BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c88819_g1_i1 len=741 path=[719:0-740]

Length=741
                                                                      Score     E

ref|XP_009767346.1|  PREDICTED: kinesin-like protein NACK2 isofor...    122   7e-28   
ref|XP_009767348.1|  PREDICTED: kinesin-like protein NACK2 isofor...    121   3e-27   
ref|XP_006342006.1|  PREDICTED: kinesin-like protein NACK2-like i...    121   3e-27   
ref|XP_009587868.1|  PREDICTED: kinesin-like protein NACK2              120   3e-27   
ref|XP_004238322.1|  PREDICTED: kinesin-like protein NACK2              119   2e-26   
ref|XP_006342008.1|  PREDICTED: kinesin-like protein NACK2-like i...    116   1e-25   
ref|XP_010933747.1|  PREDICTED: kinesin-like protein NACK1              107   1e-22   
ref|XP_009378198.1|  PREDICTED: kinesin-like protein NACK2 isofor...    106   4e-22   
ref|XP_009338641.1|  PREDICTED: kinesin-like protein NACK2 isofor...    105   5e-22   
ref|XP_009338640.1|  PREDICTED: kinesin-like protein NACK2 isofor...    105   6e-22   
ref|XP_010672217.1|  PREDICTED: kinesin-like protein NACK2              105   9e-22   
ref|XP_008372766.1|  PREDICTED: kinesin-like protein NACK1              104   1e-21   
ref|XP_009378197.1|  PREDICTED: kinesin-like protein NACK1 isofor...    104   2e-21   
ref|XP_009345268.1|  PREDICTED: kinesin-like protein NACK1              103   3e-21   
ref|XP_007042026.1|  ATP binding microtubule motor family protein...    102   7e-21   
ref|XP_010494185.1|  PREDICTED: kinesin-like protein NACK2              102   1e-20   
ref|XP_010240187.1|  PREDICTED: kinesin-like protein NACK1 isofor...    101   1e-20   
ref|XP_010240186.1|  PREDICTED: kinesin-like protein NACK1 isofor...    101   1e-20   
ref|XP_010240185.1|  PREDICTED: kinesin-like protein NACK1 isofor...    101   2e-20   
ref|XP_010028653.1|  PREDICTED: kinesin-like protein NACK1 isofor...    100   2e-20   
ref|XP_011083601.1|  PREDICTED: kinesin-like protein NACK1              100   2e-20   
ref|XP_010028651.1|  PREDICTED: kinesin-like protein NACK1 isofor...    100   3e-20   
gb|KDO49884.1|  hypothetical protein CISIN_1g002139mg                   100   3e-20   
ref|XP_006423484.1|  hypothetical protein CICLE_v10027758mg             100   3e-20   
dbj|BAJ94998.1|  predicted protein                                      100   3e-20   
gb|EMS68002.1|  Kinesin-related protein 11                              100   3e-20   
dbj|BAJ95863.1|  predicted protein                                      100   4e-20   
ref|XP_006423481.1|  hypothetical protein CICLE_v10027758mg             100   4e-20   
ref|XP_006423482.1|  hypothetical protein CICLE_v10027758mg             100   4e-20   
ref|XP_006487377.1|  PREDICTED: kinesin-like protein NACK1-like i...    100   4e-20   
ref|XP_006487385.1|  PREDICTED: kinesin-like protein NACK1-like i...    100   4e-20   
gb|KDO49879.1|  hypothetical protein CISIN_1g002139mg                   100   4e-20   
ref|XP_010649060.1|  PREDICTED: kinesin-like protein NACK1              100   4e-20   
ref|XP_007201806.1|  hypothetical protein PRUPE_ppa001038mg             100   4e-20   
gb|KDO49883.1|  hypothetical protein CISIN_1g002139mg                 99.8    5e-20   
ref|XP_008236841.1|  PREDICTED: kinesin-like protein NACK2            99.8    5e-20   
ref|XP_008241798.1|  PREDICTED: kinesin-like protein NACK1            99.8    5e-20   
ref|XP_002301999.2|  kinesin motor family protein                     99.8    5e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010647602.1|  PREDICTED: kinesin-like protein NACK1            99.8    5e-20   
ref|XP_011028953.1|  PREDICTED: kinesin-like protein NACK1 isofor...  99.8    5e-20   
ref|XP_011028954.1|  PREDICTED: kinesin-like protein NACK1 isofor...  99.8    6e-20   
