Sbjct  360   SVKNRNIPSGTSFEVKNILTAQADVEVTFEVGSLENAEAFDPLYATDAQALCAKMTAKTK  419

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             GG+GPFGL VLAS +++E TAVFFR+F   + + VVLMC D TRSS  +   K ++  FV
Sbjct  420   GGVGPFGLLVLASADQEEATAVFFRIFKAQDKH-VVLMCHDPTRSSKREMIYKPTFAGFV  478

Query  377   DVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             DV+  +  ++SLR LIDHS+VESFG  GK CITSRVYP+ AIG++AH++ FNNG   +K+
Sbjct  479   DVDIEKTNKISLRSLIDHSVVESFGEGGKTCITSRVYPSIAIGQQAHMFVFNNGAEDVKV  538

Query  200   SKLTAWSMKKPTIN  159
             S+L AW MK P +N
Sbjct  539   SELNAWEMKAPEMN  552



>ref|XP_010648345.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1 
isoform X3 [Vitis vinifera]
Length=565

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/551 (58%), Positives = 402/551 (73%), Gaps = 13/551 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             G+E +AS+   +NL++     P   YRT++HFQPP+NWMNDPNGPM Y GVYH FYQYNP
Sbjct  19    GIEAEASYPSCRNLQSNPTEQP---YRTAYHFQPPKNWMNDPNGPMYYNGVYHLFYQYNP  75

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
               A +G I+W HSTS DLVNW     A+ P+ P  DING WSGSATIL    P ++YTG 
Sbjct  76    YAAVWGNITWAHSTSYDLVNWVHLELAIKPTDPF-DINGCWSGSATILTGEEPVIIYTGK  134

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             DS+NRQVQNL+VP+N SDP L+EW+KSP NPL+ P   + I+A++FRDPTTAW+G D  W
Sbjct  135   DSQNRQVQNLSVPKNISDPLLREWIKSPHNPLMTP--IDGIDASNFRDPTTAWQGSDKVW  192

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTS  1107
             RILVGS +   G A+LYRS+DFV W +++ PLHS   +GMWECPDFYPVS +S NG++TS
Sbjct  193   RILVGSLINGHGTALLYRSRDFVNWNKSQTPLHSSNKTGMWECPDFYPVSISSRNGVETS  252

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
             +  ++ +HVLK S +   +DYY +G Y    D Y+ + G +D  S LRYDYGKFYASKTF
Sbjct  253   VQNAETRHVLKASFN--GNDYYIMGKYVPETDTYLVETGFLDAGSDLRYDYGKFYASKTF  310

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +D+ K+RRILW WI E+  DTE   +GWSG+Q  PR+V LD+  ++LVQWPV+E+  L  
Sbjct  311   FDAAKKRRILWAWIQEADKDTE---KGWSGLQSFPRSVLLDQNGQRLVQWPVKEIAILHK  367

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
             N+V   +  L+ GSV EVSGI+A+QAD+EV+F      +AE M+  WT DPQ LCS+K  
Sbjct  368   NQVTFHNKELRGGSVIEVSGITASQADVEVSFDFPHLEEAELMDPSWT-DPQALCSRKNV  426

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
             SV+GGIGPFGL VLAS N  E TA+FFR+F       +VLMCSDQ+RSSL +  DKT YG
Sbjct  427   SVKGGIGPFGLLVLASNNLTEQTAIFFRIFKSTQEKHIVLMCSDQSRSSLRQDVDKTIYG  486

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
             AFVD++   E++SLR LIDHSIVESFG KGK CIT+RVYP  AI  +AHLYAFN+G  ++
Sbjct  487   AFVDIDLNHEQISLRSLIDHSIVESFGGKGKTCITARVYPELAINTEAHLYAFNSGNQTL  546

Query  206   KLSKLTAWSMK  174
              +S L+AWSMK
Sbjct  547   NISTLSAWSMK  557



>emb|CAA49162.1| beta-fructofuranosidase [Daucus carota]
Length=592

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/559 (58%), Positives = 400/559 (72%), Gaps = 13/559 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             GVE  A H +  NL+++        +RT +HFQP +NW+NDPNGPM YKGVYH FYQYNP
Sbjct  36    GVE--AFHEIHYNLQSVGAENVKQVHRTGYHFQPKQNWINDPNGPMYYKGVYHLFYQYNP  93

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
             KGA +G I W HS S DL+NW    PA+ PS+P  D  G WSGSATILP N P +LYTG+
Sbjct  94    KGAVWGNIVWAHSVSTDLINWTPLEPAIFPSKPF-DKYGCWSGSATILPGNKPVILYTGI  152

Query  1463  DS---RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
                  +N QVQN A+P N SDPYL++W+K   NPL+  N  N  NAT+FRDPTTAW    
Sbjct  153   VEGPPKNVQVQNYAIPANLSDPYLRKWIKPDNNPLVVAN--NGENATAFRDPTTAWLDKS  210

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSP-NGL  1116
             G+W++LVGSK  RRG+A LYRSKDF++W +AKHP+HS   +GMWECPDF+PVS    NGL
Sbjct  211   GHWKMLVGSKRNRRGIAYLYRSKDFIKWTKAKHPIHSQANTGMWECPDFFPVSLKGLNGL  270

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS+ G  +KHVLK+SLD +R++YYT+GTY   +D+YIPD  SVD  +GLRYDYG FYAS
Sbjct  271   DTSVTGESVKHVLKVSLDLTRYEYYTVGTYLTDKDRYIPDNTSVDGWAGLRYDYGNFYAS  330

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+D  K RRILWGW NES      V +GW+G+Q IPRT+WLD + KQL+QWP++ELE 
Sbjct  331   KTFFDPSKNRRILWGWANESDSTAHDVAKGWAGIQLIPRTLWLDPSGKQLMQWPIEELET  390

Query  755   LRSNKVEMPSTM-LKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLC  582
             LR +KV+      L KG + EV GI+AAQAD+EVTF      K E  + +W   D + +C
Sbjct  391   LRGSKVKFSRKQDLSKGILVEVKGITAAQADVEVTFSFKSLAKREPFDPKWLEYDAEKIC  450

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD  402
             S KG++V+GG+GPFGL  LASE  +EYT VFFRVF   N +  VLMCSD TRSSL +   
Sbjct  451   SLKGSTVQGGVGPFGLLTLASEKLEEYTPVFFRVFKVQNTHK-VLMCSDATRSSLKEGLY  509

Query  401   KTSYGAFVDVN-PMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFN  225
             + S+  FVDV+    +++SLR LID+S+VESFGAKGK CI+SRVYPT A+ E AHLY FN
Sbjct  510   RPSFAGFVDVDLATDKKISLRSLIDNSVVESFGAKGKTCISSRVYPTLAVYENAHLYVFN  569

Query  224   NGVHSIKLSKLTAWSMKKP  168
             NG  +I +  L AWSMKKP
Sbjct  570   NGSETITVENLDAWSMKKP  588



>ref|XP_010648344.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1 
isoform X2 [Vitis vinifera]
Length=565

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/551 (58%), Positives = 401/551 (73%), Gaps = 13/551 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             G+E + SH   +NL++     P   YRT++HFQPP+NWMNDPNGPM Y GVYH FYQYNP
Sbjct  19    GIEGETSHHSYRNLQSDPADQP---YRTAYHFQPPKNWMNDPNGPMYYNGVYHLFYQYNP  75

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
               A +G I+W HSTS DLVNW     A+ P+ P  DING WSGSATIL    P ++YTG 
Sbjct  76    YAAVWGNITWAHSTSYDLVNWVHLELAIKPTDPF-DINGCWSGSATILTGEEPVIIYTGK  134

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             DS+NRQVQNL+VP+N SDP L+EW+KSP NPL+ P   + I+A++FRDPTTAW+G D  W
Sbjct  135   DSQNRQVQNLSVPKNISDPLLREWIKSPHNPLMTP--IDGIDASNFRDPTTAWQGSDKVW  192

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTS  1107
             RILVGS +   G A+LYRS+DFV W +++ PLHS   +GMWECPDFYPVS +S NG++TS
Sbjct  193   RILVGSLINGHGTALLYRSRDFVNWNKSQTPLHSSNKTGMWECPDFYPVSISSRNGVETS  252

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
             +  ++ +HVLK S +   +DYY +G Y    D Y+ + G +D  S LRYDYGKFYASKTF
Sbjct  253   VQNAETRHVLKASFN--GNDYYIMGKYVPETDTYLVETGFLDAGSDLRYDYGKFYASKTF  310

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +D+ K+RRILW WI E+  DTE   +GWSG+Q  PR+V LD+  ++LVQWPV+E+  L  
Sbjct  311   FDAAKKRRILWAWIQEADKDTE---KGWSGLQSFPRSVLLDQNGQRLVQWPVKEIAILHK  367

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
             N+V   +  L+ GSV EVSGI+A+QAD+EV+F      +AE M+  WT DPQ LCS+K  
Sbjct  368   NQVTFHNKELRGGSVIEVSGITASQADVEVSFDFPHLEEAELMDPSWT-DPQALCSRKNV  426

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
             SV+GGIGPFGL VLAS N  E TA+FFR+F       +VLMCSDQ+RSSL +  DKT YG
Sbjct  427   SVKGGIGPFGLLVLASNNLTEQTAIFFRIFKSTQEKHIVLMCSDQSRSSLRQDVDKTIYG  486

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
             AFVD++   E++SLR LIDHSIVESFG KGK CIT+RVYP  AI  +AHLYAFN+G  ++
Sbjct  487   AFVDIDLNHEQISLRSLIDHSIVESFGGKGKTCITARVYPELAINTEAHLYAFNSGNQTL  546

Query  206   KLSKLTAWSMK  174
              +S L+AWSMK
Sbjct  547   NISTLSAWSMK  557



>gb|EYU38654.1| hypothetical protein MIMGU_mgv1a003581mg [Erythranthe guttata]
Length=576

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/554 (57%), Positives = 400/554 (72%), Gaps = 10/554 (2%)
 Frame = -1

Query  1811  QASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGAS  1632
             +ASH    +L++         +RT +HFQP ++W+NDPNGPM Y G+YH FYQYNPKGA 
Sbjct  22    EASHKAYMHLQSTPAINVKQVHRTGYHFQPTKHWINDPNGPMYYNGIYHLFYQYNPKGAV  81

Query  1631  FGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSR  1455
             +G I W HS SKDL+NW+   PA+ PS+P  D  G WSGSATILP N P +LYTG+ D  
Sbjct  82    WGNIVWAHSVSKDLINWKKLDPAIYPSKPF-DQFGCWSGSATILPGNKPVILYTGIIDKN  140

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAW-RGPDGNWRI  1278
             N QVQN A+P + SDPYL +W+K   NPLI  +    +N T+FRDPTTAW  G DG+WRI
Sbjct  141   NTQVQNYAIPADLSDPYLTKWIKPDNNPLIVADI--SVNKTAFRDPTTAWWSGDDGHWRI  198

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLV  1101
              +G +   RG++ LYRS+DFV W++AKHPLHS  G+G WECPDF+PVS S  NGLDTS V
Sbjct  199   SIGGRRRERGMSFLYRSRDFVHWIKAKHPLHSKGGTGNWECPDFFPVSVSGKNGLDTSFV  258

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
             GS IK+VLK+SLD +R++YYT+GTY + +D+Y+PD+G +D  +GLRYDYG FYASK+F+D
Sbjct  259   GSGIKYVLKVSLDVTRYEYYTLGTYSNEKDRYVPDEGMIDGWNGLRYDYGNFYASKSFFD  318

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               K RRILWGW NES    + VK+GW+G+Q IPRT+ LD   KQL+QWP++E+E LR  K
Sbjct  319   PSKNRRILWGWANESDSTNDDVKKGWAGIQLIPRTILLDPNGKQLLQWPIEEVETLRGKK  378

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQKGAS  564
             VE+ +  L KG   E+ GI+AAQAD++V F      KAE  +  W   D Q LCSQKG++
Sbjct  379   VELSNRKLVKGEKVEIKGITAAQADVDVVFSFDSLDKAEPFDSNWDRYDAQKLCSQKGST  438

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD--KTSY  390
             V GG+GPFG+  LASEN +EYT VFFRVF   + + +VLMCSD TRS+L +     + S+
Sbjct  439   VEGGLGPFGILTLASENLEEYTPVFFRVFKAKDEH-LVLMCSDATRSTLKEGNGAYRPSF  497

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
               FVDV+  +++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHLYAFNNG  +
Sbjct  498   AGFVDVDLTEKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIYGNAHLYAFNNGTQT  557

Query  209   IKLSKLTAWSMKKP  168
             IK+  L AWSM KP
Sbjct  558   IKIDSLNAWSMNKP  571



>gb|AFH77951.1| cell wall invertase [Manihot esculenta]
Length=575

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/554 (56%), Positives = 398/554 (72%), Gaps = 7/554 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              + SH +    + ++    N  +RT +HFQPP NW+NDPNGPM YKG+YH FYQYNP GA
Sbjct  21    VEGSHKIYAQYQNVKAVKVNPVHRTGYHFQPPMNWINDPNGPMYYKGLYHLFYQYNPNGA  80

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
             ++G I W HS SKDLVNW+A   AL PS+   DING WSGS TILP N P +LYTG+D  
Sbjct  81    TWGNIVWAHSVSKDLVNWQALKHALYPSK-WFDINGCWSGSVTILPGNKPVILYTGIDPN  139

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             +R++QN AVP+N SDPYL++W+K   NP++ P+  + +NA++FRDPTTAW   DG+W+I+
Sbjct  140   DREIQNYAVPKNLSDPYLRDWIKPDDNPMVDPD--SNVNASAFRDPTTAW-WVDGHWKIV  196

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG  1098
             VGS+   RG+A LYRS+DF  W++AKHPLHS   +G WECPDF+PVS S  NGLDTS+VG
Sbjct  197   VGSRRHHRGMAYLYRSRDFKTWIKAKHPLHSVPRTGNWECPDFFPVSLSGQNGLDTSVVG  256

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               +KHV K+SLD +R+DYYT+GTYD  RDKYIPD  SVD  +GLR+DYG FYASK+F+D 
Sbjct  257   QNVKHVFKVSLDITRYDYYTVGTYDRTRDKYIPDNTSVDGWAGLRFDYGNFYASKSFFDP  316

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K RR+LWGW+NES    +   +GW+G+QG+PR +WLD +++Q+VQWPV+ELE LR  K+
Sbjct  317   SKSRRVLWGWVNESDTAADDNSKGWAGIQGVPRKIWLDSSKRQVVQWPVEELETLRRKKI  376

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQKGASV  561
             E+    LKKG   EV  I+A QAD+EVTF      KAE  + +W   D Q +C++KG++ 
Sbjct  377   ELGIQKLKKGEKVEVKRITATQADVEVTFSFPSLEKAEPFDHKWANIDAQGVCAEKGSTD  436

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAF  381
             +GG+GPFGL  LAS+  +E+T VFFRVF   N +  VL+CSD   SSL +   K S+  F
Sbjct  437   QGGLGPFGLLTLASKELEEFTPVFFRVFKAGNRHK-VLLCSDARSSSLREGLYKPSFAGF  495

Query  380   VDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             VDV+   + LSLR LIDHS+V SFG  GK  ITSRVYPT A+  KAHL+ FNNG  +I +
Sbjct  496   VDVDLSTKRLSLRSLIDHSVVSSFGEGGKTVITSRVYPTLAVFHKAHLFVFNNGSETITV  555

Query  200   SKLTAWSMKKPTIN  159
              K  AWSMK P +N
Sbjct  556   EKFNAWSMKNPIMN  569



>ref|XP_008243524.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Prunus mume]
Length=578

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/552 (57%), Positives = 390/552 (71%), Gaps = 7/552 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH V    ++L     N  +RT+FHF+PP NW+NDPNGPM + G+YH FYQYNPKGA
Sbjct  26    VEASHNVYPEFQSLAAVKVNQVHRTAFHFRPPSNWINDPNGPMYFGGLYHLFYQYNPKGA  85

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S D++NW A  PA+ PS+P  DING WSGSATILP N P +LYTG+D +
Sbjct  86    VWGNIVWAHSVSMDMINWEALEPAIYPSKPF-DINGCWSGSATILPGNKPIILYTGIDPQ  144

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
             NRQVQN A+P N SD YL++W+K   NPL+ P+    +NAT+FRDPTTAW   DG+W++L
Sbjct  145   NRQVQNYAIPANSSDQYLRKWIKPDNNPLVVPD--AGMNATAFRDPTTAWW-IDGHWKML  201

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVG  1098
             VG K   RG+A LYRSKDF+ WV+A H  HS   +GMWECPDFYPV      GLDTS  G
Sbjct  202   VGGKRKHRGVAHLYRSKDFMHWVKAHHAFHSAPHTGMWECPDFYPVPLVGKFGLDTSNFG  261

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
             + +KHV+K+SLDE+R++YYT+G Y   +D+Y+PDK  VD  SGLRYDYG FYASK+F+D 
Sbjct  262   ADVKHVMKVSLDETRYEYYTLGKYFPEKDRYVPDKALVDGWSGLRYDYGNFYASKSFFDP  321

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
              K RRILWGW NES    E V +GW+G+Q IPR VWL    KQL+QWP++ELE LR  KV
Sbjct  322   AKSRRILWGWANESDTSQEDVAKGWAGIQTIPRVVWLSPDGKQLLQWPIEELETLRGQKV  381

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQKGASV  561
             E+    LK G   EV GI+AAQAD++V F I    KAE  +  WT+ D Q LC  KG+ +
Sbjct  382   ELNIQKLKLGDYVEVKGITAAQADVDVLFTIPSLDKAEDFDPSWTSLDAQRLCGLKGSKI  441

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAF  381
             +GG+GPFGL  LAS+N +E+T VFFR+F    +  +VLMCSD T SSL     K S+  F
Sbjct  442   QGGLGPFGLLTLASQNLEEFTPVFFRIFKAQGSRHLVLMCSDATSSSLQNNLYKPSFAGF  501

Query  380   VDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             VDV+    ++LSLR LIDHS+VESFG   K CITSRVYPT A+ ++AHL+ FNNG  +I 
Sbjct  502   VDVDLTSYKKLSLRSLIDHSVVESFGPGAKTCITSRVYPTLAVNKEAHLFVFNNGTETIT  561

Query  203   LSKLTAWSMKKP  168
             +  LTAWSM  P
Sbjct  562   VESLTAWSMNAP  573



>ref|XP_006356522.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV3-like 
[Solanum tuberosum]
Length=531

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/533 (57%), Positives = 390/533 (73%), Gaps = 9/533 (2%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHI  1569
             YRT++HFQP +NWMNDPNGPM+YKG+YH FYQYNP+ A +  I+WGHSTS DLVNW  H 
Sbjct  5     YRTAYHFQPLKNWMNDPNGPMIYKGIYHLFYQYNPESAKWANIAWGHSTSTDLVNWTIHP  64

Query  1568  PALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWV  1389
             PAL PS P  D NG WSGS TIL +  PA+LYTG  S+   +QNLAVP++PSDP L EW+
Sbjct  65    PALLPSDPF-DFNGCWSGSTTILQDGTPAILYTGCVSQKVNLQNLAVPKDPSDPCLVEWI  123

Query  1388  KSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRW  1209
             KSP NP++ PN   KI    FRDPTTAW G D  WR+++G+K   RG A+LY+S+DF+ W
Sbjct  124   KSPHNPIMTPNEDEKI---WFRDPTTAWLGTDRIWRVIIGNKRENRGTALLYKSEDFIHW  180

Query  1208  VQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYYTIG  1032
              +A+ PLHS   + MWECPDF+PVS    NGLDTS +   IKHVLKIS   S  DYYTIG
Sbjct  181   TEAERPLHSSNETTMWECPDFFPVSIDGENGLDTSEIFPGIKHVLKISAMSSSVDYYTIG  240

Query  1031  TYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVK  852
             TYDH  D YIPD+GSVDN+SGLR DYGK+YASK+F+DS K+RRI   W+NES      + 
Sbjct  241   TYDHHNDVYIPDEGSVDNESGLRLDYGKYYASKSFFDSEKKRRISIAWVNESTSKEINLI  300

Query  851   QGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQ  672
             +GWSG+Q  PR +WLD+  KQL+QWPV+E+E LR+NKV++ +  L+ GS  E+SG++A Q
Sbjct  301   RGWSGLQCFPRKIWLDRGGKQLIQWPVEEIEMLRTNKVDLQNITLEAGSKREISGVTAVQ  360

Query  671   ADMEVTFK--IMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYT  498
             AD+E++F   I    +AE +E  W T+PQ + ++ G++   G+GPFGL VLAS N +EYT
Sbjct  361   ADVEISFSIPIAVLEQAEVLESSW-TNPQEIANKSGSTANTGVGPFGLLVLASNNIEEYT  419

Query  497   AVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIV  318
             A+FF +F   N+  VVLM  DQ RSS+  + DKT+YGAF+D++P+ E+LSLR LIDHSIV
Sbjct  420   AIFFTIFK-KNDKFVVLMGCDQKRSSVGLEYDKTNYGAFLDIDPLTEKLSLRTLIDHSIV  478

Query  317   ESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             ESFG  GK CIT+R YPT AI + AHL+ FNNG   + +S L AWS+ +  IN
Sbjct  479   ESFGGGGKTCITTRAYPTLAINDNAHLFVFNNGSQHVDISNLNAWSLSQAHIN  531



>ref|XP_010322785.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV3-like 
isoform X2 [Solanum lycopersicum]
Length=528

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/533 (57%), Positives = 393/533 (74%), Gaps = 12/533 (2%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHI  1569
             YRT++HFQPP+NW+N   GPM+YKG+YH FYQYNP+ A +G I+WGHSTS DLVNW  H 
Sbjct  5     YRTAYHFQPPKNWIN---GPMIYKGIYHLFYQYNPESAEWGNIAWGHSTSTDLVNWTIHP  61

Query  1568  PALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWV  1389
             PAL PS  A DING WSGSATIL +  PA+LYTG +S+  Q+QNLAVP++PSDPYL EWV
Sbjct  62    PALLPSD-AYDINGCWSGSATILQDGTPAILYTGGNSQKVQLQNLAVPKDPSDPYLVEWV  120

Query  1388  KSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRW  1209
             KSP NP++ PN   K    SFRDPTTAW GPDG WR+++G++   RG A+LY+S+DF+RW
Sbjct  121   KSPDNPIMIPNEDEK---ESFRDPTTAWLGPDGIWRVVIGNERENRGTAVLYKSEDFIRW  177

Query  1208  VQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYYTIG  1032
              +A+ PLHS   + MWECPDF+PV     NGLD S + S IKHVLK S+  S  DYYT+G
Sbjct  178   TEAERPLHSSSETTMWECPDFFPVLVDGENGLDISEIFSGIKHVLKNSVARSFVDYYTVG  237

Query  1031  TYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVK  852
              YDH  D Y PD+GSVDN+SGLR DYG++YASK+F+DS K+RRI   W+NES      + 
Sbjct  238   AYDHHNDVYTPDEGSVDNESGLRLDYGRYYASKSFFDSEKKRRIFIAWVNESTSKEIDLI  297

Query  851   QGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQ  672
             +GWSG+Q  PR +WLDK  KQLVQWPV+E+E LR+NKV++ +  L+ G   E+ G++AAQ
Sbjct  298   KGWSGLQSFPRKIWLDKGGKQLVQWPVEEIEMLRTNKVDLQNITLEAGLKREICGVTAAQ  357

Query  671   ADMEVTFK--IMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYT  498
             AD+E++F   I    +AE +E  W T+PQ + +Q G+    G+GPFGL VLAS   +EYT
Sbjct  358   ADVEISFSIPIAVLEQAEVLESNW-TNPQEIANQSGSLANTGVGPFGLLVLASNKIEEYT  416

Query  497   AVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIV  318
             A+FFR+F   N+  VVLM  DQ RSS+  + DKT+YGAF+D++P+ E+LSLR LIDHSIV
Sbjct  417   AIFFRIFK-KNDKFVVLMGCDQKRSSVGLEYDKTNYGAFLDIDPLTEKLSLRTLIDHSIV  475

Query  317   ESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             ESFG  GK CIT+R YPT AI + AH++ FNNG   + +S L+AWS+ +  IN
Sbjct  476   ESFGGGGKACITTRAYPTLAINDNAHIFVFNNGSQHVDISTLSAWSLNQAHIN  528



>ref|XP_010059629.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 3-like 
[Eucalyptus grandis]
 gb|KCW90533.1| hypothetical protein EUGRSUZ_A02647 [Eucalyptus grandis]
Length=585

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/556 (56%), Positives = 390/556 (70%), Gaps = 7/556 (1%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPK  1641
                +A H V    ++L      + +RT +HFQPP++W+NDPNGPM YKG YH FYQYNPK
Sbjct  31    CAVEARHKVYPEYQSLPAVSVKYAHRTGYHFQPPKHWINDPNGPMHYKGWYHLFYQYNPK  90

Query  1640  GASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVD  1461
             GA +G I W HS SKDLVNWRA  PA+ P++P  DING WSGSAT+LP N P +LYTG+D
Sbjct  91    GAVWGNIVWAHSVSKDLVNWRALPPAIYPTKPF-DINGCWSGSATVLPGNRPIILYTGID  149

Query  1460  SRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
             ++N QVQN AVP N SDPYL+EW K   NP++ P     +NA++FRDPTTAW   DG+W+
Sbjct  150   TKNHQVQNYAVPANASDPYLREWTKPDNNPIVDPG--PGVNASAFRDPTTAWF-EDGHWK  206

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSL  1104
             ILVGS+   RG+A LYRS+DF+ W +AKHPLHS   +GMWECPDF+PVS  + NGLDTS 
Sbjct  207   ILVGSRRKHRGMAYLYRSRDFIHWTKAKHPLHSAPKTGMWECPDFFPVSKNNANGLDTSA  266

Query  1103  VGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFY  924
             +G  +KHVLK+SLD +R++YYTIGTY   +D+Y+PD  S D  SGLRYDYG FYASKTF+
Sbjct  267   LGQGVKHVLKVSLDLTRYEYYTIGTYHPDKDRYMPDNTSADGWSGLRYDYGNFYASKTFF  326

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             D +K RR+LWGW NES      V++GW+G+Q IPR +WLD   KQL+QWPV+ELE LR  
Sbjct  327   DPVKNRRLLWGWANESDAVQSDVQKGWAGIQTIPRKIWLDSYGKQLLQWPVEELETLRGQ  386

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
              V M S  L  G   E+ GI+AAQAD++V F       AE+ +  W  + Q LC  KG+ 
Sbjct  387   NVHMSSVKLNNGEHVEIKGITAAQADVDVVFSFSSLDGAEQFDSSW-LNAQDLCGLKGSG  445

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP-VVLMCSDQTRSSLDKKTDKTSYG  387
             V G +GPFGL  LASE+ +E+T VFFR+F  ++ N   VLMCSD   SSL     K S+ 
Sbjct  446   VPGNVGPFGLLTLASEHLEEFTPVFFRIFKADDQNKHKVLMCSDARSSSLKSGIYKPSFA  505

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
              FVDV+    ++SLR LIDHS+VESFGA GK CITSRVYPT A+   A L+ FNNG  +I
Sbjct  506   GFVDVDLSDGKISLRSLIDHSVVESFGAGGKTCITSRVYPTLALLGNARLFTFNNGTQTI  565

Query  206   KLSKLTAWSMKKPTIN  159
              +  L AWSM +P +N
Sbjct  566   TIETLDAWSMNRPVMN  581



>sp|P26792.1|INV1_DAUCA RecName: Full=Beta-fructofuranosidase, insoluble isoenzyme 1; 
AltName: Full=Cell wall beta-fructosidase 1; AltName: Full=Invertase 
1; AltName: Full=Sucrose hydrolase 1; Flags: Precursor 
[Daucus carota]
 gb|AAA03516.1| beta-fructosidase [Daucus carota]
Length=592

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/559 (57%), Positives = 399/559 (71%), Gaps = 13/559 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             GVE  A H +  NL+++        +RT +HFQP +NW+NDPNGPM YKGVYH FYQYNP
Sbjct  36    GVE--AFHEIHYNLQSVGAENVKQVHRTGYHFQPKQNWINDPNGPMYYKGVYHLFYQYNP  93

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
             KGA +G I W HS S DL+NW    PA+ PS+P  D  G  SGSATILP N P +LYTG+
Sbjct  94    KGAVWGNIVWAHSVSTDLINWTPLEPAIFPSKPF-DKYGCRSGSATILPGNKPVILYTGI  152

Query  1463  DS---RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
                  +N QVQN A+P N SDPYL++W+K   NPL+  N  N  NAT+FRDPTTAW    
Sbjct  153   VEGPPKNVQVQNYAIPANLSDPYLRKWIKPDNNPLVVAN--NGENATAFRDPTTAWLDKS  210

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSP-NGL  1116
             G+W++LVGSK  RRG+A LYRSKDF++W +AKHP+HS   +GMWECPDF+PVS    NGL
Sbjct  211   GHWKMLVGSKRNRRGIAYLYRSKDFIKWTKAKHPIHSQANTGMWECPDFFPVSLKGLNGL  270

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS+ G  +KHVLK+SLD +R++YYT+GTY   +D+YIPD  SVD  +GLRYDYG FYAS
Sbjct  271   DTSVTGESVKHVLKVSLDLTRYEYYTVGTYLTDKDRYIPDNTSVDGWAGLRYDYGNFYAS  330

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+D  K RRILWGW NES      V +GW+G+Q IPRT+WLD + KQL+QWP++ELE 
Sbjct  331   KTFFDPSKNRRILWGWANESDSTAHDVAKGWAGIQLIPRTLWLDPSGKQLMQWPIEELET  390

Query  755   LRSNKVEMPSTM-LKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLC  582
             LR +KV+      L KG + EV GI+AAQAD+EVTF      K E  + +W   D + +C
Sbjct  391   LRGSKVKFSRKQDLSKGILVEVKGITAAQADVEVTFSFKSLAKREPFDPKWLEYDAEKIC  450

Query  581   SQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD  402
             S KG++V+GG+GPFGL  LASE  +EYT VFFRVF   N +  VLMCSD TRSSL +   
Sbjct  451   SLKGSTVQGGVGPFGLLTLASEKLEEYTPVFFRVFKAQNTHK-VLMCSDATRSSLKEGLY  509

Query  401   KTSYGAFVDVN-PMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFN  225
             + S+  FVDV+    +++SLR LID+S+VESFGAKGK CI+SRVYPT A+ E AHLY FN
Sbjct  510   RPSFAGFVDVDLATDKKISLRSLIDNSVVESFGAKGKTCISSRVYPTLAVYENAHLYVFN  569

Query  224   NGVHSIKLSKLTAWSMKKP  168
             NG  +I +  L AWSMKKP
Sbjct  570   NGSETITVENLDAWSMKKP  588



>ref|XP_004515314.1| PREDICTED: beta-fructofuranosidase, cell wall isozyme-like isoform 
X4 [Cicer arietinum]
Length=522

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/524 (59%), Positives = 398/524 (76%), Gaps = 13/524 (2%)
 Frame = -1

