BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8882_g1_i1 len=1002 path=[1:0-585 587:586-587 589:588-1001]

Length=1002
                                                                      Score     E

ref|XP_011093537.1|  PREDICTED: protein LIM1-like                       133   2e-34   
ref|XP_009789450.1|  PREDICTED: protein LIM1-like                       131   1e-33   
ref|XP_002513211.1|  lipid binding protein, putative                    130   1e-33   Ricinus communis
ref|XP_009612388.1|  PREDICTED: protein LIM1                            129   4e-33   
ref|XP_006439073.1|  hypothetical protein CICLE_v10033078mg             128   9e-33   
ref|XP_006439074.1|  hypothetical protein CICLE_v10033078mg             128   2e-32   
ref|XP_011025038.1|  PREDICTED: protein LIM1-like                       126   7e-32   
gb|KDP43435.1|  hypothetical protein JCGZ_16722                         125   1e-31   
gb|KHN49028.1|  hypothetical protein glysoja_031239                     125   8e-31   
gb|EYU26935.1|  hypothetical protein MIMGU_mgv1a016728mg                122   2e-30   
ref|XP_006598249.1|  PREDICTED: putative lipid-transfer protein D...    122   2e-30   
ref|XP_002263374.1|  PREDICTED: protein LIM1 isoform X1                 121   5e-30   Vitis vinifera
ref|XP_010659326.1|  PREDICTED: putative lipid-transfer protein D...    120   5e-30   
gb|KHN29205.1|  hypothetical protein glysoja_008540                     121   9e-30   
ref|XP_010695397.1|  PREDICTED: putative lipid-transfer protein DIR1    120   1e-29   
ref|XP_010032402.1|  PREDICTED: protein LIM1                            119   2e-29   
ref|XP_004306510.1|  PREDICTED: putative lipid-transfer protein D...    119   2e-29   
ref|XP_006366507.1|  PREDICTED: protein M7-like                         119   2e-29   
ref|XP_006585343.1|  PREDICTED: putative lipid-transfer protein D...    119   3e-29   
ref|NP_001234000.1|  5B protein precursor                               119   3e-29   
ref|XP_004514935.1|  PREDICTED: putative lipid-transfer protein D...    119   4e-29   
emb|CDP07728.1|  unnamed protein product                                117   1e-28   
ref|XP_003599085.1|  hypothetical protein MTR_3g027590                  116   1e-28   
ref|XP_008787368.1|  PREDICTED: protein LIM2-like                       117   1e-28   
ref|XP_010102632.1|  hypothetical protein L484_010921                   117   3e-28   
ref|XP_010257785.1|  PREDICTED: protein LIM3                            115   6e-28   
ref|XP_007149057.1|  hypothetical protein PHAVU_005G037300g             115   8e-28   
ref|XP_006850104.1|  hypothetical protein AMTR_s00022p00224500          115   8e-28   
ref|XP_007219287.1|  hypothetical protein PRUPE_ppa018509mg             114   8e-28   
ref|XP_009354696.1|  PREDICTED: protein LIM1-like                       114   8e-28   
gb|EPS68428.1|  hypothetical protein M569_06345                         115   9e-28   
gb|AES69336.2|  Lipid transfer protein                                  115   1e-27   
ref|XP_010928847.1|  PREDICTED: protein LIM1                            115   1e-27   
ref|XP_008350838.1|  PREDICTED: protein LIM1-like                       114   2e-27   
ref|XP_004149605.1|  PREDICTED: putative lipid-transfer protein D...    114   2e-27   
ref|XP_008356726.1|  PREDICTED: protein LIM1-like                       113   2e-27   
emb|CAN80001.1|  hypothetical protein VITISV_043972                     120   3e-27   Vitis vinifera
ref|XP_008461785.1|  PREDICTED: protein LIM3                            113   6e-27   
ref|XP_007220181.1|  hypothetical protein PRUPE_ppa015553mg             112   6e-27   
ref|XP_010464367.1|  PREDICTED: putative lipid-transfer protein DIR1    112   1e-26   
ref|XP_008231343.1|  PREDICTED: protein LIM1                            111   2e-26   
ref|NP_187401.1|  protease inhibitor/seed storage/lipid transfer ...    110   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884649.1|  protease inhibitor/seed storage/lipid transf...    110   5e-26   
ref|XP_010452198.1|  PREDICTED: putative lipid-transfer protein DIR1    109   9e-26   
ref|XP_006300049.1|  hypothetical protein CARUB_v10016275mg             109   1e-25   
ref|XP_007052584.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    115   1e-25   
ref|XP_006407836.1|  hypothetical protein EUTSA_v10022125mg             107   3e-25   
emb|CDY28049.1|  BnaC05g44510D                                          107   4e-25   
ref|XP_010555722.1|  PREDICTED: uncharacterized protein LOC104825138    108   5e-25   
gb|KFK38202.1|  hypothetical protein AALP_AA3G082300                    106   6e-25   
ref|XP_009147072.1|  PREDICTED: putative lipid-transfer protein DIR1    107   8e-25   
ref|XP_006403839.1|  hypothetical protein EUTSA_v10010991mg             106   2e-24   
ref|XP_002299959.2|  hypothetical protein POPTR_0001s27785g             104   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010515661.1|  PREDICTED: uncharacterized protein LOC104791462    106   3e-24   
ref|XP_010426815.1|  PREDICTED: putative lipid-transfer protein D...    105   3e-24   
ref|XP_006292260.1|  hypothetical protein CARUB_v10018469mg             105   3e-24   
ref|NP_190781.1|  protease inhibitor/seed storage/lipid transfer ...    105   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KGN58611.1|  hypothetical protein Csa_3G698520                       104   4e-24   
ref|XP_002877844.1|  protease inhibitor/seed storage/lipid transf...    105   4e-24   
ref|XP_009115917.1|  PREDICTED: putative lipid-transfer protein DIR1    105   4e-24   
emb|CDX78064.1|  BnaA09g32590D                                          105   4e-24   
ref|XP_009136657.1|  PREDICTED: uncharacterized protein LOC103860745    105   7e-24   
emb|CDX90617.1|  BnaA03g41640D                                          104   7e-24   
emb|CDY29065.1|  BnaC07g32710D                                          104   8e-24   
emb|CDX73657.1|  BnaC08g23460D                                          104   1e-23   
gb|KFK34446.1|  hypothetical protein AALP_AA5G146200                    102   3e-23   
emb|CDX74045.1|  BnaA03g30020D                                          100   2e-22   
ref|XP_004135913.1|  PREDICTED: putative lipid-transfer protein D...    100   2e-22   
ref|XP_009134967.1|  PREDICTED: protein LIM1-like                     99.4    5e-22   
ref|XP_008461263.1|  PREDICTED: protein LIM1-like                     97.8    1e-21   
emb|CDY07995.1|  BnaC03g35280D                                        97.8    2e-21   
ref|XP_010486304.1|  PREDICTED: uncharacterized protein LOC104764467  96.7    5e-21   
ref|XP_010548801.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    2e-20   
ref|XP_010238648.1|  PREDICTED: uncharacterized protein LOC104584760  74.7    5e-13   
ref|XP_008386755.1|  PREDICTED: putative lipid-transfer protein DIR1  60.1    8e-08   
ref|XP_008386579.1|  PREDICTED: putative lipid-transfer protein DIR1  59.3    2e-07   
ref|XP_009339897.1|  PREDICTED: putative lipid-transfer protein DIR1  59.3    2e-07   
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                      62.0    3e-07   Vitis vinifera
ref|XP_009339893.1|  PREDICTED: putative lipid-transfer protein DIR1  58.2    3e-07   
ref|XP_010325628.1|  PREDICTED: pectinesterase 2                      61.6    4e-07   
ref|XP_002283832.1|  PREDICTED: putative lipid-transfer protein DIR1  57.4    6e-07   Vitis vinifera
gb|AEB33950.1|  defective in induced resistance 2 protein             57.0    8e-07   
ref|XP_009797273.1|  PREDICTED: putative lipid-transfer protein DIR1  57.0    9e-07   
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...  60.1    1e-06   
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...  60.1    1e-06   
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...  60.1    1e-06   
ref|XP_007223557.1|  hypothetical protein PRUPE_ppa013722mg           56.6    1e-06   
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg           60.1    1e-06   
ref|XP_008222678.1|  PREDICTED: putative lipid-transfer protein DIR1  56.6    1e-06   
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                 59.7    1e-06   
gb|EYU31969.1|  hypothetical protein MIMGU_mgv1a005025mg              59.7    1e-06   
ref|XP_009364632.1|  PREDICTED: putative lipid-transfer protein DIR1  56.2    2e-06   
ref|XP_009339389.1|  PREDICTED: putative lipid-transfer protein DIR1  55.8    2e-06   
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                 59.3    2e-06   
gb|ADG38285.1|  AT2G45220-like protein                                56.6    2e-06   
gb|ADG38279.1|  AT2G45220-like protein                                56.6    2e-06   
ref|XP_009335428.1|  PREDICTED: putative lipid-transfer protein DIR1  55.8    3e-06   
gb|AEN81616.1|  AT2G45220-like protein                                56.6    3e-06   
gb|AEN81619.1|  AT2G45220-like protein                                56.6    3e-06   
emb|CDX83392.1|  BnaA03g21140D                                        58.5    3e-06   
emb|CDX95641.1|  BnaC03g25220D                                        58.5    3e-06   
ref|XP_009601194.1|  PREDICTED: putative lipid-transfer protein DIR1  55.1    4e-06   
ref|XP_006347887.1|  PREDICTED: pectinesterase 2-like                 58.5    4e-06   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                      58.2    5e-06   
ref|XP_008385814.1|  PREDICTED: putative lipid-transfer protein DIR1  54.7    5e-06   
emb|CDX74715.1|  BnaA05g04610D                                        57.4    7e-06   
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                 57.8    7e-06   
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                 57.8    7e-06   
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                 57.4    8e-06   
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                 57.4    8e-06   
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...  57.4    8e-06   
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative             57.4    8e-06   Ricinus communis
emb|CAN78759.1|  hypothetical protein VITISV_000562                   57.4    8e-06   Vitis vinifera
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                      57.4    1e-05   
ref|XP_008387060.1|  PREDICTED: putative lipid-transfer protein DIR1  53.9    1e-05   
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg           57.0    1e-05   
emb|CDY18944.1|  BnaC04g04060D                                        57.0    1e-05   
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...  57.0    1e-05   
gb|KHN27145.1|  Putative lipid-transfer protein DIR1                  53.5    1e-05   
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg           56.6    1e-05   
ref|XP_006606947.1|  PREDICTED: putative lipid-transfer protein D...  53.5    1e-05   
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...  56.2    2e-05   
ref|XP_008792988.1|  PREDICTED: putative lipid-transfer protein DIR1  53.1    2e-05   
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                 56.2    2e-05   
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                      56.2    2e-05   
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...  55.8    2e-05   
ref|XP_004230985.1|  PREDICTED: putative lipid-transfer protein DIR1  52.8    3e-05   
ref|XP_002882002.1|  predicted protein                                55.8    3e-05   
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                 55.5    3e-05   
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg              55.5    4e-05   
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...  55.1    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006365510.1|  PREDICTED: putative lipid-transfer protein D...  52.0    4e-05   
emb|CDY27388.1|  BnaC04g50170D                                        55.1    5e-05   
ref|XP_009142324.1|  PREDICTED: probable pectinesterase/pectinest...  55.1    5e-05   
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                 54.7    6e-05   
emb|CDY23190.1|  BnaA04g05690D                                        51.2    6e-05   
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...  54.7    6e-05   
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...  54.7    6e-05   
gb|KDP22414.1|  hypothetical protein JCGZ_26245                       54.7    7e-05   
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg           54.3    7e-05   
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                 54.3    8e-05   
gb|KDP42884.1|  hypothetical protein JCGZ_23826                       51.2    8e-05   
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                 54.3    9e-05   
gb|KFK37315.1|  hypothetical protein AALP_AA4G241100                  53.9    1e-04   
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                 53.9    1e-04   
ref|XP_008227058.1|  PREDICTED: putative lipid-transfer protein DIR1  50.8    1e-04   
ref|XP_007212412.1|  hypothetical protein PRUPE_ppa016471mg           50.4    1e-04   
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...  53.5    1e-04   
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                 53.5    2e-04   
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor               53.5    2e-04   
ref|XP_007142607.1|  hypothetical protein PHAVU_007G001800g           50.4    2e-04   
ref|XP_002529687.1|  lipid binding protein, putative                  50.1    2e-04   Ricinus communis
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg           53.5    2e-04   
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                 53.5    2e-04   
emb|CDO97873.1|  unnamed protein product                              50.4    2e-04   
gb|KHN47892.1|  Pectinesterase 2                                      53.1    2e-04   
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                 53.1    2e-04   
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g           52.8    2e-04   
ref|XP_009399057.1|  PREDICTED: putative lipid-transfer protein DIR1  49.7    2e-04   
ref|XP_006423199.1|  hypothetical protein CICLE_v10029642mg           49.7    2e-04   
ref|NP_001235199.1|  uncharacterized protein LOC100527120 precursor   49.7    2e-04   
ref|XP_004296699.1|  PREDICTED: putative lipid-transfer protein D...  49.7    3e-04   
ref|XP_002322401.1|  putative pectin methylesterase family protein    52.8    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010258605.1|  PREDICTED: putative lipid-transfer protein DIR1  49.7    3e-04   
ref|XP_002529688.1|  lipid binding protein, putative                  49.7    3e-04   Ricinus communis
ref|XP_004491449.1|  PREDICTED: putative lipid-transfer protein D...  49.3    3e-04   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                 52.4    4e-04   
emb|CDP08022.1|  unnamed protein product                              52.4    4e-04   
emb|CBI24285.3|  unnamed protein product                              52.0    4e-04   
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                 52.0    4e-04   
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                      52.0    5e-04   Vitis vinifera
emb|CAN61352.1|  hypothetical protein VITISV_027758                   48.9    5e-04   Vitis vinifera
emb|CAN72894.1|  hypothetical protein VITISV_022314                   49.3    5e-04   Vitis vinifera
emb|CAN83663.1|  hypothetical protein VITISV_017689                   51.6    5e-04   Vitis vinifera
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                      51.6    5e-04   Vitis vinifera
emb|CBI24286.3|  unnamed protein product                              51.6    5e-04   
ref|XP_007140447.1|  hypothetical protein PHAVU_008G112900g           48.5    6e-04   
ref|XP_002275805.1|  PREDICTED: putative lipid-transfer protein DIR1  48.9    6e-04   Vitis vinifera
emb|CAN76835.1|  hypothetical protein VITISV_043176                   51.6    6e-04   Vitis vinifera
ref|XP_008809954.1|  PREDICTED: putative lipid-transfer protein DIR1  48.5    6e-04   
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                 51.6    6e-04   Vitis vinifera
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                 51.6    6e-04   
gb|EPS67451.1|  hypothetical protein M569_07329                       48.5    7e-04   
ref|XP_010646191.1|  PREDICTED: putative lipid-transfer protein DIR1  48.5    7e-04   
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...  51.2    8e-04   
gb|ACM90158.1|  trypsin-alpha amylase inhibitor                       48.1    9e-04   Jatropha curcas
ref|XP_009790835.1|  PREDICTED: LOW QUALITY PROTEIN: putative lip...  49.3    9e-04   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                 51.2    9e-04   
ref|NP_001236851.1|  uncharacterized protein LOC100526983 precursor   48.1    9e-04   
ref|XP_009396800.1|  PREDICTED: putative lipid-transfer protein DIR1  48.1    0.001   
ref|XP_006577402.1|  PREDICTED: probable pectinesterase/pectinest...  49.3    0.001   
ref|XP_004294054.1|  PREDICTED: putative lipid-transfer protein D...  48.1    0.001   