gb|EMT24668.1|  Kinesin-related protein 11                            99.4    7e-20   
ref|XP_007203241.1|  hypothetical protein PRUPE_ppa001146mg           99.4    8e-20   
gb|KHN39844.1|  Centromere-associated protein E                       99.4    8e-20   
gb|KHN25430.1|  Centromere-associated protein E                       99.4    8e-20   
ref|XP_008663419.1|  PREDICTED: kinesin-like protein NACK1 isofor...  99.0    9e-20   
ref|XP_008663418.1|  PREDICTED: kinesin-like protein NACK1 isofor...  99.0    1e-19   
gb|AAK91822.1|AF272759_1  kinesin heavy chain                         99.0    1e-19   Zea mays [maize]
emb|CDP07439.1|  unnamed protein product                              98.6    1e-19   
ref|XP_008669086.1|  PREDICTED: kinesin-like protein NACK1 isofor...  98.6    1e-19   
tpg|DAA36662.1|  TPA: hypothetical protein ZEAMMB73_386599            98.6    1e-19   
ref|XP_009386197.1|  PREDICTED: kinesin-like protein NACK1            98.6    1e-19   
ref|XP_007131749.1|  hypothetical protein PHAVU_011G038800g           98.6    1e-19   
ref|XP_008669084.1|  PREDICTED: kinesin-like protein NACK1 isofor...  98.6    1e-19   
ref|XP_007131750.1|  hypothetical protein PHAVU_011G038800g           98.6    1e-19   
ref|XP_008669081.1|  PREDICTED: kinesin-like protein NACK1 isofor...  98.6    1e-19   
tpg|DAA36661.1|  TPA: hypothetical protein ZEAMMB73_386599            98.6    1e-19   
ref|XP_008382370.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...  98.2    2e-19   
ref|XP_009378441.1|  PREDICTED: kinesin-like protein NACK1            98.2    2e-19   
ref|XP_006435104.1|  hypothetical protein CICLE_v10000097mg           98.6    2e-19   
gb|KDO84747.1|  hypothetical protein CISIN_1g001290mg                 98.2    2e-19   
ref|XP_006473602.1|  PREDICTED: kinesin-like protein NACK1-like i...  98.2    2e-19   
gb|KDO84748.1|  hypothetical protein CISIN_1g001290mg                 98.2    2e-19   
ref|XP_006473600.1|  PREDICTED: kinesin-like protein NACK1-like i...  98.2    2e-19   
ref|NP_001053433.1|  Os04g0538800                                     98.2    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC77720.1|  hypothetical protein OsI_16807                        98.2    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006473601.1|  PREDICTED: kinesin-like protein NACK1-like i...  98.2    2e-19   
emb|CAE03025.3|  OSJNBa0091D06.23                                     97.8    2e-19   Oryza sativa [red rice]
ref|XP_010263901.1|  PREDICTED: kinesin-like protein NACK1 isofor...  97.8    2e-19   
ref|XP_011037209.1|  PREDICTED: kinesin-like protein NACK1            97.4    3e-19   
ref|XP_002305465.1|  kinesin motor family protein                     97.4    3e-19   Populus trichocarpa [western balsam poplar]
gb|EYU38855.1|  hypothetical protein MIMGU_mgv1a000996mg              97.4    4e-19   
ref|XP_002510482.1|  ATP binding protein, putative                    97.4    4e-19   Ricinus communis
ref|XP_010919403.1|  PREDICTED: kinesin-like protein NACK1 isofor...  97.1    4e-19   
ref|XP_011074636.1|  PREDICTED: kinesin-like protein NACK2 isofor...  97.4    4e-19   
ref|XP_011074638.1|  PREDICTED: kinesin-like protein NACK1 isofor...  97.4    4e-19   
ref|XP_008796871.1|  PREDICTED: kinesin-like protein NACK1            97.1    5e-19   
ref|XP_004976382.1|  PREDICTED: kinesin-like protein NACK1-like i...  97.1    5e-19   
gb|KHF98979.1|  Kinesin-related 11                                    96.7    6e-19   
ref|XP_010919401.1|  PREDICTED: kinesin-like protein NACK2 isofor...  96.7    7e-19   
ref|XP_010481985.1|  PREDICTED: kinesin-like protein NACK1            96.7    7e-19   
ref|XP_004974128.1|  PREDICTED: kinesin-like protein NACK1-like i...  96.3    8e-19   
gb|KHG01762.1|  Kinesin-related 11                                    96.3    9e-19   