Query  1688  MVYKGVYHFFYQYNPKGA--SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSG  1515
             M YKG+YH FYQ+NPKGA  S   I WGHS SKDLVNW +   AL PS+ + DING WSG
Sbjct  1     MRYKGLYHMFYQHNPKGAIWSNNSIVWGHSISKDLVNWLSLQHALIPSE-SYDINGCWSG  59

Query  1514  SATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINA  1335
             S+T+LPN+ P +LYTG+D    Q QNLA+P+N SDP L+EW+KSP NPL+ PN+ NKINA
Sbjct  60    SSTLLPNDKPKILYTGIDINQHQTQNLAIPKNVSDPLLREWIKSPNNPLMEPNNVNKINA  119

Query  1334  TSFRDPTTAWRGP-DGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWE  1158
             TSFRDPTTAW G  DG WR+L+GS+   +G+ IL++SKDF  W+Q K+P +S + +GMWE
Sbjct  120   TSFRDPTTAWIGHHDGFWRVLIGSQKKDKGILILFKSKDFFNWIQDKNPFYSAKNTGMWE  179

Query  1157  CPDFYPVSTSPN-GLDTSLV-GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKG--  990
             CPDF+PV  + + GLD S+  G  I+HV+K+SL +  HDYY IGTYD ++D ++PDKG  
Sbjct  180   CPDFFPVLINGSIGLDISINNGYGIRHVVKVSLIDVSHDYYFIGTYDTIKDVFVPDKGFD  239

Query  989   SVDNDSGL--RYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRT  816
              ++N+  L  RYDYGKFYASKTFYD  K+RR+LWGWINES I  + VK+GWSG+Q IPRT
Sbjct  240   KINNELSLVLRYDYGKFYASKTFYDGEKKRRVLWGWINESSIQEDDVKKGWSGIQAIPRT  299

Query  815   VWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEF  636
             +WL K+ KQL+QWP+ E+EKLRSN V + S +LK G + E+ G++AAQAD+E++F++ E 
Sbjct  300   LWLHKSGKQLIQWPIVEIEKLRSNHVNLHSKVLKGGKMLEIFGVTAAQADVEISFEVKEL  359

Query  635   GKAEKMEERWTTDPQVLCSQKGASVRG--GIGPFGLKVLASENRQEYTAVFFRVFMGNNN  462
              KA+ ++  W  DPQ LC + G+ V+G  G+GPFGL VLAS++ +EYT +FF+VF GN  
Sbjct  360   EKAQVLDPSWKLDPQHLCKENGSKVKGVVGLGPFGLLVLASKDMKEYTTIFFKVFRGNKK  419

Query  461   NPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCIT  282
             + VVLMC D  RSSL+   D  +YGAFVDV+P+ EELS+R LIDHS+VESFGA+GK CIT
Sbjct  420   H-VVLMCCDTRRSSLNHNNDLANYGAFVDVDPINEELSIRSLIDHSVVESFGAQGKACIT  478

Query  281   SRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN*LH  150
             +RVYPT AI +KAHL+ FNNG   +K+ KL AWSMKK  IN +H
Sbjct  479   TRVYPTLAINDKAHLHVFNNGTIDVKIKKLNAWSMKKAKINEMH  522



>sp|Q43089.1|INV1_PEA RecName: Full=Beta-fructofuranosidase, cell wall isozyme; AltName: 
Full=Acid invertase; AltName: Full=Sucrose hydrolase; 
Flags: Precursor [Pisum sativum]
 emb|CAA59677.1| beta-fructofuranosidase [Pisum sativum]
Length=555

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/536 (59%), Positives = 404/536 (75%), Gaps = 12/536 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPN----HTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQ  1653
             +  +A+H V Q LE L   + +      YRT++HFQP +NW+NDPNGPM Y G YH FYQ
Sbjct  18    IPIEATHHVYQTLETLSSHHSSKSNHQPYRTAYHFQPLKNWINDPNGPMRYGGFYHLFYQ  77

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             YNPKGA +G I W HS SKDLVNW     A+ PSQP+ DI G WSGSATILP   PA+LY
Sbjct  78    YNPKGAVWGNIVWAHSVSKDLVNWTPLDHAIHPSQPS-DIKGCWSGSATILPGGKPAILY  136

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D  N QVQN+A+P+N SDP L+EW KSP+NPL+ P   NKIN++SFRDPTT+W G D
Sbjct  137   TGIDPNNHQVQNIAIPKNMSDPLLREWKKSPKNPLMEPTIANKINSSSFRDPTTSWLGKD  196

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPV---STSPN  1122
             G WR+L+GSK+  +G+AILY+SK+FV WV+AKHPLHS EG+GMWECPDFYPV   +    
Sbjct  197   GFWRVLIGSKIDTKGMAILYKSKNFVDWVEAKHPLHSAEGTGMWECPDFYPVLDKNLLRT  256

Query  1121  GLDTSLVG-SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKF  945
             G+DTS  G   ++HVLK+SLD+++HD+Y IG+YD V+D ++P+ G  DN   LRYDYGK+
Sbjct  257   GVDTSRNGDDDVRHVLKVSLDDTKHDHYLIGSYDVVKDVFVPENGFEDNGFVLRYDYGKY  316

Query  944   YASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQE  765
             YASKTF+D  K RRIL GW+NES    + VK+GWSG+  IPR +WL ++ KQLVQWPV+E
Sbjct  317   YASKTFFDDGKNRRILLGWVNESSSVADDVKKGWSGIHTIPREIWLHESGKQLVQWPVKE  376

Query  764   LEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVL  585
             +E LR N V  P+ ++K G    ++G+ + QAD+E++F+I + GK E +  +W  DPQ+L
Sbjct  377   IENLRMNPVNWPTKVIKGGERISITGVDSVQADVEISFEISDLGKVESL-RKW-IDPQLL  434

Query  584   CSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKT  405
             CSQKGA V+GG+GPFGL V AS+  +EYTAVFFR+F   + N +VLMCSDQ+RSSL+K  
Sbjct  435   CSQKGAGVKGGVGPFGLLVFASQGLKEYTAVFFRIFKYQDKN-LVLMCSDQSRSSLNKDN  493

Query  404   DKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHL  237
             D TSYG FVDV+P+ E+LSLR LIDHS+VESFG +G+ C+T+RVYPT AI +KA L
Sbjct  494   DMTSYGTFVDVDPLHEKLSLRTLIDHSVVESFGGEGRACVTARVYPTLAIHDKAML  549



>emb|CAB95010.1| invertase [Beta vulgaris subsp. vulgaris]
Length=501

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/503 (61%), Positives = 385/503 (77%), Gaps = 5/503 (1%)
 Frame = -1

Query  1664  FFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMP  1485
              FYQYNP G  +G   WGHSTSKDLVNW      + P   AA+ING+WSGSATILP N P
Sbjct  1     LFYQYNPNGVIWGPPVWGHSTSKDLVNWVPQPLTMEPEM-AANINGSWSGSATILPGNKP  59

Query  1484  ALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAW  1305
             A+L+TG+D +  QVQ LA P++ SDP L+EW  +P+NP++ P   N+INATSFRDPTTAW
Sbjct  60    AILFTGLDPKYEQVQVLAYPKDTSDPNLKEWFLAPQNPVMFPTPQNQINATSFRDPTTAW  119

Query  1304  RGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSP  1125
             R PDG WR+L+GSK G+RGL++L+RS+DFV WVQAKHPL+S + SGMWECPDF+PV  + 
Sbjct  120   RLPDGVWRLLIGSKRGQRGLSLLFRSRDFVHWVQAKHPLYSDKLSGMWECPDFFPVYANG  179

Query  1124  N--GLDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYG  951
             +  G+DTS++GS +KHVLK SLD ++HD YTIG Y+  +D Y PD G + NDS LRYDYG
Sbjct  180   DQMGVDTSIIGSHVKHVLKNSLDITKHDIYTIGDYNIKKDAYTPDIGYM-NDSSLRYDYG  238

Query  950   KFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPV  771
             K+YASKTF+D  K+ RIL GW NES    + +K+GWSG+  IPR +WLDK  KQL+QWP+
Sbjct  239   KYYASKTFFDDAKKERILLGWANESSSVEDDIKKGWSGIHTIPRKIWLDKLGKQLIQWPI  298

Query  770   QELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQ  591
               +EKLR   V +   +LK GS  EVSGI+AAQAD+E++FKI +    EK +  WT+ PQ
Sbjct  299   ANIEKLRQKPVNIYRKVLKGGSQIEVSGITAAQADVEISFKIKDLKNVEKFDASWTS-PQ  357

Query  590   VLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDK  411
             +LCS+KGASV+GG+GPFGL  LAS   +EYTAVFFR+F   +N  VVLMCSDQ+RSSL+ 
Sbjct  358   LLCSKKGASVKGGLGPFGLLTLASXGLEEYTAVFFRIFKAYDNKFVVLMCSDQSRSSLNP  417

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               DKT+YG FVDVNP++E LSLR+LIDHS+VESFGAKGK  IT+RVYPT AI EKAHLY 
Sbjct  418   TNDKTTYGTFVDVNPIREGLSLRVLIDHSVVESFGAKGKNVITARVYPTLAINEKAHLYV  477

Query  230   FNNGVHSIKLSKLTAWSMKKPTI  162
             FN G  +++++ LTAWSMKK  I
Sbjct  478   FNRGTSNVEITGLTAWSMKKANI  500



>ref|XP_007012302.1| Glycosyl hydrolases family 32 protein, putative [Theobroma cacao]
 gb|EOY29921.1| Glycosyl hydrolases family 32 protein, putative [Theobroma cacao]
Length=582

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/530 (58%), Positives = 389/530 (73%), Gaps = 8/530 (2%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHI  1569
             YRT++HFQPP+NWMNDPNGP+ YKG+YH FYQYNP  A +G ISW HS S DLVNW    
Sbjct  48    YRTAYHFQPPKNWMNDPNGPLYYKGIYHLFYQYNPYAAVWGNISWAHSISYDLVNWIHLD  107

Query  1568  PALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWV  1389
              ALSP  P  DING WSGS TIL    P +LYTG D+ NRQVQNLAVP+N SDP+L EWV
Sbjct  108   HALSPEDPF-DINGCWSGSTTILSREKPVILYTGSDTENRQVQNLAVPKNLSDPFLVEWV  166

Query  1388  KSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRW  1209
             KS  NPL+ P   + I+  +FRDPTTAW+GPDG WR+LVG+++   G A+LYRS+DFV W
Sbjct  167   KSSHNPLMTP--VDGIDPQNFRDPTTAWQGPDGLWRVLVGNQMNGHGRALLYRSQDFVSW  224

Query  1208  VQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLVGSKIKHVLKISLDESRHDYYTIG  1032
              ++K PLHS   + MWECPDFYPV+     G+DTS +    KHVLK S +   HDYY +G
Sbjct  225   TRSKDPLHSSTKTDMWECPDFYPVAIDGKYGVDTSSLEKFTKHVLKASFNH--HDYYILG  282

Query  1031  TYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVK  852
              Y    + +  D   +DN S LRYDYG+FYASKTF+DS K+RRILW WI ES   T  +K
Sbjct  283   NYTPTTENFSVDTDFMDNGSDLRYDYGQFYASKTFFDSAKKRRILWSWIQESENTTYDIK  342

Query  851   QGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQ  672
             +GWSG+Q IPR++ L KT KQL+QWPV+E+E+LR+  V   S  LK GSV EVSGI+A+Q
Sbjct  343   KGWSGLQSIPRSILLSKTGKQLIQWPVEEIEELRAKNVSYQSKQLKGGSVLEVSGITASQ  402

Query  671   ADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAV  492
             AD+E++F +    +AE M+  W  DPQ++CSQK AS RG +GPFG+ VLAS++  E TA+
Sbjct  403   ADVEISFDLSNLKEAELMDPSW-VDPQLVCSQKTASFRGSVGPFGILVLASKDLTEQTAI  461

Query  491   FFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVES  312
             FFR+F  ++   VVLMCSDQ+RSSL +  +K SYGAF+D++P+ E++SLR LIDHSIVES
Sbjct  462   FFRIFRSHDKY-VVLMCSDQSRSSLREGPNKASYGAFIDIDPLYEKISLRSLIDHSIVES  520

Query  311   FGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTI  162
             FG +G+VCIT+RVYP  A  E+A+LYAFNNG   + +S L AW+MKK  I
Sbjct  521   FGGEGRVCITARVYPKLATDEQAYLYAFNNGTFDVTISNLNAWNMKKAQI  570



>gb|ADF27781.1| cell-wall invertase [Orobanche ramosa]
Length=586

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/567 (56%), Positives = 403/567 (71%), Gaps = 19/567 (3%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GG+  Q SH V   L ++        +RT++HFQP +NW+NDPNGPM Y G+YH FYQYN
Sbjct  20    GGI-VQGSHDVFAQLRSVPAVDVTQVHRTAYHFQPTKNWINDPNGPMYYNGIYHLFYQYN  78

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPA--LLY  1473
             PKGA +G I W HS SKDL+NW    PA+ PSQP  D  G WSGSATILP   P   +LY
Sbjct  79    PKGAVWGNIVWAHSVSKDLINWAKVEPAIYPSQPF-DKYGCWSGSATILPGKTPKPIILY  137

Query  1472  TG-VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP  1296
             TG VD  N QVQN AVP +P+DPYL++W+K   NPL+  +    +N +SFRDPTT W GP
Sbjct  138   TGIVDENNTQVQNYAVPADPTDPYLRKWIKPNNNPLVVAD--KSVNGSSFRDPTTGWLGP  195

Query  1295  DGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPNGL  1116
             DGNWRI +GS+   RG++ LYRS+DF+ W + KHPLHS  G+G WECPDF+PVS S  GL
Sbjct  196   DGNWRITIGSRRKHRGVSYLYRSRDFIHWTKGKHPLHSTAGTGNWECPDFFPVSVS-GGL  254

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS++G  +KHV K+SLDE+R++YYTIG Y   +D+YIPDKG +D   GLRYDYG FYAS
Sbjct  255   DTSVMGPNVKHVFKVSLDETRYEYYTIGKYYPEKDRYIPDKGMIDGWDGLRYDYGNFYAS  314

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             K+F+D  K RRILWGW NES      VK+GW+G+Q IPRT+ LD + KQLVQWP++E+E 
Sbjct  315   KSFFDPKKNRRILWGWANESDSTEMDVKKGWAGIQLIPRTIVLDPSGKQLVQWPIEEVET  374

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCS  579
             LR N+V++ S  L KG   E++GI+AAQAD++VTF      KAE  + RW   D Q LCS
Sbjct  375   LRRNEVQLRSLKLAKGEKIEITGITAAQADVDVTFSFNSLDKAEPFDPRWDKYDGQKLCS  434

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP-VVLMCSDQTRSSL-DKKT  405
             +KG++V+GG+GPFGL  LAS N +EYT VFFR+F    +N  +VL+CSD +RS+L D +T
Sbjct  435   RKGSTVQGGLGPFGLLTLASHNLEEYTPVFFRLFKAQQHNKHLVLLCSDASRSTLMDDET  494

Query  404   D--------KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGE  249
             +        + S+  FVDV+   ++L+LR LID+S+VESFGA GK  ITSRVYPT A+ E
Sbjct  495   NMKDGRDAYRPSFAGFVDVDLKDKKLTLRSLIDNSVVESFGAGGKTVITSRVYPTLAVYE  554

Query  248   KAHLYAFNNGVHSIKLSKLTAWSMKKP  168
              A LYAFNNG  ++K+  L AWSM KP
Sbjct  555   NARLYAFNNGTETVKIESLNAWSMSKP  581



>ref|NP_001052747.1| Os04g0413200 [Oryza sativa Japonica Group]
 sp|Q0JDC6.1|INV3_ORYSJ RecName: Full=Beta-fructofuranosidase, insoluble isoenzyme 3; 
AltName: Full=Cell wall beta-fructosidase 3; AltName: Full=Invertase 
3; AltName: Full=OsCIN3; AltName: Full=Sucrose hydrolase 
3; Flags: Precursor [Oryza sativa Japonica Group]
 sp|Q01IS8.2|INV3_ORYSI RecName: Full=Beta-fructofuranosidase, insoluble isoenzyme 3; 
AltName: Full=Cell wall beta-fructosidase 3; AltName: Full=Invertase 
3; AltName: Full=OsCIN3; AltName: Full=Sucrose hydrolase 
3; Flags: Precursor [Oryza sativa Indica Group]
 gb|AAO63553.1| apoplastic invertase [Oryza sativa Indica Group]
 gb|AAT84403.1| cell-wall invertase 3 [Oryza sativa Japonica Group]
 dbj|BAF14661.1| Os04g0413200 [Oryza sativa Japonica Group]
 gb|EEC77246.1| hypothetical protein OsI_15820 [Oryza sativa Indica Group]
 gb|EEE60967.1| hypothetical protein OsJ_14738 [Oryza sativa Japonica Group]
Length=586

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/555 (54%), Positives = 401/555 (72%), Gaps = 16/555 (3%)
 Frame = -1

Query  1787  NLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGH  1608
              L++L+  + +   RT +HFQPP++W+NDPNGPM YKG+YH FYQYNPKGA +G I W H
Sbjct  33    ELQSLEAKHVDGKLRTGYHFQPPKHWINDPNGPMYYKGLYHLFYQYNPKGAVWGNIEWAH  92

Query  1607  STSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAV  1428
             S S DL++W A  P + PS+   D  G WSGSAT+LP+ +P ++YTG+D   RQVQN+A 
Sbjct  93    SVSTDLIDWTALEPGIYPSK-TFDEKGCWSGSATVLPSGVPVIMYTGIDPDERQVQNVAY  151

Query  1427  PRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRG  1248
             P N SDPYL+EW K   NP+I P+    INA++FRDPTTAW GPDG+WR+LVGSKV  +G
Sbjct  152   PVNLSDPYLREWYKPDYNPIINPD--GGINASAFRDPTTAWYGPDGHWRLLVGSKVNMKG  209

Query  1247  LAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN------GLDTS-----LV  1101
             LA+LYRS+DF +WV+A HPLHS   +GMWECPDF+PV+ +        G+DT+      V
Sbjct  210   LAVLYRSRDFKKWVKAHHPLHSAH-TGMWECPDFFPVAVAGGSRHYRRGVDTAELHDAAV  268

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
               ++K+VLK+SLD +R++YYT+G YDH  D+Y+PD    DND GLRYDYG FYASK+FYD
Sbjct  269   AEEVKYVLKVSLDLTRYEYYTVGWYDHATDRYVPDAAFPDNDYGLRYDYGDFYASKSFYD  328

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               KRRRI+WGW NES    +  ++GW+G+Q IPR +WL    KQLVQWPV+EL+ LR+  
Sbjct  329   PAKRRRIVWGWANESDTVPDDRRKGWAGIQAIPRKLWLSADGKQLVQWPVEELKALRAKH  388

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASV  561
             V +   ++KKG+  EV+G  + Q+D+++ F I +  KAE+ +  W TD + LC + G+ V
Sbjct  389   VNVTDKVIKKGNYFEVTGFKSVQSDVDMAFAIKDLSKAEEFDPAWRTDAEALCKKLGSDV  448

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAF  381
              GG+GPFGL  LAS + +E TAVFFRVF  N+++ VVLMC+D TRSS + K  + ++  F
Sbjct  449   DGGVGPFGLWALASGDLKERTAVFFRVFKANDSSHVVLMCNDPTRSSYESKIYRPTFAGF  508

Query  380   VDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             VDV+  + ++++LR LIDHS+VESFGA+GK CI +RVYP KA+G+ AHL+ FNNG   +K
Sbjct  509   VDVDIAKNKQIALRTLIDHSVVESFGARGKTCILTRVYPRKAVGDDAHLFVFNNGESDVK  568

Query  203   LSKLTAWSMKKPTIN  159
             ++ L AW MK P +N
Sbjct  569   VTNLDAWEMKTPKMN  583



>ref|XP_008442862.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Cucumis melo]
Length=575

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/556 (55%), Positives = 391/556 (70%), Gaps = 9/556 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQ--PPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPK  1641
              +A H +   L+++Q         +RT FHFQP RNW+NDPNGPM + G+YH FYQYNPK
Sbjct  25    VEALHKIYPELQSIQTDASVVKPLHRTRFHFQPRRNWINDPNGPMYFNGIYHLFYQYNPK  84

Query  1640  GASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVD  1461
             GA +G I W HS S+DL+NW+    A+ PS+P  DING WSGSAT+LP N P +LYTG+D
Sbjct  85    GAVWGNIVWAHSISRDLINWKPLKAAIYPSKPF-DINGCWSGSATVLPGNKPVILYTGID  143

Query  1460  SRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
              +NRQVQN A+P N SDPYL EW+K   NP++ P     +NA++FRDPTTAW    G+W+
Sbjct  144   PQNRQVQNYAIPANLSDPYLTEWIKPDHNPIVDPG--PGVNASAFRDPTTAWLSKSGHWK  201

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSL  1104
              ++GSK  RRG+A LYRS+DFV+W +AKHPLHS   +GMWECPDFYPV      GLD S+
Sbjct  202   TIIGSKRKRRGMAYLYRSRDFVKWTKAKHPLHSAANTGMWECPDFYPVPLRGRLGLDPSV  261

Query  1103  VGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFY  924
              G+ +KHVLK+SLD +R++YYT+G Y   +DKY+PD  SVD  SGLRYDYG FYASK+FY
Sbjct  262   TGNWVKHVLKVSLDLTRYEYYTVGKYFPKKDKYVPDNTSVDGWSGLRYDYGNFYASKSFY  321

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             D L++RR+LWGW NES    + V +GW+G+Q IPRTVWLD  +KQL+QWPV+EL  LR  
Sbjct  322   DPLRKRRVLWGWANESDSAQDDVSKGWAGIQLIPRTVWLDHNQKQLIQWPVEELNTLRGK  381

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
             KV +    L KG   EV GI+AAQAD+EV F      KAE  + RW  D Q  C Q G  
Sbjct  382   KVVLSHQKLLKGHTVEVKGITAAQADVEVIFSFSSLDKAEPFDPRW-VDAQAACDQLGLK  440

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL-DKKTDKTSYG  387
              +GG+GPFGL  LASEN +E+T VFFR+F  ++ + VVLMCSD   SSL +    K ++ 
Sbjct  441   SQGGVGPFGLLTLASENLEEFTPVFFRIFKAHHKH-VVLMCSDARSSSLKEDGLYKPAFA  499

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
              +VD++   ++LSLR LIDHS+VESFG  GK CITSRVYPTK +   AHL+ FNNG  +I
Sbjct  500   GYVDIDLSSKKLSLRSLIDHSVVESFGGGGKTCITSRVYPTKGVFNDAHLHVFNNGTEAI  559

Query  206   KLSKLTAWSMKKPTIN  159
              +  L+AWSMK   +N
Sbjct  560   TVEYLSAWSMKSARVN  575



>ref|XP_009600222.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
isoform X1 [Nicotiana tomentosiformis]
Length=584

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/555 (58%), Positives = 393/555 (71%), Gaps = 10/555 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
              SH V  +L++       + +RT FHFQPP++W+NDPN PM Y G+YH FYQYNPKG+ +
Sbjct  33    GSHKVYIDLQSSSAVNVKNVHRTGFHFQPPKHWINDPNAPMYYNGIYHLFYQYNPKGSVW  92

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  G WSGSATILP+N P +LYTG VDS  
Sbjct  93    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGTWSGSATILPSNKPIILYTGLVDSNK  151

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN AVP N SDPYL+EW+K   NPLI P+    IN T FRDPTTAW G DG+WRILV
Sbjct  152   TQVQNYAVPANLSDPYLREWIKPDNNPLIVPDI--SINKTQFRDPTTAWMGQDGHWRILV  209

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGS  1095
             GS   +RGLAILY+S+DF+RWV+AKHPLHS   +G WECPDFYPVS  S  GLD S  G 
Sbjct  210   GSLRKQRGLAILYKSRDFIRWVKAKHPLHSSANTGNWECPDFYPVSLQSTKGLDASYYGE  269

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
               K+VLK SLD +R +YYTIGTYD  RD+YIPD   +D   GLR DYG FYASK+FYD +
Sbjct  270   NTKYVLKNSLDVTRFEYYTIGTYDTKRDRYIPDNTFIDGWKGLRLDYGNFYASKSFYDPI  329

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQLVQWPV+ELE LR  KV
Sbjct  330   KNRRIVWGWTNESDILPDDDIKKGWAGIQAIPRKVWLDPSGKQLVQWPVEELETLRKQKV  389

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASV  561
             ++ +  L KG + EV GI+ AQAD+EVTF      KAE+   +W     Q +C+ KG+++
Sbjct  390   QLSNKKLNKGEMVEVKGITPAQADVEVTFSFSSLDKAEQFNPKWADLYAQDVCAIKGSTI  449

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSYG  387
             +GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS+L   +   K S+ 
Sbjct  450   QGGLGPFGLVTLASKNLEEYTPVFFRVFKAQRNYK-VLMCSDARRSTLKHSEAMYKPSFA  508

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
              +VDV+ + ++LSLR LID+S+VESFGA GK CITSRVYPT AI + AHL+AFNNG   I
Sbjct  509   GYVDVDLVGKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHDNAHLFAFNNGTEKI  568

Query  206   KLSKLTAWSMKKPTI  162
             K+  L AWSM    I
Sbjct  569   KIETLNAWSMGTSNI  583



>ref|XP_004515216.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Cicer arietinum]
Length=573

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/556 (57%), Positives = 396/556 (71%), Gaps = 9/556 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +A H +  +L+++  P  +  +RT +HFQP RNW+NDPNGPM YKGVYH FYQYNPKGA
Sbjct  23    VEAFHRIYPHLQSVSTPSVSKLHRTGYHFQPIRNWINDPNGPMYYKGVYHLFYQYNPKGA  82

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DS  1458
              +G I WGHS SKDL+NW+   PAL PS+P  D  G WSGSATILP   P +LYTGV D 
Sbjct  83    VWGNIVWGHSVSKDLINWKQLQPALYPSKPF-DKYGCWSGSATILPGQGPVILYTGVVDK  141

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPR-NPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
             R+ +VQ LA+P N SDP+L +WVK  R NP++  +H   +N + FRDPTTAW G DG+WR
Sbjct  142   RSNEVQCLAIPANASDPFLTKWVKPDRLNPIVIADH--SMNGSVFRDPTTAWLGKDGHWR  199

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSL  1104
             +L+G K    GLA LYRSKDFV+W++AKHP+HS + +GMWECPDFYPVS +  NGLD S+
Sbjct  200   MLIGGKKKDSGLAYLYRSKDFVKWIRAKHPIHSAKTTGMWECPDFYPVSLNGKNGLDASM  259

Query  1103  VGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFY  924
              G+ +KHVLK SLD +R++YYTIGTY   +DKYIPD  S D   GLRYDYG FYASK+F+
Sbjct  260   TGNSVKHVLKNSLDMTRYEYYTIGTYLQNKDKYIPDNTSEDGWGGLRYDYGNFYASKSFF  319

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             D  K RRI+WGW NES    + VK+GW+G+Q IPRTVWLD   +QL QWPV+EL  LR  
Sbjct  320   DPSKNRRIIWGWANESDSKEDDVKKGWAGIQAIPRTVWLDSGGRQLRQWPVEELNTLRGK  379

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
             KVE+ +  LKKG   EV GI+AAQAD+EVT       KAE+ + RW  + + LC+ KG++
Sbjct  380   KVEIGNQKLKKGDYVEVKGITAAQADVEVTLSFSSLDKAEEFDPRW-VNAEDLCALKGSN  438

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
             V+GG+GPFGL  LAS+  +EYT VFFR+F  +N + V+LMCSD   SS + +  K S+  
Sbjct  439   VQGGVGPFGLLTLASQKLEEYTPVFFRIFKASNKH-VILMCSDARSSSSNIELYKPSFAG  497

Query  383   FVDVNPMQE-ELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
             FVDV+     +LSLR LIDHS+VESFGA GK  I SRVYP  A+ EKAHL+ FNNG   I
Sbjct  498   FVDVDLANNMKLSLRSLIDHSVVESFGAGGKTNILSRVYPKLAVKEKAHLFVFNNGNEQI  557

Query  206   KLSKLTAWSMKKPTIN  159
              +  L AWSMK    N
Sbjct  558   TVENLKAWSMKSARRN  573



>emb|CAA84526.1| beta-fructofuranosidase; cell wall invertase I; fructosidase 
[Vicia faba var. minor]
Length=575

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/557 (57%), Positives = 399/557 (72%), Gaps = 10/557 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +A H +   L+++  P  N  +RT FHFQP RNW+NDPNGPM Y+G+YH FYQYNPKGA
Sbjct  24    VEAFHDIYPGLQSISAPSVNKLHRTGFHFQPNRNWINDPNGPMYYRGIYHLFYQYNPKGA  83

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DS  1458
              +G I WGHS SKDL+NW+   PAL PS+P  D  G WSGSATILP   P +LYTGV D 
Sbjct  84    VWGNIVWGHSVSKDLINWKELEPALFPSKPF-DKYGCWSGSATILPGKGPVILYTGVVDK  142

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPR-NPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
             ++ +VQ +A+P N S P L  W K  R NP++  +H  ++N + FRDPTTAW G DG+WR
Sbjct  143   QSNEVQCIAIPANASVPLLTNWGKPDRLNPILTADH--RMNGSVFRDPTTAWFGKDGHWR  200

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSL  1104
             IL+G K G  G+A LYRSK+F++W++AKHP+HS + +GMWECPDFYPVS    NGLD S+
Sbjct  201   ILIGGKTGDTGVAYLYRSKNFLKWIRAKHPIHSAKRTGMWECPDFYPVSLEGKNGLDLSM  260

Query  1103  V-GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
             + G+ +KHVLK SLD +R++YYTIGTY   +DKYIPDK S D   GLRYDYG FYASK+F
Sbjct  261   MMGNNVKHVLKNSLDITRYEYYTIGTYLQNQDKYIPDKTSEDGWGGLRYDYGNFYASKSF  320

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +D  K RRI+WGW NES    + VK+GW+G+Q IPRTVWLD +R+QL QWPV+EL +LR 
Sbjct  321   FDPTKNRRIIWGWANESDTKEDDVKKGWAGIQAIPRTVWLDSSRRQLRQWPVEELNRLRG  380

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
              +VEM +  LKKG   EV GI+A+QAD+EVTF      KAE  +  W  + + LC+QKG+
Sbjct  381   KQVEMKNRKLKKGGYLEVKGITASQADVEVTFSFSSLDKAEAFDPNW-ENAEDLCAQKGS  439

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
              VRGG+GPFGL  LAS+  +EYT+VFFRVF   N +  +LMCSD   SSL+++  K S+ 
Sbjct  440   KVRGGVGPFGLLTLASKKLEEYTSVFFRVFKAANKHK-ILMCSDAKSSSLNRELYKPSFA  498