>ref|XP_011093537.1| PREDICTED: protein LIM1-like [Sesamum indicum]
Length=131

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            ESK  PCGSTF +T++QL+PCR AV+ F P PP EACCA++++LGQPCLC ++NGPPI G
Sbjct  48   ESKGHPCGSTFFATLVQLIPCRAAVAPFSPVPPNEACCASIKALGQPCLCVLINGPPISG  107

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR+MA+QLPDKCTANFEPCE+
Sbjct  108  VDRSMAMQLPDKCTANFEPCEI  129



>ref|XP_009789450.1| PREDICTED: protein LIM1-like [Nicotiana sylvestris]
Length=110

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            ES A PC +TF S +IQL+PCR AV+ F P PP+EACCA++++LGQPCLC ++NGPPI G
Sbjct  27   ESNAHPCSATFFSALIQLIPCRAAVAPFSPIPPSEACCASIKALGQPCLCVLINGPPISG  86

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR MALQLPDKCTANFEPCEL
Sbjct  87   VDRTMALQLPDKCTANFEPCEL  108



>ref|XP_002513211.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF49202.1| lipid binding protein, putative [Ricinus communis]
Length=109

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + KA  CGSTF S ++QL+PCR AV+ F P PP++ACC+AV++LGQPCLC +VNGPPI G
Sbjct  26   QGKAYACGSTFFSALVQLIPCRAAVAPFSPIPPSDACCSAVKALGQPCLCVLVNGPPISG  85

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDRNMALQLPDKCTANFEPCE+
Sbjct  86   VDRNMALQLPDKCTANFEPCEI  107



>ref|XP_009612388.1| PREDICTED: protein LIM1 [Nicotiana tomentosiformis]
Length=110

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            ES A PC +TF S +IQL+PCR AV+ F P PP+EACCA++++LGQPCLC ++NGPPI G
Sbjct  27   ESNAHPCSATFFSALIQLIPCRAAVAPFSPIPPSEACCASIKALGQPCLCVLINGPPISG  86

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR MALQLPDKCTANFEPCE 
Sbjct  87   VDRTMALQLPDKCTANFEPCEF  108



>ref|XP_006439073.1| hypothetical protein CICLE_v10033078mg [Citrus clementina]
 ref|XP_006482848.1| PREDICTED: protein M7-like [Citrus sinensis]
 gb|ESR52313.1| hypothetical protein CICLE_v10033078mg [Citrus clementina]
Length=107

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            +  + PC +TF+ST++QL+PCRPAVS F P PP+EACC A+++LGQPCLC ++NGPPI G
Sbjct  24   QGNSHPCANTFISTLVQLIPCRPAVSPFSPIPPSEACCNAIKALGQPCLCVLINGPPIAG  83

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            +DRN+ALQLPDKC ANFEPC++
Sbjct  84   IDRNVALQLPDKCIANFEPCDM  105



>ref|XP_006439074.1| hypothetical protein CICLE_v10033078mg [Citrus clementina]
 gb|ESR52314.1| hypothetical protein CICLE_v10033078mg [Citrus clementina]
 gb|KDO83477.1| hypothetical protein CISIN_1g039389mg [Citrus sinensis]
Length=125

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            +  + PC +TF+ST++QL+PCRPAVS F P PP+EACC A+++LGQPCLC ++NGPPI G
Sbjct  24   QGNSHPCANTFISTLVQLIPCRPAVSPFSPIPPSEACCNAIKALGQPCLCVLINGPPIAG  83

Query  647  VDRNMALQLPDKCTANFEPC  588
            +DRN+ALQLPDKC ANFEPC
Sbjct  84   IDRNVALQLPDKCIANFEPC  103



>ref|XP_011025038.1| PREDICTED: protein LIM1-like [Populus euphratica]
Length=109

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +A PCGSTF S +IQ++PCR AV+ F P  P+EACC+AV++LGQPCLC +VNGPPI G
Sbjct  25   QGQAHPCGSTFFSALIQMIPCRAAVAPFSPIQPSEACCSAVKALGQPCLCTLVNGPPISG  84

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDRNMALQLPDKC+A+FEPCE+
Sbjct  85   VDRNMALQLPDKCSASFEPCEI  106



>gb|KDP43435.1| hypothetical protein JCGZ_16722 [Jatropha curcas]
Length=108

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +A  CGSTF S ++QL+PCR AV+ F P PP+E CC A+++LGQPCLC +VNGPPI G
Sbjct  24   QGEAHACGSTFFSALVQLIPCRAAVAPFSPIPPSEVCCNALKTLGQPCLCVLVNGPPISG  83

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDRNMALQLPDKCT NFEPCE+
Sbjct  84   VDRNMALQLPDKCTTNFEPCEI  105



>gb|KHN49028.1| hypothetical protein glysoja_031239 [Glycine soja]
Length=160

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +++PC STF S ++QL+PCR AV+ F P PP+++CC A+++LGQPCLC +VNGPPI G
Sbjct  30   QVQSSPCTSTFFSALVQLIPCRAAVAPFSPIPPSDSCCNALKALGQPCLCVLVNGPPISG  89

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDRNMA QLPDKCTANFEPC+L
Sbjct  90   VDRNMASQLPDKCTANFEPCDL  111



>gb|EYU26935.1| hypothetical protein MIMGU_mgv1a016728mg [Erythranthe guttata]
Length=109

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            +S   PCGSTF S ++QL+PC+ AV+ F P PPTEACCA++++LGQPCLC +V GPPI G
Sbjct  26   DSIGHPCGSTFFSALVQLIPCKAAVAPFSPIPPTEACCASIKALGQPCLCVLVTGPPIAG  85

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR MA+QLP KCTA+FEPCE+
Sbjct  86   VDRTMAMQLPVKCTADFEPCEM  107



>ref|XP_006598249.1| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
Length=112

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +++PC STF S ++QL+PCR AV+ F P PP+++CC A+++LGQPCLC +VNGPPI G
Sbjct  30   QVQSSPCTSTFFSALVQLIPCRAAVAPFSPIPPSDSCCNALKALGQPCLCVLVNGPPISG  89

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDRNMA QLPDKCTANFEPC++
Sbjct  90   VDRNMASQLPDKCTANFEPCDI  111



>ref|XP_002263374.1| PREDICTED: protein LIM1 isoform X1 [Vitis vinifera]
Length=108

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + K   CG++F S +IQ++PCR AV+ F P PP+EACC AVR+LGQPCLC +VNGPPI G
Sbjct  25   QGKGTTCGTSFFSALIQMIPCRAAVAPFSPIPPSEACCNAVRTLGQPCLCVLVNGPPISG  84

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDRNMA+ LP+KCT NF+PCE+
Sbjct  85   VDRNMAMLLPEKCTTNFDPCEM  106



>ref|XP_010659326.1| PREDICTED: putative lipid-transfer protein DIR1 isoform X2 [Vitis 
vinifera]
Length=95

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + K   CG++F S +IQ++PCR AV+ F P PP+EACC AVR+LGQPCLC +VNGPPI G
Sbjct  12   QGKGTTCGTSFFSALIQMIPCRAAVAPFSPIPPSEACCNAVRTLGQPCLCVLVNGPPISG  71

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDRNMA+ LP+KCT NF+PCE+
Sbjct  72   VDRNMAMLLPEKCTTNFDPCEM  93



>gb|KHN29205.1| hypothetical protein glysoja_008540 [Glycine soja]
Length=143

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 72/103 (70%), Gaps = 8/103 (8%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + ++ PC STF S ++QL+PCR AV+ F P PP +ACC A++ LGQPCLC +VNGPPI G
Sbjct  30   QVQSNPCTSTFFSALVQLIPCRAAVAPFSPIPPNDACCNALKGLGQPCLCVLVNGPPISG  89

Query  647  VDRNMALQLPDKCTANFEPCELgk*cycg*ggKMEMNKQGYGG  519
            VDRNMA QLP+KCTANF+PCE+           + MNK    G
Sbjct  90   VDRNMASQLPEKCTANFDPCEI--------SLSLSMNKHKKKG  124



>ref|XP_010695397.1| PREDICTED: putative lipid-transfer protein DIR1 [Beta vulgaris 
subsp. vulgaris]
Length=110

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            CG+TF S ++QL+PCR AVS F P PP++ CC AV++LGQPCLC +VNGPPI GVDR+MA
Sbjct  33   CGNTFFSALVQLIPCRTAVSPFSPIPPSDTCCNAVKTLGQPCLCVLVNGPPISGVDRSMA  92

Query  629  LQLPDKCTANFEPCEL  582
            LQLPDKC +NF+PCEL
Sbjct  93   LQLPDKCASNFDPCEL  108



>ref|XP_010032402.1| PREDICTED: protein LIM1 [Eucalyptus grandis]
 gb|KCW51807.1| hypothetical protein EUGRSUZ_J01258 [Eucalyptus grandis]
Length=107

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +   CGSTF S ++QL+PCR AV+ F   PP+EACC A+++LGQPCLC +VNGPPI G
Sbjct  24   KGEGLTCGSTFFSAMVQLIPCRAAVAPFSSIPPSEACCNAIKALGQPCLCVLVNGPPISG  83

Query  647  VDRNMALQLPDKCTANFEPCE  585
            VDR MALQLP+KCTANFEPC+
Sbjct  84   VDRTMALQLPEKCTANFEPCD  104



>ref|XP_004306510.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=108

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +   CG TF +++IQL+PCRPAV  F P PP+E CC A+++LGQPCLC +VNGPPI G
Sbjct  25   QGQGNSCGLTFFASLIQLIPCRPAVIPFSPIPPSETCCTALKALGQPCLCVLVNGPPISG  84

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDRNMA+QLP+KC+ANFEPC +
Sbjct  85   VDRNMAIQLPEKCSANFEPCSI  106



>ref|XP_006366507.1| PREDICTED: protein M7-like [Solanum tuberosum]
Length=109

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -2

Query  824  SKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGV  645
            S   PC STF S +IQL+PCR +V  F   PP+EACCA++++LGQPCLC ++NGPPI GV
Sbjct  27   SNGHPCSSTFFSALIQLIPCRASVVPFSSVPPSEACCASIKALGQPCLCVLINGPPISGV  86

Query  644  DRNMALQLPDKCTANFEPCEL  582
            DR+MA+QLPDKCTANFE CE 
Sbjct  87   DRSMAVQLPDKCTANFEQCEF  107



>ref|XP_006585343.1| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
Length=112

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + ++ PC STF S ++QL+PCR AV+ F P PP +ACC A++ LGQPCLC +VNGPPI G
Sbjct  30   QVQSNPCTSTFFSALVQLIPCRAAVAPFSPIPPNDACCNALKGLGQPCLCVLVNGPPISG  89