ref|XP_010445916.1|  PREDICTED: kinesin-like protein NACK1            92.0    9e-19   
dbj|BAD18096.1|  kinesin heavy chain-like protein                     95.1    9e-19   Ipomoea batatas [batate]
ref|XP_007017694.1|  ATP binding microtubule motor family protein...  96.3    9e-19   
ref|XP_002448243.1|  hypothetical protein SORBIDRAFT_06g023880        95.9    1e-18   Sorghum bicolor [broomcorn]
ref|XP_011090438.1|  PREDICTED: kinesin-like protein NACK1            95.9    1e-18   
ref|XP_006599344.1|  PREDICTED: kinesin-like protein NACK1-like i...  95.5    1e-18   
gb|KHN41676.1|  Kinesin-related protein 4                             95.5    1e-18   
gb|EEC73688.1|  hypothetical protein OsI_08259                        91.3    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_002280678.2|  PREDICTED: kinesin-like protein NACK1            95.5    1e-18   Vitis vinifera
ref|XP_006599340.1|  PREDICTED: kinesin-like protein NACK1-like i...  95.5    1e-18   
ref|XP_010531480.1|  PREDICTED: kinesin-like protein NACK1            95.5    1e-18   
ref|NP_001047565.2|  Os02g0644400                                     90.9    2e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CBI19799.3|  unnamed protein product                              95.1    2e-18   
ref|XP_004974129.1|  PREDICTED: kinesin-like protein NACK1-like i...  95.1    2e-18   
ref|XP_004974127.1|  PREDICTED: kinesin-like protein NACK1-like i...  95.1    2e-18   
ref|XP_009389113.1|  PREDICTED: kinesin-like protein NACK1            94.7    3e-18   
ref|XP_003538873.1|  PREDICTED: kinesin-like protein NACK1-like i...  94.7    3e-18   
ref|XP_010113382.1|  Kinesin-related protein 4                        94.7    3e-18   
ref|XP_007156119.1|  hypothetical protein PHAVU_003G260200g           94.7    3e-18   
ref|XP_006652585.1|  PREDICTED: kinesin-like protein NACK1-like       94.4    3e-18   
gb|KDP38590.1|  hypothetical protein JCGZ_04515                       94.4    3e-18   
ref|XP_003516550.1|  PREDICTED: kinesin-like protein NACK2-like i...  94.4    4e-18   
ref|XP_008791670.1|  PREDICTED: kinesin-like protein NACK2 isofor...  94.4    4e-18   
gb|EYU31140.1|  hypothetical protein MIMGU_mgv1a000697mg              94.4    4e-18   
ref|XP_008791672.1|  PREDICTED: kinesin-like protein NACK1 isofor...  94.0    4e-18   
gb|KHN36049.1|  Kinesin-related protein 4                             94.0    5e-18   
ref|XP_004512117.1|  PREDICTED: kinesin-related protein 4-like is...  94.0    5e-18   
ref|XP_009398104.1|  PREDICTED: kinesin-like protein NACK1            94.0    5e-18   
ref|XP_004512118.1|  PREDICTED: kinesin-related protein 4-like is...  94.0    5e-18   
gb|EEE57467.1|  hypothetical protein OsJ_07707                        93.2    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004958729.1|  PREDICTED: kinesin-like protein NACK1-like       93.6    5e-18   
ref|XP_009630368.1|  PREDICTED: kinesin-like protein NACK1 isofor...  93.6    6e-18   
ref|XP_002512997.1|  ATP binding protein, putative                    93.6    6e-18   Ricinus communis
ref|XP_010263900.1|  PREDICTED: kinesin-like protein NACK1 isofor...  93.6    7e-18   
ref|XP_009630370.1|  PREDICTED: kinesin-like protein NACK2 isofor...  93.6    7e-18   
gb|KDO71126.1|  hypothetical protein CISIN_1g001693mg                 93.2    7e-18   
ref|XP_006647603.1|  PREDICTED: kinesin-like protein NACK1-like       93.2    8e-18   
gb|KDO71125.1|  hypothetical protein CISIN_1g001693mg                 93.2    8e-18   
dbj|BAD25802.1|  putative kinesin heavy chain                         92.8    9e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006380794.1|  hypothetical protein POPTR_0007s13860g           93.2    9e-18   
ref|XP_010091188.1|  Kinesin-related protein 11                       93.2    9e-18   