Query  386   AFVDVN-PMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              FV+V+    ++LSLR LIDHS+VESFG  GK  I SRVYPT A+ EKAHL+ FNNG   
Sbjct  499   GFVNVDLGNNKKLSLRSLIDHSVVESFGVGGKTNILSRVYPTLALKEKAHLFVFNNGTEH  558

Query  209   IKLSKLTAWSMKKPTIN  159
             I +  L AWSMK  + N
Sbjct  559   ITVENLKAWSMKTASRN  575



>gb|AFR69122.1| cell wall invertase [Manihot esculenta]
Length=576

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/553 (57%), Positives = 393/553 (71%), Gaps = 8/553 (1%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
              SH +    +  +    +  +RT++HFQPP NW+NDPNGPM YKG+YH FYQYNPKGA +
Sbjct  24    GSHRIYVEYQNFKADKVSQVHRTAYHFQPPMNWINDPNGPMYYKGLYHLFYQYNPKGAVW  83

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNR  1449
             G I W HS SKDL+NW A   A+ PS+   D NG WSGS TILP++ P +LYTG+D + R
Sbjct  84    GNIVWAHSVSKDLINWEALEHAIYPSK-EFDKNGCWSGSVTILPDDKPVILYTGIDPKKR  142

Query  1448  QVQNLAVPRNPSDPYLQEWVK-SPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
             QVQN AVP+N SDPYL+EW K    NP++ P+    +NA++FRDPTTAW   DG WR++V
Sbjct  143   QVQNYAVPKNLSDPYLREWDKPDDHNPIVDPD--KSVNASAFRDPTTAWL-VDGQWRMVV  199

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGS  1095
             GS+    G+A LYRSKDF  WV+A+ PLHS E +GMWECPDF+PVS S  NGLDTS+   
Sbjct  200   GSRDKDTGIAYLYRSKDFKEWVKAESPLHSLEKTGMWECPDFFPVSLSGENGLDTSVFEK  259

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
             K KH  K+SLD +R++YYTIGTYD   DKYIPD+ S+D  SGLR+DYG FYASKTF+D  
Sbjct  260   KGKHAFKVSLDVTRYEYYTIGTYDKENDKYIPDEDSIDGWSGLRFDYGNFYASKTFFDPS  319

Query  914   KRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE  735
             K RRILWGW NES    +  ++GW+G+Q IPR VWLD   KQLVQWPV+ELE LR+N+V+
Sbjct  320   KHRRILWGWANESDTVKDDKEKGWAGIQAIPRKVWLDANGKQLVQWPVEELETLRTNEVQ  379

Query  734   MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASVR  558
             + +  L+KG   EV GI+AAQAD++VTF      KAE  + +W   D   +C+QKG+ V 
Sbjct  380   LSNQKLQKGEHIEVKGITAAQADVDVTFSFPSLDKAESFDPKWEKLDALDVCAQKGSKVE  439

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             GG+GPFGL  LASE  +E+T VFFR+F     +  VL+CSD + SSL     K S+  FV
Sbjct  440   GGLGPFGLLTLASEKLEEFTPVFFRIFKAPTKH-AVLLCSDASSSSLGNGLYKPSFAGFV  498

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             DV+    +LSLR LIDHS+VESFGA+GK  I SRVYPT AI  KAHL+ FNNG  +I + 
Sbjct  499   DVDLTNNKLSLRSLIDHSVVESFGAEGKTVILSRVYPTLAILGKAHLFVFNNGSETITME  558

Query  197   KLTAWSMKKPTIN  159
             KL AWSMKKP +N
Sbjct  559   KLGAWSMKKPQMN  571



>emb|CDM80288.1| unnamed protein product [Triticum aestivum]
Length=586

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/573 (52%), Positives = 409/573 (71%), Gaps = 16/573 (3%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
                  QASH+V   L++L+        RT +HFQPP++W+NDPNGPM YKG+YH FYQYN
Sbjct  18    AATAVQASHVVYPELQSLEAKEVATELRTGYHFQPPKHWINDPNGPMYYKGLYHLFYQYN  77

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             P+GA +G I W HS S DL++W A  PA+ P++P  D+NG WSGSAT+LPN++P ++YTG
Sbjct  78    PRGAVWGNIIWAHSVSTDLIHWVALQPAIYPTRPF-DVNGCWSGSATLLPNDVPIIMYTG  136

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             +D    QVQN+A P N SDP+L+EWVK   NP+I P+H   IN ++FRDPTTAW GPDG+
Sbjct  137   IDPDKNQVQNVAYPANLSDPFLREWVKPEYNPIITPDH--GINVSAFRDPTTAWYGPDGH  194

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST------SP  1125
             WR++VG+K   RG+A LYRS+DF +WV+A+H LH+G  +GMWECPDF+PV+         
Sbjct  195   WRLVVGTKENMRGIAALYRSRDFKKWVKARHSLHAGL-TGMWECPDFFPVAVVGGSRHHQ  253

Query  1124  NGLDTS-----LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRY  960
              G+DT+      +   +K+VLK+SL+ +R+DYYT+GTY+H +++Y PD    DND GLRY
Sbjct  254   RGVDTAELHDRALAEDVKYVLKVSLELTRYDYYTVGTYNHDKERYTPDPAFPDNDYGLRY  313

Query  959   DYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQ  780
             DYG FYASK+F+D  K+RR+LWGW NES   T+   +GW+G+Q IPR ++L ++ +QL+Q
Sbjct  314   DYGDFYASKSFFDPAKKRRVLWGWANESDTVTDDRHKGWAGIQAIPRKIFLSRSGRQLIQ  373

Query  779   WPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT  600
             WPV+E++ LRS  + + +  +K G   EV+G  + Q+D+E  F I    KAEK +  W T
Sbjct  374   WPVEEVKSLRSKHINVSNKAVKGGEYFEVTGFKSVQSDVEAAFSIRNLDKAEKFDPSWRT  433

Query  599   DPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSS  420
             D Q LC +  + V+GG+GPFGL +LAS++ +E TAVFFRVF  N+ N VVLMC+D TRSS
Sbjct  434   DAQGLCKKFNSHVKGGVGPFGLWLLASDDLEERTAVFFRVFKTNDTNYVVLMCNDPTRSS  493

Query  419   LDKKTDKTSYGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKA  243
              + +  + ++  FV+V+  + ++++LR LIDHS+VESFGA GK CI +RVYP KAIG+ A
Sbjct  494   YESQIYRPTFAGFVNVDIAKTKKIALRTLIDHSVVESFGAGGKTCILTRVYPRKAIGDDA  553

Query  242   HLYAFNNGVHSIKLSKLTAWSMKKPTIN*LHPQ  144
             HL+ FNNG   IK++ L AW MK PT+N L  Q
Sbjct  554   HLFVFNNGESDIKVTNLHAWEMKTPTMNKLLEQ  586



>ref|XP_010912306.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 4-like 
[Elaeis guineensis]
Length=576

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/532 (56%), Positives = 386/532 (73%), Gaps = 6/532 (1%)
 Frame = -1

Query  1748  YRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHI  1569
             YRT++HFQPP+NWMNDPNGPM Y G+YH FYQYNP  A +G I+WGHSTS DL+NW    
Sbjct  45    YRTAYHFQPPKNWMNDPNGPMYYNGIYHLFYQYNPFSAVWGNITWGHSTSTDLINWTPQD  104

Query  1568  PALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWV  1389
             PA+ PS+P  DING W+GSATILP N P +LYTG D++NRQVQN+A P+N SDP+L+EW+
Sbjct  105   PAIKPSKPF-DINGCWTGSATILPGNKPVILYTGSDTQNRQVQNVAFPKNLSDPFLREWM  163

Query  1388  KSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRW  1209
             K   NPL+ P   + INA+ FRDP TAW G DG+WR+ VG+++   G AILY+S DFV W
Sbjct  164   KPDYNPLMEP--VDGINASQFRDPMTAWHGSDGHWRVAVGAEIKGNGTAILYKSGDFVHW  221

Query  1208  VQAKHPLHSGEGSGMWECPDFYPV-STSPNGLDTSLVGSKIKHVLKISLDESRHDYYTIG  1032
             ++A  PLH+  GSGMWECPDFYPV S    GLDTS     +KHVLK+SL E+  D+Y +G
Sbjct  222   MRAASPLHTSRGSGMWECPDFYPVLSKGRQGLDTSENSKDVKHVLKMSLGETHSDHYMLG  281

Query  1031  TYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVK  852
              YD  +D ++PDK   D  + LRYDYG FYASKTF+D  K+RRILW W+NES    + + 
Sbjct  282   RYDLEKDIFVPDKMVDDYRAWLRYDYGNFYASKTFFDVKKKRRILWAWLNESDTKADGLL  341

Query  851   QGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQ  672
             +GW G+Q +PRT+WLD   +QLVQWPV+ELE LR N   + +T +K G + E+ G+ A+Q
Sbjct  342   KGWQGIQAVPRTIWLDSNGRQLVQWPVKELESLRRNGAHLHNTEIKTGGLFEIKGVKASQ  401

Query  671   ADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAV  492
             AD+EV F++     A+  +  W  DP  LC  + ASV+GG+GPFGL +LAS N +E+TAV
Sbjct  402   ADIEVDFELPNLEIAKPFDPSWLIDPPKLCRDEDASVQGGLGPFGLLILASHNLEEHTAV  461

Query  491   FFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQE-ELSLRILIDHSIVE  315
             FFRV+  +N + +VL+CSDQ RSSL  + DK +YG+FVD++  +E ++SLR LIDHS+VE
Sbjct  462   FFRVYKAHNRH-MVLLCSDQRRSSLRPEVDKPAYGSFVDIDIKKEGKISLRTLIDHSVVE  520

Query  314   SFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             SF   G+ CIT+RVYP   +    HLYAFNNG  ++K+SKL AW M KP IN
Sbjct  521   SFAGGGRTCITARVYPEVLVTGDIHLYAFNNGTETVKVSKLQAWDMAKPWIN  572



>gb|EYU35515.1| hypothetical protein MIMGU_mgv1a003330mg [Erythranthe guttata]
Length=592

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/563 (56%), Positives = 401/563 (71%), Gaps = 21/563 (4%)
 Frame = -1

Query  1814  TQASHIVL-QNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKG  1638
               ASH V  +++ +L        +R+ +HFQP ++W+NDPNGPM Y GVYH FYQYNPKG
Sbjct  32    VDASHDVFSEDVLSLSAVNVKKEHRSGYHFQPTKHWINDPNGPMYYNGVYHLFYQYNPKG  91

Query  1637  ASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VD  1461
             A +G I W HS SKDL+NW+    A+ PS+P  D  G WSGSAT+LP N P +LYTG VD
Sbjct  92    AVWGNIVWAHSVSKDLINWKKVEHAIFPSKPF-DKYGCWSGSATVLPGNKPVILYTGIVD  150

Query  1460  SRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
              +N QVQN AVP N SDPYL+EW+K   NPLI  +    IN T FRDPTTAW G DG+WR
Sbjct  151   DKNTQVQNYAVPANLSDPYLREWIKPDNNPLIVAD--KAINGTYFRDPTTAWLGKDGHWR  208

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPNGLDTSLV  1101
             I +G K   RG++ LY+S+DF+ WV+AKHPLH+  G+G WECPDF+PVS + NGLDTS+V
Sbjct  209   ISIGGKKNNRGISYLYKSRDFMHWVKAKHPLHATAGTGNWECPDFFPVSAT-NGLDTSVV  267

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
             G  +KHV+K+SLD +R +YYT+G+YD  +D+YIPD   +D  +GLRYDYG FYASK+F+D
Sbjct  268   GPNVKHVMKVSLDATRFEYYTLGSYDVGKDRYIPDPDMIDGWNGLRYDYGNFYASKSFFD  327

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               K RRILWGW NES      +K+GW+GVQ IPRT+ LD   KQL+QWPV+ELE LR NK
Sbjct  328   PSKNRRILWGWANESDSTDNDIKKGWAGVQLIPRTIVLDPNGKQLLQWPVEELETLRGNK  387

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQKGAS  564
             VE+ + +L KG   E+ GI+AAQAD++VTF      KAE  +  W   D Q +CSQKG++
Sbjct  388   VELSNKILNKGENVEIKGITAAQADVDVTFSFESLDKAEPFDPSWDRYDAQKICSQKGST  447

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKT----  396
             V GG+GPFGL  LAS+N +EYT VFFRVF   + + +VLMCSD +RSS+  K DKT    
Sbjct  448   VEGGLGPFGLLTLASQNLEEYTPVFFRVFKDQDKH-LVLMCSDASRSSI--KDDKTKMKD  504

Query  395   -------SYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHL  237
                    S+  FV+V+  +++LSLR LID+S+VESFGA GK CITSRVYP  A+   AHL
Sbjct  505   GKDAYRPSFAGFVNVDLTEKKLSLRSLIDNSVVESFGAGGKTCITSRVYPALALFGNAHL  564

Query  236   YAFNNGVHSIKLSKLTAWSMKKP  168
             YAFNNG  ++K+  L AW+M +P
Sbjct  565   YAFNNGTEAVKIDSLNAWTMNRP  587



>emb|CCV19961.1| beta-fructofuranosidase, insoluble isoenzyme IVR1.1_1A [Triticum 
aestivum]
Length=584

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/567 (53%), Positives = 405/567 (71%), Gaps = 16/567 (3%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
              +   ASH+V   L++L+    +   RT +HFQPP++W+N    PM YKG+YH FYQYNP
Sbjct  17    ALAVHASHVVYPELQSLEATEVDKELRTGYHFQPPKHWINGSKWPMYYKGLYHLFYQYNP  76

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
             KGA +G I W HS S DLV+W A  P + PS+P  DING WSGSATILPN +P ++YTG+
Sbjct  77    KGAVWGNIIWAHSVSTDLVDWVALEPGIYPSKPF-DINGCWSGSATILPNGVPVIMYTGI  135

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             D + RQVQN+A P N SDP+L++WVK   NP+I P+H   INA++FRDPTTAW GPDG+W
Sbjct  136   DPKERQVQNVAYPANLSDPFLRKWVKPDYNPIINPDH--GINASAFRDPTTAWYGPDGHW  193

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST------SPN  1122
             R++VGSK   RG+A+LYRS+DF RW++A H LH+G  +GMWECPDFYPV+         N
Sbjct  194   RLVVGSKENMRGIAVLYRSRDFRRWIKAHHSLHAGL-TGMWECPDFYPVAVPGGRRHHQN  252

Query  1121  GLDT-----SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYD  957
             G+DT     S V +++K+VLK+SLD +R++YYTIG YDH +D+Y PD    DND GLRYD
Sbjct  253   GVDTAELHDSTVAAEVKYVLKVSLDVTRYEYYTIGWYDHAKDRYTPDLDFPDNDYGLRYD  312

Query  956   YGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQW  777
             YG FYASK+FYD +K+RR+LWGW NES    +   +GW+G+Q IPR ++L ++ +QL+QW
Sbjct  313   YGDFYASKSFYDPVKKRRVLWGWANESDTVPDDRNKGWAGIQAIPRKIFLSRSGRQLIQW  372

Query  776   PVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTD  597
             PV+E++ LR+  V + +  +K G   +V G  + Q+D+E  F I    KAEK    W TD
Sbjct  373   PVEEIKSLRAKHVNVSNKAVKSGEFFKVGGFKSVQSDVEAAFMIKNLEKAEKFNASWRTD  432

Query  596   PQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL  417
              Q LC +  + V+GG+GPFGL +LAS++ +E TAVFFRVF  N+ + VVLMC+D TRSS 
Sbjct  433   AQGLCKKLNSHVKGGVGPFGLWLLASDDLKERTAVFFRVFKNNDTSYVVLMCNDPTRSSF  492

Query  416   DKKTDKTSYGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAH  240
             + +  + ++  FV+V+  + ++++LR LIDHS+VESFGA GK CI +RVYP KA+G+ AH
Sbjct  493   ESQIYRPTFAGFVNVDISKTKKIALRTLIDHSVVESFGAGGKTCILTRVYPRKAVGDNAH  552

Query  239   LYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             L+ FNNG   IKL+ L AW MK PT+N
Sbjct  553   LFVFNNGESDIKLTNLRAWEMKTPTMN  579



>ref|XP_002489109.1| hypothetical protein SORBIDRAFT_0067s002010 [Sorghum bicolor]
 gb|EES20530.1| hypothetical protein SORBIDRAFT_0067s002010 [Sorghum bicolor]
Length=598

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/590 (52%), Positives = 414/590 (70%), Gaps = 16/590 (3%)
 Frame = -1

Query  1892  INMGDTYslwllsisflllvLYGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRN  1713
             I MG T     L +  +LL   G    +ASH V   L++L+    +   RT +HFQPP++
Sbjct  9     IEMGTTGMAAALLLVAVLLHCTGTAMVRASHTVYPELQSLEVEKVDEMSRTGYHFQPPKH  68

Query  1712  WMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADI  1533
             W+NDPNGPM YKG+YH FYQYNPKGA +G I W HS S DL++W A  P + PS+   DI
Sbjct  69    WINDPNGPMYYKGLYHLFYQYNPKGAVWGNIEWAHSVSTDLIDWTALDPGIYPSK-NFDI  127

Query  1532  NGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNH  1353
              G WSGSAT+LP+ MP ++YTG+D  + QVQNLA P+N SDP+L+EWVK   NP+I+P+ 
Sbjct  128   KGCWSGSATVLPSGMPIVMYTGIDPNDHQVQNLAYPKNLSDPFLREWVKPDYNPIISPD-  186

Query  1352  YNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEG  1173
              + INA++FRDPTTAW GPD +WR+LVGS+V  +GLA+LYRS+DF RWV+A HPLHSG  
Sbjct  187   -SGINASAFRDPTTAWLGPDKHWRLLVGSRVDDKGLAVLYRSRDFKRWVKAHHPLHSGL-  244

Query  1172  SGMWECPDFYPVSTSPN------GLDTS-----LVGSKIKHVLKISLDESRHDYYTIGTY  1026
             +GMWECPDF+PV+          G+DT+      +  ++K+VLK+SLD +R++YYT+G+Y
Sbjct  245   TGMWECPDFFPVAVHGGSRHHRRGVDTAELHDRALAEEVKYVLKVSLDMTRYEYYTVGSY  304

Query  1025  DHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQG  846
             DH  D+Y PD G  DND GLRYDYG FYASK+FYD  KRRRILWGW NES    +  ++G
Sbjct  305   DHATDRYTPDAGFRDNDYGLRYDYGDFYASKSFYDPAKRRRILWGWANESDTVPDDRRKG  364

Query  845   WSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQAD  666
             W+G+Q IPR +WL    KQL+QWPV+E++ LR   V +   ++K G   EV G  + Q+D
Sbjct  365   WAGIQAIPRKLWLSPGGKQLIQWPVEEVKALRGKHVNVSDQVVKGGQYFEVDGFKSVQSD  424

Query  665   MEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFF  486
             +EVTF + +  KAE+   +W TDPQ LC ++GA  +G +GPFGL VLA+ +  E TAVFF
Sbjct  425   VEVTFAVDDLSKAEQFNPKWFTDPQRLCKKRGAREKGEVGPFGLWVLAAGDLTERTAVFF  484

Query  485   RVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQ-EELSLRILIDHSIVESF  309
             RVF  N +  VVLMC+D T S+ + +  + ++ +FV+ +  + + ++LR LIDHS+VESF
Sbjct  485   RVFRTNTSRLVVLMCNDPTNSTFEAQVYRPTFASFVNHDIAKTKTIALRTLIDHSVVESF  544

Query  308   GAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             GA G+ CI SRVYP KA+G+ AHL+ FN+G   +K++KL AW M+ P +N
Sbjct  545   GAGGRTCILSRVYPKKALGDNAHLFVFNHGEVDVKVAKLDAWEMRTPKMN  594



>emb|CDP08275.1| unnamed protein product [Coffea canephora]
Length=575

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/534 (57%), Positives = 390/534 (73%), Gaps = 8/534 (1%)
 Frame = -1

Query  1760  PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNW  1581
             P   YRT++HFQP +NWMNDPNGPM YKG+YH FYQYNP  A +G I+WGH+ S +L++W
Sbjct  36    PKQPYRTAYHFQPSKNWMNDPNGPMYYKGIYHLFYQYNPYAAVWGNITWGHAVSHNLIDW  95

Query  1580  RAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYL  1401
                  A+ P++P  DING WSGSAT+LP   P +LYTG D +NRQVQNLA P+NPSDPYL
Sbjct  96    IDLEHAIEPTEPY-DINGCWSGSATMLPGGNPVILYTGADFKNRQVQNLAEPKNPSDPYL  154

Query  1400  QEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKD  1221
             +EW+K+  NPL+ P   N I+   FRDPTTAW+GPD  WR++VGS++   G A+LYRSKD
Sbjct  155   KEWIKAKNNPLMTP--INGIDPQFFRDPTTAWQGPDKRWRVVVGSQIDGHGTALLYRSKD  212

Query  1220  FVRWVQAKHPLHSGEGSGMWECPDFYPVSTSP-NGLDTSLVGSKIKHVLKISLDESRHDY  1044
             FV W +++ PLH    + MWECPDFYPV  S  NGLDTS+     KHVLK S D+   DY
Sbjct  213   FVTWTKSEKPLHFSNKTKMWECPDFYPVIVSRRNGLDTSVHSKNSKHVLKASFDD--QDY  270

Query  1043  YTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDT  864
             Y IGTY+   DK+IPD   +++   LRYDYG FYASKTFYDS KRRRILWGW+ E+    
Sbjct  271   YIIGTYNPETDKFIPDVDFMESYLKLRYDYGIFYASKTFYDSAKRRRILWGWVTEADDKL  330

Query  863   EYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGI  684
             + +K+GWSG+Q IPR++ LDK  KQL QWP++E+E+LR  +V + +  +K G+  E++GI
Sbjct  331   DDIKKGWSGLQSIPRSIVLDKNGKQLTQWPIKEIERLRRKEVSLQNKGVKGGTAFEITGI  390

Query  683   SAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQE  504
             +A+QAD+EV+F +     AE M      DP++LCS+K AS +G IGPFGL VLAS+N  E
Sbjct  391   TASQADVEVSFHLPNLHDAELMHPE-KVDPKILCSEKNASAKGVIGPFGLMVLASKNLTE  449

Query  503   YTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHS  324
              TAVFFRVF  +++   VLMCSDQTRSSL K+ +K+S+GAFVDV+P +E +SLR LIDHS
Sbjct  450   RTAVFFRVFKSHDDKYAVLMCSDQTRSSLRKEVNKSSFGAFVDVDP-KENISLRSLIDHS  508

Query  323   IVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTI  162
             IVESFG  GK CITSRVYP  A+G++AHLY FN G  S+ +S L  WSM +  I
Sbjct  509   IVESFGGGGKTCITSRVYPELAVGQEAHLYVFNYGTKSVTISNLHGWSMGRAKI  562



>ref|XP_002530338.1| Beta-fructofuranosidase, insoluble isoenzyme 1 precursor, putative 
[Ricinus communis]
 gb|EEF32054.1| Beta-fructofuranosidase, insoluble isoenzyme 1 precursor, putative 
[Ricinus communis]
Length=573

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/553 (55%), Positives = 397/553 (72%), Gaps = 13/553 (2%)
 Frame = -1

Query  1811  QASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGAS  1632
             Q SH  +Q  +  Q       +RT++HFQPP +W+NDPNGPM Y G+YH FYQYNPKGA 
Sbjct  27    QGSHQRIQAKQVKQ------LHRTAYHFQPPMHWINDPNGPMHYNGIYHLFYQYNPKGAI  80

Query  1631  FGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRN  1452
             +G I W HS SKDL+NW A  PA+ PS+   DI G WSGSATILP+N P +LYTGVD + 
Sbjct  81    WGNIVWAHSVSKDLINWEALEPAIYPSE-WFDIVGCWSGSATILPDNKPVILYTGVDPKQ  139

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
             RQ+QN A+P+N SDPYL+EWVK   NP+++P+  +K+NAT+FRDPTTAW   DG WR+ V
Sbjct  140   RQLQNYAIPKNLSDPYLREWVKPKDNPVVSPD--SKVNATAFRDPTTAWYA-DGQWRMAV  196

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGS  1095
             GS+   RG+A LYRSKDF +WV+AKHPLH+   +GMWECPDF+PV+ S  +G+DTSL+  
Sbjct  197   GSRRNDRGVAYLYRSKDFKKWVKAKHPLHAKAETGMWECPDFFPVALSGEDGVDTSLINQ  256

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +KHVLK+SL+ +R++YYT+G YD  +D+Y PD   VD  SGLRYDYG FYASKTF+D  
Sbjct  257   NVKHVLKVSLELTRYEYYTLGIYDKGKDRYYPDSNLVDGWSGLRYDYGNFYASKTFFDPS  316

Query  914   KRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVE  735
             K RRILWGW NES  + +   +GW+G+Q IPR +WLD    QL+QWP+QELE LR   V+
Sbjct  317   KNRRILWGWANESDAEHDDTNKGWAGIQLIPRKLWLDPRGNQLIQWPIQELETLRGQSVQ  376

Query  734   MPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERW-TTDPQVLCSQKGASVR  558
             +    +KKG   EV GI+AAQAD++VTF      KAE  + +W     Q +C+ KG+  +
Sbjct  377   LTKKHIKKGEYVEVKGITAAQADVDVTFSFPSLDKAEPFDPKWKNLVAQDICAVKGSKAQ  436

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             GG+GPFGL  LASEN +E+T VFFRVF  ++    VL+CSD   SSL     + S+  FV
Sbjct  437   GGLGPFGLLTLASENLEEFTPVFFRVFKASDKYK-VLLCSDARSSSLGSGLYRPSFAGFV  495

Query  377   DVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLS  198
             DV+   ++LSLR LIDHS+VESFGA+G+  +T+RVYPT AI +KAHL+AFNNG  ++ + 
Sbjct  496   DVDLADKKLSLRSLIDHSVVESFGAEGRTVVTARVYPTIAIYDKAHLFAFNNGSETVTVE  555

Query  197   KLTAWSMKKPTIN  159
              L AWSM +P +N
Sbjct  556   NLKAWSMNRPVMN  568



>gb|AEV46305.1| apoplastic invertase [Solanum tuberosum]
Length=584

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/557 (55%), Positives = 399/557 (72%), Gaps = 11/557 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++       + +RTSFHFQPP+ W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSAISVKNVHRTSFHFQPPKYWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTKFRDPTTAWMGQDGLWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS    RG+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRKHRGMALLYRSRDFIKWAKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +KHVLK SLD +R DYYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD +
Sbjct  269   NVKHVLKNSLDVNRFDYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSFYDPM  328

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K+
Sbjct  329   KNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETLRKQKI  388

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASV  561
             ++ +  L KG + EV GISA+QAD+EV+F      KAE+ + +W     Q +C+ KG+++
Sbjct  389   QLNNKKLSKGEMFEVEGISASQADIEVSFSFSSLNKAEQFDPKWADLYAQDVCAIKGSTI  448

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSYG  387
             +GG+GPFGL  +AS+N +EYT VFFRVF    N   VLMCSD  RS++  ++   K S+ 
Sbjct  449   QGGLGPFGLATVASKNLEEYTPVFFRVFKAQKNYK-VLMCSDARRSTMRQNEAMYKPSFA  507

Query  386   AFVDVNPM-QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHL+ FNNG  +
Sbjct  508   GYVDVDLVDMKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHNNAHLFVFNNGSET  567

Query  209   IKLSKLTAWSMKKPTIN  159
             I +  L AWSM  P ++
Sbjct  568   ITIETLNAWSMDVPKMH  584



>emb|CAN71810.1| hypothetical protein VITISV_003872 [Vitis vinifera]
Length=500

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/516 (60%), Positives = 385/516 (75%), Gaps = 37/516 (7%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPY--PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFY  1656
             +G V  +ASH V  +L+   P     +  YRT +HFQP +NWMN   GPM+YKG+YHFFY
Sbjct  19    HGFVPLEASHQVYIHLQNQSPSSLKTHQPYRTGYHFQPRKNWMN---GPMIYKGLYHFFY  75

Query  1655  QYNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALL  1476
             QYNP GA +G I W HSTS DLVNW  H  A+SPSQPA DING WSGSATILPN  P +L
Sbjct  76    QYNPHGAVWGNIVWAHSTSTDLVNWTPHKYAISPSQPA-DINGCWSGSATILPNGKPVIL  134

Query  1475  YTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGP  1296
             YTG+D +N+QVQN+AVP+N SDP+L EW K P+NPL+ P   N INA+SFRDPTTAW+G 
Sbjct  135   YTGIDPQNKQVQNMAVPKNLSDPFLLEWTKLPQNPLMEPTTINSINASSFRDPTTAWQGT  194

Query  1295  DGNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNG  1119
             DG WR+++GSK+ R+GLAILYRSKDFVRW +A+HPLHSG+ +GMWECPDF+PVS  S  G
Sbjct  195   DGRWRVIIGSKIKRKGLAILYRSKDFVRWTKAQHPLHSGKNTGMWECPDFFPVSINSSTG  254

Query  1118  LDTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYA  939
             +DTS +   +K+VLK+SLD+++HDYYTIG+Y+  +D Y+PDKGSVDNDSGLRYDYGKFYA
Sbjct  255   VDTSSISKTLKYVLKLSLDDTKHDYYTIGSYNREKDTYVPDKGSVDNDSGLRYDYGKFYA  314

Query  938   SKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELE  759
             SKTF+D+ K RRILWGWINES      +++GWSGVQ IPR VWLDK+ K    W      
Sbjct  315   SKTFFDNAKNRRILWGWINESSSVEHDIEKGWSGVQAIPRNVWLDKSGK---HW------  365

Query  758   KLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCS  579
                           K GS  EV GI+A+QAD+E++FKI +F KAE  +E W ++PQ+LCS
Sbjct  366   --------------KGGSKVEVGGITASQADVEISFKISDFKKAEVFDESW-SNPQLLCS  410

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDK  399
             Q+GASV+GG+GPFGL VLAS+  +EYTAVFFR+F       VVLMCSDQ+RSSLD   DK
Sbjct  411   QRGASVKGGLGPFGLMVLASKGMEEYTAVFFRIFK-RQTKYVVLMCSDQSRSSLDNDNDK  469

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKV  291
             T+YGAF+DV+P+ E+LSLR     S+V SF    K+
Sbjct  470   TTYGAFLDVDPVHEKLSLR-----SLVSSFNKNIKI  500



>gb|AEV46307.1| apoplastic invertase [Solanum tuberosum]
Length=584

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/557 (55%), Positives = 399/557 (72%), Gaps = 11/557 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++       + +RT FHFQPP++W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSAISVKNVHRTGFHFQPPKHWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTEFRDPTTAWMGQDGLWRIII  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS    RG+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRKHRGMALLYRSRDFIKWAKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +KHVLK SLD +R DYYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD +
Sbjct  269   NVKHVLKNSLDVNRFDYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSFYDPM  328

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K+
Sbjct  329   KNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETLRKQKI  388