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDRNMA QLP+KCTANF+PCE+
Sbjct  90   VDRNMASQLPEKCTANFDPCEI  111



>ref|NP_001234000.1| 5B protein precursor [Solanum lycopersicum]
 emb|CAA80273.1| 5B protein [Solanum lycopersicum]
Length=105

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -2

Query  824  SKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGV  645
            S   PC STF S +IQL+PCR +V  F   PP+EACCA++++LGQPCLC ++NGPPI GV
Sbjct  23   SNGHPCSSTFFSALIQLIPCRASVVPFSSVPPSEACCASIKALGQPCLCVLINGPPISGV  82

Query  644  DRNMALQLPDKCTANFEPCEL  582
            DRNMA+QLP+KCTANFE CE 
Sbjct  83   DRNMAVQLPEKCTANFEQCEF  103



>ref|XP_004514935.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cicer arietinum]
Length=107

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + ++ PC STF S ++QL+PCR AV+ F P PP +ACC A++ LGQPCLC +VNGPPI G
Sbjct  25   QVQSTPCTSTFFSALVQLIPCRAAVAPFSPIPPNDACCNALKGLGQPCLCVLVNGPPISG  84

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR+MA QLPDKCT NFEPCE+
Sbjct  85   VDRSMASQLPDKCTTNFEPCEI  106



>emb|CDP07728.1| unnamed protein product [Coffea canephora]
Length=108

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+K +PC STF S ++QL+PCR AV+   P+ P EACC A+++LGQPCLC ++NGPPI G
Sbjct  26   ETKGSPCVSTFFSALVQLIPCRAAVAPLSPYQPNEACCVALKALGQPCLCVLINGPPISG  85

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR++A+QLP+KC ANFEPC L
Sbjct  86   VDRSLAMQLPEKCAANFEPCNL  107



>ref|XP_003599085.1| hypothetical protein MTR_3g027590 [Medicago truncatula]
Length=89

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +++PC STF S+++QL+PCR AV+ F P PP ++CC A+R+LGQPCLC +VNGPPI G
Sbjct  7    QVQSSPCSSTFFSSLVQLIPCRGAVAPFSPIPPNDSCCNALRALGQPCLCVLVNGPPISG  66

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDRNMA QLPDKC  +F+PCE+
Sbjct  67   VDRNMASQLPDKCATSFDPCEI  88



>ref|XP_008787368.1| PREDICTED: protein LIM2-like [Phoenix dactylifera]
Length=113

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C STF S ++QL PCRPAV+ F P PP+EACC AV++LGQPCLC +VNGPPI GVDRNMA
Sbjct  36   CTSTFFSALLQLTPCRPAVTPFSPAPPSEACCNAVKTLGQPCLCQLVNGPPITGVDRNMA  95

Query  629  LQLPDKCTANFEPC  588
            +QLP KCT NFEPC
Sbjct  96   MQLPGKCTVNFEPC  109



>ref|XP_010102632.1| hypothetical protein L484_010921 [Morus notabilis]
 gb|EXB93782.1| hypothetical protein L484_010921 [Morus notabilis]
Length=125

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C STF S +I+L+PCR AV+ F P PP+EACC +V++LGQPCLC ++NGPPI GVDRNMA
Sbjct  43   CTSTFFSALIRLIPCRAAVAPFSPIPPSEACCNSVKALGQPCLCILINGPPISGVDRNMA  102

Query  629  LQLPDKCTANFEPCE  585
            LQLP+KCTANFEPC 
Sbjct  103  LQLPEKCTANFEPCS  117



>ref|XP_010257785.1| PREDICTED: protein LIM3 [Nelumbo nucifera]
Length=107

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C STF + ++QL+PCRPAV++F P PPTE CC AVR LGQPCLC +V+GPPI GVDRN+A
Sbjct  30   CSSTFFAALVQLIPCRPAVTSFSPLPPTEGCCNAVRMLGQPCLCMLVSGPPIAGVDRNVA  89

Query  629  LQLPDKCTANFEPCEL  582
            +QLP KC  NFEPC++
Sbjct  90   MQLPAKCAFNFEPCQV  105



>ref|XP_007149057.1| hypothetical protein PHAVU_005G037300g, partial [Phaseolus vulgaris]
 gb|ESW21051.1| hypothetical protein PHAVU_005G037300g, partial [Phaseolus vulgaris]
Length=106

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E +++ C STF ST++QL+PCR AV+ F   PPT+ACC A+R+LGQPCLC +V GPPI G
Sbjct  28   EVESSSCKSTFFSTLVQLIPCRAAVAPFSSIPPTDACCNALRTLGQPCLCVLVTGPPISG  87

Query  647  VDRNMALQLPDKCTANFEP  591
            VDRNMA QLPDKCT NFEP
Sbjct  88   VDRNMASQLPDKCTTNFEP  106



>ref|XP_006850104.1| hypothetical protein AMTR_s00022p00224500 [Amborella trichopoda]
 gb|ERN11685.1| hypothetical protein AMTR_s00022p00224500 [Amborella trichopoda]
Length=105

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C STF   ++QL+PCRPAV+ F P PP++ACC AVR+LGQPC+C ++NGPPI G+DRNMA
Sbjct  31   CPSTFFGALLQLIPCRPAVAPFSPIPPSDACCNAVRTLGQPCMCVLINGPPISGIDRNMA  90

Query  629  LQLPDKCTANFEPCE  585
            +QLP KCTANF PCE
Sbjct  91   MQLPTKCTANFPPCE  105



>ref|XP_007219287.1| hypothetical protein PRUPE_ppa018509mg, partial [Prunus persica]
 gb|EMJ20486.1| hypothetical protein PRUPE_ppa018509mg, partial [Prunus persica]
Length=88

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +   C STF S+I+QL+PCR AV  F P PP+E CC A+++LGQPCLC +VNGPPI G
Sbjct  7    QGEGTMCASTFFSSIVQLIPCRAAVVPFSPIPPSETCCNALKALGQPCLCVLVNGPPISG  66

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR MA+QLP+KCT NFEPC L
Sbjct  67   VDRTMAVQLPEKCTVNFEPCTL  88



>ref|XP_009354696.1| PREDICTED: protein LIM1-like [Pyrus x bretschneideri]
Length=93

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + + + C STF S ++QL+PCR AV  F P PP+E CC A+++LGQPCLC +VNGPPI G
Sbjct  12   QGQGSTCASTFFSALVQLIPCRAAVVPFSPIPPSETCCGALKALGQPCLCVLVNGPPISG  71

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR+MA+QLP+KC+ANFEPC  
Sbjct  72   VDRSMAMQLPEKCSANFEPCTF  93



>gb|EPS68428.1| hypothetical protein M569_06345 [Genlisea aurea]
Length=104

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + K  PCG+TF S ++QL+PCRP+V+ F   PP+EACCA++++LGQPCLC +VNGPPI G
Sbjct  21   QVKGNPCGTTFFSALVQLIPCRPSVAPFSSLPPSEACCASIQALGQPCLCVLVNGPPISG  80

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR  A+QLP+KC  NF+PC++
Sbjct  81   VDRITAMQLPNKCAINFQPCDI  102



>gb|AES69336.2| Lipid transfer protein [Medicago truncatula]
Length=125

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +++PC STF S+++QL+PCR AV+ F P PP ++CC A+R+LGQPCLC +VNGPPI G
Sbjct  25   QVQSSPCSSTFFSSLVQLIPCRGAVAPFSPIPPNDSCCNALRALGQPCLCVLVNGPPISG  84

Query  647  VDRNMALQLPDKCTANFEPC  588
            VDRNMA QLPDKC  +F+PC
Sbjct  85   VDRNMASQLPDKCATSFDPC  104



>ref|XP_010928847.1| PREDICTED: protein LIM1 [Elaeis guineensis]
Length=111

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PP+EACC A+++LGQPCLCA+VNGPP+ GVDRNMA
Sbjct  34   CPRTFFSALLQLMPCRLAVATFNPAPPSEACCNAIKTLGQPCLCALVNGPPVTGVDRNMA  93

Query  629  LQLPDKCTANFEPCE  585
            +QLP KCT NFEPC 
Sbjct  94   MQLPVKCTVNFEPCN  108



>ref|XP_008350838.1| PREDICTED: protein LIM1-like [Malus domestica]
Length=107

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +   C STF S ++QL+PCR AV+ F P PP+E CC A++ LGQPCLC +VNGPPI G
Sbjct  26   QGQGTTCTSTFFSALVQLIPCRVAVAPFSPIPPSETCCNALKXLGQPCLCVLVNGPPISG  85

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            +DRNMA+QLP+KC ANFEPC  
Sbjct  86   IDRNMAMQLPEKCAANFEPCTF  107



>ref|XP_004149605.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
 ref|XP_004161403.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
Length=105

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + K   C  TF S++ +L+PCRP+V+ FRP PPT ACC A+++LGQPCLC +VNGPPI G
Sbjct  23   KGKGETCSFTFFSSLARLMPCRPSVAPFRPIPPTVACCNAIKTLGQPCLCVLVNGPPITG  82

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR +A+ LP KCTANF+PCE+
Sbjct  83   VDRELAMLLPQKCTANFDPCEM  104



>ref|XP_008356726.1| PREDICTED: protein LIM1-like [Malus domestica]
Length=93

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + + + C STF S ++QL+PCR AV  F P PP+E CC A+++LGQPCLC +VNGPPI G
Sbjct  12   QGQGSTCASTFFSALVQLIPCRAAVXPFSPIPPSEICCGALKALGQPCLCVLVNGPPISG  71

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR+MA+QLP+KC ANFEPC  
Sbjct  72   VDRSMAMQLPEKCGANFEPCTF  93



>emb|CAN80001.1| hypothetical protein VITISV_043972 [Vitis vinifera]
Length=460

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + K   CG++F S +IQ++PCR AV+ F P PP+EACC AVR+LGQPCLC +VNGPPI G
Sbjct  363  QGKGTTCGTSFFSALIQMIPCRAAVAPFSPIPPSEACCNAVRTLGQPCLCVLVNGPPISG  422

Query  647  VDRNMALQLPDKCTANFEPC  588
            VDRNMA+ LP+KCT NF+PC
Sbjct  423  VDRNMAMLLPEKCTTNFDPC  442



>ref|XP_008461785.1| PREDICTED: protein LIM3 [Cucumis melo]
Length=122

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + K   C  TF S++ +L+PCRP+V+ FRP PPT ACC AV++LGQPCLC +VNGPPI G
Sbjct  40   KGKGETCSFTFFSSLARLMPCRPSVAPFRPIPPTVACCNAVKTLGQPCLCVLVNGPPITG  99

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR +A+ LP KCTA+F+PCE+
Sbjct  100  VDRELAMLLPQKCTADFDPCEM  121



>ref|XP_007220181.1| hypothetical protein PRUPE_ppa015553mg [Prunus persica]
 gb|EMJ21380.1| hypothetical protein PRUPE_ppa015553mg [Prunus persica]
Length=88

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +   C STF S+I+QL+PCRPAV  F P PP+E CC A+++LGQPCLC  VNGP I G
Sbjct  7    QGEGTMCASTFFSSIVQLIPCRPAVVPFSPIPPSETCCNALKALGQPCLCVFVNGPSISG  66

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR MA+QLP+KC  NFEPC L
Sbjct  67   VDRTMAMQLPEKCIINFEPCTL  88



>ref|XP_010464367.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=109

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+   PCG TF+S +IQL+PCRP+V+ F    P E CCAA+++LGQPCLC +  GPPI+G
Sbjct  26   ETLGHPCGRTFLSALIQLVPCRPSVAPFSTLRPNELCCAAIKTLGQPCLCVLAKGPPIVG  85

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR +AL LP KC+ANF PCE+
Sbjct  86   VDRTLALHLPGKCSANFPPCEV  107



>ref|XP_008231343.1| PREDICTED: protein LIM1 [Prunus mume]
Length=106

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + +   C STF S+I+QL+PCR AV  F P PP+E CC A+++LGQPCLC +VNGP I G
Sbjct  23   QGEGTMCASTFFSSIVQLIPCRAAVVPFSPIPPSETCCNALKALGQPCLCVLVNGPSISG  82

Query  647  VDRNMALQLPDKCTANFEPCEL  582
            VDR MA+QLP+KCT NFEPC +
Sbjct  83   VDRTMAMQLPEKCTINFEPCGI  104



>ref|NP_187401.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 gb|AAF02152.1|AC009853_12 putative 5B-anther specific protein [Arabidopsis thaliana]
 gb|AEE74544.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=106

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+   PCG TF+S +IQL+PCRP+V+ F   PP   CCAA+++LGQPCLC +  GPPI+G
Sbjct  26   ETLGHPCGRTFLSALIQLVPCRPSVAPFSTLPPNGLCCAAIKTLGQPCLCVLAKGPPIVG  85

Query  647  VDRNMALQLPDKCTANFEPCE  585
            VDR +AL LP KC+ANF PC 
Sbjct  86   VDRTLALHLPGKCSANFLPCN  106



>ref|XP_002884649.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60908.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=106

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+   PCG TF+S +IQL+PCRP+V+ F   PP + CCAA++ LGQPCLC +  GPPI+G
Sbjct  26   ETLGHPCGRTFLSALIQLVPCRPSVAPFSTLPPNKLCCAAIKILGQPCLCVLAKGPPIVG  85