gb|KDO71124.1|  hypothetical protein CISIN_1g001693mg                 93.2    9e-18   
gb|AES95091.2|  ATP-binding microtubule motor family protein          93.2    9e-18   
ref|XP_003612133.1|  Kinesin-related protein                          93.2    9e-18   
ref|XP_006466916.1|  PREDICTED: kinesin-like protein NACK1-like i...  93.2    9e-18   
ref|XP_006425531.1|  hypothetical protein CICLE_v10024791mg           93.2    9e-18   
ref|XP_008444776.1|  PREDICTED: kinesin-like protein NACK1            93.2    9e-18   
ref|XP_006466914.1|  PREDICTED: kinesin-like protein NACK1-like i...  93.2    9e-18   
ref|XP_010535298.1|  PREDICTED: kinesin-like protein NACK1            93.2    1e-17   
gb|KDP27640.1|  hypothetical protein JCGZ_19645                       92.8    1e-17   
ref|XP_002452843.1|  hypothetical protein SORBIDRAFT_04g033456        92.0    1e-17   Sorghum bicolor [broomcorn]
gb|KDP46700.1|  hypothetical protein JCGZ_06488                       92.8    1e-17   
emb|CDY15900.1|  BnaA04g12110D                                        92.8    1e-17   
ref|XP_002863777.1|  kinesin motor family protein                     92.8    1e-17   
gb|KCW53110.1|  hypothetical protein EUGRSUZ_J02401                   92.8    1e-17   
gb|EEC73693.1|  hypothetical protein OsI_08272                        92.4    1e-17   Oryza sativa Indica Group [Indian rice]
ref|NP_001047571.1|  Os02g0645100                                     92.4    1e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009760421.1|  PREDICTED: kinesin-like protein NACK2            92.4    1e-17   
ref|XP_006413467.1|  hypothetical protein EUTSA_v10026976mg           92.4    2e-17   
ref|NP_199064.1|  ATP binding microtubule motor family protein        92.4    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHG01461.1|  Kinesin-related 11                                    92.0    2e-17   
ref|XP_006279726.1|  hypothetical protein CARUB_v10027496mg           92.0    2e-17   
ref|XP_008669085.1|  PREDICTED: kinesin-like protein NACK1 isofor...  92.0    2e-17   
ref|XP_002313758.2|  kinesin motor family protein                     92.0    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_007046742.1|  ATP binding microtubule motor family protein...  91.7    3e-17   
emb|CDX99601.1|  BnaC04g33580D                                        91.7    3e-17   
ref|XP_006854867.1|  hypothetical protein AMTR_s00182p00038530        91.7    3e-17   
ref|XP_002462712.1|  hypothetical protein SORBIDRAFT_02g030680        91.7    3e-17   Sorghum bicolor [broomcorn]
ref|XP_009336756.1|  PREDICTED: kinesin-like protein NACK1            91.7    3e-17   
ref|XP_008388151.1|  PREDICTED: kinesin-like protein NACK1            91.7    3e-17   
ref|XP_008388149.1|  PREDICTED: kinesin-like protein NACK2            91.7    3e-17   
ref|XP_003569980.1|  PREDICTED: kinesin-like protein NACK2            91.3    3e-17   
ref|XP_009140272.1|  PREDICTED: kinesin-like protein NACK1            90.9    4e-17   
ref|XP_011047336.1|  PREDICTED: kinesin-like protein NACK2 isofor...  91.3    4e-17   
tpg|DAA40602.1|  TPA: hypothetical protein ZEAMMB73_556467            86.7    4e-17   
ref|XP_011047311.1|  PREDICTED: kinesin-like protein NACK2 isofor...  90.9    5e-17   
ref|XP_008671753.1|  PREDICTED: kinesin-like protein NACK1            86.7    5e-17   
ref|XP_007157943.1|  hypothetical protein PHAVU_002G111200g           90.9    5e-17   
ref|XP_009137750.1|  PREDICTED: kinesin-like protein NACK2            90.9    6e-17   
emb|CDY03482.1|  BnaC01g16000D                                        90.5    6e-17   
ref|XP_004953277.1|  PREDICTED: kinesin-like protein NACK1-like i...  90.5    6e-17   
ref|XP_003519876.1|  PREDICTED: kinesin-like protein NACK1-like       90.5    7e-17   