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASV  561
             ++ +  L KG + EV GISA+QAD+EV+F      KAE+ + +W     Q +C+ KG+++
Sbjct  389   QLNNKKLSKGEMFEVEGISASQADIEVSFSFSSLNKAEQFDPKWADLYAQDVCAIKGSTI  448

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSYG  387
             +GG+GPFGL  LAS+N +EYT VFFRVF    N   VL+CSD  RS++  ++   K S+ 
Sbjct  449   QGGLGPFGLATLASKNLEEYTPVFFRVFKAQKNYK-VLLCSDARRSTMRQNEAMYKPSFA  507

Query  386   AFVDVNPM-QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHL+ FNNG  +
Sbjct  508   GYVDVDLVDMKKLSLRSLIDNSVVESFGADGKTCITSRVYPTLAIHNNAHLFVFNNGSET  567

Query  209   IKLSKLTAWSMKKPTIN  159
             I +  L AWSM  P ++
Sbjct  568   IIIETLNAWSMDVPKMH  584



>gb|EYU35517.1| hypothetical protein MIMGU_mgv1a003306mg [Erythranthe guttata]
Length=593

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/562 (56%), Positives = 400/562 (71%), Gaps = 18/562 (3%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH V  +L++L        +RT +HFQP ++W+NDPNGPM + GVYH FYQYNPKGA
Sbjct  34    VEASHNVFMHLQSLSAVNVRKEHRTGYHFQPTKHWINDPNGPMYFNGVYHLFYQYNPKGA  93

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDS  1458
              +G I W HS SKDL+NW     A+ PS+P  D  G WSGSAT+LP N P +LYTG VD 
Sbjct  94    VWGNIVWAHSVSKDLINWEKVEHAIYPSKPF-DKYGCWSGSATVLPGNKPVILYTGIVDD  152

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRI  1278
             +N QVQN AVP N SDPYL+EW+K   NPLI  +    INAT FRDPTTAW G DG+WRI
Sbjct  153   KNSQVQNYAVPANLSDPYLREWIKPDNNPLIVSDP--SINATFFRDPTTAWLGKDGHWRI  210

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLV  1101
              +G +  RRG++ LYRS+DFV WV+AKH LH+  G+G WECPDF+PVS S  NGLDTS+V
Sbjct  211   TIGGRRNRRGISYLYRSRDFVHWVKAKHALHTSAGTGNWECPDFFPVSVSGTNGLDTSVV  270

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
             G  +KHVLK+SLD +R +YYT+G+Y+  +D+Y PD   +D  +GLRYDYG FYASK+F+D
Sbjct  271   GPNVKHVLKVSLDATRFEYYTLGSYE--KDRYTPDPDMIDGWNGLRYDYGNFYASKSFFD  328

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               K RRILWGW NES    + +K+GW+GVQ IPRT+ LD + KQL+QWPV+E+E LR NK
Sbjct  329   PSKNRRILWGWANESDSTDKDIKKGWAGVQLIPRTLTLDPSGKQLLQWPVEEVENLRKNK  388

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQKGAS  564
             VE+ + +L KG   E+ GI+AAQ+D++VTF      KAE  +  W   D Q LC QKG++
Sbjct  389   VELSNKILNKGETVEIKGITAAQSDVDVTFSFGSLDKAEPFDPSWDRYDAQKLCGQKGST  448

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSS-------LDKKT  405
             V GG+GPFG+  LAS+N +EYT VFFRVF  + +   VLMCSD +RSS       +D   
Sbjct  449   VEGGLGPFGILTLASQNLEEYTPVFFRVFK-DQDKYQVLMCSDASRSSASVDKTKMDDGK  507

Query  404   D--KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
             D  + S+  FV+V+  +++LSLR LID+S+VESFGA GK CITSRVYP  A+   AHLYA
Sbjct  508   DAYRPSFAGFVNVDLNEKKLSLRSLIDNSVVESFGAGGKTCITSRVYPALALYGNAHLYA  567

Query  230   FNNGVHSIKLSKLTAWSMKKPT  165
             FNNG  ++K+  L AWSM KP 
Sbjct  568   FNNGSETVKIDSLNAWSMSKPV  589



>emb|CDP15447.1| unnamed protein product [Coffea canephora]
Length=575

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/560 (56%), Positives = 395/560 (71%), Gaps = 9/560 (2%)
 Frame = -1

Query  1829  YGGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQY  1650
             Y GVE  ASH V  + ++L        +RT +HFQP ++W+NDPNGPM Y GVYH FYQY
Sbjct  22    YNGVE--ASHNVYLHYQSLSAIKVEQVHRTGYHFQPKKHWINDPNGPMYYNGVYHLFYQY  79

Query  1649  NPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             NPKGA +G I W HS S DL+NW    PA+ PS+P  D  G WSGSAT+LP N P +LYT
Sbjct  80    NPKGAVWGNIVWAHSVSTDLINWTPLEPAIFPSKPF-DKYGCWSGSATVLPGNKPVILYT  138

Query  1469  G-VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             G VD  N QVQN AVP N SDPYL++WVK   NPLI       +N T+FRDP TAW G D
Sbjct  139   GIVDKNNTQVQNYAVPANLSDPYLRKWVKPDNNPLIVSEA--GVNKTAFRDPPTAWLGRD  196

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGL  1116
             G WRIL+G +    G+A LY+S+DF++W +A +P+H   G+G WECPDFYPV+ S  NGL
Sbjct  197   GEWRILIGGRWKDTGIAFLYKSRDFMKWKKAANPIHQSAGTGNWECPDFYPVAKSGTNGL  256

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             +TS++G  +KHVLK+SLD +R +YYT+G Y    D+Y+PD  S DN  GLRYDYG FYAS
Sbjct  257   ETSVLGQNVKHVLKVSLDATRFEYYTLGKYYPAEDRYVPDNTSPDNWKGLRYDYGNFYAS  316

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             K+F+D  K RR+LWGW NES    + +K+GW+G+Q IPRT+ LD   KQL+QWPV+EL+ 
Sbjct  317   KSFFDPSKNRRVLWGWANESDTAKDDIKKGWAGIQLIPRTITLDPNGKQLLQWPVKELDT  376

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERW-TTDPQVLCS  579
             LR   V + + +LKKG +  V+GI+ AQAD+EVTF       AE  + +W   D Q +CS
Sbjct  377   LRGAHVRLSNQLLKKGDLVGVTGITPAQADVEVTFSFRSLDLAESFDPKWRKLDAQDVCS  436

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDK  399
             ++G+ V+GG+GPFGL  LA+E+ QEYT VFFR+F     + VVLMCSD TRSSL K+  +
Sbjct  437   KRGSFVQGGLGPFGLATLATEDLQEYTPVFFRIFKDAGKH-VVLMCSDATRSSLKKELYR  495

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
              S+  FVDV+   ++LSLR LIDHS+VESFGA GK CI+SRVYPTKA+ +KAHLYAFNNG
Sbjct  496   PSFAGFVDVDLTDKKLSLRSLIDHSVVESFGAGGKSCISSRVYPTKAVFDKAHLYAFNNG  555

Query  218   VHSIKLSKLTAWSMKKPTIN  159
               +I +  L AWSMK   +N
Sbjct  556   TEAITVETLDAWSMKTAKVN  575



>gb|AEV46308.1| apoplastic invertase [Solanum tuberosum]
Length=584

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/562 (55%), Positives = 400/562 (71%), Gaps = 13/562 (2%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPK  1641
             ++  ASH +  +L++       + +RT FHFQPP+NW+NDPN PM Y GVYH FYQYNPK
Sbjct  28    IKVFASHNIFLDLQSSSAISVKNVHRTGFHFQPPKNWINDPNAPMYYNGVYHLFYQYNPK  87

Query  1640  GASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-  1464
             G+ +G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV 
Sbjct  88    GSVWGNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVV  146

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             DS + QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG W
Sbjct  147   DSHDSQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTEFRDPTTAWMGQDGLW  204

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTS  1107
             RI++GS    RG+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S
Sbjct  205   RIVIGSMRKHRGMALLYRSRDFIKWAKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDAS  264

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
               G  +KHVLK SLD +R DYYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+F
Sbjct  265   YRGKNVKHVLKNSLDVNRFDYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSF  324

Query  926   YDSLKRRRILWGWINES--LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             YD +K RRI+WGW NES  L D E +K+GW+G+Q IPR VWLD + KQL+QWP++ELE L
Sbjct  325   YDPMKNRRIVWGWTNESDGLPDDE-IKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETL  383

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQ  576
             R  K+++ +  L KG + EV GISA+QAD+EV+F      KAE+ + +W     Q +C+ 
Sbjct  384   RKQKIQLNNKKLSKGEMFEVEGISASQADIEVSFSFSSLNKAEQFDPKWADLYAQDVCAI  443

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTD  402
             KG++++GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCS+  RS++  ++   
Sbjct  444   KGSTIQGGLGPFGLATLASKNLEEYTPVFFRVFKAQKNYK-VLMCSNARRSTMRQNEAMY  502

Query  401   KTSYGAFVDVNPM-QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFN  225
             K S+  +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYP  AI   AHL+ FN
Sbjct  503   KPSFAGYVDVDLVDMKKLSLRSLIDNSVVESFGAGGKTCITSRVYPMLAIHNNAHLFVFN  562

Query  224   NGVHSIKLSKLTAWSMKKPTIN  159
             NG  +I +  L AWSM  P ++
Sbjct  563   NGSETITIETLNAWSMDVPKMH  584



>ref|XP_008452732.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
isoform X1 [Cucumis melo]
Length=564

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/534 (57%), Positives = 398/534 (75%), Gaps = 8/534 (1%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             N  YRT+FHFQPP+NWMNDPNGPM YKGVYH FYQYNP  A +G I+W HS S DLV+W 
Sbjct  25    NQPYRTAFHFQPPKNWMNDPNGPMYYKGVYHLFYQYNPYSAIWGNITWAHSISYDLVDWV  84

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
                 ALSP++P  + NG WSGSATIL +  P++LYTG +S+N+Q QNLA+P+N SDP L+
Sbjct  85    HLEHALSPTEPY-ETNGCWSGSATILLDEQPSILYTGANSKNQQFQNLALPKNRSDPLLK  143

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW+KSP+NPLIAP   + I+ ++FRDPTTAW G D  WR++VG ++G  G+AILYRS+DF
Sbjct  144   EWIKSPQNPLIAP--VDDIDPSNFRDPTTAWLGQDRLWRVIVGGEIGGSGMAILYRSEDF  201

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVGSKIKHVLKISLDESRHDYY  1041
             V W ++K PLHS   +GMWECPDFYPVS +  NGLDTS+    IKHVLK S +++  D+Y
Sbjct  202   VNWTRSKSPLHSSNETGMWECPDFYPVSINGSNGLDTSVHDGLIKHVLKASFNDT--DHY  259

Query  1040  TIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTE  861
              +G+Y    D Y  +   + N S +RYDYGKFYASK+FYDS K+RR+LWGWI ES  + +
Sbjct  260   VLGSYIPGTDTYSVENNFLSNGSDMRYDYGKFYASKSFYDSGKKRRLLWGWIKESDSEGD  319

Query  860   YVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGIS  681
                +GWSG+Q IPRT+ L ++ +QLVQWP++ELEKLR+ +V      LK GSV EV GI+
Sbjct  320   DTTKGWSGLQSIPRTILLGESGRQLVQWPIKELEKLRTKQVSFNDVDLKSGSVFEVPGIT  379

Query  680   AAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASV-RGGIGPFGLKVLASENRQE  504
             AAQAD+E++F++    +AE+M   W  DPQ+LC +   ++ +G IGPFGL VLAS++  E
Sbjct  380   AAQADIEISFRLSGLKEAEEMNSSW-NDPQLLCKENNKALWKGAIGPFGLLVLASKDLTE  438

Query  503   YTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHS  324
              TAV+FRVF    +  VVLMCSDQ+RSS  +  +K +YGAFVD++P++E +SLR LIDHS
Sbjct  439   QTAVYFRVFRNQYDKYVVLMCSDQSRSSQREGLEKATYGAFVDMDPLRETISLRSLIDHS  498

Query  323   IVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTI  162
             I+ESFG  GK CIT+RVYP  AI ++AHLYAFNNG   +++S+L+ WSMK+  +
Sbjct  499   IIESFGGNGKACITARVYPKIAINQEAHLYAFNNGSMDVRISRLSGWSMKRAQV  552



>gb|ABY81288.1| cell-wall invertase [Populus alba x Populus grandidentata]
Length=584

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/555 (56%), Positives = 397/555 (72%), Gaps = 8/555 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH +    ++L        +RT +HFQPP+NW+NDPNGP+ YKG+YH FYQYNPKGA
Sbjct  30    VEASHKIYLRYQSLSVDKVKQIHRTGYHFQPPKNWINDPNGPLYYKGLYHLFYQYNPKGA  89

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDS  1458
              +G I W HS SKDL+NW +  PA+ PS+   D  G WSGSATILPN  P + YTG VD 
Sbjct  90    VWGNIVWAHSVSKDLINWESLEPAIYPSK-WFDNYGCWSGSATILPNGEPVIFYTGIVDG  148

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRI  1278
              NRQ+QN AVP N SDPYL+EWVK   NP++ P+    +NA++FRDPTTAWR   G+WRI
Sbjct  149   NNRQIQNYAVPANSSDPYLREWVKPDDNPIVYPD--PSVNASAFRDPTTAWR-VGGHWRI  205

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLV  1101
             L+GSK   RG+A LYRS DF +W +AKHPLHS +G+GMWECPDF+PVS S   GLDTS+ 
Sbjct  206   LIGSKKRDRGIAYLYRSLDFKKWFKAKHPLHSVQGTGMWECPDFFPVSLSGEEGLDTSVG  265

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
             GS ++HVLK+SLD +R++YYTIGTYD  +D+Y PD+  VD  +GLRYDYG FYASKTF+D
Sbjct  266   GSNVRHVLKVSLDLTRYEYYTIGTYDEKKDRYYPDEALVDGWAGLRYDYGNFYASKTFFD  325

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               K RRILWGW NES    + + +GW+G+Q IPR VWLD + KQL+QWPV ELEKLRS+ 
Sbjct  326   PSKNRRILWGWANESDSVQQDMNKGWAGIQLIPRRVWLDPSGKQLLQWPVAELEKLRSHN  385

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGAS  564
             V++ +  L +G   EV GI+AAQAD++VTF      KAE  + +W   D   +C+QKG+ 
Sbjct  386   VQLRNQKLYQGYHVEVKGITAAQADVDVTFSFPSLDKAEPFDPKWAKLDALDVCAQKGSK  445

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
              +GG+GPFGL  LASE  +E+T VFFRVF   + +  VL+CSD   SSL +   K  +  
Sbjct  446   AQGGLGPFGLLTLASEKLEEFTPVFFRVFKAADKHK-VLLCSDARSSSLGEGLYKPPFAG  504

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             FVDV+   ++L+LR LIDHS+VESFGA G+  ITSRVYP  A+ EKAHL+ FNNG  ++ 
Sbjct  505   FVDVDLTDKKLTLRSLIDHSVVESFGAGGRTVITSRVYPIIAVFEKAHLFVFNNGSETVT  564

Query  203   LSKLTAWSMKKPTIN  159
             +  L AWSMK P +N
Sbjct  565   VESLDAWSMKMPVMN  579



>emb|CDM80514.1| unnamed protein product [Triticum aestivum]
Length=586

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/569 (52%), Positives = 411/569 (72%), Gaps = 16/569 (3%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              QASH+V   L++L+        RT +HFQPP++W+NDPNGPM YKG+YH FYQYNPKGA
Sbjct  22    VQASHVVYPELQSLESKEVATELRTGYHFQPPKHWINDPNGPMYYKGLYHLFYQYNPKGA  81

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S DL++W A  PA+ P++P  D+NG WSGS T+LPN +P ++YTG+D  
Sbjct  82    VWGNIIWAHSVSTDLIHWAALEPAIYPTRPF-DVNGCWSGSTTLLPNGVPVIMYTGIDPH  140

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
               QVQN+A P N SDPYL+ WVK   NP+I+ +  N INA++FRDPTTAW GPDG+WR++
Sbjct  141   KNQVQNVAYPANLSDPYLRHWVKPDYNPIISAD--NGINASAFRDPTTAWYGPDGHWRLV  198

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST------SPNGLD  1113
             VG+K   +G+A+LYRS+DF +WV+A+H LH+G  +GMWECPDF+PV+         +G+D
Sbjct  199   VGTKENMKGIAVLYRSRDFKKWVKARHSLHAGL-TGMWECPDFFPVAVVGGSRHHQSGVD  257

Query  1112  TS-----LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGK  948
             T+     ++  ++K+VLK+SL+ +R+DYYT+GTY+H +++Y PD    DND GLRYDYG 
Sbjct  258   TAELHDRVMAEEVKYVLKVSLELARYDYYTVGTYNHDKERYTPDPAFPDNDYGLRYDYGD  317

Query  947   FYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQ  768
             FYASK+F+D  K+RR+LWGW NES    + + +GW+G+Q IPR ++L ++ +QL+QWPV+
Sbjct  318   FYASKSFFDPAKKRRVLWGWANESDTVPDDLHKGWAGIQAIPRKIFLSRSGRQLIQWPVE  377

Query  767   ELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQV  588
             E++ LRS  V + +  +K G   +VSG  + Q+D+E  F I    KAEK +  W TD Q 
Sbjct  378   EVKSLRSKHVNVSNKAVKGGEHFKVSGFKSVQSDVEAAFAIKNLNKAEKFDPTWRTDAQE  437

Query  587   LCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKK  408
             LC++  + V+GG+GPFGL +L S++ +E T VFFRVF  N+ N VVLMC+D TRSS + +
Sbjct  438   LCNKFNSHVKGGVGPFGLWLLTSDDLEERTVVFFRVFKTNDTNYVVLMCNDPTRSSYESQ  497

Query  407   TDKTSYGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               + ++  FV+V+  + ++++LR LIDHS+VESFGA GK CI +RVYP KAIG+ AHL+ 
Sbjct  498   IYRPTFAGFVNVDIAKTKKIALRTLIDHSVVESFGAGGKTCILTRVYPRKAIGDDAHLFV  557

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN*LHPQ  144
             FNNG   IK++KL AW MK PT+N L  Q
Sbjct  558   FNNGESDIKVTKLHAWEMKTPTMNKLLEQ  586



>gb|AFW58193.1| invertase cell wall3 [Zea mays]
Length=590

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/568 (53%), Positives = 408/568 (72%), Gaps = 20/568 (4%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH V   L++L+    + T RT +HFQPP++W+NDPNGPM YKG+YH FYQYNPKGA
Sbjct  23    VRASHAVYPELQSLEAEKVDETSRTGYHFQPPKHWINDPNGPMYYKGLYHLFYQYNPKGA  82

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S DL++W A  P + PS+   D+ G WSGSAT+LP+ +P ++YTG+D  
Sbjct  83    VWGNIVWAHSVSTDLIDWTALAPGIYPSR-QFDVKGCWSGSATVLPSGVPVVMYTGIDPD  141

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
               QVQN+A P+N SDP+L+EWVK   NP+IAP+  + +NA++FRDPTTAW GPD +WR+L
Sbjct  142   EHQVQNVAYPKNLSDPFLREWVKPDYNPIIAPD--SGVNASAFRDPTTAWYGPDRHWRLL  199

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPNG------LD  1113
             VGSKVG +GLA+LYRS+DF RWV+A HPLHSG  +GMWECPDF+PV+    G      +D
Sbjct  200   VGSKVGGKGLAVLYRSRDFRRWVKAHHPLHSGL-TGMWECPDFFPVAVHGGGRHYRRGVD  258

Query  1112  TS-----LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGK  948
             T+      +  ++K+VLK+SLD +R++YYT+GTYDH  D+Y PD G  DND GLRYDYG 
Sbjct  259   TAELHDRALAEEVKYVLKVSLDLTRYEYYTVGTYDHATDRYTPDAGFRDNDYGLRYDYGD  318

Query  947   FYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQ  768
             FYASK+FYD  KRRR+LWGW NES    +  ++GW+G+Q IPR +WL    KQL+QWPV+
Sbjct  319   FYASKSFYDPAKRRRVLWGWANESDTVPDDRRKGWAGIQAIPRKLWLSPRGKQLIQWPVE  378

Query  767   ELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQV  588
             E++ LR+  V +   ++K G   EV+G  + Q+D+EV F I +  KAE+   RW TDPQ 
Sbjct  379   EVKALRAKHVNVSDKVVKSGQYFEVTGFKSVQSDVEVEFAIGDLSKAERFNPRWLTDPQA  438

Query  587   LCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP----VVLMCSDQTRSS  420
             LC ++GA   G +GPFGL VLA+ +  E TAVFFRVF  N+N+     VVLMC+D T S+
Sbjct  439   LCKKRGARETGEVGPFGLWVLAAGDLTERTAVFFRVFRANSNSSSSRLVVLMCNDPTNST  498

Query  419   LDKKTDKTSYGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKA  243
              + +  + ++ +FV+V+  + + ++LR LIDHS+VESFGA G+ CI +RVYP KA+G+ A
Sbjct  499   FEAQVYRPTFASFVNVDIARTKTIALRTLIDHSVVESFGAGGRTCILTRVYPKKALGDNA  558

Query  242   HLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             HL+ FN+G   +K+++L AW M+ P +N
Sbjct  559   HLFVFNHGEVDVKVTRLDAWEMRTPKMN  586



>emb|CCV19967.1| beta-fructofuranosidase, insoluble isoenzyme IVR1_5DL [Triticum 
aestivum]
Length=584

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/566 (52%), Positives = 406/566 (72%), Gaps = 16/566 (3%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPK  1641
             +   ASH+V   L++L+    +   RT +HFQPP++W+N    PM YKG+YH FYQYNPK
Sbjct  18    LAVHASHVVYPELQSLEATEVDKELRTGYHFQPPKHWINGSKWPMYYKGLYHLFYQYNPK  77

Query  1640  GASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVD  1461
             GA +G I W HS S DL++W A  P + PS+P  DING WSGSATILPN +P ++YTG+D
Sbjct  78    GAVWGNIIWAHSVSTDLIDWVALEPGIYPSKPF-DINGCWSGSATILPNGVPVIMYTGID  136

Query  1460  SRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
              + RQVQN+A P N SDP+L++WVK   NP+I P+H   INA++FRDPTTAW GPDG+WR
Sbjct  137   PKERQVQNVAYPANLSDPFLRKWVKPDYNPIINPDH--GINASAFRDPTTAWYGPDGHWR  194

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS------PNG  1119
             ++VGSK   RG+A+LYRS+DF RW++A H LH+G  +GMWECPDFYPV+ +       +G
Sbjct  195   LVVGSKENMRGIAVLYRSRDFRRWIKAHHSLHAGL-TGMWECPDFYPVAVAGGRRHHQSG  253

Query  1118  LDT-----SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDY  954
             +DT     S V +++K+VLK+SLD +R++YYTIG YDH +D+Y PD    DND GLRYDY
Sbjct  254   VDTAELHDSTVAAEVKYVLKVSLDVTRYEYYTIGWYDHAKDRYTPDLDFPDNDYGLRYDY  313

Query  953   GKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWP  774
             G FYASK+F+D +K+RR+LWGW NES    +   +GW+G+Q IPR ++L ++ +QL+QWP
Sbjct  314   GDFYASKSFFDPVKKRRVLWGWANESDTVPDDRNKGWAGIQAIPRKIFLSRSGRQLIQWP  373

Query  773   VQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDP  594
             V+E++ LR+  V + +  +K G   +V G  + Q+D+E  F I    KAEK    W TD 
Sbjct  374   VEEIKSLRAKHVNVSNKAVKGGDYFKVGGFKSVQSDVEAAFMIKNLEKAEKFNASWRTDA  433

Query  593   QVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLD  414
             Q LC +  + V+GG+GPFGL +LAS++ +E TAVFFRVF  N+ + VVLMC+D TRSS +
Sbjct  434   QGLCKKLNSHVKGGVGPFGLWLLASDDLKERTAVFFRVFKNNDTSYVVLMCNDPTRSSFE  493

Query  413   KKTDKTSYGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHL  237
              +  + ++  FV+++  + ++++LR LIDHS+VESFGA GK CI +RVYP KA+G+ AHL
Sbjct  494   SQIYRPTFAGFVNIDITKTKKIALRTLIDHSVVESFGAGGKTCILTRVYPRKAVGDNAHL  553

Query  236   YAFNNGVHSIKLSKLTAWSMKKPTIN  159
             + FNNG   IKL+ L AW MK PT+N
Sbjct  554   FVFNNGESDIKLTNLRAWEMKTPTMN  579



>gb|EMT10261.1| Beta-fructofuranosidase, insoluble isoenzyme 3 [Aegilops tauschii]
Length=579

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/566 (52%), Positives = 407/566 (72%), Gaps = 19/566 (3%)
 Frame = -1

Query  1820  VETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPK  1641
             +   ASH+V   L++L+    +   RT +HFQPP++W+N   GPM YKG+YH FYQYNPK
Sbjct  16    LAVHASHVVYPELQSLEATEVDKELRTGYHFQPPKHWIN---GPMYYKGLYHLFYQYNPK  72

Query  1640  GASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVD  1461
             GA +G I W HS S DL++W A  P + PS+P  DING WSGSATILPN +P ++YTG+D
Sbjct  73    GAVWGNIIWAHSVSTDLIDWVALEPGIYPSKPF-DINGCWSGSATILPNGVPVIMYTGID  131

Query  1460  SRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
              + RQVQN+A P N SDP+L++WVK   NP+I P+H   INA++FRDPTTAW GPDG+WR
Sbjct  132   PKERQVQNVAYPANLSDPFLRKWVKPDYNPIINPDH--GINASAFRDPTTAWYGPDGHWR  189

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS------PNG  1119
             ++VGSK   RG+A+LYRS+DF RW++A H LH+G  +GMWECPDFYPV+ +       +G
Sbjct  190   LVVGSKENMRGIAVLYRSRDFRRWIKAHHSLHAGL-TGMWECPDFYPVAVAGGRRHHQSG  248

Query  1118  LDT-----SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDY  954
             +DT     S V +++K+VLK+SLD +R++YYTIG YDH +D+Y PD    DND GLRYDY
Sbjct  249   VDTAELHDSTVAAEVKYVLKVSLDVTRYEYYTIGWYDHAKDRYTPDLDFPDNDYGLRYDY  308

Query  953   GKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWP  774
             G FYASK+F+D +K+RR+LWGW NES    +   +GW+G+Q IPR ++L ++ +QL+QWP
Sbjct  309   GDFYASKSFFDPVKKRRVLWGWANESDTVPDDRNKGWAGIQAIPRKIFLSRSGRQLIQWP  368

Query  773   VQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDP  594
             V+E++ LR+  V + +  +K G   +V G  + Q+D+E  F I    KAEK    W TD 
Sbjct  369   VEEIKSLRAKHVNVSNKAVKGGDYFKVGGFKSVQSDVEAAFMIKNLEKAEKFNASWRTDA  428

Query  593   QVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLD  414
             Q LC +  + V+GG+GPFGL +LAS++ +E TAVFFRVF  N+ + VVLMC+D TRSS +
Sbjct  429   QGLCKKLNSHVKGGVGPFGLWLLASDDLKERTAVFFRVFKNNDTSYVVLMCNDPTRSSFE  488

Query  413   KKTDKTSYGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHL  237
              +  + ++  FV+++  + ++++LR LIDHS+VESFGA GK CI +RVYP KA+G+ AHL
Sbjct  489   SQIYRPTFAGFVNIDITKTKKIALRTLIDHSVVESFGAGGKTCILTRVYPRKAVGDNAHL  548

Query  236   YAFNNGVHSIKLSKLTAWSMKKPTIN  159
             + FNNG   IKL+ L AW MK PT+N
Sbjct  549   FVFNNGESDIKLTNLRAWEMKTPTMN  574



>ref|XP_004149196.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Cucumis sativus]
 ref|XP_004161221.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Cucumis sativus]
 gb|KGN59150.1| hypothetical protein Csa_3G777580 [Cucumis sativus]
Length=576

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/560 (55%), Positives = 394/560 (70%), Gaps = 10/560 (2%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQ--PPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQ  1653
             G V   A H +   L+++Q         +RT FHFQP RNW+NDPNGPM +KG+YH FYQ
Sbjct  23    GVVFVDALHKIYPELQSIQTDASVIKPLHRTRFHFQPRRNWINDPNGPMYFKGIYHLFYQ  82

Query  1652  YNPKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLY  1473
             YNPKGA +G I W HS S+DL+NW+   PA+ PS+P  DING WSGSAT+LP + P +LY
Sbjct  83    YNPKGAVWGNIVWAHSISRDLINWKPLKPAIYPSKPF-DINGCWSGSATVLPGDKPVILY  141

Query  1472  TGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPD  1293
             TG+D +NRQVQN A+P N SDPYL EW+K   NP++ P     +NA++FRDPTTAW    
Sbjct  142   TGIDPQNRQVQNYAIPANLSDPYLTEWIKPDNNPIVDPG--PGVNASAFRDPTTAWLSKS  199

Query  1292  GNWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GL  1116
             G+W+ ++GSK  +RG+A LYRS+DFV+W +AKHPLHS   +GMWECPDFYPV      GL
Sbjct  200   GHWKTVIGSKRKKRGMAYLYRSRDFVKWTKAKHPLHSAANTGMWECPDFYPVPLRGKLGL  259

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             D S+ G+ +KHV K+SLD +R++YYT+G Y   +DKY+PD  SVD  SGLRYDYG FYAS
Sbjct  260   DPSVTGNWVKHVFKVSLDLTRYEYYTVGKYFPKKDKYVPDNTSVDGWSGLRYDYGNFYAS  319

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             K+FYD LK+RR+LWGW NES    + V +GW+G+Q IPRTVWLD  ++QL QWPV+EL  
Sbjct  320   KSFYDPLKKRRVLWGWANESDSAQDDVSKGWAGIQLIPRTVWLDHNQRQLKQWPVKELNT  379

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQ  576
             LR  KV +    L KG   EV GI+AAQAD+EV F      KA+  + RW  D Q  C Q
Sbjct  380   LRGKKVVLSHQKLLKGHTVEVKGITAAQADVEVMFSFSSLDKADPFDPRW-VDAQAACDQ  438

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL-DKKTDK  399
              G S +GG+GPFGL  LASEN  E+T VFFR+F  ++ + VVLMCSD   SSL ++   K
Sbjct  439   LGNS-QGGVGPFGLLTLASENLDEFTPVFFRIFKAHHKH-VVLMCSDARSSSLKEEGLYK  496

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
              ++  +VD++  +++LSLR LIDHS+VESFG  GK CITSRVYPTK + + AHL+ FNNG
Sbjct  497   PAFAGYVDIDLSRKKLSLRSLIDHSVVESFGGGGKTCITSRVYPTKGVFDDAHLHVFNNG  556

Query  218   VHSIKLSKLTAWSMKKPTIN  159
               +I +  L AWSMK   +N
Sbjct  557   TEAITVEYLRAWSMKSARMN  576



>gb|ABY81289.1| cell-wall invertase [Populus alba x Populus grandidentata]
Length=580