Query  647  VDRNMALQLPDKCTANFEPCE  585
            VDR +AL LP KC+ANF PC 
Sbjct  86   VDRTLALHLPGKCSANFPPCN  106



>ref|XP_010452198.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
 ref|XP_010452261.1| PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]
Length=106

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+   PCG TF+S +IQL+PCRP+V+ F    P E CCAA+++LGQPCLC +  GPPI+G
Sbjct  26   ETLGHPCGRTFLSALIQLVPCRPSVAPFSTLRPNELCCAAIKTLGQPCLCVLAKGPPIVG  85

Query  647  VDRNMALQLPDKCTANFEPCE  585
            VDR +AL LP KC+ANF PC 
Sbjct  86   VDRTLALHLPGKCSANFPPCN  106



>ref|XP_006300049.1| hypothetical protein CARUB_v10016275mg [Capsella rubella]
 gb|EOA32947.1| hypothetical protein CARUB_v10016275mg [Capsella rubella]
Length=113

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+   PCG TF+S +IQL+PCRP+V+ F    P E CCAA+++LGQPCLC +  GPPI+G
Sbjct  26   ETLGHPCGRTFLSALIQLVPCRPSVAPFSTLRPNELCCAAIKALGQPCLCVLAKGPPIVG  85

Query  647  VDRNMALQLPDKCTANFEPC  588
            VDR +AL LP KC+ANF PC
Sbjct  86   VDRTLALHLPGKCSANFPPC  105



>ref|XP_007052584.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
 gb|EOX96741.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
[Theobroma cacao]
Length=417

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C   FV   + L+PCR AV+ F P PP EACC A+++LGQPCLC +VNGPPI GVDRNMA
Sbjct  340  CAGEFVEQELALIPCRAAVAPFSPIPPNEACCNAIKALGQPCLCVLVNGPPISGVDRNMA  399

Query  629  LQLPDKCTANFEPCEL  582
            LQLP+KCTANFEPC++
Sbjct  400  LQLPEKCTANFEPCDI  415



>ref|XP_006407836.1| hypothetical protein EUTSA_v10022125mg, partial [Eutrema salsugineum]
 gb|ESQ49289.1| hypothetical protein EUTSA_v10022125mg, partial [Eutrema salsugineum]
Length=80

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -2

Query  824  SKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGV  645
            + A PCG TF+S +IQL+PCRP+V+ F    P E CCAA+++LGQPCLC +  GPPI GV
Sbjct  1    ATAHPCGRTFLSALIQLVPCRPSVAPFSTLSPNELCCAAIKTLGQPCLCVLAKGPPISGV  60

Query  644  DRNMALQLPDKCTANFEPC  588
            DR +ALQLP KC+ANF PC
Sbjct  61   DRTLALQLPGKCSANFPPC  79



>emb|CDY28049.1| BnaC05g44510D [Brassica napus]
Length=104

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+ A PCG TF+S +IQL+PCRP+V+ F    P   CCAA++ LGQPCLCA+  GPPI G
Sbjct  24   EATAHPCGRTFLSALIQLVPCRPSVAPFSTLSPNGLCCAAIKRLGQPCLCALSKGPPISG  83

Query  647  VDRNMALQLPDKCTANFEPCE  585
            VDR ++LQLP KC+ANF PC 
Sbjct  84   VDRTLSLQLPGKCSANFPPCN  104



>ref|XP_010555722.1| PREDICTED: uncharacterized protein LOC104825138 [Tarenaya hassleriana]
Length=135

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  821  KAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVD  642
            +A  C  TF S ++QL+PCR AV+ F P PPTEACC+AV +LG+PCLC + NGPP+ G+D
Sbjct  54   EAGGCSRTFFSALVQLIPCRAAVAPFSPVPPTEACCSAVVTLGRPCLCLLANGPPLSGID  113

Query  641  RNMALQLPDKCTANFEPCEL  582
            R+MALQLP +C+ NF PCE+
Sbjct  114  RSMALQLPQRCSTNFPPCEV  133



>gb|KFK38202.1| hypothetical protein AALP_AA3G082300 [Arabis alpina]
Length=91

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -2

Query  818  AAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDR  639
            A PCG TF+S +IQL+PCRP+V+ F    P   CCAA+++LGQPCLC +  GPPI GVDR
Sbjct  11   AHPCGRTFLSALIQLVPCRPSVAPFSTLSPNILCCAAIKTLGQPCLCVLARGPPISGVDR  70

Query  638  NMALQLPDKCTANFEPCEL  582
             +ALQLP KC+ANF PCE+
Sbjct  71   ALALQLPGKCSANFPPCEM  89



>ref|XP_009147072.1| PREDICTED: putative lipid-transfer protein DIR1 [Brassica rapa]
 emb|CDY35932.1| BnaA05g30180D [Brassica napus]
Length=104

 Score =   107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+ A PCG TF+S +IQL+PCRP+V+ F    P   CCAA++ LGQPCLCA+  GPPI G
Sbjct  24   EATAHPCGRTFLSALIQLVPCRPSVAPFSTLSPNGLCCAAIKRLGQPCLCALSKGPPISG  83

Query  647  VDRNMALQLPDKCTANFEPCE  585
            VDR ++LQLP KC+ANF PC 
Sbjct  84   VDRALSLQLPGKCSANFPPCN  104



>ref|XP_006403839.1| hypothetical protein EUTSA_v10010991mg [Eutrema salsugineum]
 gb|ESQ45292.1| hypothetical protein EUTSA_v10010991mg [Eutrema salsugineum]
Length=124

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPTE+CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  47   CSRTFFSALVQLIPCRAAVAPFSPVPPTESCCSAVVTLGRPCLCLLANGPPLSGIDRSMA  106

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C+ANF PC++
Sbjct  107  LQLPQRCSANFPPCDV  122



>ref|XP_002299959.2| hypothetical protein POPTR_0001s27785g [Populus trichocarpa]
 gb|EEE84764.2| hypothetical protein POPTR_0001s27785g [Populus trichocarpa]
Length=68

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = -2

Query  776  LLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKCTANF  597
            ++PCR AV+ F P  P+E CC+AV++LGQPCLC +VNGPPI GVDRNMALQLPDKC+ANF
Sbjct  1    MIPCRAAVAPFSPIQPSELCCSAVKALGQPCLCTLVNGPPISGVDRNMALQLPDKCSANF  60

Query  596  EPCEL  582
            EPCE+
Sbjct  61   EPCEI  65



>ref|XP_010515661.1| PREDICTED: uncharacterized protein LOC104791462 [Camelina sativa]
Length=139

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPTE CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  62   CSRTFFSALVQLIPCRAAVAPFSPIPPTETCCSAVVTLGRPCLCLLANGPPLSGIDRSMA  121

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C+ANF PC++
Sbjct  122  LQLPQRCSANFPPCDV  137



>ref|XP_010426815.1| PREDICTED: putative lipid-transfer protein DIR1 isoform X1 [Camelina 
sativa]
 ref|XP_010426816.1| PREDICTED: putative lipid-transfer protein DIR1 isoform X2 [Camelina 
sativa]
Length=125

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPTE CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  48   CSRTFFSALVQLIPCRAAVAPFSPIPPTETCCSAVVTLGRPCLCLLANGPPLSGIDRSMA  107

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C+ANF PC++
Sbjct  108  LQLPQRCSANFPPCDV  123



>ref|XP_006292260.1| hypothetical protein CARUB_v10018469mg [Capsella rubella]
 gb|EOA25158.1| hypothetical protein CARUB_v10018469mg [Capsella rubella]
Length=125

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPTE CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  48   CSRTFFSALVQLIPCRAAVAPFSPIPPTETCCSAVVTLGRPCLCLLANGPPLSGIDRSMA  107

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C+ANF PC++
Sbjct  108  LQLPQRCSANFPPCDV  123



>ref|NP_190781.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 emb|CAB41333.1| 5B protein like protein [Arabidopsis thaliana]
 gb|AAS49078.1| At3g52130 [Arabidopsis thaliana]
 dbj|BAD95162.1| 5B protein like protein [Arabidopsis thaliana]
 gb|AEE78898.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=125

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPTE CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  48   CSRTFFSALVQLIPCRAAVAPFSPIPPTEICCSAVVTLGRPCLCLLANGPPLSGIDRSMA  107

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C+ANF PC++
Sbjct  108  LQLPQRCSANFPPCDI  123



>gb|KGN58611.1| hypothetical protein Csa_3G698520 [Cucumis sativus]
Length=86

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  794  VSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPD  615
            VS    L+PCRP+V+ FRP PPT ACC A+++LGQPCLC +VNGPPI GVDR +A+ LP 
Sbjct  15   VSKHEMLMPCRPSVAPFRPIPPTVACCNAIKTLGQPCLCVLVNGPPITGVDRELAMLLPQ  74

Query  614  KCTANFEPCEL  582
            KCTANF+PCE+
Sbjct  75   KCTANFDPCEM  85



>ref|XP_002877844.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54103.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=124

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPTE CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  47   CSRTFFSALVQLIPCRAAVAPFSPIPPTEMCCSAVVTLGRPCLCLLANGPPLSGIDRSMA  106

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C+ANF PC++
Sbjct  107  LQLPQRCSANFPPCDV  122



>ref|XP_009115917.1| PREDICTED: putative lipid-transfer protein DIR1 [Brassica rapa]
Length=121

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPT++CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  44   CSRTFFSALVQLIPCRAAVAPFSPIPPTQSCCSAVVTLGRPCLCLLANGPPLSGIDRSMA  103

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C+ANF PC++
Sbjct  104  LQLPQRCSANFPPCDI  119



>emb|CDX78064.1| BnaA09g32590D [Brassica napus]
Length=121

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPT++CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  44   CSRTFFSALVQLIPCRAAVAPFSPIPPTQSCCSAVVTLGRPCLCLLANGPPLSGIDRSMA  103

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C+ANF PC++
Sbjct  104  LQLPQRCSANFPPCDI  119



>ref|XP_009136657.1| PREDICTED: uncharacterized protein LOC103860745 [Brassica rapa]
Length=133

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPTE+CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  56   CSRTFFSALVQLIPCRAAVAPFSPIPPTESCCSAVVTLGRPCLCLLANGPPLSGIDRSMA  115

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C ANF PC++
Sbjct  116  LQLPQRCFANFPPCDV  131



>emb|CDX90617.1| BnaA03g41640D [Brassica napus]
Length=123

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPTE+CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  46   CSRTFFSALVQLIPCRAAVAPFSPIPPTESCCSAVVTLGRPCLCLLANGPPLSGIDRSMA  105

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C ANF PC++
Sbjct  106  LQLPQRCFANFPPCDV  121



>emb|CDY29065.1| BnaC07g32710D [Brassica napus]
Length=123

 Score =   104 bits (260),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPTE+CC+AV +LG+PCLC + NGPP+ G+DR+MA
Sbjct  46   CSRTFFSALVQLIPCRAAVAPFSPIPPTESCCSAVVTLGRPCLCLLANGPPLSGIDRSMA  105

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C ANF PC++
Sbjct  106  LQLPQRCFANFPPCDV  121



>emb|CDX73657.1| BnaC08g23460D [Brassica napus]
Length=149

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPT++CC+AV +LG+PCLC + NGPP+  +DR+MA
Sbjct  72   CSRTFFSALVQLIPCRAAVAPFSPIPPTQSCCSAVVTLGRPCLCLLANGPPLSSIDRSMA  131

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C+ANF PC++
Sbjct  132  LQLPQRCSANFPPCDI  147



>gb|KFK34446.1| hypothetical protein AALP_AA5G146200 [Arabis alpina]
Length=118

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = -2

Query  809  CGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMA  630
            C  TF S ++QL+PCR AV+ F P PPTE CC+AV +LG+PCLC + NGPP+  +DR+MA
Sbjct  41   CSRTFFSALVQLIPCRAAVAPFSPIPPTETCCSAVVTLGRPCLCLLANGPPLSSIDRSMA  100

Query  629  LQLPDKCTANFEPCEL  582
            LQLP +C+ANF PC++
Sbjct  101  LQLPQRCSANFPPCDV  116



>emb|CDX74045.1| BnaA03g30020D [Brassica napus]
Length=103

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+ A PCG TF+S +I+L+PC  +V  F    P E CC A+++LGQPCLC + NGP I G
Sbjct  23   EATAHPCGRTFLSALIELVPCTLSVVPFSTLSPNEPCCTAIKTLGQPCLCVIANGPSIPG  82

Query  647  VDRNMALQLPDKCTANFEPCE  585
            VD  +ALQLP KC+ANF PC 
Sbjct  83   VDHTLALQLPGKCSANFSPCN  103



>ref|XP_004135913.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
 ref|XP_004167985.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cucumis 
sativus]
 gb|KGN45155.1| hypothetical protein Csa_7G428920 [Cucumis sativus]
Length=104

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            ++KA  C ++ + +++QL+PCRP++S F P PP+  CC A+++LGQ C+CA+++ PP+ G
Sbjct  24   QAKAKFCSNSLIYSLVQLIPCRPSLSPFHPIPPSLVCCDAIKTLGQSCICALLDAPPVSG  83