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/555 (56%), Positives = 394/555 (71%), Gaps = 7/555 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH +    + L     N  +RT +HFQPPR+W+NDPN PM YKG+YH FYQYNPKGA
Sbjct  25    AEASHKIYSRYQNLSVENVNQVHRTGYHFQPPRHWINDPNAPMYYKGLYHLFYQYNPKGA  84

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDS  1458
              +G I W HS SKDL+NW +  PA+ PS+   D  G WSGSAT+LPN  P +LYTG VD 
Sbjct  85    VWGNIVWAHSVSKDLINWESLEPAIYPSK-WFDYYGCWSGSATVLPNGEPVILYTGIVDK  143

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRI  1278
              N Q+QN AVP N SDPYL+EWVK   NP++ P+    +N ++FRDPTTAW   DG+WRI
Sbjct  144   NNSQIQNYAVPANLSDPYLREWVKPDDNPIVNPDA--NVNGSAFRDPTTAWWA-DGHWRI  200

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLV  1101
             L+GS+  +RG+A LYRSKDF +WV+AKHPLHS +G+GMWECPDF+PVS S  NGLD S++
Sbjct  201   LIGSRRKQRGVAYLYRSKDFKKWVKAKHPLHSVQGTGMWECPDFFPVSLSGKNGLDPSVM  260

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
             G  +KHVLK+SLD +R++YYT+GTY+  +DKY PD+G VD  +GLR DYG FYASKTF+D
Sbjct  261   GQNVKHVLKVSLDMTRYEYYTMGTYNKKKDKYFPDEGLVDGWAGLRLDYGNFYASKTFFD  320

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
                 RR+LWGW NES    +   +GW+G+Q IPR VWLD + KQL+QWPV ELEKLR + 
Sbjct  321   PSTNRRVLWGWANESDDPQKDKDKGWAGIQLIPRKVWLDPSGKQLLQWPVAELEKLRGHN  380

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGAS  564
             V++ +  L +G+  EV  I+AAQAD++VTF      KAE  + +W   D   +C QKG+ 
Sbjct  381   VQLRNQKLNQGNHVEVKVITAAQADVDVTFSFPSLDKAEPFDPKWAKLDALDVCDQKGSK  440

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
               GG+GPFGL  LAS+N +E+T VFFRVF    +   VL+CSD   SSL K   K S+  
Sbjct  441   DPGGLGPFGLLTLASKNLEEFTPVFFRVFKAAADKHKVLLCSDARSSSLGKGLYKPSFAG  500

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             FVDV+   ++LSLR LIDHS+VESFG  G++ I+SRVYPT A+ EKAHLY FNNG  +I 
Sbjct  501   FVDVDLTGKKLSLRSLIDHSVVESFGVGGRIAISSRVYPTIAVSEKAHLYVFNNGSETIT  560

Query  203   LSKLTAWSMKKPTIN  159
             +  L AWSM  P +N
Sbjct  561   VENLNAWSMNTPVMN  575



>gb|AAQ24870.1| cell wall invertase 3 [Oryza sativa Indica Group]
Length=586

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/555 (53%), Positives = 400/555 (72%), Gaps = 16/555 (3%)
 Frame = -1

Query  1787  NLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGH  1608
              L++L+  + +   RT +HFQPP++W+NDPNGPM YKG+YH FYQYNPKGA +G I W H
Sbjct  33    ELQSLEAKHVDGKLRTGYHFQPPKHWINDPNGPMYYKGLYHLFYQYNPKGAVWGNIKWAH  92

Query  1607  STSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAV  1428
             S S DL++W A  P + PS+   D  G WSGSAT+LP+ +P ++YTG+D   RQVQN+A 
Sbjct  93    SVSTDLIDWTALEPGIYPSK-TFDEKGCWSGSATVLPSGVPVIMYTGIDPDERQVQNVAY  151

Query  1427  PRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRG  1248
               N SDPYL+EW K   NP++ P+    INA++FRDPTTAW GPDG+WR+LVGSKV  +G
Sbjct  152   LVNLSDPYLREWHKPDYNPIVNPD--GGINASAFRDPTTAWYGPDGHWRLLVGSKVNMKG  209

Query  1247  LAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN------GLDTS-----LV  1101
             LA+LYRS+DF +WV+A HPLHS   +GMWECPDF+PV+ +        G+DT+      V
Sbjct  210   LAVLYRSRDFKKWVKAHHPLHSAH-TGMWECPDFFPVAVAGGSRHYRRGVDTAELHDAAV  268

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
               ++K+VLK+SLD +R++YYT+G YDH  D+Y+PD    DND GLRYDYG FYASK+FYD
Sbjct  269   AEEVKYVLKVSLDLTRYEYYTVGWYDHATDRYVPDAAFPDNDYGLRYDYGDFYASKSFYD  328

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               KRRRI+WGW NES    +  ++GW+G+Q IPR +WL    KQLV+WPV+EL+ LR+  
Sbjct  329   PAKRRRIVWGWANESDTVPDDRRKGWAGIQAIPRKLWLSADGKQLVRWPVEELKALRAKH  388

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASV  561
             V +   ++KKG+  EV+G  + Q+D+++ F I +  KAE+ +  W TD + LC + G+ V
Sbjct  389   VNVTDKVIKKGNYFEVTGFKSVQSDVDMAFAIKDLSKAEEFDPAWRTDAEALCKKLGSDV  448

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAF  381
              GG+GPFGL  LAS + +E TAVFFRVF  N+++ VVLMC+D TRSS + K  + ++  F
Sbjct  449   DGGVGPFGLWALASGDLKERTAVFFRVFKANDSSHVVLMCNDPTRSSYESKIYRPTFAGF  508

Query  380   VDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             VDV+  + ++++LR LIDHS+VESFGA+GK CI +RVYP KA+G+ AHL+ FNNG   +K
Sbjct  509   VDVDIAKNKQIALRTLIDHSVVESFGARGKTCILTRVYPRKAVGDDAHLFVFNNGESDVK  568

Query  203   LSKLTAWSMKKPTIN  159
             ++ L AW MK P +N
Sbjct  569   VTNLDAWEMKTPKMN  583



>gb|EMS66375.1| Beta-fructofuranosidase, insoluble isoenzyme 3 [Triticum urartu]
Length=581

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/568 (52%), Positives = 405/568 (71%), Gaps = 19/568 (3%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
               +   ASH+V   L++L+    +   RT +HFQPP++W+N   GPM YKG+YH FYQYN
Sbjct  16    AALAVHASHVVYPELQSLEATEVDKELRTGYHFQPPKHWIN---GPMYYKGLYHLFYQYN  72

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS S DL++W A  P + PS+P  DING WSGSATILPN +P ++YTG
Sbjct  73    PKGAVWGNIIWAHSVSTDLIDWVALEPGIYPSKPF-DINGCWSGSATILPNGVPVIMYTG  131

Query  1466  VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGN  1287
             +D  NRQ+QN+A P N SDP+L++WVK   NP+I P+    INA++FRDPTTAW GPDG+
Sbjct  132   IDPNNRQMQNVAYPANLSDPFLRKWVKPDYNPIINPDR--GINASAFRDPTTAWYGPDGH  189

Query  1286  WRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST------SP  1125
             WR++VGSK   RG+A+LYRS+DF RW++A H LH+G  +GMWECPDFYPV+         
Sbjct  190   WRLVVGSKENMRGIAVLYRSRDFRRWIKAHHSLHAGL-TGMWECPDFYPVAVPGGRRHHQ  248

Query  1124  NGLDT-----SLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRY  960
             NG+DT     S V +++K+VLK+SLD +R++YYTIG YDH +D+Y PD    DND GLRY
Sbjct  249   NGVDTAELHDSTVAAEVKYVLKVSLDVTRYEYYTIGWYDHAKDRYTPDLDFPDNDYGLRY  308

Query  959   DYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQ  780
             DYG FYASK+F+D +K+RR+LWGW NES    +   +GW+G+Q IPR ++L ++ +QL+Q
Sbjct  309   DYGDFYASKSFFDPVKKRRVLWGWANESDTVPDDRNKGWAGIQAIPRKIFLSRSGRQLIQ  368

Query  779   WPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT  600
             WPV+E++ LR+  V + +  +K G   +V G  + Q+D+E  F I    KAEK    W T
Sbjct  369   WPVEEIKSLRAKHVNVSNKAVKSGEFFKVGGFKSVQSDVEAAFMIKNLEKAEKFNASWRT  428

Query  599   DPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSS  420
             D Q LC +  + V+GG+GPFGL +LAS++ +E TAVFFRVF  N+ + VVLMC+D TRSS
Sbjct  429   DAQGLCKKLNSHVKGGVGPFGLWLLASDDLKERTAVFFRVFKNNDTSYVVLMCNDPTRSS  488

Query  419   LDKKTDKTSYGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKA  243
              + +  + ++  FV+V+  + ++++LR LIDHS+VESFGA GK CI +RVYP KA+G+ A
Sbjct  489   FESQIYRPTFAGFVNVDISKTKKIALRTLIDHSVVESFGAGGKTCILTRVYPRKAVGDNA  548

Query  242   HLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             HL+ FNNG   IKL+ L AW MK PT+N
Sbjct  549   HLFVFNNGESDIKLTNLRAWEMKTPTMN  576



>ref|XP_002309419.1| cell-wall invertase family protein [Populus trichocarpa]
 gb|EEE92942.1| cell-wall invertase family protein [Populus trichocarpa]
Length=578

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/555 (56%), Positives = 397/555 (72%), Gaps = 8/555 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH +    ++L       T+RT +HFQPP+NW+NDPNGP+ YKG+YH FYQYNPKGA
Sbjct  24    VEASHKIYLRYQSLSVDKVKQTHRTGYHFQPPKNWINDPNGPLYYKGLYHLFYQYNPKGA  83

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDS  1458
              +G I W HS SKDL+NW +  PA+ PS+   D  G WSGSATILPN  P + YTG VD 
Sbjct  84    VWGNIVWAHSVSKDLINWESLEPAIYPSK-WFDNYGCWSGSATILPNGEPVIFYTGIVDE  142

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRI  1278
              NRQ+QN AVP N SDPYL+EWVK   NP++ P+    +NA++FRDPTTAWR  DG+WRI
Sbjct  143   NNRQIQNYAVPANSSDPYLREWVKPDDNPIVYPD--PSVNASAFRDPTTAWR-VDGHWRI  199

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLV  1101
             L+GSK   RG+A LYRS DF +W +AKHPLHS +G+GMWECPDF+PVS +S +GLDTS+ 
Sbjct  200   LIGSKKRDRGIAYLYRSLDFKKWFKAKHPLHSVQGTGMWECPDFFPVSLSSEDGLDTSVG  259

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
             GS ++HVLK+SLD +R++YYTIGTYD  +D+Y PD+  VD  +GLRYD G FYASKTF+D
Sbjct  260   GSNVRHVLKVSLDLTRYEYYTIGTYDEKKDRYYPDEALVDGWAGLRYDCGNFYASKTFFD  319

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
                 RRILWGW NES    +   +GW+G+Q IPR VWLD + KQL+QWPV ELEKLRS+ 
Sbjct  320   PSTNRRILWGWANESDSVQQDKNKGWAGIQLIPRRVWLDPSGKQLLQWPVAELEKLRSHN  379

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGAS  564
             V++ +  L +G   EV GI+AAQAD++VTF      KAE  + +W   D   +C+QKG+ 
Sbjct  380   VQLRNQKLYQGYHVEVKGITAAQADVDVTFSFPSLDKAEPFDPKWAKLDALDVCAQKGSK  439

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
              +GG+GPFGL  LASE  +E+T VFFRVF   + +  VL+CSD   SSL     K  +  
Sbjct  440   AQGGLGPFGLLTLASEKLEEFTPVFFRVFKAADKHK-VLLCSDARSSSLGVGLYKPPFAG  498

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             FVDV+   ++L+LR LIDHS+VESFGA G+  ITSRVYP  A+ +KAHL+ FNNG  ++ 
Sbjct  499   FVDVDLTDKKLTLRSLIDHSVVESFGAGGRTVITSRVYPIIAVFDKAHLFVFNNGSETVT  558

Query  203   LSKLTAWSMKKPTIN  159
             +  L AWSMK P +N
Sbjct  559   VETLNAWSMKVPVMN  573



>ref|NP_001275055.1| beta-fructofuranosidase, insoluble isoenzyme 1-like [Solanum 
tuberosum]
 gb|AEV46310.1| apoplastic invertase [Solanum tuberosum]
Length=584

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/557 (55%), Positives = 399/557 (72%), Gaps = 11/557 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++  P    + +RT FHFQPP++W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSPISVKNVHRTGFHFQPPKHWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTKFRDPTTAWMGQDGLWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS    RG+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRKHRGMALLYRSRDFIKWAKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +K+VLK SLD +R +YYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD +
Sbjct  269   NVKYVLKNSLDVNRFEYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSFYDPM  328

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K+
Sbjct  329   KNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETLRKQKI  388

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASV  561
             ++    L KG + EV GISA+QAD+EV+F      KAE+ + +W     Q +C+ KG+++
Sbjct  389   QLNKKKLSKGEMFEVKGISASQADIEVSFSFSSLNKAEQFDPKWADLYAQDVCAIKGSTI  448

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSYG  387
             +GG+GPFGL  LAS+N +EYT VFF+VF    N   VLMCSD  RS++  ++   K S+ 
Sbjct  449   QGGLGPFGLVTLASKNLEEYTPVFFQVFKAQKNYK-VLMCSDARRSTMRQNEAMYKPSFA  507

Query  386   AFVDVNPM-QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHL+ FNNG  +
Sbjct  508   GYVDVDLVDMKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHNNAHLFVFNNGSET  567

Query  209   IKLSKLTAWSMKKPTIN  159
             I +  L AWSM  P ++
Sbjct  568   ITIETLNAWSMDVPKMH  584



>gb|KEH42003.1| beta-fructofuranosidase [Medicago truncatula]
Length=568

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/556 (57%), Positives = 397/556 (71%), Gaps = 12/556 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              QA H    +L+++     +  +RT +HFQP RNW+N   GPM Y+GVYH FYQYNPKGA
Sbjct  21    VQAFHRKYPHLQSVSARSVSKLHRTGYHFQPNRNWIN---GPMYYRGVYHLFYQYNPKGA  77

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DS  1458
              +G I WGHS SKDL+NW+   PAL PS+P  D  G WSGSATI+P   P +LYTGV D 
Sbjct  78    VWGNIVWGHSVSKDLINWKELQPALYPSKPF-DKYGCWSGSATIIPGQGPVILYTGVVDK  136

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPR-NPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
             R+ +VQ +A+P N SDP L +WVK  R NP++  +H   +N + FRDPTTAW G DG+WR
Sbjct  137   RSNEVQCIAIPANASDPLLTKWVKPNRLNPIVIADH--NMNGSVFRDPTTAWLGKDGHWR  194

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSL  1104
             ILVGSK    GLA LYRS+DFV+W +AKHP+HS + +GMWECPDFYPVS    NGLD S 
Sbjct  195   ILVGSKREDMGLAYLYRSRDFVKWTRAKHPIHSAKTTGMWECPDFYPVSLEGKNGLDAST  254

Query  1103  VGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFY  924
             +G+ +KHVLK SLD +R++YYT+GTY   +DKYIPDK S D   GLRYDYG FYASK+F+
Sbjct  255   IGNSVKHVLKNSLDMTRYEYYTVGTYIQNKDKYIPDKTSEDGWGGLRYDYGNFYASKSFF  314

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             D  K RRI+WGW NES    + VK+GW+G+Q IPRTVWLD   +QL QWPV+EL +LR  
Sbjct  315   DPSKSRRIIWGWANESDTKEDDVKKGWAGIQAIPRTVWLDPGGRQLRQWPVEELNRLREK  374

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
             +V + +  +KKG   EV GI+AAQAD+EVTF      KAE  + +W  + + LC+QKG+ 
Sbjct  375   EVGINNKKVKKGGYVEVKGITAAQADVEVTFTFSSLDKAETFDPKW-VNAEDLCAQKGSK  433

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
             V+GGIGPFGL  LAS+  +EYT VFFR+F  +N + V+LMCSD   SSL+++  K S+G 
Sbjct  434   VQGGIGPFGLLTLASKKLEEYTPVFFRIFKASNKH-VILMCSDAKSSSLNRELYKPSFGG  492

Query  383   FVDVN-PMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
             FVDV+    ++LSLR LIDHS+VESFGA GK  I SRVYPT A+ EKAHL+ FNNG   I
Sbjct  493   FVDVDLANNKKLSLRSLIDHSVVESFGAGGKTNILSRVYPTVAVNEKAHLFVFNNGTEQI  552

Query  206   KLSKLTAWSMKKPTIN  159
              + KL AWSMK  + N
Sbjct  553   TVEKLKAWSMKTASRN  568



>gb|AEV46306.1| apoplastic invertase [Solanum tuberosum]
Length=584

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/557 (55%), Positives = 397/557 (71%), Gaps = 11/557 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++       + +RT FHFQPP+ W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSAISVKNVHRTGFHFQPPKYWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTKFRDPTTAWMGQDGLWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS     G+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRKHSGMALLYRSRDFIKWAKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +KHVLK SLD +R DYYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD +
Sbjct  269   NVKHVLKNSLDVNRFDYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSFYDPM  328

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             K RRI+W WINES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K+
Sbjct  329   KNRRIVWAWINESDVLPDDEIKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETLRKQKI  388

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASV  561
             ++ +  L KG + EV GISA+QAD+EV+F      KAE+ + +W     Q +C+ KG+++
Sbjct  389   QLNNKKLSKGEMFEVEGISASQADIEVSFSFSSLNKAEQFDPKWADLYAQDVCAIKGSTI  448

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSYG  387
             +GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS++  ++   K S+ 
Sbjct  449   QGGLGPFGLATLASKNLEEYTPVFFRVFKAQKNYK-VLMCSDARRSTMRQNEAMYKPSFA  507

Query  386   AFVDVNPM-QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHL+ FNNG  +
Sbjct  508   GYVDVDLVDMKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHNNAHLFVFNNGSET  567

Query  209   IKLSKLTAWSMKKPTIN  159
             I +  + AWSM  P ++
Sbjct  568   ITIETINAWSMDVPKMH  584



>ref|XP_009592423.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
isoform X1 [Nicotiana tomentosiformis]
Length=582

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/554 (57%), Positives = 389/554 (70%), Gaps = 12/554 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH V   L++         +RT +HFQPP++W+NDPNGPM Y GVYH FYQYNPKGA +
Sbjct  30    ASHEVFMELQSSSAVSVRKMHRTGYHFQPPKHWINDPNGPMYYNGVYHLFYQYNPKGAVW  89

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPA--LLYTG-VDS  1458
             G I W HS S+DL+NW    PA+ PS+   D  G WSGSATILP   P   +LYTG VD+
Sbjct  90    GNIVWAHSVSRDLINWARLEPAIYPSK-VFDKYGTWSGSATILPGKKPKPIILYTGIVDA  148

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRI  1278
             +N QVQN A+P N SDP+L++W+K   NPL+  +    IN T FRDPTTAW G DG+WRI
Sbjct  149   KNTQVQNYAIPANLSDPFLRKWIKPDNNPLVVAD--KSINKTQFRDPTTAWLGRDGHWRI  206

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLV  1101
             LVGS    RG AILYRSKDF++W +A+HPLH+   +G WECPDF+PVS    NGLDTS  
Sbjct  207   LVGSVRKHRGKAILYRSKDFMKWTKAQHPLHTSANTGNWECPDFFPVSLEHSNGLDTSFD  266

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
             G  IKHVLK+SLD +R +YYT+GTYD  +D+YIPD  S+D   GLR DYG FYASKTFYD
Sbjct  267   GDNIKHVLKVSLDLTRFEYYTVGTYDTKKDRYIPDNISMDGWKGLRLDYGNFYASKTFYD  326

Query  920   SLKRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
               K RRILWGW NES     + VK+GW+G+Q IPR +WLD   KQLVQWPV+EL+ LR N
Sbjct  327   PSKNRRILWGWANESDAFPIDDVKKGWAGIQAIPRKIWLDPNGKQLVQWPVEELKTLRKN  386

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERW-TTDPQVLCSQKGA  567
             KV++ +  L KG + EV GI+ AQAD+EVTF        E+ +  W     Q +C+ +G+
Sbjct  387   KVQLRNQKLNKGEIVEVKGITPAQADVEVTFIFSSLDNVEEFDSSWDDLYAQDVCAIRGS  446

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTS  393
             +V GG+GPFGL  L+SEN +EYT VFFRVF   +    VLMCSD +RS+L   KK  K S
Sbjct  447   TVEGGLGPFGLLTLSSENLEEYTPVFFRVFKAQDKYK-VLMCSDASRSTLKDSKKMYKPS  505

Query  392   YGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             +  +VDV+   ++LSLR LIDHS+VESFGA GK CITSRVYPT AI +KAHL+AFNNG  
Sbjct  506   FAGYVDVDLSDKKLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAIHDKAHLFAFNNGTE  565

Query  212   SIKLSKLTAWSMKK  171
             +I +  L AWSM K
Sbjct  566   TITIETLDAWSMAK  579



>gb|AEV46299.1| apoplastic invertase [Solanum tuberosum]
Length=584

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/557 (55%), Positives = 398/557 (71%), Gaps = 11/557 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++       + +RTSFHFQPP+ W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSAISVKNVHRTSFHFQPPKYWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTKFRDPTTAWMGQDGLWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS    RG+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRKHRGMALLYRSRDFIKWAKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +K+VLK SLD +R DYYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD  
Sbjct  269   NVKYVLKNSLDVNRFDYYTIGMYDTRKDRYIPDNNSIDGCKGLRLDYGNFYASKSFYDPT  328

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K+
Sbjct  329   KNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDHSGKQLIQWPIEELETLRKQKI  388

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASV  561
             ++ +  L KG + EV GISA+Q+D+EV+F      KAE+ +  W     Q +C+ KG+++
Sbjct  389   QLNNKKLSKGEMFEVKGISASQSDIEVSFSFSSLNKAEQFDPNWADLYAQDVCAIKGSTI  448

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSYG  387
             +GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS++  ++   K S+ 
Sbjct  449   QGGLGPFGLATLASKNLEEYTPVFFRVFKAQKNYK-VLMCSDARRSTMRQNEAMYKPSFA  507

Query  386   AFVDVNPM-QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI + AHL+ FNNG  +
Sbjct  508   GYVDVDLVDMKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHDNAHLFVFNNGSET  567

Query  209   IKLSKLTAWSMKKPTIN  159
             I +  L AWSM  P ++
Sbjct  568   ITIETLNAWSMDVPKMH  584



>ref|XP_009758032.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
isoform X1 [Nicotiana sylvestris]
Length=583

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/556 (57%), Positives = 390/556 (70%), Gaps = 12/556 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
               ASH VL  L++         +RT +HFQPP++W+NDPNGPM Y GVYH FYQYNPKGA
Sbjct  29    VNASHEVLMELQSSSAVSVRKIHRTGYHFQPPKHWINDPNGPMYYNGVYHLFYQYNPKGA  88

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPA--LLYTG-V  1464
              +G I W HS S DL+NW    PA+ PS+   D  G WSGSATILP   P   +LYTG V
Sbjct  89    VWGNIVWAHSVSTDLINWARLEPAIYPSK-VFDKYGTWSGSATILPGKKPKPIILYTGIV  147

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             D++N QVQN A+P N SDP+L++W+K   NPLI  +    IN T FRDPTTAW G DG+W
Sbjct  148   DAKNTQVQNYAIPANLSDPFLRKWIKPDNNPLIVAD--KSINKTQFRDPTTAWLGRDGHW  205

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTS  1107
             RILVGS    RG AILYRSKDF++W +A+HPLH+   +G WECPDF+PVS    NGLDTS
Sbjct  206   RILVGSVRKHRGKAILYRSKDFMKWTKAQHPLHTSANTGNWECPDFFPVSLEHSNGLDTS  265

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
               G  IKHVLK+SLD +R +YYT+GTYD  +D+YIPD  S+D   GLR DYG FYASKTF
Sbjct  266   FDGDNIKHVLKVSLDLTRFEYYTVGTYDTKKDRYIPDNTSIDGWKGLRLDYGNFYASKTF  325

Query  926   YDSLKRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLR  750
             YD  K RRILWGW NES     + VK+GW+G+Q IPR +WLD + KQLVQWPV+EL+ LR
Sbjct  326   YDPSKNRRILWGWANESDAFPIDDVKKGWAGIQAIPRKIWLDPSGKQLVQWPVEELKTLR  385

Query  749   SNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERW-TTDPQVLCSQK  573
              N+V++ +  L KG   EV GI+ AQAD+EVTF        E+ +  W     Q +C+ +
Sbjct  386   KNEVQLRNQKLNKGEKVEVKGITPAQADVEVTFSFSSLDNVEEFDSSWDDLYAQDVCAIR  445

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDK  399
             G++V+GG+GPFGL  L+SEN +EYT VFFRVF   +    VLMCSD +RS+L   KK  K
Sbjct  446   GSNVQGGLGPFGLLTLSSENLEEYTPVFFRVFKVQDKYK-VLMCSDASRSTLKDSKKMYK  504

Query  398   TSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNG  219
              S+  +VDV+   ++LSLR LIDHS+VESFGA GK CITSRVYPT AI +KAHL+AFNNG
Sbjct  505   PSFAGYVDVDLTDKKLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAIHDKAHLFAFNNG  564

Query  218   VHSIKLSKLTAWSMKK  171
               +I +  L AWSM K
Sbjct  565   TETITIETLDAWSMAK  580



>ref|XP_009783398.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
isoform X1 [Nicotiana sylvestris]
Length=581

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/555 (57%), Positives = 390/555 (70%), Gaps = 10/555 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
              SH +  +L++       + +RT FHFQPP++W+NDPN PM Y G+YH FYQYNPKG+ +
Sbjct  30    GSHKIYLDLQSSSAVSVKNVHRTGFHFQPPKHWINDPNAPMYYNGIYHLFYQYNPKGSVW  89

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDSRN  1452
             G I W HS SK+L+NW    PA+ PS+P  D  G WSGSATILP N P +LYTG VD+  
Sbjct  90    GNIVWAHSVSKNLINWINLEPAIYPSKPF-DKYGTWSGSATILPGNKPIILYTGIVDANK  148

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN AVP N SDPYL+EW+K   NPLI P+    IN T FRDPTTAW G DG+WRILV
Sbjct  149   TQVQNYAVPANLSDPYLREWIKPDNNPLIVPDI--SINKTQFRDPTTAWMGQDGHWRILV  206

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS   +RGLAILY+S+DF+RWV+AKHPLHS   +G WECPDF+PVS  S NGLD S  G 
Sbjct  207   GSLRKQRGLAILYKSRDFIRWVKAKHPLHSSPNTGNWECPDFFPVSLQSTNGLDASYYGE  266

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
               K VLK SLD +R +YYTIGTYD  +D+YIPD   VD   GLR DYG FYASK+FYD  
Sbjct  267   NAKFVLKNSLDITRFEYYTIGTYDTKKDRYIPDNTFVDGWKGLRLDYGNFYASKSFYDPS  326

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             K RRI+W W NES ++  + +K+GW+G+Q IPR VWLD + KQLVQWPV+EL+ LR   V
Sbjct  327   KNRRIVWAWTNESDILPDDEIKKGWAGIQAIPRKVWLDPSGKQLVQWPVEELQTLRKQNV  386

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASV  561
             ++ +  L KG + E+ GI+ AQAD+EVTF      KAE+   +W     Q  C+ KG+++
Sbjct  387   QLSNKRLNKGEMVEIKGITPAQADVEVTFSFANLDKAEQFNPKWADLYAQDACAIKGSTI  446

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSYG  387
             +GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS+L   +   K S+ 
Sbjct  447   QGGLGPFGLVTLASKNLEEYTPVFFRVFKAQRNYK-VLMCSDARRSTLKHSEAMYKPSFA  505

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
              +VDV+ + ++LSLR LID+S+VESFGA GK CITSRVYPT AI + AHL+AFNNG  +I
Sbjct  506   GYVDVDLVDKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHDNAHLFAFNNGTETI  565

Query  206   KLSKLTAWSMKKPTI  162
             K+  L AWSM    I
Sbjct  566   KIETLNAWSMGTSNI  580



>ref|NP_001117494.1| beta-fructofuranosidase 5 [Arabidopsis thaliana]
 gb|AEE33187.1| beta-fructofuranosidase, insoluble isoenzyme CWINV3 [Arabidopsis 
thaliana]
Length=555

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/521 (58%), Positives = 385/521 (74%), Gaps = 11/521 (2%)
 Frame = -1

Query  1694  GPMVYKGVYHFFYQYNPKGASFG-KISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWS  1518
             GPM+YKG+YH FYQYNP GA +  +I WGHSTS DLVNW +  PA +PSQP+ DING WS
Sbjct  17    GPMIYKGIYHLFYQYNPYGAVWDVRIVWGHSTSVDLVNWISQPPAFNPSQPS-DINGCWS  75

Query  1517  GSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKIN  1338
             GS TILPN  P +LYTG+D    QVQN+AVP N SDPYL+EW K P+NPL+  N  N IN
Sbjct  76    GSVTILPNGKPVILYTGIDQNKGQVQNVAVPVNISDPYLREWSKPPQNPLMTTNAVNGIN  135

Query  1337  ATSFRDPTTAWRGPDGNWRILVGSKVG-RRGLAILYRSKDFVRWVQAKHPLHSGEGSGMW  1161
                FRDPTTAW G DG WR++VGS    RRGLAILY+S+DF  W Q+  PLH  + +GMW
Sbjct  136   PDRFRDPTTAWLGRDGEWRVIVGSSTDDRRGLAILYKSRDFFNWTQSMKPLHYEDLTGMW  195

Query  1160  ECPDFYPVS-TSPNGLDTSLVGSK-IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGS  987
             ECPDF+PVS T  +G++TS VG   IKHVLK+SL E+ HDYYTIG+YD  +D Y+PD G 
Sbjct  196   ECPDFFPVSITGSDGVETSSVGENGIKHVLKVSLIETLHDYYTIGSYDREKDVYVPDLGF  255

Query  986   VDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWL  807
             V N+S  R DYGK+YASKTFYD +K+RRILWGW+NES    + +++GWSG+Q  PR +WL
Sbjct  256   VQNESAPRLDYGKYYASKTFYDDVKKRRILWGWVNESSPAKDDIEKGWSGLQSFPRKIWL  315

Query  806   DKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKA  627
             D++ K+L+QWP++E+E LR  +V     +LK GS  +V G++AAQAD+EV+FK+ E  KA
Sbjct  316   DESGKELLQWPIEEIETLRGQQVNWQKKVLKAGSTLQVHGVTAAQADVEVSFKVKELEKA  375

Query  626   EKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP---  456
             + +E  W TDPQ +CSQ   SV  G+GPFGL VLAS + +EYT+V+FR+F  N++     
Sbjct  376   DVIEPSW-TDPQKICSQGDLSVMSGLGPFGLMVLASNDMEEYTSVYFRIFKSNDDTNKKT  434