Query  647  VDRNMALQLPDKCTANFEPC  588
            VD N+A+ LP KC ANFEPC
Sbjct  84   VDYNLAMSLPQKCAANFEPC  103



>ref|XP_009134967.1| PREDICTED: protein LIM1-like [Brassica rapa]
Length=103

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+ A PCG TF+S +I+L+PC  +V  F    P E CC A+++LGQPCLC + NGP I G
Sbjct  23   EATAHPCGRTFLSALIELVPCTLSVVPFSTLSPNEPCCTAIKTLGQPCLCVIANGPSIPG  82

Query  647  VDRNMALQLPDKCTANFEPCE  585
            VD  +ALQLP KC+ANF PC 
Sbjct  83   VDHTLALQLPGKCSANFPPCN  103



>ref|XP_008461263.1| PREDICTED: protein LIM1-like [Cucumis melo]
Length=104

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            + KA  C ++ + +++QLLPCRP++S F P PP+  CC A+ +LGQ C+CA+++ PP+ G
Sbjct  24   QGKAKFCSNSLIYSLVQLLPCRPSLSPFHPIPPSPLCCNAIETLGQSCICALLDAPPVSG  83

Query  647  VDRNMALQLPDKCTANFEPC  588
            VD N+A+ LP KC +NFEPC
Sbjct  84   VDYNLAMSLPQKCASNFEPC  103



>emb|CDY07995.1| BnaC03g35280D [Brassica napus]
 emb|CDY07996.1| BnaC03g35270D [Brassica napus]
Length=103

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            ++ A PCG TF+S +I+L+PC  +V  F    P E CC A+++LGQPCLC + NGP I G
Sbjct  23   KATAHPCGRTFLSALIELVPCTLSVVPFSTLSPNEPCCTAIKTLGQPCLCVIANGPSIPG  82

Query  647  VDRNMALQLPDKCTANFEPCE  585
            VD  +ALQLP KC+ANF PC 
Sbjct  83   VDHTLALQLPGKCSANFPPCN  103



>ref|XP_010486304.1| PREDICTED: uncharacterized protein LOC104764467 [Camelina sativa]
Length=118

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -2

Query  827  ESKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIG  648
            E+   PCG T +S +IQL+PCRP+++ F    P E CCAA+++LGQPCL  +  GPPI+G
Sbjct  26   ETLGHPCGRTILSALIQLVPCRPSLAPFSTLRPNELCCAAIKTLGQPCLRVLAKGPPIVG  85

Query  647  VDRNMALQLPDKCTANF  597
            V+R +AL LP KC+ANF
Sbjct  86   VNRTLALHLPGKCSANF  102



>ref|XP_010548801.1| PREDICTED: non-specific lipid-transfer protein 1 [Tarenaya hassleriana]
Length=117

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 2/78 (3%)
 Frame = -2

Query  824  SKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGV  645
            ++A PCG TF S ++QL+PC+P+V+ F   PP   CC A+++LGQ CLC + NG PI GV
Sbjct  30   TRAHPCGRTFFSALVQLVPCKPSVAPFSTVPP--KCCTAIKTLGQHCLCLLANGLPISGV  87

Query  644  DRNMALQLPDKCTANFEP  591
            DR +ALQLP KC+ANF P
Sbjct  88   DRTLALQLPGKCSANFPP  105



>ref|XP_010238648.1| PREDICTED: uncharacterized protein LOC104584760 [Brachypodium 
distachyon]
Length=130

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = -2

Query  821  KAAPCGST---FVSTIIQLL-PCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPI  654
            +   CGS+   ++  ++QL+ PC+ AV+ F P PP+E CC+AVR LGQPCLC ++ GP I
Sbjct  37   RGEACGSSSYNYLGALLQLMIPCKAAVAPFSPSPPSEDCCSAVRELGQPCLCLLLAGPLI  96

Query  653  IGVDRNMALQLPDKCTANFE  594
             G DR M  +LP  C A  +
Sbjct  97   SGADRQMLSRLPSTCAATGD  116



>ref|XP_008386755.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008387154.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
 ref|XP_008343359.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            ++  L+ CRPAV++  P PPT+ACCAA+      CLC+  N    P +G+D N+ALQLP 
Sbjct  39   SVTDLMKCRPAVTSPNPAPPTKACCAALSHANLSCLCSYKNSSVLPSLGIDPNLALQLPA  98

Query  614  KC  609
            KC
Sbjct  99   KC  100



>ref|XP_008386579.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            ++  L+ CRPAV++  P PPT+ACCAA+      CLC+  N    P +G+D N+ALQLP 
Sbjct  39   SVTGLMTCRPAVTSPNPAPPTKACCAALSHANLSCLCSYKNSSVLPSLGIDPNLALQLPA  98

Query  614  KC  609
            KC
Sbjct  99   KC  100



>ref|XP_009339897.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=112

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            ++  L+ CRPAV++  P PPT+ACCAA+      CLC+  N    P +G+D N+ALQLP 
Sbjct  43   SVSDLMTCRPAVTSPNPAPPTKACCAALSHANLSCLCSYKNSSVLPSLGIDPNLALQLPA  102

Query  614  KC  609
            KC
Sbjct  103  KC  104



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQII--DNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y + I+  +  VDPN KCS  D  TWLS  +TNLE CRA FV+L V+  + P + SNN
Sbjct  97   KLYEYTILRLNKTVDPNTKCSQVDSQTWLSTALTNLETCRAGFVELGVSDYLLP-LMSNN  155

Query  63   VLYLINN  43
            V  LI+N
Sbjct  156  VSKLISN  162



>ref|XP_009339893.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=108

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            ++  L+ CRPAV++  P PPT+ACC+A+      CLC+  N    P +G+D N+ALQLP 
Sbjct  39   SVTGLMTCRPAVTSPNPAPPTKACCSALSHANVSCLCSYKNSSVLPSLGIDPNLALQLPA  98

Query  614  KC  609
            KC
Sbjct  99   KC  100



>ref|XP_010325628.1| PREDICTED: pectinesterase 2 [Solanum lycopersicum]
Length=524

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I + VDPN KCS  D  TWLS  +TNLE C+A F +L VT  + P +++NNV  LI+N
Sbjct  112  IKSTVDPNTKCSATDAQTWLSTALTNLETCKAGFEELGVTDYVMPLMSNNNVSSLISN  169



>ref|XP_002283832.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=99

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = -2

Query  806  GSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNM  633
            GS    T   L  C+P+VS   P PP+ ACCAA+     PCLC+  N    P +G+D NM
Sbjct  24   GSICRMTQDGLTACKPSVSGQSPLPPSPACCAAISKADLPCLCSFKNSALLPYLGIDPNM  83

Query  632  ALQLPDKCT  606
            A QLP KC 
Sbjct  84   ATQLPAKCN  92



>gb|AEB33950.1| defective in induced resistance 2 protein [Nicotiana tabacum]
Length=106

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = -2

Query  824  SKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPI--I  651
            S  +PCG +    I  L+ C+PAVS  +P PP+E CCAA+     PCLC   N P I   
Sbjct  28   SGDSPCGLS----IGDLMSCKPAVSGPKPLPPSEKCCAALGKADLPCLCTFKNSPMISAF  83

Query  650  GVDRNMALQLPDKCTANFEPC  588
             ++  +A+ LP KC  N   C
Sbjct  84   KINATLAMDLPSKCNLNSPNC  104



>ref|XP_009797273.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana sylvestris]
Length=106

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = -2

Query  824  SKAAPCGSTFVSTIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPI--I  651
            S  +PCG +    I  L+ C+PAVS  +P PP+E CCAA+     PCLC   N P I   
Sbjct  28   SGDSPCGLS----IGDLMSCKPAVSGPKPLPPSEKCCAALGKADLPCLCTFKNSPMISAF  83

Query  650  GVDRNMALQLPDKCTANFEPC  588
             ++  +A+ LP KC  N   C
Sbjct  84   KINATLAMDLPSKCNLNSPNC  104



>ref|XP_010506460.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Camelina sativa]
Length=510

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            Y    I+  +DPNVKCS  D  TWLS  +TNL+ CRA FVDL VT  + P + SNNV  L
Sbjct  105  YTISNINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFVDLGVTDIVLP-LMSNNVSNL  163

Query  51   INN  43
            + N
Sbjct  164  LCN  166



>ref|XP_010518135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X1 [Camelina sativa]
 ref|XP_010518136.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X2 [Camelina sativa]
Length=510

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            Y    I+  +DPNVKCS  D  TWLS  +TNL+ CRA FVDL VT  + P + SNNV  L
Sbjct  105  YTISNINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFVDLGVTDIVLP-LMSNNVSNL  163

Query  51   INN  43
            + N
Sbjct  164  LCN  166



>ref|XP_010508199.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Camelina sativa]
Length=510

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            Y    I+  +DPNVKCS  D  TWLS  +TNL+ CRA FVDL VT  + P + SNNV  L
Sbjct  105  YTISNINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFVDLGVTDIVLP-LMSNNVSNL  163

Query  51   INN  43
            + N
Sbjct  164  LCN  166



>ref|XP_007223557.1| hypothetical protein PRUPE_ppa013722mg [Prunus persica]
 gb|EMJ24756.1| hypothetical protein PRUPE_ppa013722mg [Prunus persica]
Length=107

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            ++  L+ CRPAV+A  P PPT ACC+A+      CLC+  N    P +G+D N+ALQLP 
Sbjct  38   SLNGLMTCRPAVTAPNPAPPTTACCSALSHADMGCLCSYKNSNLLPSLGIDPNLALQLPA  97

Query  614  KC  609
            KC
Sbjct  98   KC  99



>ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
 gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
Length=511

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGN-IFPTVTSNNVLY  55
            +  Q ++  V+P+ KC+  D+ TWLS  +TNLE CR  F DL V+ N IFP+V SNNV  
Sbjct  103  FTIQKLNRTVNPSTKCTQYDKQTWLSTALTNLETCREGFADLGVSNNYIFPSV-SNNVSN  161

Query  54   LINN  43
            LI+N
Sbjct  162  LISN  165



>ref|XP_008222678.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=107

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = -2

Query  776  LLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDKC  609
            L+ CRPAV+A  P PPT ACC+A+      CLC+  N    P +G+D N+ALQLP KC
Sbjct  42   LMTCRPAVTAPNPAPPTTACCSALSHADMGCLCSYKNSNLLPSLGIDPNLALQLPAKC  99



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            +    I + VDPN KC+ AD  +WLS  +TNLE CRA F +L VT  + P + SNNV  L
Sbjct  111  HTIHKIKSTVDPNTKCTAADAQSWLSTALTNLETCRAGFEELGVTDYVMP-LMSNNVSSL  169

Query  51   INN  43
            I+N
Sbjct  170  ISN  172



>gb|EYU31969.1| hypothetical protein MIMGU_mgv1a005025mg [Erythranthe guttata]
Length=500

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = -1

Query  222  QIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
              ++  VDP  KC+ AD  TWLS  +TNLE C++ FVD  +T  IFP + SNNV  L++N
Sbjct  112  HAVNKTVDPTTKCTPADAQTWLSAALTNLETCKSGFVDFGLTDYIFP-LMSNNVSLLLSN  170



>ref|XP_009364632.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Pyrus 
x bretschneideri]
 ref|XP_009364650.1| PREDICTED: putative lipid-transfer protein DIR1, partial [Pyrus 
x bretschneideri]
Length=108

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = -2

Query  806  GSTFVST----IIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDR  639
            GST VS       QL  CRPAV+   P PPT+ CC+ VR    PCLC   +  P IG+D 
Sbjct  28   GSTAVSICNIESDQLKECRPAVTGKSPKPPTKRCCSVVRQANLPCLCNFKSVLPSIGIDP  87

Query  638  NMALQLPDKC  609
             +A+ LP KC
Sbjct  88   ALAMALPKKC  97



>ref|XP_009339389.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=102

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = -2

Query  806  GSTFVST----IIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDR  639
            GST VS       QL  CRPAV+   P PPT+ CC+ VR    PCLC   +  P IG+D 
Sbjct  22   GSTAVSICNIESDQLKECRPAVTGKSPKPPTKRCCSVVRQANLPCLCNFKSVLPSIGIDP  81

Query  638  NMALQLPDKC  609
             +A+ LP KC
Sbjct  82   ALAMALPKKC  91



>ref|XP_004307817.1| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=459

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -1

Query  219  IIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++  VDPN KC+  D  TWLS  +TNLE CRA FV+L V+  + P + SNNV  LI+N
Sbjct  52   LLNRTVDPNTKCTEFDSQTWLSTALTNLETCRAGFVELGVSDFVLP-LMSNNVSKLISN  109



>gb|ADG38285.1| AT2G45220-like protein [Neslia paniculata]
Length=166

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQI--IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y F I  I+  +DPNVKCS  D  TWLS  +TNL+ CRA F++  VT  + P + SNN
Sbjct  45   KLYDFTISKINKTMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLEFGVTDLVLP-LMSNN  103

Query  63   VLYLINN  43
            V  L+ N
Sbjct  104  VSNLLCN  110



>gb|ADG38279.1| AT2G45220-like protein [Capsella grandiflora]
 gb|ADG38280.1| AT2G45220-like protein [Capsella grandiflora]
 gb|ADG38281.1| AT2G45220-like protein [Capsella grandiflora]
 gb|ADG38282.1| AT2G45220-like protein [Capsella grandiflora]
 gb|ADG38283.1| AT2G45220-like protein [Capsella grandiflora]
 gb|ADG38284.1| AT2G45220-like protein [Capsella grandiflora]
Length=166

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQI--IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y F +  I+  +DPNVKCS  D  TWLS  +TNL+ CR  F++L VT  + P + SNN
Sbjct  45   KLYDFTVSNINGTMDPNVKCSKTDAQTWLSTALTNLDTCRNGFLELGVTDMVLP-LMSNN  103

Query  63   VLYLINN  43
            V  LI N
Sbjct  104  VSNLICN  110



>ref|XP_009335428.1| PREDICTED: putative lipid-transfer protein DIR1 [Pyrus x bretschneideri]
Length=118

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = -2

Query  806  GSTFVST----IIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDR  639
            GST VS       QL  CRPAV+   P PPT+ CC+ VR    PCLC   +  P IG+D 
Sbjct  38   GSTAVSICNIESDQLKECRPAVTGKSPKPPTKRCCSVVRQANLPCLCNFKSVLPSIGIDP  97

Query  638  NMALQLPDKC  609
             +A+ LP KC
Sbjct  98   ALAMALPKKC  107



>gb|AEN81616.1| AT2G45220-like protein, partial [Capsella rubella]
 gb|AEN81617.1| AT2G45220-like protein, partial [Capsella rubella]
 gb|AEN81618.1| AT2G45220-like protein, partial [Capsella rubella]
 gb|AEN81621.1| AT2G45220-like protein, partial [Capsella rubella]
 gb|AEN81623.1| AT2G45220-like protein, partial [Capsella rubella]
Length=170

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQI--IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y F +  I+  +DPNVKCS  D  TWLS  +TNL+ CR  F++L VT  + P + SNN
Sbjct  48   KLYDFTVSNINGTMDPNVKCSKTDAQTWLSTALTNLDTCRNGFLELGVTDMVLP-LMSNN  106

Query  63   VLYLINN  43
            V  LI N
Sbjct  107  VSNLICN  113



>gb|AEN81619.1| AT2G45220-like protein, partial [Capsella rubella]
 gb|AEN81620.1| AT2G45220-like protein, partial [Capsella rubella]
 gb|AEN81622.1| AT2G45220-like protein, partial [Capsella rubella]
Length=170

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQI--IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y F +  I+  +DPNVKCS  D  TWLS  +TNL+ CR  F++L VT  + P + SNN
Sbjct  48   KLYDFTVSNINGTMDPNVKCSKTDAQTWLSTALTNLDTCRNGFLELGVTDMVLP-LMSNN  106

Query  63   VLYLINN  43
            V  LI N
Sbjct  107  VSNLICN  113



>emb|CDX83392.1| BnaA03g21140D [Brassica napus]
Length=445

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQI--IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y F +  I+  +DPNVKCS  D  TWLS  +TNL+ CRA F++L VT  + P + SNN
Sbjct  36   KLYDFTVSKINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVLP-LMSNN  94

Query  63   VLYLINN  43
            V  LI N
Sbjct  95   VSNLICN  101



>emb|CDX95641.1| BnaC03g25220D [Brassica napus]
Length=445

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQI--IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y F +  I+  +DPNVKCS  D  TWLS  +TNL+ CRA F++L VT  + P + SNN
Sbjct  36   KLYDFTVSKINETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVLP-LMSNN  94

Query  63   VLYLINN  43
            V  LI N
Sbjct  95   VSNLICN  101



>ref|XP_009601194.1| PREDICTED: putative lipid-transfer protein DIR1 [Nicotiana tomentosiformis]
Length=104

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPI--IGVDRNMALQLPD  615
            +I  L+ C+PAVS  +P PP+E CC A+     PCLC   N P I    ++  +A+ LP 
Sbjct  34   SIADLMSCKPAVSGPKPMPPSEKCCTALGKADLPCLCTFKNSPIISTFKINATLAMDLPS  93

Query  614  KCTANFEPC  588
            KC  N   C
Sbjct  94   KCNLNSPNC  102



>ref|XP_006347887.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=516

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I + VDPN KCS  D  TWLS  +TNLE C+A F +L VT  + P + SNNV  LI+N
Sbjct  112  IKSTVDPNTKCSATDAQTWLSTALTNLETCKAGFEELGVTDYVMP-LMSNNVSSLISN  168



>ref|XP_011090444.1| PREDICTED: pectinesterase 2 [Sesamum indicum]
Length=531

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            +    I+  VDPN KC+ AD  TWLS  +TNLE C++ FVD  +T +    + SNNV  L
Sbjct  119  HTIHKINTTVDPNTKCTPADAQTWLSTALTNLETCKSGFVDFGITDDYMFPMMSNNVSLL  178

Query  51   INN  43
            ++N
Sbjct  179  LSN  181



>ref|XP_008385814.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=114

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKC  609
            QL  CRPAV+   P PPT+ CC  VR    PCLC   +  P IG+D  +A+ LP KC
Sbjct  47   QLKECRPAVTGKSPKPPTKRCCXVVRQANLPCLCNFKSVLPSIGIDPALAMALPKKC  103



>emb|CDX74715.1| BnaA05g04610D [Brassica napus]
Length=445

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I+  +DPNVKCS  D  TWLS  +TNL+ CRA F++L VT  + P + SNNV  LI N
Sbjct  45   INETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSSLICN  101



>ref|XP_009374493.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -1

Query  222  QIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++++  +DP  KC+  D  TWLS  +TNL+ CRA FV+L V+  +FP + SNNV  LI+N
Sbjct  110  KLLNQTIDPATKCTDYDTQTWLSTALTNLDTCRAGFVELAVSDFVFP-LMSNNVSKLISN  168



>ref|XP_009340592.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -1

Query  222  QIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++++  +DP  KC+  D  TWLS  +TNL+ CRA FV+L V+  +FP + SNNV  LI+N
Sbjct  110  KLLNQTIDPATKCTDYDTQTWLSTALTNLDTCRAGFVELAVSDFVFP-LMSNNVSKLISN  168



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  222  QIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++++ VDP +KC+  D  TWLS  +TNL+ CRA FV+L V+  + P + SNNV  LI+N
Sbjct  111  KLLNHTVDPAIKCTDYDSQTWLSTALTNLDTCRAGFVELGVSDFVLP-LMSNNVSKLISN  169



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  222  QIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++++ VDP +KC+  D  TWLS  +TNL+ CRA FV+L V+  + P + SNNV  LI+N
Sbjct  111  KLLNHTVDPAIKCTDYDSQTWLSTALTNLDTCRAGFVELGVSDFVLP-LMSNNVSKLISN  169



>ref|XP_009143104.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I+  +DPNVKCS  D  TWLS  +TNL+ CRA F++L VT  + P + SNNV  LI N
Sbjct  110  INETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSSLICN  166



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++ +DPN KC+  D  TWLS  +TNLE CRA FV+L V+  + P + SNNV  LI N
Sbjct  47   LNHTLDPNTKCTDYDAQTWLSTALTNLETCRAGFVELGVSDFMLP-LMSNNVSKLIGN  103



>emb|CAN78759.1| hypothetical protein VITISV_000562 [Vitis vinifera]
Length=513

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +DPN +C+ AD  TWLS  +TNL+ C+  F++L V+G+  P + SNNV  LI+N
Sbjct  106  LNKTLDPNTRCTQADAQTWLSTALTNLQTCQDGFIELGVSGHFLP-LMSNNVSKLISN  162



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I + V PN KC+ AD  +WLS  +TNLE CRA F +L VT  + P + SNNV  LI+N
Sbjct  140  IKSTVGPNTKCTAADAQSWLSTALTNLETCRAGFEELGVTDYVMP-LMSNNVSSLISN  196



>ref|XP_008387060.1| PREDICTED: putative lipid-transfer protein DIR1 [Malus domestica]
Length=108

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            ++  L+ CR AV++    PPT+ACCAA+      CLC+  N    P +G+D N+ALQLP 
Sbjct  39   SVTDLMTCRAAVTSPNLAPPTKACCAALSHANLSCLCSYKNSSVLPSLGIDPNLALQLPA  98

Query  614  KC  609
            KC
Sbjct  99   KC  100



>ref|XP_006397702.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
 gb|ESQ39155.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
Length=511

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I+  +DPNVKCS  D  TWLS  +TNL+ CRA F++L VT  + P + SNNV  LI N
Sbjct  111  INETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVLPLI-SNNVSNLICN  167



>emb|CDY18944.1| BnaC04g04060D [Brassica napus]
Length=442

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I+  +DPNVKCS  D  TWLS  +TNL+ CRA F++L VT  + P + SNNV  LI N
Sbjct  100  INQTMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSNLICN  156



>ref|XP_010524372.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            Y    ++  +DP+VKCS  D  TWLS  +TNLE CR  F++L V   + P + SNNV  L
Sbjct  104  YTVSKLNETIDPHVKCSKVDAQTWLSSALTNLETCRTGFIELGVPDFLLP-LMSNNVSKL  162

Query  51   INN  43
            I+N
Sbjct  163  ISN  165



>gb|KHN27145.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=94

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDKCT  606
             L+ C+PAV+   P PP++ CC+ +     PCLC+  N P  P +G+D  +ALQLP KC 
Sbjct  28   DLMTCKPAVTPPNPTPPSQQCCSVLSHADLPCLCSYKNSPLLPSLGIDPKLALQLPAKCN  87

Query  605  ANFEP  591
                P
Sbjct  88   LPHPP  92



>ref|XP_006293950.1| hypothetical protein CARUB_v10022941mg, partial [Capsella rubella]
 gb|EOA26848.1| hypothetical protein CARUB_v10022941mg, partial [Capsella rubella]
Length=546

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQI--IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y F +  I+  +DPNVKCS  D  TWLS  +TNL+ CR  F++L VT  + P + SNN
Sbjct  137  KLYDFTVSNINGTMDPNVKCSKTDAQTWLSTALTNLDTCRNGFLELGVTDMVLP-LMSNN  195

Query  63   VLYLINN  43
            V  LI N
Sbjct  196  VSNLICN  202



>ref|XP_006606947.1| PREDICTED: putative lipid-transfer protein DIR1-like [Glycine 
max]
Length=101

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDKCT  606
             L+ C+PAV+   P PP++ CC+ +     PCLC+  N P  P +G+D  +ALQLP KC 
Sbjct  35   DLMTCKPAVTPPNPTPPSQQCCSVLSHADLPCLCSYKNSPLLPSLGIDPKLALQLPAKCN  94

Query  605  ANFEP  591
                P
Sbjct  95   LPHPP  99



>ref|XP_009133718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQI--IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y F +  I+  ++PNVKCS  D  TWLS  +TNL+ CRA F++L VT  + P + SNN
Sbjct  101  KLYDFTVSKINETMNPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDIVLP-LMSNN  159

Query  63   VLYLINN  43
            V  LI N
Sbjct  160  VSNLICN  166



>ref|XP_008792988.1| PREDICTED: putative lipid-transfer protein DIR1 [Phoenix dactylifera]
Length=107

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPF-PPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDKC  609
            +L+ C+P++S  +P   P +ACC A+     PCLCA  N    P +G+D N+A+QLP KC
Sbjct  40   ELMACKPSISTAKPVEKPADACCTALSHADLPCLCAYKNSGMLPYLGIDPNLAMQLPAKC  99

Query  608  T  606
            +
Sbjct  100  S  100



>ref|XP_008377824.1| PREDICTED: pectinesterase 2-like [Malus domestica]
Length=518

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -1

Query  222  QIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++++  +DP  K +  D  TWLS  +TNL+ CRA FV+LEV+  +FP + SNNV  LI+N
Sbjct  110  KLLNQTIDPATKSTDYDTQTWLSTALTNLDTCRAGFVELEVSDFVFP-LMSNNVSKLISN  168



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGN-IFPTVTSNNVLY  55
            +  Q ++  V+P  KC+  D  TWLS  +TNLE CR  F DL V+ N IFP++ SNNV  
Sbjct  103  FTIQKLNKTVNPITKCTQDDSQTWLSTALTNLETCREGFADLGVSNNYIFPSM-SNNVSN  161

Query  54   LINN  43
            LI+N
Sbjct  162  LISN  165



>ref|XP_010544633.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            Y    ++  VDP VKCS  D  TWLS  +TNLE CR  F++L V   + P + SNNV  L
Sbjct  104  YTVSKLNETVDPYVKCSKVDAQTWLSSALTNLETCRTGFIELGVPDFLLP-LMSNNVSKL  162

Query  51   INN  43
            I+N
Sbjct  163  ISN  165



>ref|XP_004230985.1| PREDICTED: putative lipid-transfer protein DIR1 [Solanum lycopersicum]
Length=104

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 2/70 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPI--IGVDRNMALQLPD  615
            TI  L+ C+ AVS  +P PP++ CCAA+     PCLC   N P +    ++  +A+ LP 
Sbjct  34   TIYDLMTCKSAVSGPKPLPPSDKCCAALTKADFPCLCTFKNSPMLSDFKINSTLAMDLPS  93