Query  455   --VVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCIT  282
               VVLMCSDQ+RSSL+ + DK+++GAFV ++P  + +SLR LIDHSIVES+G  G+ CIT
Sbjct  435   KYVVLMCSDQSRSSLNDENDKSTFGAFVAIDPSHQTISLRTLIDHSIVESYGGGGRTCIT  494

Query  281   SRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             SRVYP  AIGE A+L+ FN G  S+ +  L+AWS+K   IN
Sbjct  495   SRVYPKLAIGENANLFVFNKGTQSVDILTLSAWSLKSAQIN  535



>ref|XP_006307158.1| hypothetical protein CARUB_v10008754mg [Capsella rubella]
 gb|EOA40056.1| hypothetical protein CARUB_v10008754mg [Capsella rubella]
Length=553

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/523 (57%), Positives = 392/523 (75%), Gaps = 10/523 (2%)
 Frame = -1

Query  1703  DPNGPMVYKGVYHFFYQYNPKGASFG-KISWGHSTSKDLVNWRAHIPALSPSQPAADING  1527
             DPNGPM+YKG+YH FYQYNP GA +  +I WGHSTS DLVNW    PA SPSQP+ DING
Sbjct  14    DPNGPMIYKGIYHLFYQYNPYGAVWDVRIVWGHSTSVDLVNWTPQPPAFSPSQPS-DING  72

Query  1526  AWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYN  1347
              WSGS TILPN  P +LYTG+D    QVQN+AVP N SDPYL+EW K P NPL+APN  N
Sbjct  73    CWSGSVTILPNGKPVILYTGIDLNKSQVQNVAVPVNVSDPYLREWSKPPLNPLMAPNSVN  132

Query  1346  KINATSFRDPTTAWRGPDGNWRILVGSKVG-RRGLAILYRSKDFVRWVQAKHPLHSGEGS  1170
              I+   FRDPTTAW G DG WR++VGS    RRGL ILY+S+DF+ W Q+  PLH  + +
Sbjct  133   GIDPDRFRDPTTAWLGLDGEWRVIVGSSTDDRRGLVILYKSRDFLNWTQSTTPLHYEDLT  192

Query  1169  GMWECPDFYPVS-TSPNGLDTS-LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPD  996
             GMWECPDF+PVS T  +G++TS +V + +K+VLK+SL E+ HDYYTIG+YD  +D Y+PD
Sbjct  193   GMWECPDFFPVSITGSDGVETSSVVQNDVKYVLKVSLIETLHDYYTIGSYDREKDVYVPD  252

Query  995   KGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRT  816
              G V + S  R DYGK+YASKTFYD +K+RRILWGW+NES    + +++GW+G+Q  PR 
Sbjct  253   LGFVQDRSAPRLDYGKYYASKTFYDDVKKRRILWGWVNESSPAKDDIEKGWAGLQSFPRK  312

Query  815   VWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEF  636
             +WLD++ K+L+QWP++E++ LR  +V   + +L+ GS  ++ G++AAQAD+EV+FK+ E 
Sbjct  313   IWLDESGKELLQWPIEEIDTLRGTQVSWQNKVLEAGSTVQIHGVTAAQADVEVSFKVNEL  372

Query  635   GKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNP  456
              KA+ ++  W TDPQ +C ++  SV+  +GPFGL VL S + +EYT+V+FR+F  N++N 
Sbjct  373   EKADVIDPSW-TDPQKICREEDLSVKSRVGPFGLMVLTSSDMEEYTSVYFRIFKSNDSNK  431

Query  455   ----VVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVC  288
                 VVLMCSDQ+RSSL+++ DK+++GAFV ++P Q+ LSLR LIDHSIVES+G  G+ C
Sbjct  432   HTKYVVLMCSDQSRSSLNEENDKSTFGAFVGIDPSQQTLSLRTLIDHSIVESYGGGGRTC  491

Query  287   ITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             ITSRVYP  AIGE A+L+AFN G  S+ +  L+AWS+K   IN
Sbjct  492   ITSRVYPKLAIGENANLFAFNKGSESVDVLSLSAWSLKSAQIN  534



>ref|XP_011094303.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Sesamum indicum]
Length=589

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/562 (55%), Positives = 394/562 (70%), Gaps = 16/562 (3%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH V + LE++        +RT +HFQP ++W+NDPNGPM + G YH FYQYNPKGA
Sbjct  28    VEASHKVFRQLESVSAVDVTKEHRTGYHFQPLKHWINDPNGPMYFNGYYHLFYQYNPKGA  87

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDS  1458
              +G I W HS SKDL+NW+    A+ PS+P  D  G WSGSAT+LP N P +LYTG VD 
Sbjct  88    VWGNIVWAHSVSKDLINWKKVEHAIYPSKPF-DEYGCWSGSATVLPGNKPVILYTGIVDD  146

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRI  1278
             +  QVQN AVP + SDPYL+ W+K   NPLI  +  N++N T+FRDPTTAW G DG WRI
Sbjct  147   KQTQVQNYAVPADVSDPYLRVWIKPDNNPLIVAD--NEVNKTAFRDPTTAWLGKDGEWRI  204

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSLV  1101
              +G +    G++ LY+SKDF+RW + +HPLHS +G+G WECPDF+PV  +   GLDTS  
Sbjct  205   TIGGRRFDTGMSFLYKSKDFMRWTKVQHPLHSTDGTGNWECPDFFPVQVNGKMGLDTSAT  264

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
             G  +K+V K+SLD +R++YYTIGTY+   DKYIPDK  VD  +GLR DYG FYASK+F+D
Sbjct  265   GPDVKYVFKVSLDVTRYEYYTIGTYNSEEDKYIPDKDMVDGWNGLRLDYGNFYASKSFFD  324

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               K RRILWGW NES      V++GW+G+Q IPRT+ LD   KQL+QWP++ELE LR NK
Sbjct  325   PSKNRRILWGWANESDTTDNDVEKGWAGIQLIPRTMVLDPNGKQLLQWPIEELETLRKNK  384

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTT-DPQVLCSQKGAS  564
             VE+ +  L KG+  E+ GI+AAQAD++VTF      KAE  +  W   + Q LCSQKG++
Sbjct  385   VELSNQELNKGAKVEIKGITAAQADVDVTFSFDNLDKAEPFDPSWDRYNAQKLCSQKGST  444

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLD---------K  411
             V GG+GPFGL  LASEN +EYT VFFRVF     + +VL+CSD +RS+L          K
Sbjct  445   VEGGLGPFGLLTLASENLEEYTPVFFRVFKDQEKH-LVLLCSDASRSTLKDGKSSMKDGK  503

Query  410   KTDKTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
                + S+  FVDV    ++LSLR LID+S+VE+FGA GK CITSRVYPT AI +KAHLYA
Sbjct  504   DAYRPSFAGFVDVELKDKKLSLRSLIDNSVVETFGAGGKTCITSRVYPTLAIYDKAHLYA  563

Query  230   FNNGVHSIKLSKLTAWSMKKPT  165
             FNNG  ++++ KL AWSM KP 
Sbjct  564   FNNGTETVRIEKLNAWSMSKPV  585



>gb|AEV46298.1| apoplastic invertase [Solanum tuberosum]
Length=584

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/557 (55%), Positives = 398/557 (71%), Gaps = 11/557 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
              SH V  +L++       + +RT FHFQPP++W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    GSHNVFLDLQSSSAISVKNVHRTGFHFQPPKHWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++WVK   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   TQVQNYAIPANLSDPFLRKWVKPNNNPLIIPD--NSINKTKFRDPTTAWMGVDGVWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGS  1095
             GS    RG+A+LYRS+DF++WV+A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRKHRGMALLYRSRDFIKWVKAQHPLHSSPHTGNWECPDFFPVSLNNTNGLDASYRGK  268

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +K+VLK SLD +R DYYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD  
Sbjct  269   NVKYVLKNSLDVNRFDYYTIGMYDTRKDRYIPDNNSIDGCKGLRLDYGNFYASKSFYDPT  328

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K+
Sbjct  329   KNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDHSGKQLIQWPIEELETLRKQKI  388

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASV  561
             ++ +  L KG + EV GISA+Q+D+EV+F      KAE+ +  W     Q +C+ KG+++
Sbjct  389   QLNNKKLSKGEMFEVKGISASQSDIEVSFSFSSLNKAEQFDPNWADLYAQDVCAIKGSTI  448

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSYG  387
             +GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS++  ++   K S+ 
Sbjct  449   QGGLGPFGLATLASKNLEEYTPVFFRVFKAQKNYK-VLMCSDARRSTMRQNEAMYKPSFA  507

Query  386   AFVDVNPM-QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI + AHL+ FNNG  +
Sbjct  508   GYVDVDLVDMKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHDNAHLFVFNNGSET  567

Query  209   IKLSKLTAWSMKKPTIN  159
             I +  L AWSM  P ++
Sbjct  568   ITIETLNAWSMDVPKMH  584



>ref|NP_001185230.1| beta-fructofuranosidase 5 [Arabidopsis thaliana]
 gb|AEE33188.1| beta-fructofuranosidase, insoluble isoenzyme CWINV3 [Arabidopsis 
thaliana]
Length=579

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/544 (56%), Positives = 392/544 (72%), Gaps = 14/544 (3%)
 Frame = -1

Query  1763  YPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFG-KISWGHSTSKDLV  1587
             Y  H  R  F    P   ++   GPM+YKG+YH FYQYNP GA +  +I WGHSTS DLV
Sbjct  21    YARHAVRRPFGHPVPNVSVS---GPMIYKGIYHLFYQYNPYGAVWDVRIVWGHSTSVDLV  77

Query  1586  NWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDP  1407
             NW +  PA +PSQP+ DING WSGS TILPN  P +LYTG+D    QVQN+AVP N SDP
Sbjct  78    NWISQPPAFNPSQPS-DINGCWSGSVTILPNGKPVILYTGIDQNKGQVQNVAVPVNISDP  136

Query  1406  YLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVG-RRGLAILYR  1230
             YL+EW K P+NPL+  N  N IN   FRDPTTAW G DG WR++VGS    RRGLAILY+
Sbjct  137   YLREWSKPPQNPLMTTNAVNGINPDRFRDPTTAWLGRDGEWRVIVGSSTDDRRGLAILYK  196

Query  1229  SKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSK-IKHVLKISLDES  1056
             S+DF  W Q+  PLH  + +GMWECPDF+PVS T  +G++TS VG   IKHVLK+SL E+
Sbjct  197   SRDFFNWTQSMKPLHYEDLTGMWECPDFFPVSITGSDGVETSSVGENGIKHVLKVSLIET  256

Query  1055  RHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINES  876
              HDYYTIG+YD  +D Y+PD G V N+S  R DYGK+YASKTFYD +K+RRILWGW+NES
Sbjct  257   LHDYYTIGSYDREKDVYVPDLGFVQNESAPRLDYGKYYASKTFYDDVKKRRILWGWVNES  316

Query  875   LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSE  696
                 + +++GWSG+Q  PR +WLD++ K+L+QWP++E+E LR  +V     +LK GS  +
Sbjct  317   SPAKDDIEKGWSGLQSFPRKIWLDESGKELLQWPIEEIETLRGQQVNWQKKVLKAGSTLQ  376

Query  695   VSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASE  516
             V G++AAQAD+EV+FK+ E  KA+ +E  W TDPQ +CSQ   SV  G+GPFGL VLAS 
Sbjct  377   VHGVTAAQADVEVSFKVKELEKADVIEPSW-TDPQKICSQGDLSVMSGLGPFGLMVLASN  435

Query  515   NRQEYTAVFFRVFMGNNNNP-----VVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEEL  351
             + +EYT+V+FR+F  N++       VVLMCSDQ+RSSL+ + DK+++GAFV ++P  + +
Sbjct  436   DMEEYTSVYFRIFKSNDDTNKKTKYVVLMCSDQSRSSLNDENDKSTFGAFVAIDPSHQTI  495

Query  350   SLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKK  171
             SLR LIDHSIVES+G  G+ CITSRVYP  AIGE A+L+ FN G  S+ +  L+AWS+K 
Sbjct  496   SLRTLIDHSIVESYGGGGRTCITSRVYPKLAIGENANLFVFNKGTQSVDILTLSAWSLKS  555

Query  170   PTIN  159
               IN
Sbjct  556   AQIN  559



>gb|AEV46321.1| apoplastic invertase [Solanum tuberosum]
Length=589

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/557 (56%), Positives = 389/557 (70%), Gaps = 9/557 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
               ASH V   L++       + +RT +HFQPP+NW+NDPN PM Y GVYH FYQYNP G+
Sbjct  29    VNASHKVFPGLQSTSTVDVKNVHRTGYHFQPPKNWINDPNAPMYYNGVYHLFYQYNPYGS  88

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDS  1458
              +G I W HS S DL+NW    P + PS+   D  G WSGSATILPNN P +LYTG VD+
Sbjct  89    VWGNIVWAHSVSTDLINWIPLEPGIYPSE-VFDKYGTWSGSATILPNNKPIILYTGIVDA  147

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRI  1278
             +N QVQN A+P N SDP+L++W+K   NPLI  +    IN T FRDPTT W G DG WR 
Sbjct  148   KNTQVQNYAIPANISDPFLRKWIKPDNNPLIVADV--SINKTQFRDPTTCWLGQDGYWRT  205

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLV  1101
             L+GS  G++GLAILY+SK+F++W + +HPLHS +G+G WECPDF+PV     NGLD S  
Sbjct  206   LIGSVWGKQGLAILYKSKNFMKWTKIQHPLHSVDGTGNWECPDFFPVLLHGTNGLDASYN  265

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
                IKH LK+SLD +R +YYT+G YD  +D+YIPDK S+D   GLR DYG +YASK+FYD
Sbjct  266   KKNIKHALKVSLDVTRFEYYTVGIYDTKKDRYIPDKTSIDGWKGLRLDYGNYYASKSFYD  325

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               K RRI+WGW NES    + VK+GW+G+Q IPR +WLD + KQLVQWPV+ELE LR  K
Sbjct  326   PSKNRRIMWGWANESDTVNDDVKKGWAGIQTIPRKLWLDPSGKQLVQWPVEELETLREQK  385

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERW-TTDPQVLCSQKGAS  564
             V++ +  LKKG   EV GI+ AQAD+EVTF      KAE  +  W     Q +C+ KG++
Sbjct  386   VQLSNRKLKKGDKIEVKGITPAQADVEVTFSFSSLDKAEPFDPNWDNLYAQDVCAIKGST  445

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSY  390
             V+GG+GPFGL  LAS+N +EYT VFFRVF   +    VLMCSD +RS+L  DK   K S+
Sbjct  446   VQGGLGPFGLLTLASQNLEEYTPVFFRVFKAQDKYK-VLMCSDASRSTLKNDKTMYKPSF  504

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
               +VDV+ + + LSLR LIDHS+VESFGA GK CITSRVYPT AI + AHL+ FNNG  +
Sbjct  505   AGYVDVDLINKTLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAIYDNAHLFVFNNGTET  564

Query  209   IKLSKLTAWSMKKPTIN  159
             IK+  L AW+M KP +N
Sbjct  565   IKIKSLNAWTMGKPKMN  581



>ref|XP_009601011.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1 [Nicotiana 
tomentosiformis]
Length=581

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/555 (57%), Positives = 390/555 (70%), Gaps = 11/555 (2%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GGV+  ASH V  +L++       + +RT +HFQPP+NW+NDPNGPM Y GVYH FYQYN
Sbjct  27    GGVD--ASHKVYMHLQSTSSANVKNVHRTGYHFQPPKNWINDPNGPMYYNGVYHLFYQYN  84

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS S DL+NW    PA+ PS+   D  G WSGSATILP N P +LYTG
Sbjct  85    PKGAVWGNIVWAHSVSTDLINWIPLEPAIYPSK-IFDKFGTWSGSATILPGNKPIILYTG  143

Query  1466  VDSRNR-QVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             +   NR QVQN A+P N SDPYL++W+K   NPLI  +    IN T FRDPTTAW G DG
Sbjct  144   IVDANRTQVQNYAIPANLSDPYLRKWIKPDNNPLIVADM--SINKTQFRDPTTAWMGRDG  201

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
             +WRILVGS    RG AILYRSKDF++W +AKHPLH+   +G WECPDF+PVS    NGLD
Sbjct  202   HWRILVGSVRNHRGKAILYRSKDFMKWTKAKHPLHTATNTGNWECPDFFPVSLKHTNGLD  261

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS  G  IKHVLK+SLD +R +YYT+GTYD  +D+YIPD  SVD   GLR DYG +YASK
Sbjct  262   TSYNGEYIKHVLKVSLDVTRFEYYTVGTYDTKKDRYIPDNTSVDGWKGLRLDYGNYYASK  321

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             +FYD  K RRI+ GW NES    + V++GW+GV  IPR +WLD + KQLVQWPV+ELE L
Sbjct  322   SFYDPSKNRRIMLGWANESDTVDDDVRKGWAGVHPIPRKLWLDPSGKQLVQWPVKELETL  381

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQ  576
             R  KV++ +  L KG   EV GI+ AQAD+EVTF      KAE  +  W     Q +C  
Sbjct  382   RKEKVQLSNHKLYKGEKIEVKGITVAQADVEVTFSFASLDKAEPFDPSWADLYAQDVCFI  441

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD--  402
             KG++V+GG+GPFGL  LAS+N +EYT VFFRVF   +    VLMCSD +RS+L  +T   
Sbjct  442   KGSTVQGGLGPFGLITLASKNLEEYTPVFFRVFKAQDKYK-VLMCSDASRSTLKNETTMY  500

Query  401   KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNN  222
             K S+  +VDV+   ++LSLR LID+S+VESFGA GK CITSRVYPT AI +KAHL+AFNN
Sbjct  501   KPSFAGYVDVDLAYKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIFDKAHLFAFNN  560

Query  221   GVHSIKLSKLTAWSM  177
             G  +I +  L AWSM
Sbjct  561   GTEAITIETLNAWSM  575



>gb|AEV46309.1| apoplastic invertase [Solanum tuberosum]
Length=585

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 400/558 (72%), Gaps = 12/558 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++       + +RT FHFQPP++W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSAISVKNVHRTGFHFQPPKHWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTKFRDPTTAWMGQDGLWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVG-  1098
             GS    RG+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRKHRGMALLYRSRDFIKWAKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
              K+KHVLK SLD +R +YYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD 
Sbjct  269   KKVKHVLKNSLDVNRFEYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSFYDP  328

Query  917   LKRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
             +K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K
Sbjct  329   MKNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETLRKQK  388

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGAS  564
             +++ +  L KG + EV GISA+QAD+EV+F      +AE+ + +W     Q +C+ KG++
Sbjct  389   IQLNNKKLSKGEMFEVKGISASQADIEVSFSFSSLNEAEQFDPKWADLYAQDVCAIKGST  448

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSY  390
             ++GG+GPFGL  LAS+N +EYT VFFRVF    N   +LMCSD  RS++  ++   K S+
Sbjct  449   IQGGLGPFGLATLASKNLEEYTPVFFRVFKAQKNYK-ILMCSDARRSTMRQNEAMYKPSF  507

Query  389   GAFVDVNPM-QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
               +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHL+ FNNG  
Sbjct  508   AGYVDVDLVDMKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHNNAHLFVFNNGSE  567

Query  212   SIKLSKLTAWSMKKPTIN  159
             +I +  L AWSM  P ++
Sbjct  568   TITIETLNAWSMDVPKMH  585



>gb|AAM28823.1|AF506004_2 cell-wall invertase [Solanum lycopersicum]
Length=582

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/556 (57%), Positives = 390/556 (70%), Gaps = 11/556 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPY-PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GV   ASH V  +L++       +  +RT +HFQPP+NW+NDPNGPM Y GVYH FYQYN
Sbjct  25    GVFVDASHKVYMHLQSTTSHVDASKVHRTGYHFQPPKNWINDPNGPMYYNGVYHLFYQYN  84

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA++G I W HS SKDL+NW    PA+ PS+   D  G WSGSATILP N P +LYTG
Sbjct  85    PKGATWGNIVWAHSVSKDLINWIPLEPAIYPSK-VFDKYGTWSGSATILPGNKPVILYTG  143

Query  1466  -VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
              VD+   QVQN A+P N SDPYL++W+K   NPLI  +    IN   FRDPTTAW G DG
Sbjct  144   IVDANKTQVQNYAIPANMSDPYLRKWIKPDNNPLIVAD--KNINKIQFRDPTTAWMGRDG  201

Query  1289  NWRILVGSKVGRRGLAILYRS-KDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
              WR+LVGS    RG  I+Y+S K+F++W +AKHPLHS +G+G WECPDF+PVS  + NGL
Sbjct  202   YWRVLVGSVRNHRGKVIMYKSNKNFMKWTKAKHPLHSAQGTGNWECPDFFPVSLKNENGL  261

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS  G  +KHVLK+S D +R D+YT+GTYD  +DKY PD  S+D   GLR DYG +YAS
Sbjct  262   DTSYDGKDVKHVLKVSFDVTRFDHYTVGTYDTKKDKYFPDNTSIDGWKGLRLDYGNYYAS  321

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+DS K RRIL GW NES      VK+GW+GV  IPR +WLD + KQLVQWPVQELE 
Sbjct  322   KTFFDSGKNRRILLGWANESDTVDNDVKKGWAGVHPIPRKIWLDPSGKQLVQWPVQELET  381

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCS  579
             LR  KV++ +  L KG   E+ GI+ AQAD+EV F      KAE  +  W     Q +C+
Sbjct  382   LRKKKVQLNNKKLNKGEKVEIKGITVAQADVEVIFSFASLDKAEPFDSSWADLYAQDVCA  441

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD-  402
              KG++V+GG+GPFGL  LAS+N +EYT VFFRVF  ++N   VLMCSD +RSSL  +T  
Sbjct  442   IKGSTVQGGLGPFGLLTLASKNLEEYTPVFFRVFKAHDNYK-VLMCSDASRSSLKNETTM  500

Query  401   -KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFN  225
              K S+  +VDV+   ++LSLR LID+SIVESFGA GK CITSRVYPT AI +KAHL+AFN
Sbjct  501   YKPSFAGYVDVDLADKKLSLRSLIDNSIVESFGAGGKTCITSRVYPTLAIFDKAHLFAFN  560

Query  224   NGVHSIKLSKLTAWSM  177
             NG  +I +  L AWSM
Sbjct  561   NGAETITIETLNAWSM  576



>emb|CDP08274.1| unnamed protein product [Coffea canephora]
Length=574

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/537 (56%), Positives = 397/537 (74%), Gaps = 9/537 (2%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             N  +RT++HFQPP+NWMNDPNGPM YKG+YH FYQYNP  A +G ISWGHS S +LV+W 
Sbjct  38    NQPHRTAYHFQPPKNWMNDPNGPMYYKGIYHLFYQYNPYSAVWGNISWGHSISYNLVDWI  97

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
                 A++P++P  DING WSGSA+ILP   P +LYTG D RNRQVQN+AVP+N SDPYL+
Sbjct  98    HIEQAINPTEPY-DINGCWSGSASILPGGNPVILYTGSDFRNRQVQNIAVPKNLSDPYLR  156

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW+KS  NPL+ P   N I+   FRDPTTAW GPD  WR++VGS++   G A+LY+S+DF
Sbjct  157   EWIKSDHNPLMTP--MNGIDPQFFRDPTTAWEGPDKIWRVVVGSQIKGHGTALLYQSRDF  214

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPVSTSP-NGLDTSLVGSKIKHVLKISLDESRHDYY  1041
             V W ++  PLH    + MWECPDFYPVS    NGLDTS+  +  KHVLK S ++   DYY
Sbjct  215   VNWTRSHRPLHFSNKTAMWECPDFYPVSVDGINGLDTSVQDTGTKHVLKASFND--RDYY  272

Query  1040  TIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTE  861
              IGTY+   D +  +   +D++  LRYDYG FYASKTFYDS KRRRILWGW+ E+  + +
Sbjct  273   IIGTYEPETDTFSVNPDFMDSNVKLRYDYGIFYASKTFYDSAKRRRILWGWVLEADGEPD  332

Query  860   YVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGIS  681
              + +GWSG+Q +PR+++LDKT KQL QWP++E+E LR  +V + +  +K G++ E++GI+
Sbjct  333   DINKGWSGLQSLPRSIFLDKTGKQLSQWPIEEIETLRRKEVNLQNKEIKGGTMFEITGIT  392

Query  680   AAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEY  501
             A+QAD+EV+F +    + E M   W  DPQ LCS+K A+  G IGPFG+  LAS++  E+
Sbjct  393   ASQADIEVSFHLPNLDEVELMHPEW-LDPQFLCSEKNAATGGVIGPFGILALASKDLTEH  451

Query  500   TAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRILIDHSI  321
             TAVFFRVF G++N  VVLMCSDQ RSSL ++  K+++GAFVDV+P+ E +SLR LIDHSI
Sbjct  452   TAVFFRVFRGHDNY-VVLMCSDQNRSSLREEVKKSTFGAFVDVDPV-EMISLRSLIDHSI  509

Query  320   VESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN*LH  150
             +ESFG +GK CIT+RVYP  AIG ++H+Y FNNG  SI++S L+AWSMK+  I  LH
Sbjct  510   IESFGGEGKTCITARVYPKLAIGNESHVYVFNNGTESIRISNLSAWSMKRAQIFPLH  566



>ref|XP_010049203.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1-like 
[Eucalyptus grandis]
Length=575

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/539 (58%), Positives = 382/539 (71%), Gaps = 8/539 (1%)
 Frame = -1

Query  1775  LQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSK  1596
             LQ    +  YRT +HFQPPRNWMNDPNGP+ + GVYH FYQYNP GA +G I W HS S 
Sbjct  32    LQSDSTDQPYRTGYHFQPPRNWMNDPNGPIYHNGVYHLFYQYNPYGAVWGNIVWAHSVSY  91

Query  1595  DLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNP  1416
             DL+NW     A+ P+ P  D+NG WSGSAT+LP   PA+ YTG D +NRQVQNLA+P+N 
Sbjct  92    DLINWVNLEDAIYPTGPF-DVNGCWSGSATLLPGGKPAIFYTGSDVKNRQVQNLAMPKNT  150

Query  1415  SDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAIL  1236
             SDP L+EWVKS  NPLI P +    N   FRDPTTAW+G D  WR+LVGS++  RG AIL
Sbjct  151   SDPLLREWVKSTHNPLITPPYGTDPNF--FRDPTTAWQGEDKAWRLLVGSQIKGRGTAIL  208

Query  1235  YRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGSKIKHVLKISLDE  1059
             Y+S+DF+ W +     +S   + MWECPDFYPV   S N ++TS  G   KHVLK S + 
Sbjct  209   YKSEDFISWSRIGSLFNSLAETDMWECPDFYPVGINSMNAVETSEQGEWTKHVLKASFNS  268

Query  1058  SRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINE  879
               HDYY +G YD   D++  +     + SGLRYDYGKFYASKTFYDS K RRILWGWINE
Sbjct  269   --HDYYILGNYDKKTDRFSVENDFTVSSSGLRYDYGKFYASKTFYDSAKERRILWGWINE  326

Query  878   SLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVS  699
             S   +  +K+GWSG+Q IPR V L K+ KQLVQWP++E EKLR+ +V   S  LK GS  
Sbjct  327   SDSKSSDIKKGWSGLQSIPRNVLLSKSGKQLVQWPIKETEKLRAKEVTALSKDLKGGSAV  386

Query  698   EVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLAS  519
             EV GI+AAQAD+EV+F+  +  KAE ++   + DPQ+LCS K ASVRG +GPFGL  LAS
Sbjct  387   EVLGITAAQADIEVSFETTDLAKAETIDHN-SVDPQLLCSSKTASVRGKLGPFGLLALAS  445

Query  518   ENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQEELSLRI  339
             E+ +E TA++F V +  N   VVLMCSDQ+RSSL    DKT+YG FVD++P  E++SLR 
Sbjct  446   EDLKEQTAIYFHV-LKKNGKFVVLMCSDQSRSSLMGGLDKTTYGGFVDIDPRHEKISLRS  504

Query  338   LIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTI  162
             LIDHSIVESF  KGK CIT+RVYP+ AIG KAHLY FNNG   +K+S+L+AWSMK   I
Sbjct  505   LIDHSIVESFSGKGKTCITARVYPSLAIGNKAHLYVFNNGTVGVKISRLSAWSMKNARI  563



>gb|KDP34087.1| hypothetical protein JCGZ_07658 [Jatropha curcas]
Length=576

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/557 (54%), Positives = 395/557 (71%), Gaps = 10/557 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYP-NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GV+T  SH  ++N ++     P    YRTS+HFQ P+NW+NDPNGPM YKG YH FYQYN
Sbjct  17    GVKTVPSHQEVKNFQSQTFVAPETQPYRTSYHFQSPKNWLNDPNGPMWYKGFYHLFYQYN  76

Query  1646  PKGASFGK-ISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYT  1470
             P  A FG  + W HS S DLVNW     AL PS+P  DI   WSGSATILP ++P +LYT
Sbjct  77    PHSALFGNGMVWAHSVSSDLVNWVHLNHALYPSEPF-DITSCWSGSATILPGDIPVILYT  135

Query  1469  GVDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             G+D+ N QVQNLA+P+N SDP+L++WVK  +NPL+ P     + A +FRDPTTAW GPDG
Sbjct  136   GIDANNTQVQNLAIPKNLSDPFLEDWVKYSQNPLMTPPV--GVEADNFRDPTTAWLGPDG  193

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
              W ++VGS    +G+AILY+S DF+ W + K PL+S E SGMWECPDF+PVS +  NG+D
Sbjct  194   KWNVIVGSWSNNQGMAILYQSGDFINWRKYKDPLYSTERSGMWECPDFFPVSINGTNGVD  253

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
              S++   +KHVLK S +   HDYY IG Y    +KYIPD       + LRYDYGKFYASK
Sbjct  254   ASVLNPTVKHVLKASFNS--HDYYMIGAYVPETEKYIPDSDLTGTVTDLRYDYGKFYASK  311

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             +F+DS+K RRILWGW+NES    + +K+GWSG+Q IPR +WLD++  QLVQWPV+E+ KL
Sbjct  312   SFFDSVKNRRILWGWVNESDTPDDDIKKGWSGLQAIPRQIWLDRSGNQLVQWPVEEINKL  371

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQK  573
                ++ + + +L  GS  E+  I+A+QAD+E+ F++ E  +AE     W  DPQ +C+  
Sbjct  372   HDKQINIENKILDNGSTFEIQYITASQADVEIVFELPELEEAEFFNPTW-VDPQKMCTDA  430

Query  572   GASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTS  393
              A+V+G +GPFGL  LA+++  E TA+FFR+F G+N   VVLMCSDQ+RSSL  + D+T+
Sbjct  431   NAAVKGRLGPFGLLALATKDLTEQTAIFFRIFKGHNAY-VVLMCSDQSRSSLRDEVDRTT  489