Query  614  KCTANFEPCE  585
            KC  +   C 
Sbjct  94   KCKLDSPNCS  103



>ref|XP_002882002.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58261.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I+  +DPNVKCS  D  TWLS  +TNL+ CRA F++L VT  + P + SNNV  L+ N
Sbjct  111  INETMDPNVKCSKTDAQTWLSTALTNLDTCRAGFLELGVTDVVLP-LMSNNVSNLLCN  167



>ref|XP_003634048.1| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=520

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -1

Query  222  QIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            Q ++  +DP  KC+  D+ TWLS  +TNL+ CRA FV+L V+  + P + SNNV  LI+N
Sbjct  110  QQLNQTLDPATKCTDFDQQTWLSTALTNLDTCRAGFVELGVSDFVLP-LMSNNVSKLISN  168



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  VDP + C+  D  TWLS  +TN+E CR  F++L VT  +FP +++NNV  LI N
Sbjct  116  LNKTVDPTINCTDFDSQTWLSTALTNIETCRTGFLELNVTDFVFPLISNNNVSKLICN  173



>ref|NP_566038.1| putative pectinesterase/pectinesterase inhibitor 17 [Arabidopsis 
thaliana]
 sp|O22149.2|PME17_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
17; Includes: RecName: Full=Pectinesterase inhibitor 17; AltName: 
Full=Pectin methylesterase inhibitor 17; Includes: RecName: 
Full=Pectinesterase 17; Short=PE 17; AltName: Full=Pectin 
methylesterase 17; Short=AtPME17; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK32841.1|AF361829_1 At2g45220/F4L23.27 [Arabidopsis thaliana]
 gb|AAB82640.2| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC10527.1| putative pectinesterase/pectinesterase inhibitor 17 [Arabidopsis 
thaliana]
Length=511

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I+  +DPNVKCS  D  TWLS  +TNL+ CRA F++L VT  + P + SNNV  L+ N
Sbjct  111  INETMDPNVKCSKLDAQTWLSTALTNLDTCRAGFLELGVTDIVLP-LMSNNVSNLLCN  167



>ref|XP_006365510.1| PREDICTED: putative lipid-transfer protein DIR1-like [Solanum 
tuberosum]
Length=104

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPI--IGVDRNMALQLPD  615
            TI  L+ C+ AVS  +P PP++ CCAA+     PCLC   N P +    ++  +A+ LP 
Sbjct  34   TINDLMTCKSAVSGPKPLPPSDKCCAALTKADLPCLCTFKNSPMLSSFKINSTLAMDLPS  93

Query  614  KC  609
            KC
Sbjct  94   KC  95



>emb|CDY27388.1| BnaC04g50170D [Brassica napus]
Length=510

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQI--IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y F +  I+  +DP+ KCS  D  TWLS  +TNL+ C+A F++L VT  I P + SNN
Sbjct  101  KLYDFTVSKINKTMDPDTKCSKTDSQTWLSTALTNLDTCKAGFLELGVTDFILP-LMSNN  159

Query  63   VLYLINN  43
            V  LI N
Sbjct  160  VSDLICN  166



>ref|XP_009142324.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -1

Query  237  KAYMFQI--IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNN  64
            K Y F +  I+  +DP+ KCS  D  TWLS  +TNL+ C+A F++L VT  I P + SNN
Sbjct  101  KLYDFTVSKINKTMDPDTKCSKTDSQTWLSTALTNLDTCKAGFLELGVTDFILP-LMSNN  159

Query  63   VLYLINN  43
            V  LI N
Sbjct  160  VSDLICN  166



>ref|XP_009599511.1| PREDICTED: pectinesterase 2-like [Nicotiana tomentosiformis]
Length=522

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSN-NVLYLINN  43
            I+  +DP++K +  D  TWLS  +TN+E CR+ F++L VT  + P + SN NV YLI+N
Sbjct  109  INKTIDPSIKSTADDVQTWLSTALTNIETCRSGFIELGVTDYVMPILMSNINVSYLISN  167



>emb|CDY23190.1| BnaA04g05690D [Brassica napus]
Length=80

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  634  MFRSTPMMGGPLTTAQRQGWPRDLTAAQQASVGGNGLKAETAGLQGKS  777
            M RS P  GGPL + QRQG P    AAQQ SVGG GLK  TA L G S
Sbjct  1    MERSMPESGGPLASRQRQGRPSVTIAAQQDSVGGTGLKGATAALHGIS  48



>ref|XP_009627969.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Nicotiana tomentosiformis]
Length=521

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGN-IFPTVTSNNVLYLINN  43
            ++  +DPN KC+  D  TWLS  +TNLE CR  FV+L V  + I P++ SNNV  LI N
Sbjct  112  LNKTLDPNTKCTDFDTQTWLSTALTNLETCRTGFVELGVNSDYILPSIMSNNVSELICN  170



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -1

Query  219  IIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++  +DP+ KC+  D  TWLS  +TNL+ CRA FV+L V+  ++P + SNNV  LI+N
Sbjct  113  LLNKTLDPSTKCTDFDAQTWLSTALTNLDTCRAGFVELGVSDFVWP-LMSNNVSKLISN  170



>gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++ +DP+ KC+  D  TWLS  +TNLE C+A FV+L VT  + P + SNNV  LI N
Sbjct  115  LNHTIDPSAKCTDYDVQTWLSTALTNLETCKAGFVELGVTDFMLP-LMSNNVSSLIRN  171



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -1

Query  219  IIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++  +DP  KC+  D  TWLS  +TNL+ CRA FV+L V+  + P + SNNV  LI+N
Sbjct  75   LLNQTIDPATKCTDYDAQTWLSTALTNLDTCRAGFVELGVSDFVLP-LMSNNVSKLISN  132



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -1

Query  219  IIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++  +DP  KC+  D  TWLS  +TNL+ CRA FV+L V+  + P + SNNV  LI+N
Sbjct  110  LLNQTIDPATKCTDYDAQTWLSTALTNLDTCRAGFVELGVSDFVLP-LMSNNVSKLISN  167



>gb|KDP42884.1| hypothetical protein JCGZ_23826 [Jatropha curcas]
Length=101

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            +I  L  CRPAV+   P PPT ACC+A+      CLC+  N    P +G+D  +AL+LP+
Sbjct  32   SISGLTSCRPAVTPPNPAPPTSACCSALSHADLRCLCSYKNSTLLPSLGIDPKLALKLPE  91

Query  614  KC  609
            KC
Sbjct  92   KC  93



>ref|XP_009773838.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=524

 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGN-IFPTVTSNNVLYLINN  43
            ++  +DPN KC+  D  TWLS  +TNLE CR  FV+L V  + I P++ SNNV  LI N
Sbjct  112  LNKTLDPNTKCTDFDTQTWLSTALTNLETCRTGFVELGVNSDYILPSLMSNNVSELICN  170



>gb|KFK37315.1| hypothetical protein AALP_AA4G241100 [Arabis alpina]
Length=509

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I+  +D NVKCS  D  TWLS  +TNL+ CRA F+DL VT  + P + SNNV  L+ N
Sbjct  109  INATMDTNVKCSKTDAQTWLSTALTNLDTCRAGFLDLGVTDIVLP-LMSNNVSKLLCN  165



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +DP++KC+  D  TWLS  +TNL+ CRA F++L V+  + P + SNNV  LI+N
Sbjct  118  LNRTLDPSIKCTDFDAQTWLSTALTNLQTCRAGFIELGVSDFMLP-LMSNNVSKLISN  174



>ref|XP_008227058.1| PREDICTED: putative lipid-transfer protein DIR1 [Prunus mume]
Length=104

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKCTAN  600
            +L  CRPAV+   P PPT+ CC  V     PCLC   +  P  G++  +A+ LP KC  N
Sbjct  37   KLNECRPAVTGNSPKPPTKKCCDVVHQANLPCLCNYKSAFPAFGINPALAMALPKKCGMN  96



>ref|XP_007212412.1| hypothetical protein PRUPE_ppa016471mg, partial [Prunus persica]
 gb|EMJ13611.1| hypothetical protein PRUPE_ppa016471mg, partial [Prunus persica]
Length=89

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKCTAN  600
            +L  CRPAV+   P PPT+ CC  V     PCLC   +  P  G++  +A+ LP KC  N
Sbjct  24   KLNECRPAVTGNSPKPPTKKCCDVVHQANLPCLCNYKSAFPAFGINPALAMALPKKCGMN  83



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +DPN KC+  D  TWLS  +TNLE CR  FV+L V+  + P + SNNV  LI N
Sbjct  65   LNKTIDPNTKCTDFDAQTWLSTALTNLETCRTGFVELGVSDFVLP-LMSNNVSKLICN  121



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++ +D N KC+  D  TWLS  +TNLE CRA FV+L V   + P + SNNV  LI+N
Sbjct  112  LNHTLDSNTKCTDFDAQTWLSTALTNLETCRAGFVELGVPDYVLP-LMSNNVTKLISN  168



>gb|KEH29121.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=513

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  ++P  KCS  D  TWLS  +TNLE C+A F DL V   I P + SNNV  L++N
Sbjct  111  LNKTLNPKTKCSQVDAQTWLSTALTNLETCKAGFYDLGVQDYILP-LMSNNVTKLLSN  167



>ref|XP_007142607.1| hypothetical protein PHAVU_007G001800g [Phaseolus vulgaris]
 gb|ESW14601.1| hypothetical protein PHAVU_007G001800g [Phaseolus vulgaris]
Length=101

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            ++  L+ C+ AV+   P  P++ CC+ V  +   CLC   N P  P +G+D ++ALQLP 
Sbjct  32   SVTDLMTCKAAVTPPSPSEPSDECCSVVSKVDMDCLCNYKNSPLLPSLGIDPDLALQLPA  91

Query  614  KCTANFEP  591
            KC  +  P
Sbjct  92   KCKLDKTP  99



>ref|XP_002529687.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF32698.1| lipid binding protein, putative [Ricinus communis]
Length=93

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = -2

Query  785  IIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDK  612
            I  L+ C+PAV+   P  PT ACC+A+      CLC+  N    P +G+D N+ALQLP K
Sbjct  26   ISGLMACKPAVTPPNPSAPTSACCSALTHADMRCLCSYKNSNLLPSLGIDPNLALQLPPK  85

Query  611  CT  606
            C 
Sbjct  86   CN  87



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++ +D N KC+  D  TWLS  +TNLE CRA FV+L V   + P + SNNV  LI+N
Sbjct  112  LNHTLDSNTKCTDFDAQTWLSTALTNLETCRAGFVELGVPDYVLP-LMSNNVTKLISN  168



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++ +D N KC+  D  TWLS  +TNLE CRA FV+L V   + P + SNNV  LI+N
Sbjct  112  LNHTLDSNTKCTDFDAQTWLSTALTNLETCRAGFVELGVPDYVLP-LMSNNVTKLISN  168



>emb|CDO97873.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDKC  609
            +L+ C+PAV+   P  P+ ACCAA++     CLC+  +    P +G+D N+A QLP+KC
Sbjct  38   ELMSCKPAVTPPEPSDPSSACCAALKHADVACLCSFKSSSWLPSLGIDPNLATQLPEKC  96



>gb|KHN47892.1| Pectinesterase 2 [Glycine soja]
Length=507

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            Y  Q ++  ++PN KC+  D  TWLS  +TNLE C+  F +L V   + P + SNNV  L
Sbjct  98   YTIQRLNKTINPNTKCNETDTQTWLSTALTNLETCKNGFYELGVPDYVLP-LMSNNVTKL  156

Query  51   INN*GCANFGEISVNRP  1
            ++N    N G      P
Sbjct  157  LSNTLSLNKGPYQYKPP  173



>ref|XP_003517028.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            Y  Q ++  ++PN KC+  D  TWLS  +TNLE C+  F +L V   + P + SNNV  L
Sbjct  106  YTIQRLNKTINPNTKCNETDTQTWLSTALTNLETCKNGFYELGVPDYVLP-LMSNNVTKL  164

Query  51   INN*GCANFGEISVNRP  1
            ++N    N G      P
Sbjct  165  LSNTLSLNKGPYQYKPP  181



>ref|XP_007134831.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
 gb|ESW06825.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
Length=520

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 1/63 (2%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            Y  Q ++  +DP  KC+  D  TWLS  +TNLE CRA   +L V   + P + SNNV  L
Sbjct  110  YTIQRLNKTLDPYTKCTQTDTQTWLSTALTNLETCRAGLYELGVQDYMLP-LMSNNVTKL  168

Query  51   INN  43
            ++N
Sbjct  169  LSN  171



>ref|XP_009399057.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=103

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = -2

Query  767  CRPAVSAFRPFP-PTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDKCT  606
            CRP +S  +P   P++ACCAA++    PCLC+  N    P IG+D   A+QLP KC+
Sbjct  40   CRPCISTVKPAEQPSDACCAALKQADLPCLCSYKNSVLLPYIGIDPKRAMQLPAKCS  96



>ref|XP_006423199.1| hypothetical protein CICLE_v10029642mg [Citrus clementina]
 gb|ESR36439.1| hypothetical protein CICLE_v10029642mg [Citrus clementina]
Length=103

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 2/59 (3%)
 Frame = -2

Query  776  LLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDKCT  606
            L  C+PAV+A  P PP+ ACC+A+      C CA  N     + G+D N A+QLP KC 
Sbjct  38   LTACQPAVAASNPSPPSTACCSALSKADLQCFCAFKNSRVLSLYGIDFNQAMQLPAKCN  96