Query  392   YGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
             YGAFV++NP  E++SLR LIDHSI+ESFG KG+ CITSRVYP  A+ + AHLY FNNG  
Sbjct  490   YGAFVNINPQHEKISLRSLIDHSIIESFGGKGRTCITSRVYPKFAVNKDAHLYVFNNGTL  549

Query  212   SIKLSKLTAWSMKKPTI  162
             S+ +S+L AW M K  I
Sbjct  550   SVTISRLNAWGMNKAEI  566



>ref|XP_009803979.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
[Nicotiana sylvestris]
Length=580

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/555 (57%), Positives = 391/555 (70%), Gaps = 12/555 (2%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GGV+  ASH V  +L++      N  +RT +HFQPP+NW+NDPNGPM Y GVYH FYQYN
Sbjct  27    GGVD--ASHKVYMHLQSTSSNVKN-VHRTGYHFQPPKNWINDPNGPMYYNGVYHLFYQYN  83

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS S DL+NW    PA+ PS+   D  G WSGSATILP N P +LYTG
Sbjct  84    PKGAVWGNIVWAHSVSTDLINWIPLEPAIYPSK-IFDKFGTWSGSATILPGNKPIILYTG  142

Query  1466  VDSRNR-QVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             +   NR QVQN A+P N SDPYL++W+K   NPLI  +    IN T FRDPTTAW G DG
Sbjct  143   IIDANRTQVQNYAIPANLSDPYLRKWIKPDNNPLIVADM--SINKTQFRDPTTAWMGRDG  200

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
             +WRILVGS    RG  ILYRSKDF++W +AKHPLH+   +G WECPDF+PVS    NGLD
Sbjct  201   HWRILVGSVKNHRGKVILYRSKDFMKWTKAKHPLHTATNTGNWECPDFFPVSLKHTNGLD  260

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS  G   KHVLK+SLD +R +YYT+GTYD  +D+YIPD  SVD   GLR DYG +YASK
Sbjct  261   TSYRGEYTKHVLKVSLDVTRFEYYTVGTYDTRKDRYIPDNTSVDGWKGLRLDYGNYYASK  320

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             +F+D  K RRI+ GW NES    + V++GW+GV  IPR +WLD + KQLVQWPV+ELE L
Sbjct  321   SFFDPSKNRRIMLGWANESDTVDDDVRKGWAGVHPIPRKLWLDPSGKQLVQWPVEELETL  380

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQ  576
             R  KV++ +  L KG + EV GI+ AQAD+EVTF      KAE  +  W     Q +C+ 
Sbjct  381   RKKKVQLSNHKLYKGEMIEVKGITVAQADVEVTFSFASLDKAEPFDPSWADLYAQDVCAI  440

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD--  402
             KG++V+GG+GPFGL  LAS+N +EYT VFFRVF   +    VLMCSD +RS+L  +T   
Sbjct  441   KGSTVQGGLGPFGLITLASKNLEEYTLVFFRVFKAQDKYK-VLMCSDASRSTLKNETTMY  499

Query  401   KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNN  222
             K S+G +VDV+   ++LSLR LID+S+VESFGA GK CITSRVYPT AI +KAHL+AFNN
Sbjct  500   KPSFGGYVDVDLADKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIFDKAHLFAFNN  559

Query  221   GVHSIKLSKLTAWSM  177
             G  +I +  L AWSM
Sbjct  560   GTEAITIETLNAWSM  574



>ref|XP_011004211.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1 [Populus 
euphratica]
 ref|XP_011004212.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1 [Populus 
euphratica]
Length=578

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/555 (55%), Positives = 395/555 (71%), Gaps = 8/555 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH +    ++L        +RT +HFQPP+NW+NDPN P+ YKG+YH FYQYNPKGA
Sbjct  24    VEASHKIYPRYQSLSVDKVKQIHRTGYHFQPPKNWINDPNAPLYYKGLYHLFYQYNPKGA  83

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDS  1458
              +G I W HS SKDL+NW +  PA+ PS+   D  G WSGSATILPN  P + YTG VD 
Sbjct  84    VWGNIVWAHSVSKDLINWESLEPAIYPSK-WFDNYGCWSGSATILPNGEPVIFYTGIVDE  142

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRI  1278
              NRQ+QN AVP N SDPYL+EWVK   NP++ P+    +NA++FRDPTTAWR  DG+W+I
Sbjct  143   NNRQIQNYAVPANSSDPYLREWVKPDDNPIVYPD--PSVNASAFRDPTTAWR-VDGHWKI  199

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLV  1101
             L+GSK   RG+A LYRS DF +W +AKHPLHS +G+GMWECPDF+PV+ S   GLDTS+ 
Sbjct  200   LIGSKRRDRGVAYLYRSLDFKKWFKAKHPLHSVQGTGMWECPDFFPVTLSGEEGLDTSVG  259

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
             GS ++HVLK+SLD +R++YYTIGTYD  +D+Y PD+  VD  +GLRYDYG FYASKTF+D
Sbjct  260   GSNVRHVLKVSLDLTRYEYYTIGTYDEKKDRYYPDEALVDGWAGLRYDYGNFYASKTFFD  319

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
                 RRILWGW NES    +   +GW+G+Q IPR VWLD + KQL+QWPV ELEKLRS+ 
Sbjct  320   PSTNRRILWGWANESDSVRQDKNKGWAGIQLIPRRVWLDPSGKQLLQWPVAELEKLRSHN  379

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGAS  564
             V++ +  L +G   EV GI+AAQAD++VTF      KAE  + +W   D   +C+QKG+ 
Sbjct  380   VQLRNQKLYQGYHVEVKGITAAQADVDVTFSFPSLDKAEPFDPKWAKLDALDVCAQKGSK  439

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
              +GG+GPFGL  LASE  +E+T VFFRVF   + +  VL+CSD   SSL +   K  +  
Sbjct  440   AQGGLGPFGLLTLASEKLEEFTPVFFRVFKAADKHK-VLLCSDARSSSLGEGLYKPPFAG  498

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             FVDV+   ++L+LR LIDHS+VESFGA G+  ITSRVYP  A+ +KAHL+ FNNG  ++ 
Sbjct  499   FVDVDLTDKKLTLRSLIDHSVVESFGAGGRTVITSRVYPIIAVFDKAHLFVFNNGRETVT  558

Query  203   LSKLTAWSMKKPTIN  159
             +  L AWSMK P +N
Sbjct  559   VENLNAWSMKVPVMN  573



>emb|CAA79676.1| beta-fructofuranosidase [Solanum tuberosum]
Length=587

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/557 (55%), Positives = 388/557 (70%), Gaps = 9/557 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
               ASH V   L++       + +RT +HFQPP+NW+NDPN PM Y GVYH FYQYNP G+
Sbjct  27    VNASHKVFPGLQSTSTVDEKNVHRTGYHFQPPKNWINDPNAPMYYNGVYHLFYQYNPYGS  86

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDS  1458
              +G I W HS S DL+NW    P + PS+   D  G WSGSATILPNN P +LYTG VD+
Sbjct  87    VWGNIVWAHSVSTDLINWIPLEPGIYPSE-VFDKYGTWSGSATILPNNKPIILYTGIVDA  145

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRI  1278
             +N QVQN A+P N SDP+L++W+K   NPLI  +    IN T FRDPTT W G DG WR 
Sbjct  146   KNTQVQNYAIPANISDPFLRKWIKPDNNPLIVADV--SINKTQFRDPTTCWLGQDGYWRT  203

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLV  1101
             L+GS  G++GLAILY+SK+F++W + +HPLHS +G+G WECPDF+PV     NGLD S  
Sbjct  204   LIGSVWGKQGLAILYKSKNFMKWTKIQHPLHSVDGTGNWECPDFFPVLLHGTNGLDASYN  263

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
                IKH LK+SLD +R +YYT+G YD  +D+YIPDK S+D   GLR DYG +YASK+FYD
Sbjct  264   KKNIKHALKVSLDVTRFEYYTVGIYDTKKDRYIPDKTSIDGWKGLRLDYGNYYASKSFYD  323

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               K RRI+WGW NES    + VK+GW+G+Q IPR +WLD + KQLVQWPV+ELE LR  K
Sbjct  324   PSKNRRIMWGWANESDTVNDDVKKGWAGIQTIPRKLWLDPSGKQLVQWPVEELETLREQK  383

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERW-TTDPQVLCSQKGAS  564
             V++ +  LKKG   EV GI+ AQAD+EVTF      KAE  +  W     Q +C+ KG++
Sbjct  384   VQLSNRKLKKGDKIEVKGITPAQADVEVTFSFSSLDKAEPFDPNWDNLYAQDVCAIKGST  443

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSY  390
             V+G +GPFGL  LAS+N +EYT VFFRVF   +    VLMCSD +RS+L  DK   K S+
Sbjct  444   VQGDLGPFGLLTLASQNLEEYTPVFFRVFKAQDKYK-VLMCSDASRSTLKNDKTMYKPSF  502

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
               +VDV+ + + LSLR LIDHS+VESFGA GK CITSRVYPT AI + AHL+ FNNG  +
Sbjct  503   AGYVDVDLINKTLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAIYDNAHLFVFNNGTET  562

Query  209   IKLSKLTAWSMKKPTIN  159
             IK+  L AW+M KP +N
Sbjct  563   IKIKSLNAWTMGKPKMN  579



>gb|ADN06440.1| invertase [Solanum tuberosum]
Length=590

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/557 (55%), Positives = 387/557 (69%), Gaps = 9/557 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
               ASH V   L++       + +RT +HFQPP+NW+NDPN PM Y GVYH FYQYNP G+
Sbjct  29    VNASHKVFPGLQSTSTVDVKNVHRTGYHFQPPKNWINDPNAPMYYNGVYHLFYQYNPYGS  88

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDS  1458
              +G I W HS S DL+NW    P + PS+   D  G WSGSATILPNN P +LYTG VD+
Sbjct  89    VWGNIVWAHSVSTDLINWIPLEPGIYPSE-VFDKYGTWSGSATILPNNKPIILYTGIVDA  147

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRI  1278
             +N QVQN A+P N SDP+L++W+K   NPLI  +    IN T FRDPTT W G DG WR 
Sbjct  148   KNTQVQNYAIPANISDPFLRKWIKPDNNPLIVADV--SINKTQFRDPTTCWLGQDGYWRT  205

Query  1277  LVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLV  1101
             L+GS   ++GLAILY+SK+F++W + +HPLHS +G+G WECPDF+PV     NGLD S  
Sbjct  206   LIGSVWEKQGLAILYKSKNFMKWTKVQHPLHSADGTGNWECPDFFPVLLHGTNGLDASYN  265

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
                IKHVLK+SLD +R +YYT+G YD  +D+YIPDK S+D   GLR DYG +YASK+FYD
Sbjct  266   KKNIKHVLKVSLDVTRFEYYTVGKYDTKKDRYIPDKTSIDGWKGLRLDYGNYYASKSFYD  325

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               K RRI+WGW NES    + VK+GW+G+Q  PR +WLD + KQLVQWPV+ELE LR NK
Sbjct  326   PSKNRRIMWGWANESDTVNDDVKKGWAGIQTSPRKLWLDPSGKQLVQWPVEELETLRENK  385

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTD-PQVLCSQKGAS  564
             +++ +  L KG   EV GI+ AQAD+EVTF      KAE  +  W     Q +C+ KG++
Sbjct  386   IQLMNRKLNKGDKIEVKGITPAQADVEVTFSFSSLDKAEPFDPNWANLYAQDVCAIKGST  445

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSY  390
             V+GG+GPFGL  LAS+N +EYT VFFRVF   +    VLMCSD TRS+L  DK   K S+
Sbjct  446   VQGGLGPFGLLTLASQNLEEYTPVFFRVFKAQDKYK-VLMCSDATRSTLKNDKTMYKPSF  504

Query  389   GAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
               +VDV+   + LSLR LIDHS+VESFGA GK CITSRVYPT AI + AHL+ FNNG  +
Sbjct  505   AGYVDVDLTNKTLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAIYDNAHLFVFNNGTET  564

Query  209   IKLSKLTAWSMKKPTIN  159
             IK+  L AW+M KP +N
Sbjct  565   IKIKSLNAWTMGKPKMN  581



>gb|AAL16015.1|AF420223_1 cell wall invertase [Carica papaya]
Length=582

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/551 (56%), Positives = 392/551 (71%), Gaps = 7/551 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +ASH +    ++L     +  +RT++HFQPP++W+NDPN PM Y GVYH FYQYNPKGA
Sbjct  32    VEASHRIYPQFQSLSVDIVDQIHRTAYHFQPPKHWINDPNAPMYYNGVYHLFYQYNPKGA  91

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S DL+NW    PA+ PS+P  DI G WSGSAT+LPNN+P +LYTG+DS 
Sbjct  92    VWGNIVWAHSVSTDLINWIPLKPAIVPSEPF-DIKGCWSGSATVLPNNIPIILYTGLDSN  150

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
               Q+QN AVP N SDP+L+ W+K   NPL+AP+H   +N T+FRDPTTAW G DG WR+L
Sbjct  151   ETQLQNYAVPANISDPHLENWIKPANNPLVAPDH--TVNRTAFRDPTTAWLGSDGWWRML  208

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSLVG  1098
             VGSK  RRG+A LY+SKDF+ WV+AKHP+HS   +GMWECPDF+PV  S  NGLD  + G
Sbjct  209   VGSKNKRRGIAHLYKSKDFMNWVKAKHPIHSRPDTGMWECPDFFPVPKSGENGLDVGITG  268

Query  1097  SKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
               ++HVLK+SLD +R++YYTIG Y    D+YIP    VD  +GLR DYG FYASK+F+D 
Sbjct  269   RDVRHVLKVSLDLTRYEYYTIGRYYPEIDRYIPYDTLVDGWAGLRPDYGNFYASKSFFDP  328

Query  917   LKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
                RRILWGW NES    + V +GW+G+Q IPR VWLD + KQL  WPV+E+EKLR + V
Sbjct  329   KTNRRILWGWANESDSRQDDVDKGWAGIQTIPRKVWLDPSGKQLRLWPVEEVEKLRKDPV  388

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVR  558
              M +T ++ G   EV+G++AAQ D+EV+F I    KAE  +  W  + Q LC+  GA  +
Sbjct  389   LMENTAVELGQHVEVTGVTAAQCDVEVSFTIPSLEKAEPFDPEW-VNAQDLCAPMGAKKQ  447

Query  557   GGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFV  378
             GG+GPFGL  LASE+ +E T VFFRVF  +    VVLMCSD + SSL +   K S+  FV
Sbjct  448   GGVGPFGLLTLASEDLEEATPVFFRVFKADTKY-VVLMCSDASSSSLKEGLYKPSFAGFV  506

Query  377   DVNPMQEE-LSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKL  201
             +V+   E+ +SLR LIDHS+VESFGA GK CITSRVYPTKA+  +AHL+ FNNG  ++ +
Sbjct  507   NVDIEAEKRISLRSLIDHSVVESFGAGGKTCITSRVYPTKAVDGEAHLFVFNNGTEAVHV  566

Query  200   SKLTAWSMKKP  168
              KL+AWSM +P
Sbjct  567   EKLSAWSMNRP  577



>emb|CAD40590.2| OJ000126_13.7 [Oryza sativa Japonica Group]
 emb|CAH67362.1| OSIGBa0134P10.8 [Oryza sativa Indica Group]
Length=583

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/555 (53%), Positives = 398/555 (72%), Gaps = 19/555 (3%)
 Frame = -1

Query  1787  NLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGH  1608
              L++L+  + +   RT +HFQPP++W+N   GPM YKG+YH FYQYNPKGA +G I W H
Sbjct  33    ELQSLEAKHVDGKLRTGYHFQPPKHWIN---GPMYYKGLYHLFYQYNPKGAVWGNIEWAH  89

Query  1607  STSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAV  1428
             S S DL++W A  P + PS+   D  G WSGSAT+LP+ +P ++YTG+D   RQVQN+A 
Sbjct  90    SVSTDLIDWTALEPGIYPSK-TFDEKGCWSGSATVLPSGVPVIMYTGIDPDERQVQNVAY  148

Query  1427  PRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRG  1248
             P N SDPYL+EW K   NP+I P+    INA++FRDPTTAW GPDG+WR+LVGSKV  +G
Sbjct  149   PVNLSDPYLREWYKPDYNPIINPD--GGINASAFRDPTTAWYGPDGHWRLLVGSKVNMKG  206

Query  1247  LAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN------GLDTS-----LV  1101
             LA+LYRS+DF +WV+A HPLHS   +GMWECPDF+PV+ +        G+DT+      V
Sbjct  207   LAVLYRSRDFKKWVKAHHPLHSAH-TGMWECPDFFPVAVAGGSRHYRRGVDTAELHDAAV  265

Query  1100  GSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYD  921
               ++K+VLK+SLD +R++YYT+G YDH  D+Y+PD    DND GLRYDYG FYASK+FYD
Sbjct  266   AEEVKYVLKVSLDLTRYEYYTVGWYDHATDRYVPDAAFPDNDYGLRYDYGDFYASKSFYD  325

Query  920   SLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
               KRRRI+WGW NES    +  ++GW+G+Q IPR +WL    KQLVQWPV+EL+ LR+  
Sbjct  326   PAKRRRIVWGWANESDTVPDDRRKGWAGIQAIPRKLWLSADGKQLVQWPVEELKALRAKH  385

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASV  561
             V +   ++KKG+  EV+G  + Q+D+++ F I +  KAE+ +  W TD + LC + G+ V
Sbjct  386   VNVTDKVIKKGNYFEVTGFKSVQSDVDMAFAIKDLSKAEEFDPAWRTDAEALCKKLGSDV  445

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAF  381
              GG+GPFGL  LAS + +E TAVFFRVF  N+++ VVLMC+D TRSS + K  + ++  F
Sbjct  446   DGGVGPFGLWALASGDLKERTAVFFRVFKANDSSHVVLMCNDPTRSSYESKIYRPTFAGF  505

Query  380   VDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             VDV+  + ++++LR LIDHS+VESFGA+GK CI +RVYP KA+G+ AHL+ FNNG   +K
Sbjct  506   VDVDIAKNKQIALRTLIDHSVVESFGARGKTCILTRVYPRKAVGDDAHLFVFNNGESDVK  565

Query  203   LSKLTAWSMKKPTIN  159
             ++ L AW MK P +N
Sbjct  566   VTNLDAWEMKTPKMN  580



>emb|CAB85898.1| beta-fructosidase [Solanum pennellii]
 emb|CAB85899.1| beta fructosidase [Solanum pennellii]
Length=584

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/557 (55%), Positives = 396/557 (71%), Gaps = 11/557 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++       + +RT FHFQPP++W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSAISVKNVHRTRFHFQPPKHWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  G WSGS+TILPNN P ++YTGV DS N
Sbjct  92    GNIIWAHSVSKDLINWIHLEPAIYPSK-KFDKYGTWSGSSTILPNNKPVIIYTGVVDSYN  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRIL+
Sbjct  151   NQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINRTEFRDPTTAWMGQDGLWRILI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVS-TSPNGLDTSLVGS  1095
             GS    RG+A+LYRS+DF++W++A+HPLHS   +G WECPDF+PVS  S NGLD S  G 
Sbjct  209   GSMRKHRGMALLYRSRDFMKWIKAQHPLHSSTNTGNWECPDFFPVSLNSTNGLDVSYRGK  268

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +K+VLK SLD +R DYYTIG Y    D+YIP+  S+D   GLR DYG FYASKTFYD  
Sbjct  269   NVKYVLKNSLDVARFDYYTIGMYHTKIDRYIPNNNSIDGWKGLRIDYGNFYASKTFYDPS  328

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             + RR++WGW NES ++  + +K+GW+G+QGIPR VWLD + KQLVQWP++ELE LR  KV
Sbjct  329   RNRRVIWGWSNESDVLPDDDIKKGWAGIQGIPRQVWLDLSGKQLVQWPIEELETLRKQKV  388

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASV  561
             ++ +  L KG + EV GISA+QAD+EV F      KAE+ + RW     Q +C+ KG+++
Sbjct  389   QLNNKKLSKGEMFEVKGISASQADVEVLFSFSSLNKAEQFDPRWADLYAQDVCAIKGSTI  448

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSYG  387
             +GG+GPFGL  LAS+N +EYT VFFRVF    N   +LMCSD  RS++  ++   K S+ 
Sbjct  449   QGGLGPFGLATLASKNLEEYTPVFFRVFKAQKNYK-ILMCSDARRSTMRQNEAMYKPSFA  507

Query  386   AFVDVNPM-QEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              +VDV+ +  ++LSLR LIDHS+VESFGA GK CITSRVYP+ AI + AHL+ FNNG  +
Sbjct  508   GYVDVDLVDMKKLSLRSLIDHSVVESFGAGGKTCITSRVYPSLAIYDNAHLFVFNNGSET  567

Query  209   IKLSKLTAWSMKKPTIN  159
             I +  L AWSM    +N
Sbjct  568   ITIETLNAWSMGACKMN  584



>ref|XP_009600223.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
isoform X2 [Nicotiana tomentosiformis]
Length=581

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/555 (57%), Positives = 390/555 (70%), Gaps = 13/555 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
              SH V  +L++       + +RT FHFQPP++W+N    PM Y G+YH FYQYNPKG+ +
Sbjct  33    GSHKVYIDLQSSSAVNVKNVHRTGFHFQPPKHWIN---APMYYNGIYHLFYQYNPKGSVW  89

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG-VDSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  G WSGSATILP+N P +LYTG VDS  
Sbjct  90    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGTWSGSATILPSNKPIILYTGLVDSNK  148

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN AVP N SDPYL+EW+K   NPLI P+    IN T FRDPTTAW G DG+WRILV
Sbjct  149   TQVQNYAVPANLSDPYLREWIKPDNNPLIVPDI--SINKTQFRDPTTAWMGQDGHWRILV  206

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS   +RGLAILY+S+DF+RWV+AKHPLHS   +G WECPDFYPVS  S  GLD S  G 
Sbjct  207   GSLRKQRGLAILYKSRDFIRWVKAKHPLHSSANTGNWECPDFYPVSLQSTKGLDASYYGE  266

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
               K+VLK SLD +R +YYTIGTYD  RD+YIPD   +D   GLR DYG FYASK+FYD +
Sbjct  267   NTKYVLKNSLDVTRFEYYTIGTYDTKRDRYIPDNTFIDGWKGLRLDYGNFYASKSFYDPI  326

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKV  738
             K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQLVQWPV+ELE LR  KV
Sbjct  327   KNRRIVWGWTNESDILPDDDIKKGWAGIQAIPRKVWLDPSGKQLVQWPVEELETLRKQKV  386

Query  737   EMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGASV  561
             ++ +  L KG + EV GI+ AQAD+EVTF      KAE+   +W     Q +C+ KG+++
Sbjct  387   QLSNKKLNKGEMVEVKGITPAQADVEVTFSFSSLDKAEQFNPKWADLYAQDVCAIKGSTI  446

Query  560   RGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSYG  387
             +GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS+L   +   K S+ 
Sbjct  447   QGGLGPFGLVTLASKNLEEYTPVFFRVFKAQRNYK-VLMCSDARRSTLKHSEAMYKPSFA  505

Query  386   AFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSI  207
              +VDV+ + ++LSLR LID+S+VESFGA GK CITSRVYPT AI + AHL+AFNNG   I
Sbjct  506   GYVDVDLVGKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHDNAHLFAFNNGTEKI  565

Query  206   KLSKLTAWSMKKPTI  162
             K+  L AWSM    I
Sbjct  566   KIETLNAWSMGTSNI  580



>gb|AEV46338.1| apoplastic invertase [Solanum tuberosum]
Length=582

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/556 (57%), Positives = 387/556 (70%), Gaps = 11/556 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYP-NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GV   ASH V  +L++       +  +RT +HFQPP+NW+NDPNGPM Y GVYH FYQYN
Sbjct  25    GVFVDASHKVYMHLQSTTSHVDVSKVHRTGYHFQPPKNWINDPNGPMYYNGVYHLFYQYN  84

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKDL+NW    PA+ PS+   D  G WSGSATILP N P +LYTG
Sbjct  85    PKGAIWGNIVWAHSVSKDLINWIPLEPAIYPSK-VFDKYGTWSGSATILPGNKPVILYTG  143

Query  1466  -VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
              VD+   QVQN A+P N SDPYL++W+K   NPLI  +    IN + FRDPTTAW G DG
Sbjct  144   IVDANKTQVQNYAIPANISDPYLRKWIKPDNNPLIVAD--KTINKSQFRDPTTAWMGRDG  201

Query  1289  NWRILVGSKVGRRGLAILYRS-KDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
             NWRILVGS    RG  I+Y+S KDF++W +AKHPLHS  G+G WECPDF+PVS  + NGL
Sbjct  202   NWRILVGSVRNHRGKVIMYKSDKDFMKWTKAKHPLHSAPGTGNWECPDFFPVSLKNKNGL  261

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS  G  IKHVLK+S D +R D+YT+GTYD  +DKY PD  S+D   GLR DYG +YAS
Sbjct  262   DTSYNGKDIKHVLKVSFDVTRFDHYTVGTYDTKKDKYFPDNTSIDGWKGLRLDYGNYYAS  321

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+D+ K RRIL GW NES      V++GW+GV  IPR +WLD + KQLVQWPVQELE 
Sbjct  322   KTFFDNGKNRRILLGWANESDTVDNDVRKGWAGVHPIPRKIWLDPSGKQLVQWPVQELET  381

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCS  579
             LR  KV++ +  L KG   E+ GI+ AQAD+EV F      KAE  +  W     Q +C+
Sbjct  382   LRKKKVQLNNKKLNKGEKVEIKGITVAQADVEVIFSFTSLDKAEPFDPSWADLYAQDVCA  441

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD-  402
              KG++V+GG+GPFGL  LAS+N +EYT VFFR+F   +    VLMCSD +RSSL  +T  
Sbjct  442   IKGSTVQGGLGPFGLLTLASKNLEEYTPVFFRIFKAQDKYK-VLMCSDASRSSLKNETTM  500

Query  401   -KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFN  225
              K S+  +VDV+   ++LSLR LIDHS+VESFGA GK CITSRVYPT AI +KAHL+AFN
Sbjct  501   YKPSFAGYVDVDLADKKLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAIFDKAHLFAFN  560

Query  224   NGVHSIKLSKLTAWSM  177
             NG   I +  L AWSM
Sbjct  561   NGAERITIETLNAWSM  576



>gb|ADM47341.1| apoplastic invertase [Solanum tuberosum]
Length=582

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/556 (57%), Positives = 387/556 (70%), Gaps = 11/556 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPY-PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GV   ASH V  +L++       +  +RT +HFQPP+NW+NDPNGPM Y GVYH FYQYN
Sbjct  25    GVFVDASHKVYMHLQSTTSHVDASKVHRTGYHFQPPKNWINDPNGPMYYNGVYHLFYQYN  84

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS SKDL+NW    PA+ PS+   D  G WSGSATILP N P +LYTG
Sbjct  85    PKGAIWGNIIWAHSVSKDLINWIPLEPAIYPSK-VFDKYGTWSGSATILPGNKPVILYTG  143

Query  1466  -VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
              VD+   QVQN A+P N SDPYL++W+K   NPLI  +    IN + FRDPTTAW G DG
Sbjct  144   IVDANKTQVQNYAIPANMSDPYLRKWIKPDNNPLIVAD--KTINKSQFRDPTTAWMGRDG  201

Query  1289  NWRILVGSKVGRRGLAILYRS-KDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
             NWRILVGS    RG  I+Y+S K+F++W +AKHPLHS  G+G WECPDF+PVS  + +GL
Sbjct  202   NWRILVGSVRNHRGKVIMYKSNKNFMKWTKAKHPLHSAPGTGNWECPDFFPVSLKNKDGL  261

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS  G  IKHVLK+S D +R D+YTIGTYD  +DKY PD  S+D   GLR DYG +YAS
Sbjct  262   DTSYNGKDIKHVLKVSFDVTRFDHYTIGTYDTKKDKYFPDNTSIDGWKGLRLDYGNYYAS  321

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+DS K RRIL GW NES      V++GW+GV  IPR +WLD + KQLVQWPVQELE 
Sbjct  322   KTFFDSGKNRRILLGWANESDTRDNDVRKGWAGVHPIPRKIWLDSSGKQLVQWPVQELET  381

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCS  579
             LR  KV++ +  L KG   E+ GI+ AQAD+EV F      KAE  +  W     Q +C+
Sbjct  382   LRKKKVQLNNKKLNKGEKVEIKGITVAQADVEVIFSFASLEKAELFDPSWADLYAQDVCA  441

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD-  402
              KG++V+GG+GPFGL  LAS+N +EYT VFFR+F   +    VLMCSD +RSSL  +T  
Sbjct  442   IKGSTVQGGLGPFGLLTLASKNLEEYTPVFFRIFKAQDKYK-VLMCSDASRSSLKNETTM  500

Query  401   -KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFN  225
              K S+  +VDV+   ++LSLR LIDHS+VESFGA GK CITSRVYPT AI +KAHL+AFN
Sbjct  501   YKPSFAGYVDVDLADKKLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAIFDKAHLFAFN  560

Query  224   NGVHSIKLSKLTAWSM  177
             NG   I +  L AWSM
Sbjct  561   NGAERITIETLNAWSM  576



>gb|AEV46303.1| apoplastic invertase [Solanum tuberosum]
Length=585

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 399/558 (72%), Gaps = 12/558 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++       + +RT FHFQPP++W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSAISVKNVHRTGFHFQPPKHWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTKFRDPTTAWMGQDGLWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS    RG+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRKHRGMALLYRSRDFIKWAKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +K+VLK SLD +R +YYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD +
Sbjct  269   NVKYVLKNSLDVNRFEYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSFYDPM  328

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK-  741
             K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K 
Sbjct  329   KNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETLRKQKI  388

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGAS  564
             +++ +  L KG + EV GISA+QAD+EV+F      KAE+ + +W     Q +C+ KG++
Sbjct  389   IQLNNKKLSKGEMFEVKGISASQADIEVSFSFSSLNKAEQFDPKWADLYAQDVCAIKGST  448

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSY  390
             ++GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS++  ++   K S+
Sbjct  449   IQGGLGPFGLVTLASKNLEEYTPVFFRVFKAQKNYK-VLMCSDARRSTMRQNEAMYKPSF  507

Query  389   GAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
               +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHL+ FNNG  
Sbjct  508   AGYVDVDLVDTKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHNNAHLFVFNNGSE  567

Query  212   SIKLSKLTAWSMKKPTIN  159
             +I +  L AWSM  P ++
Sbjct  568   TITIETLNAWSMDVPKMH  585



>gb|AES82076.2| beta-fructofuranosidase, insoluble protein [Medicago truncatula]
Length=574

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/554 (56%), Positives = 389/554 (70%), Gaps = 8/554 (1%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +A H V  +L+++     +  +RT +HFQPPRNW+NDPNGPM Y G YH FYQYNPKG+
Sbjct  25    VEAFHKVYPHLQSVSAISVSEVHRTGYHFQPPRNWINDPNGPMYYNGYYHLFYQYNPKGS  84