>ref|NP_001235199.1| uncharacterized protein LOC100527120 precursor [Glycine max]
 gb|ACU16166.1| unknown [Glycine max]
 gb|KHN05127.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=101

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKC  609
            QL  CR AV+   P PP E CCA +R    PCLC   +  P+IG+    AL LP KC
Sbjct  37   QLNLCRAAVTGQNPPPPDEKCCAVIRQANLPCLCRYKSILPLIGIKPEKALALPGKC  93



>ref|XP_004296699.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=104

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            ++  L+ C+PAV+   P  PT+ACC+A+      CLC+  N    P +G+D  +A+QLP 
Sbjct  35   SVNNLMSCKPAVTKPNPARPTQACCSALSHADLGCLCSYRNSNLLPSLGIDPKLAMQLPG  94

Query  614  KC  609
            KC
Sbjct  95   KC  96



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            +++ +D N KC+  D  TWLS  +TNLE C+A F DL V+  + P + SNNV  LI N
Sbjct  109  LNHTIDSNTKCTQFDAQTWLSTALTNLETCKAGFKDLGVSDFVLP-LMSNNVSKLIRN  165



>ref|XP_010258605.1| PREDICTED: putative lipid-transfer protein DIR1 [Nelumbo nucifera]
Length=103

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDKCT  606
             LL C+PAVS   P  P+ ACC A+ S    CLC+  N    P +G++ + A+QLP KC 
Sbjct  37   DLLACKPAVSKQNPADPSPACCKALSSADLSCLCSYKNSILLPSLGINPDFAMQLPTKCN  96

Query  605  AN  600
             N
Sbjct  97   LN  98



>ref|XP_002529688.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF32699.1| lipid binding protein, putative [Ricinus communis]
Length=106

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = -2

Query  785  IIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDK  612
            I  L+ C+PAV+   P  PT ACC+A+      CLC+  N    P +G+D N+ALQLP K
Sbjct  39   ISGLMACKPAVTPPNPSAPTSACCSALTHADMRCLCSYKNSNVLPSLGIDPNLALQLPPK  98

Query  611  C  609
            C
Sbjct  99   C  99



>ref|XP_004491449.1| PREDICTED: putative lipid-transfer protein DIR1-like [Cicer arietinum]
Length=104

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKCTAN  600
            QL  CR AV+   P PP E CCA +R    PCLC   +  P +G+    A++LP KC + 
Sbjct  37   QLKFCRAAVTGENPPPPDEKCCAVIRGANLPCLCTYKSILPSLGISVKDAMELPGKCGSK  96



>ref|XP_010259034.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=517

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -1

Query  204  VDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            V+P  KC+  D  TWLS  +TNLE CR  FV+L V+  I P + SNNV  LI+N
Sbjct  114  VNPGAKCTDVDLQTWLSTALTNLETCRTGFVELGVSDYILP-LMSNNVSKLISN  166



>emb|CDP08022.1| unnamed protein product [Coffea canephora]
Length=534

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            I+  VDP  KC+  D  TWLS  +TNLE C+  F++L V  ++ P + SNNV  LI+N
Sbjct  113  INKTVDPYTKCNAVDAQTWLSTALTNLETCKQGFIELGVADHLVP-LMSNNVSCLISN  169



>emb|CBI24285.3| unnamed protein product [Vitis vinifera]
Length=444

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +DPN +C+  D  TWLS  +TNL+ C+  F++L V+ +  P + SNNV  LI+N
Sbjct  37   LNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIELGVSDHFLPLI-SNNVSKLISN  93



>ref|XP_010056340.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=508

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -1

Query  195  NVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN*GCAN  28
            N +C+  D+ TWLS  +TNLE CRA FV+L V+ N+ P + SNNV  LI N   AN
Sbjct  108  NRQCTQDDKQTWLSTALTNLETCRAGFVELGVSDNVLP-LMSNNVSELIRNILSAN  162



>ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +DPN +C+  D  TWLS  +TNL+ C+  F++L V+ +  P + SNNV  LI+N
Sbjct  106  LNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIELGVSDHFLPLI-SNNVSKLISN  162



>emb|CAN61352.1| hypothetical protein VITISV_027758 [Vitis vinifera]
Length=107

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKCTAN  600
            +L  C PAVS   P PPT+ACC A+ S    CLC   +  P  G++  +A+ LP KC  +
Sbjct  37   KLAECLPAVSGRSPPPPTKACCTALLSADLHCLCNYKSALPAFGINPALAMALPKKCGGS  96

Query  599  FEP  591
              P
Sbjct  97   LPP  99



>emb|CAN72894.1| hypothetical protein VITISV_022314 [Vitis vinifera]
Length=133

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKCTAN  600
            QL  C PA+    P PPT+ CCA ++     CLC+  +  P  GV+  +A+ LP KC  N
Sbjct  37   QLAQCLPAIXGPSPSPPTKECCAVIQKADMHCLCSYKHALPNFGVNPGLAMALPKKCGLN  96



>emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera]
Length=512

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +DPN +C+  D  TWLS  +TNL+ C+  F++L V+  + P++ SNNV  LI+N
Sbjct  105  LNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIELGVSDYLLPSM-SNNVSKLISN  161



>ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=512

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +DPN +C+  D  TWLS  +TNL+ C+  F++L V+  + P++ SNNV  LI+N
Sbjct  105  LNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIELGVSDYLLPSM-SNNVSKLISN  161



>emb|CBI24286.3| unnamed protein product [Vitis vinifera]
Length=415

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +D N +C+ AD  TWLS  +TNL+ C+  F+DL V+  + P + SNNV  LI+N
Sbjct  105  LNKTLDSNTRCTQADAQTWLSTALTNLQTCQDGFIDLGVSDYVLP-LMSNNVSKLISN  161



>ref|XP_007140447.1| hypothetical protein PHAVU_008G112900g [Phaseolus vulgaris]
 gb|ESW12441.1| hypothetical protein PHAVU_008G112900g [Phaseolus vulgaris]
Length=101

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -2

Query  767  CRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKC  609
            CR AV+   P PP E CC  +R    PCLC+  +  P+ G++   AL LP KC
Sbjct  41   CRAAVTGKNPPPPDEQCCGVIRQANLPCLCSYKSMLPLFGINAKKALALPGKC  93



>ref|XP_002275805.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=107

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKCTAN  600
            +L  C PAVS   P PPT+ACC A+ S    CLC   +  P  G++  +A+ LP KC  +
Sbjct  37   KLAECLPAVSGRSPPPPTKACCTALLSADLHCLCNYKSALPAFGINPALAMALPKKCGGS  96

Query  599  FEP  591
              P
Sbjct  97   LPP  99



>emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera]
Length=497

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +D N +C+ AD  TWLS  +TNL+ C+  F+DL V+  + P + SNNV  LI+N
Sbjct  90   LNKTLDSNTRCTQADAQTWLSTALTNLQTCQDGFIDLGVSDYVLP-LMSNNVSKLISN  146



>ref|XP_008809954.1| PREDICTED: putative lipid-transfer protein DIR1 [Phoenix dactylifera]
Length=104

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNG--PPIIGVDRNMALQLPDKCT  606
             LL CRPA S   P  P+  CC+A+     PC C+  +     I+G+D N  LQLP KC 
Sbjct  38   DLLECRPAASLSNPTEPSAKCCSAIAKADLPCFCSYKHSFFLFILGIDVNRVLQLPSKCN  97

Query  605  AN  600
             +
Sbjct  98   ID  99



>ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=512

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +D N +C+ AD  TWLS  +TNL+ C+  F+DL V+  + P + SNNV  LI+N
Sbjct  105  LNKTLDSNTRCTQADAQTWLSTALTNLQTCQDGFIDLGVSDYVLP-LMSNNVSKLISN  161



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -1

Query  186  CSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            C+  +  TWLS  +TNLE CRA FV+L V+GN+ P + SNNV  LI+N
Sbjct  118  CTHDEAQTWLSTALTNLETCRAGFVELGVSGNVLP-LMSNNVSKLISN  164



>gb|EPS67451.1| hypothetical protein M569_07329 [Genlisea aurea]
Length=98

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            T+ +L+ CRPA +  +P  P+ ACC A++     CLC  ++ P  P + +D  +ALQ+P 
Sbjct  30   TVGELMECRPAATPPKPENPSAACCKALKHADFKCLCNYLDNPVLPSLNIDPKLALQIPK  89

Query  614  KC  609
            KC
Sbjct  90   KC  91



>ref|XP_010646191.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
 ref|XP_010646192.1| PREDICTED: putative lipid-transfer protein DIR1 [Vitis vinifera]
Length=104

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKCTAN  600
            QL  C PA+    P PPT+ CCA ++     CLC+  +  P  GV+  +A+ LP KC  N
Sbjct  37   QLAQCLPAIRGPSPSPPTKECCAVIQKADMHCLCSYKHALPNFGVNPGLAMALPKKCGLN  96



>ref|XP_004306939.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Fragaria vesca subsp. vesca]
Length=508

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = -1

Query  222  QIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            Q ++  V+P+ KC+  D  TWLS  +TNLE CR  F +L V+ + F  V SNNV  LI+N
Sbjct  106  QKLNTTVNPSTKCTQEDTQTWLSTALTNLETCREGFSELGVS-DFFLPVMSNNVSNLISN  164



>gb|ACM90158.1| trypsin-alpha amylase inhibitor [Jatropha curcas]
Length=101

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = -2

Query  788  TIIQLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPD  615
            +I  L  C PAV+   P PPT ACC+A+      CLC+  N    P +G+D+ + L+LP+
Sbjct  32   SISGLTSCSPAVTPPNPAPPTSACCSALSHADLRCLCSYKNSTLLPSLGIDQKLPLKLPE  91

Query  614  KC  609
            KC
Sbjct  92   KC  93



>ref|XP_009790835.1| PREDICTED: LOW QUALITY PROTEIN: putative lipid-transfer protein 
DIR1 [Nicotiana sylvestris]
Length=178

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = -2

Query  776  LLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDKC  609
            L+ C+P+V+   P  PT  CC+A+      CLC+  N    P +GVD  +A+QLP+KC
Sbjct  113  LMSCKPSVTTPNPSAPTAKCCSALSQADWGCLCSYKNSQWLPSLGVDPTLAMQLPEKC  170



>ref|XP_004514851.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=515

 Score = 51.2 bits (121),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -1

Query  216  IDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYLINN  43
            ++  +D N KCS  D  TWLS  +TNLE C+A F +L V   + P + SNNV  L++N
Sbjct  111  LNKTLDTNTKCSQVDAQTWLSTALTNLETCKAGFYELGVQDYVLP-LMSNNVTKLLSN  167



>ref|NP_001236851.1| uncharacterized protein LOC100526983 precursor [Glycine max]
 gb|ACU16019.1| unknown [Glycine max]
 gb|KHN14582.1| Putative lipid-transfer protein DIR1 [Glycine soja]
Length=101

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 33/63 (52%), Gaps = 0/63 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKCTAN  600
            QL  CR AV+   P PP E CCA VR     CLC+  +  P  G++   AL LP KC   
Sbjct  37   QLNLCRAAVTGQNPPPPDEKCCAVVRQANLRCLCSYKSTLPSFGINPKNALALPGKCGLQ  96

Query  599  FEP  591
            + P
Sbjct  97   WPP  99



>ref|XP_009396800.1| PREDICTED: putative lipid-transfer protein DIR1 [Musa acuminata 
subsp. malaccensis]
Length=105

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 3/60 (5%)
 Frame = -2

Query  776  LLPCRPAVSAFRPF-PPTEACCAAVRSLGQPCLCAVVNGP--PIIGVDRNMALQLPDKCT  606
            L  C+P ++  +P   P+EACCAA++    PCLC+  N    P +G+D   A+QLP KC 
Sbjct  39   LAACKPCIAMVKPEEKPSEACCAALKQADLPCLCSYKNSDLLPYLGIDPKQAMQLPAKCN  98



>ref|XP_006577402.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Glycine max]
Length=180

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 1/63 (2%)
 Frame = -1

Query  231  YMFQIIDNIVDPNVKCSTADE*TWLSMTVTNLEMCRAEFVDLEVTGNIFPTVTSNNVLYL  52
            Y  Q ++  + P  KC+  D  TWLS  +TNLE C+  F +L V   + P + SNNV  L
Sbjct  106  YTIQKLNKTIAPYTKCTQTDTQTWLSTALTNLETCKNGFYELGVPDYVLP-LMSNNVTKL  164

Query  51   INN  43
            ++N
Sbjct  165  LSN  167



>ref|XP_004294054.1| PREDICTED: putative lipid-transfer protein DIR1-like [Fragaria 
vesca subsp. vesca]
Length=102

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 30/57 (53%), Gaps = 0/57 (0%)
 Frame = -2

Query  779  QLLPCRPAVSAFRPFPPTEACCAAVRSLGQPCLCAVVNGPPIIGVDRNMALQLPDKC  609
            QL  CR AVS   P PP++ CC  V     PCLC      P  G+D  +A+ LP KC
Sbjct  36   QLNYCRRAVSGKSPTPPSKKCCGVVHRANLPCLCNYKTVLPSFGIDPALAMALPKKC  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2242237191290