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DS  1458
              +G I W HS SKDL+NW+A  PA+ PS+P  D  G WSGSATI+P   P +LYTG+ D 
Sbjct  85    VWGNIVWAHSVSKDLINWKALEPAIYPSKPF-DKYGCWSGSATIVPGKGPVILYTGIIDE  143

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVK-SPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
             +N QVQ  A+P +P+DP L++W+K    NP++       +N ++FRDPTTAW G DG WR
Sbjct  144   KNTQVQVYAIPEDPTDPLLRKWIKPDAINPIVIAGQ--GVNGSAFRDPTTAWMGKDGRWR  201

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTSPN-GLDTSL  1104
             +LVGS+   RG+A LYRS+DFV+WV+AKHP+HS   +GMWECPDFYPVS     GLDTS+
Sbjct  202   MLVGSRRKHRGMAYLYRSRDFVKWVRAKHPIHSKTTTGMWECPDFYPVSLKGKVGLDTSI  261

Query  1103  VGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFY  924
              G+ +KHVLK SLD +R +YYT+GTY   +DKYIP   S D   GLRYDYG FYASK+F+
Sbjct  262   EGNHVKHVLKNSLDMTRFEYYTLGTYLTDKDKYIPSNTSEDGWGGLRYDYGNFYASKSFF  321

Query  923   DSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSN  744
             D  K RRILWGW NES    + VK+GW+G+Q IPRTVWLD T +QLVQWPV+EL  LR  
Sbjct  322   DQSKNRRILWGWANESDSQDDDVKKGWAGIQAIPRTVWLDPTERQLVQWPVEELNVLREK  381

Query  743   KVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGAS  564
             +V M +  L+KG+  EV+GI+AAQAD+EVTF      KAE  +  W  + Q LCSQKG+ 
Sbjct  382   EVSMNNQKLEKGNHVEVAGITAAQADVEVTFSFSSLDKAEAYDPSW-VNAQDLCSQKGSK  440

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGA  384
             V+GG+GPFGL  LASEN  E+T VFFRVF   + + VVL+CSD T SSL     K S+  
Sbjct  441   VQGGVGPFGLLTLASENLAEFTPVFFRVFKAPSKH-VVLLCSDATSSSLTSNLYKPSFAG  499

Query  383   FVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIK  204
             FVDV+   ++LSLR LIDHS+VESFG  GK  I SRVYP  A+  +A+L+ FNNG   I 
Sbjct  500   FVDVDFATKKLSLRSLIDHSVVESFGEGGKTNILSRVYPVLAVANQANLFVFNNGTEPII  559

Query  203   LSKLTAWSMKKPTI  162
             +  L AWSMK   +
Sbjct  560   VENLKAWSMKSAEL  573



>emb|CAB76673.1| invertase, putative [Solanum tuberosum]
Length=585

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 399/558 (72%), Gaps = 12/558 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++ +     + +RT FHFQPP+ W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSRAISVKNVHRTGFHFQPPKYWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTKFRDPTTAWMGQDGLWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS    RG+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRKHRGMALLYRSRDFIKWAKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +K+VLK SLD +R +YYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD +
Sbjct  269   NVKYVLKNSLDVNRFEYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSFYDPM  328

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK-  741
             K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K 
Sbjct  329   KNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETLRKQKI  388

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGAS  564
             +++ +  L KG + EV GISA+QAD+EV+F      KAE+ + +W     Q +C+ KG++
Sbjct  389   IQLNNKKLSKGEMFEVKGISASQADIEVSFSFSSLNKAEQFDPKWADLYAQDVCAIKGST  448

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSY  390
             ++GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS++  ++   K S+
Sbjct  449   IQGGLGPFGLVTLASKNLEEYTPVFFRVFKAQKNYK-VLMCSDARRSTMRQNEAMYKPSF  507

Query  389   GAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
               +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHL+ FNNG  
Sbjct  508   AGYVDVDLVDTKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHNNAHLFVFNNGSE  567

Query  212   SIKLSKLTAWSMKKPTIN  159
             +I +  L AWSM  P ++
Sbjct  568   TITIETLNAWSMDVPKMH  585



>ref|XP_008784034.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 4-like 
[Phoenix dactylifera]
Length=573

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/535 (55%), Positives = 385/535 (72%), Gaps = 6/535 (1%)
 Frame = -1

Query  1757  NHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASFGKISWGHSTSKDLVNWR  1578
             ++ YRT++HFQPP+NWMNDPNGPM Y G+YH FYQYNP  A +G I+WGHS S DL+NW 
Sbjct  42    SNQYRTAYHFQPPKNWMNDPNGPMYYNGIYHLFYQYNPNSAVWGNITWGHSISTDLINWT  101

Query  1577  AHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSRNRQVQNLAVPRNPSDPYLQ  1398
                PA+ PS+ + DING WSGSATI   + PA+LYTG+D+ NRQVQN+A+P+N SDP+L+
Sbjct  102   PQDPAIHPSK-SFDINGCWSGSATIRRGSEPAILYTGIDAENRQVQNVAIPKNLSDPFLR  160

Query  1397  EWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILVGSKVGRRGLAILYRSKDF  1218
             EW     NPL+ P   + ++ + FRDP TAW G DG+WR+ VG+++   G A+LY+S DF
Sbjct  161   EWSTPDYNPLMEP--VDGLDPSQFRDPMTAWHGSDGHWRVAVGAQIAGNGTAVLYKSSDF  218

Query  1217  VRWVQAKHPLHSGEGSGMWECPDFYPV-STSPNGLDTSLVGSKIKHVLKISLDESRHDYY  1041
             V WV+A  PLH+ +GSGMWECPDFYPV S    GLDTS     +K VLK+SL E++ D+Y
Sbjct  219   VHWVRAASPLHTSKGSGMWECPDFYPVPSKGRQGLDTSENSKDVKRVLKMSLSETQSDHY  278

Query  1040  TIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLIDTE  861
              +G YD  +D ++PD+   D    LRYDYGKFYASKTF+D  K+RRI W W+NES  + +
Sbjct  279   MLGKYDIEKDIFVPDETVDDYRVWLRYDYGKFYASKTFFDEEKKRRISWAWLNESDTEAD  338

Query  860   YVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNKVEMPSTMLKKGSVSEVSGIS  681
              + +GW+G+Q  PRT+WLD   +QLVQWPV+ELE LR N   + +T LK G + E+ G+ 
Sbjct  339   ALLKGWAGIQAAPRTIWLDSNGRQLVQWPVKELESLRRNGAHLQNTELKTGGLFEIKGVK  398

Query  680   AAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGASVRGGIGPFGLKVLASENRQEY  501
             A+QAD+EV F++    +AE ++  W  DP  LC ++ ASV+GG+GPFGL +LAS N +E+
Sbjct  399   ASQADVEVDFELPNLERAEPLDPSWLMDPPKLCREEDASVQGGLGPFGLLILASHNLEEH  458

Query  500   TAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYGAFVDVNPMQE-ELSLRILIDHS  324
             TAVFFRV+  +N   +VL+CSDQ RSSL  + DK +YG+FVD+N  +E  +SLR LIDHS
Sbjct  459   TAVFFRVYKAHNGY-MVLLCSDQRRSSLRPEVDKPAYGSFVDMNIEKEGRISLRTLIDHS  517

Query  323   IVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHSIKLSKLTAWSMKKPTIN  159
             +VESF   G+ CIT+RVYP   +    HLYAFNNG  +IK+ KL AW M KP IN
Sbjct  518   VVESFAGGGRTCITARVYPEVLVTGDIHLYAFNNGTETIKIPKLQAWDMAKPWIN  572



>emb|CAA57428.1| beta-fructofuranosidase [Nicotiana tabacum]
Length=580

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/555 (57%), Positives = 390/555 (70%), Gaps = 12/555 (2%)
 Frame = -1

Query  1826  GGVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GGV+  ASH V  +L++      N  +RT +HFQPP+NW+NDPNGPM Y GVYH FYQYN
Sbjct  27    GGVD--ASHKVYMHLQSTSSNVKN-VHRTGYHFQPPKNWINDPNGPMYYNGVYHLFYQYN  83

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA +G I W HS S DL+NW    PA+ PS+   D  G WSGSATILP N P +LYTG
Sbjct  84    PKGAVWGNIVWAHSVSTDLINWIPLEPAIYPSK-IFDKFGTWSGSATILPGNKPIILYTG  142

Query  1466  VDSRNR-QVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
             +   NR QVQN A+P N SDPYL++W+K   NPLI  +    IN T FRDPTTAW G DG
Sbjct  143   IIDANRTQVQNYAIPANLSDPYLRKWIKPDNNPLIVADM--SINKTQFRDPTTAWMGRDG  200

Query  1289  NWRILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLD  1113
             +WRILVGS    RG  ILYRSKDF++W +AKHPLH+   +G WECPDF+PVS    NGLD
Sbjct  201   HWRILVGSVKNHRGKVILYRSKDFMKWTKAKHPLHTATNTGNWECPDFFPVSLKHTNGLD  260

Query  1112  TSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASK  933
             TS  G   KHVLK+SLD +R +YYT+GTYD  +D+YIPD  SVD   GLR DYG +YASK
Sbjct  261   TSYRGEYTKHVLKVSLDVTRFEYYTVGTYDTRKDRYIPDNTSVDGWKGLRLDYGNYYASK  320

Query  932   TFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKL  753
             +F+D  K RRI+ GW NES    + V++GW+GV  IPR +WLD + KQLVQWPV+ELE L
Sbjct  321   SFFDPSKNRRIMLGWANESDTVDDDVRKGWAGVHPIPRKLWLDPSGKQLVQWPVEELETL  380

Query  752   RSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQ  576
             R  KV++ +  L KG + EV GI+ AQAD+EVTF      KAE  +  W     Q +C+ 
Sbjct  381   RKKKVQLSNHKLYKGEMIEVKGITVAQADVEVTFSFASLDKAEPFDPSWADLYAQDVCAI  440

Query  575   KGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD--  402
             KG++V+GG GPFGL  LAS+N +EYT VFFRVF   +    VLMCSD +RS+L  +T   
Sbjct  441   KGSTVQGGRGPFGLITLASKNLEEYTLVFFRVFKAQDKYK-VLMCSDASRSTLKNETTMY  499

Query  401   KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNN  222
             K S+G +VDV+   ++LSLR LID+S+VESFGA GK CITSRVYPT AI +KAHL+AFNN
Sbjct  500   KPSFGGYVDVDLADKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIFDKAHLFAFNN  559

Query  221   GVHSIKLSKLTAWSM  177
             G  +I +  L AWSM
Sbjct  560   GTEAITIETLNAWSM  574



>gb|AEV46301.1| apoplastic invertase [Solanum tuberosum]
 gb|AEV46302.1| apoplastic invertase [Solanum tuberosum]
Length=586

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/559 (55%), Positives = 400/559 (72%), Gaps = 13/559 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++       + +RT FHFQPP++W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSAISVKNVHRTGFHFQPPKHWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPIILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTKFRDPTTAWMGQDGLWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS    RG+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRNHRGMALLYRSRDFIKWTKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1094  K-IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
             K +KHVLK SLD +R +YYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD 
Sbjct  269   KNVKHVLKNSLDVNRFEYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSFYDP  328

Query  917   LKRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
             +K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K
Sbjct  329   MKNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETLRKQK  388

Query  740   -VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGA  567
              +++ +  L KG + EV GISA+QAD+EV+F      KAE+ + +W     Q +C+ KG+
Sbjct  389   IIQLNNKKLSKGEMFEVKGISASQADIEVSFSFSSLNKAEQFDPKWADLYAQDVCAIKGS  448

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTS  393
             +++GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS++  ++   K S
Sbjct  449   TIQGGLGPFGLVTLASKNLEEYTPVFFRVFKAQKNYK-VLMCSDARRSTMRQNEAMYKPS  507

Query  392   YGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGV  216
             +  +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHL+ FNNG 
Sbjct  508   FAGYVDVDLVDTKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHNNAHLFVFNNGS  567

Query  215   HSIKLSKLTAWSMKKPTIN  159
              +I +  L AWSM  P ++
Sbjct  568   ETITIETLNAWSMDVPKMH  586



>ref|XP_007027808.1| Cell wall invertase 2 [Theobroma cacao]
 gb|EOY08310.1| Cell wall invertase 2 [Theobroma cacao]
Length=575

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/555 (57%), Positives = 391/555 (70%), Gaps = 12/555 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNP  1644
             GVE  ASH V Q L++         +RT +HFQPPRNW+NDPNGPM YKG+YH FYQYNP
Sbjct  25    GVE--ASHKVYQGLKSKTAVKVKQLHRTGYHFQPPRNWINDPNGPMYYKGIYHLFYQYNP  82

Query  1643  KGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV  1464
             KGA +G I W HS SKDL+NW A  PA+ PS+P  DI G WSGSAT+LP N P + YTG+
Sbjct  83    KGAVWGNIVWAHSVSKDLINWEALEPAIYPSKPF-DIKGCWSGSATVLPGNKPVIFYTGI  141

Query  1463  DSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNW  1284
             D + +Q+QN A+P N SDPYL++W K   NP+       K+N T+FRDPTTAW+  D +W
Sbjct  142   DPQGKQIQNYAIPSNSSDPYLRQWTKPTDNPIAVAGF--KMNKTAFRDPTTAWK-IDEHW  198

Query  1283  RILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTS  1107
             R+LVG +  +RG+A LYRS+DF +W +A+HPLHS   +GMWECPDFYPV+     G +TS
Sbjct  199   RMLVGGRRNQRGIAHLYRSRDFKKWTKAQHPLHSVPNTGMWECPDFYPVALFGEAGQNTS  258

Query  1106  LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
               G  +KHVLK+SLD +R +YYT+G Y   RDKY+ D  S+D   GLRYDYG FYASK+F
Sbjct  259   AFGPNVKHVLKVSLDATRFEYYTLGEYFPSRDKYVVDMDSIDGRDGLRYDYGNFYASKSF  318

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +D +K RRILWGW NES    + V +GW+G+Q IPR VWLD  RKQL+QWPV+E+E LRS
Sbjct  319   FDPVKDRRILWGWANESDTPQDDVSKGWAGIQTIPRKVWLDPNRKQLLQWPVEEIETLRS  378

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
               V +    LK G   EV  I+AAQAD++VTF I    KAE  +  W T+ Q LCS KG+
Sbjct  379   QNVRLSEKKLKLGDRIEVEEITAAQADVDVTFSIPNLDKAEPFDPSW-TNAQELCSLKGS  437

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL-DKKTDKTSY  390
             SV+GG+GPFGL  LAS+  +EYT VFFRVF     + VVL+CSD   SSL +    K S+
Sbjct  438   SVQGGVGPFGLLTLASQKLEEYTPVFFRVFKAQYKH-VVLLCSDARSSSLRNIGLYKPSF  496

Query  389   GAFVDVN-PMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
               FVDV+   +++LSLR LIDHS+VESFGA GK CITSRVYPT A+   AHL+AFNNG  
Sbjct  497   AGFVDVDLSEKKQLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAVFGDAHLFAFNNGTE  556

Query  212   SIKLSKLTAWSMKKP  168
             +I +  L AWSM+KP
Sbjct  557   TI-IVDLNAWSMRKP  570



>emb|CDM80283.1| unnamed protein product [Triticum aestivum]
Length=582

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/569 (52%), Positives = 408/569 (72%), Gaps = 19/569 (3%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              QASH+V   L++L+        RT +HFQPP++W+N   GPM Y+G+YH FYQYNPKGA
Sbjct  21    VQASHVVYPELQSLEAKEVATELRTGYHFQPPKHWIN---GPMYYRGLYHLFYQYNPKGA  77

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGVDSR  1455
              +G I W HS S DL++W A  PA+ P++P  D+NG WSGSAT+LPN  P ++YTG+D  
Sbjct  78    VWGNIIWAHSVSTDLIHWVALQPAIYPTRPF-DVNGCWSGSATMLPNGAPVIMYTGIDPD  136

Query  1454  NRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRIL  1275
               QVQN+A P N SDPYL   VK   NP+I+P+H   INA++FRDPTTAW GPDG+WR++
Sbjct  137   KNQVQNVAYPANLSDPYLWRCVKPDYNPIISPDH--GINASAFRDPTTAWYGPDGHWRLV  194

Query  1274  VGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS------PNGLD  1113
             VG+K   +G+A+LYRS+DF +WV+A+H LH+G  +GMWECPDFYPV+ +       +G+D
Sbjct  195   VGTKENMKGIAVLYRSRDFKKWVKARHSLHAGL-TGMWECPDFYPVAVAGGSRHHQSGVD  253

Query  1112  TS-----LVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGK  948
             T+     +V  ++K+VLK+SL+ +R+DYYT+GTYDH +++Y PD+   DND GLRYDYG 
Sbjct  254   TAELHDRVVAEEVKYVLKVSLELTRYDYYTVGTYDHDKERYTPDRAFPDNDYGLRYDYGD  313

Query  947   FYASKTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQ  768
             FYASK+F+D  K+RR+LWGW NES   T+   +GW+G+Q IPR ++L ++ +QL+QWPV+
Sbjct  314   FYASKSFFDPAKKRRVLWGWANESDTVTDDRHKGWAGIQAIPRKIFLSRSGRQLIQWPVE  373

Query  767   ELEKLRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQV  588
             E++ LRS  V + +  +K G   +V+G    Q+D+E  F I    KAEK +  W TD Q 
Sbjct  374   EVKSLRSKHVNVSNKAVKGGEYFKVTGFKTVQSDVEAAFTIRNLDKAEKFDPAWRTDAQG  433

Query  587   LCSQKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKK  408
             LC +  + V+GG+GPFGL +LAS++ +E TAVFFRVF  N+ + VVLMC+D TRSS + +
Sbjct  434   LCKKFNSHVKGGVGPFGLWLLASDDLKERTAVFFRVFKTNDTSYVVLMCNDPTRSSYESQ  493

Query  407   TDKTSYGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYA  231
               + ++  FV+V+  + ++++LR LIDHS+VESFGA GK CI +RVYP KAIG+ AHL+ 
Sbjct  494   IYRPTFAGFVNVDIAKTKKIALRTLIDHSVVESFGAGGKTCILTRVYPRKAIGDDAHLFV  553

Query  230   FNNGVHSIKLSKLTAWSMKKPTIN*LHPQ  144
             FNNG   IK++ L AW MK PT+N L  Q
Sbjct  554   FNNGESDIKVTNLHAWEMKTPTMNKLLEQ  582



>ref|NP_001233842.1| acid invertase [Solanum lycopersicum]
 dbj|BAA33150.1| acid invertase [Solanum lycopersicum]
Length=582

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/556 (57%), Positives = 389/556 (70%), Gaps = 11/556 (2%)
 Frame = -1

Query  1823  GVETQASHIVLQNLEALQPPY-PNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYN  1647
             GV   ASH V  +L++       +  +RT +HFQPP+NW+NDPNGPM Y GVYH FYQYN
Sbjct  25    GVFVDASHKVYMHLQSTTSHVDASKVHRTGYHFQPPKNWINDPNGPMYYNGVYHLFYQYN  84

Query  1646  PKGASFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTG  1467
             PKGA++G I W HS SKDL+NW    PA+ PS+   D  G WSGSATILP N P +LYTG
Sbjct  85    PKGATWGNIVWAHSVSKDLINWIPLEPAIYPSK-VFDKYGTWSGSATILPGNKPVILYTG  143

Query  1466  -VDSRNRQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDG  1290
              VD+   QVQN A+P N SDPYL++W+K   NPLI  +    IN   FRDPTTAW G DG
Sbjct  144   IVDANKTQVQNYAIPANMSDPYLRKWIKPDNNPLIVAD--KNINKIQFRDPTTAWMGRDG  201

Query  1289  NWRILVGSKVGRRGLAILYRS-KDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGL  1116
              WR+LVGS    RG  I+Y+S K+F++W +AKHPLHS +G+G WECPDF+PVS  + NGL
Sbjct  202   YWRVLVGSVRNHRGKVIMYKSNKNFMKWTKAKHPLHSAQGTGNWECPDFFPVSLKNENGL  261

Query  1115  DTSLVGSKIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYAS  936
             DTS  G  +KHVLK+S D +R D+YT+GTYD  +DKY PD  S+D   GL  DYG +YAS
Sbjct  262   DTSYDGKDVKHVLKVSFDVTRFDHYTVGTYDTKKDKYFPDNTSIDGWKGLGLDYGNYYAS  321

Query  935   KTFYDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEK  756
             KTF+DS K RRIL GW NES      VK+GW+GV  IPR +WLD + KQLVQWPVQELE 
Sbjct  322   KTFFDSGKNRRILLGWANESDTVDNDVKKGWAGVHPIPRKIWLDPSGKQLVQWPVQELET  381

Query  755   LRSNKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCS  579
             LR  KV++ +  L KG   E+ GI+ AQAD+EV F      KAE  +  W     Q +C+
Sbjct  382   LRKKKVQLNNKKLNKGEKVEIKGITVAQADVEVIFSFASLDKAEPFDSSWADLYAQDVCA  441

Query  578   QKGASVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTD-  402
              KG++V+GG+GPFGL  LAS+N +EYT VFFRVF  ++N   VLMCSD +RSSL  +T  
Sbjct  442   IKGSTVQGGLGPFGLLTLASKNLEEYTPVFFRVFKAHDNYK-VLMCSDASRSSLKNETTM  500

Query  401   -KTSYGAFVDVNPMQEELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFN  225
              K S+  +VDV+   ++LSLR LID+SIVESFGA GK CITSRVYPT AI +KAHL+AFN
Sbjct  501   YKPSFAGYVDVDLADKKLSLRSLIDNSIVESFGAGGKTCITSRVYPTLAIFDKAHLFAFN  560

Query  224   NGVHSIKLSKLTAWSM  177
             NG  +I +  L AWSM
Sbjct  561   NGAETITIETLNAWSM  576



>gb|AEV46304.1| apoplastic invertase [Solanum tuberosum]
Length=585

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/558 (55%), Positives = 398/558 (71%), Gaps = 12/558 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++       + +RT FHFQPP+ W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSAISVKNVHRTGFHFQPPKYWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPVILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTKFRDPTTAWMGQDGLWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS    RG+A+LYRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRKHRGMALLYRSRDFIKWAKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1094  KIKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDSL  915
              +K+VLK SLD +R +YYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD +
Sbjct  269   NVKYVLKNSLDVNRFEYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSFYDPM  328

Query  914   KRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK-  741
             K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K 
Sbjct  329   KNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETLRKQKI  388

Query  740   VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGAS  564
             +++ +  L KG + EV GISA+QAD+EV+F      KAE+ + +W     Q +C+ KG++
Sbjct  389   IQLNNKKLSKGEMFEVKGISASQADIEVSFSFSSLNKAEQFDPKWADLYAQDVCAIKGST  448

Query  563   VRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTSY  390
             ++GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS++  ++   K S+
Sbjct  449   IQGGLGPFGLVTLASKNLEEYTPVFFRVFKAQKNYK-VLMCSDARRSTMRQNEAMYKPSF  507

Query  389   GAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVH  213
               +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHL+ FNNG  
Sbjct  508   AGYVDVDLVDTKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHNNAHLFVFNNGSE  567

Query  212   SIKLSKLTAWSMKKPTIN  159
             +I +  L AWSM  P ++
Sbjct  568   TITIETLNAWSMDVPKMH  585



>gb|AEV46300.1| apoplastic invertase [Solanum tuberosum]
Length=586

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/559 (55%), Positives = 400/559 (72%), Gaps = 13/559 (2%)
 Frame = -1

Query  1808  ASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGASF  1629
             ASH +  +L++       + +RT FHFQPP++W+NDPN PM Y GVYH FYQYNPKG+ +
Sbjct  32    ASHNIFLDLQSSSAISVKNVHRTGFHFQPPKHWINDPNAPMYYNGVYHLFYQYNPKGSVW  91

Query  1628  GKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DSRN  1452
             G I W HS SKDL+NW    PA+ PS+   D  GAWSGSATILPNN P +LYTGV DS +
Sbjct  92    GNIVWAHSVSKDLINWIHLEPAIYPSK-KFDKYGAWSGSATILPNNKPIILYTGVVDSHD  150

Query  1451  RQVQNLAVPRNPSDPYLQEWVKSPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWRILV  1272
              QVQN A+P N SDP+L++W+K   NPLI P+  N IN T FRDPTTAW G DG WRI++
Sbjct  151   SQVQNYAIPANLSDPFLRKWIKPNNNPLIVPD--NSINKTKFRDPTTAWMGQDGLWRIVI  208

Query  1271  GSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVST-SPNGLDTSLVGS  1095
             GS    RG+A++YRS+DF++W +A+HPLHS   +G WECPDF+PVS  + NGLD S  G 
Sbjct  209   GSMRNHRGMALVYRSRDFIKWTKAQHPLHSSPHTGNWECPDFFPVSLKNTNGLDASYRGK  268

Query  1094  K-IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTFYDS  918
             K +KHVLK SLD +R +YYTIG YD  +D+YIPD  S+D   GLR DYG FYASK+FYD 
Sbjct  269   KNVKHVLKNSLDVNRFEYYTIGMYDTKKDRYIPDNNSIDGSKGLRLDYGNFYASKSFYDL  328

Query  917   LKRRRILWGWINES-LIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRSNK  741
             +K RRI+WGW NES ++  + +K+GW+G+Q IPR VWLD + KQL+QWP++ELE LR  K
Sbjct  329   MKNRRIVWGWTNESDVLPDDEIKKGWAGIQAIPRKVWLDPSGKQLIQWPIEELETLRKQK  388

Query  740   -VEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWT-TDPQVLCSQKGA  567
              +++ +  L KG + EV GISA+QAD+EV+F      KAE+ + +W     Q +C+ KG+
Sbjct  389   IIQLNNKKLSKGEMFEVKGISASQADIEVSFSFSSLNKAEQFDPKWADLYAQDVCAIKGS  448

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSL--DKKTDKTS  393
             +++GG+GPFGL  LAS+N +EYT VFFRVF    N   VLMCSD  RS++  ++   K S
Sbjct  449   TIQGGLGPFGLATLASKNLEEYTPVFFRVFKAQKNYK-VLMCSDARRSTMRQNEAMYKPS  507

Query  392   YGAFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGV  216
             +  +VDV+ +  ++LSLR LID+S+VESFGA GK CITSRVYPT AI   AHL+ FNNG 
Sbjct  508   FAGYVDVDLVDTKKLSLRSLIDNSVVESFGAGGKTCITSRVYPTLAIHNNAHLFVFNNGS  567

Query  215   HSIKLSKLTAWSMKKPTIN  159
              +I +  L AWSM  P ++
Sbjct  568   ETITIETLNAWSMDVPKMH  586



>ref|XP_003535739.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 1-like 
isoform X1 [Glycine max]
Length=576

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/557 (56%), Positives = 394/557 (71%), Gaps = 10/557 (2%)
 Frame = -1

Query  1814  TQASHIVLQNLEALQPPYPNHTYRTSFHFQPPRNWMNDPNGPMVYKGVYHFFYQYNPKGA  1635
              +A H +  +L+++     +   RT +HFQP +NW+NDPNGPM Y G+YH FYQYNPKGA
Sbjct  25    VEAFHDIYPDLQSISARSVSKLQRTGYHFQPRKNWINDPNGPMYYNGIYHLFYQYNPKGA  84

Query  1634  SFGKISWGHSTSKDLVNWRAHIPALSPSQPAADINGAWSGSATILPNNMPALLYTGV-DS  1458
              +G I WGH+ SKDL+NW+   PAL PS+P  D  G WSGSAT+LP   P +LYTGV D 
Sbjct  85    VWGNIVWGHAVSKDLINWKELEPALYPSKPF-DKYGVWSGSATVLPGKGPVILYTGVIDK  143

Query  1457  RNRQVQNLAVPRNPSDPYLQEWVK-SPRNPLIAPNHYNKINATSFRDPTTAWRGPDGNWR  1281
             ++ +VQ  A+P N SDP+L++WVK    NP++  +H   +NA+ FRDPTTAW   DG+WR
Sbjct  144   QSNEVQLYAIPENKSDPFLRKWVKPKAFNPIVVADH--SMNASVFRDPTTAWWSKDGHWR  201

Query  1280  ILVGSKVGRRGLAILYRSKDFVRWVQAKHPLHSGEGSGMWECPDFYPVSTS-PNGLDTSL  1104
             +L+G +   RG+A LYRSKDFV+W+QAKHP+HS   +GMWECPDFYPVS    NGLD S+
Sbjct  202   MLIGGRRKDRGMAYLYRSKDFVKWIQAKHPIHSAASTGMWECPDFYPVSLKGKNGLDISV  261

Query  1103  VGSK-IKHVLKISLDESRHDYYTIGTYDHVRDKYIPDKGSVDNDSGLRYDYGKFYASKTF  927
             VGS  IKHVLK SLD +R++YYTIGTY   +DKYIPD  S D   GLRYDYG FYASK+F
Sbjct  262   VGSSSIKHVLKNSLDLTRYEYYTIGTYFKNKDKYIPDNTSEDGWGGLRYDYGNFYASKSF  321

Query  926   YDSLKRRRILWGWINESLIDTEYVKQGWSGVQGIPRTVWLDKTRKQLVQWPVQELEKLRS  747
             +D  K RRILW W NES    + VK+GW+G+Q IPRTVWLD   KQLVQWPV+EL  LR 
Sbjct  322   FDPSKNRRILWAWANESDSKEDDVKKGWAGIQSIPRTVWLDYGGKQLVQWPVEELNSLRK  381

Query  746   NKVEMPSTMLKKGSVSEVSGISAAQADMEVTFKIMEFGKAEKMEERWTTDPQVLCSQKGA  567
              +V++    LKKG   EV GI+AAQAD+EVTF      +AE  + RW  + Q LCSQKG+
Sbjct  382   KEVKISHQKLKKGQHVEVKGITAAQADVEVTFSFSSLDRAEPFDSRW-VNAQDLCSQKGS  440

Query  566   SVRGGIGPFGLKVLASENRQEYTAVFFRVFMGNNNNPVVLMCSDQTRSSLDKKTDKTSYG  387
              V+GG+GPFGL  LASE  +E+T VFFR+F   N + V+LMCSD   SSL ++  K S+ 
Sbjct  441   KVQGGVGPFGLLTLASEKLEEFTPVFFRIFKAPNKH-VILMCSDARSSSLKRELYKPSFA  499

Query  386   AFVDVNPMQ-EELSLRILIDHSIVESFGAKGKVCITSRVYPTKAIGEKAHLYAFNNGVHS  210
              FV+V+  + ++LSL+ LIDHS+VESFGA G+  I SRVYPT AI +KAHL+ FNNG   
Sbjct  500   GFVNVDLAKNKKLSLKSLIDHSVVESFGAGGRTNILSRVYPTLAIKKKAHLFVFNNGTEH  559

Query  209   IKLSKLTAWSMKKPTIN  159
             I +  L AWSMK    N
Sbjct  560   ITVEYLKAWSMKSARRN  576



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5791006246578