ref|XP_004289095.1|  PREDICTED: uncharacterized protein LOC101300397  90.5    7e-17   
gb|KHN00495.1|  Kinesin-related protein 11                            90.1    7e-17   
ref|XP_011025920.1|  PREDICTED: kinesin-like protein NACK2            90.5    7e-17   
ref|XP_010448602.1|  PREDICTED: kinesin-like protein NACK1            90.5    8e-17   
ref|XP_009597015.1|  PREDICTED: kinesin-like protein NACK1            90.1    8e-17   
emb|CDY34261.1|  BnaA01g13640D                                        90.1    8e-17   
ref|XP_006659658.1|  PREDICTED: kinesin-like protein NACK2-like       90.1    8e-17   
ref|NP_001159162.1|  uncharacterized protein LOC100304245             86.7    9e-17   Zea mays [maize]
ref|XP_009791027.1|  PREDICTED: kinesin-like protein NACK1            90.1    1e-16   
ref|XP_010909958.1|  PREDICTED: kinesin-like protein NACK1            90.1    1e-16   
emb|CAB51660.1|  putative protein                                     90.1    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567695.1|  ATP binding microtubule motor family protein        89.7    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22403.1|  BnaA06g37250D                                        87.8    1e-16   
gb|EEE69110.1|  hypothetical protein OsJ_28179                        89.7    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062429.1|  Os08g0547500                                     89.7    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009617690.1|  PREDICTED: kinesin-like protein NACK2            89.7    1e-16   
ref|XP_004293191.1|  PREDICTED: uncharacterized protein LOC101301847  89.4    1e-16   
gb|EYU24075.1|  hypothetical protein MIMGU_mgv1a001308mg              89.4    1e-16   
ref|XP_002531511.1|  conserved hypothetical protein                   89.4    1e-16   Ricinus communis
ref|XP_006403375.1|  hypothetical protein EUTSA_v10003349mg           89.4    1e-16   
ref|XP_009101917.1|  PREDICTED: uncharacterized protein LOC103828075  87.8    2e-16   
dbj|BAD09937.1|  putative kinesin heavy chain                         89.4    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393646.1|  PREDICTED: kinesin-like protein NACK1            89.4    2e-16   
emb|CDP01925.1|  unnamed protein product                              89.4    2e-16   
ref|XP_010526582.1|  PREDICTED: kinesin-like protein NACK1 isofor...  89.0    2e-16   
ref|XP_004509341.1|  PREDICTED: kinesin-related protein 4-like is...  89.0    2e-16   
ref|XP_004167109.1|  PREDICTED: uncharacterized LOC101212680          89.0    2e-16   
ref|XP_004152764.1|  PREDICTED: uncharacterized protein LOC101212680  89.0    2e-16   
gb|AFW63202.1|  hypothetical protein ZEAMMB73_949881                  89.0    2e-16   
emb|CDY12957.1|  BnaC02g29640D                                        89.0    2e-16   
ref|XP_010526578.1|  PREDICTED: kinesin-like protein NACK1 isofor...  89.0    2e-16   
ref|XP_004509338.1|  PREDICTED: kinesin-related protein 4-like is...  89.0    2e-16   
gb|EMT03608.1|  Kinesin-related protein 4                             89.0    2e-16   
gb|EMS48860.1|  Kinesin-related protein 4                             89.0    2e-16   
emb|CDY02395.1|  BnaA02g23040D                                        88.2    3e-16   
ref|XP_009336747.1|  PREDICTED: kinesin-like protein NACK1            88.6    3e-16   
tpg|DAA40600.1|  TPA: hypothetical protein ZEAMMB73_646629            88.2    3e-16   
ref|XP_006411686.1|  hypothetical protein EUTSA_v10024409mg           88.6    3e-16   
gb|AET03829.2|  ATP-binding microtubule motor family protein          88.6    3e-16   
ref|XP_004232466.1|  PREDICTED: kinesin-like protein NACK2            88.6    3e-16   
ref|XP_008221318.1|  PREDICTED: kinesin-like protein NACK1            88.6    3e-16   
gb|KEH20388.1|  ATP-binding microtubule motor family protein          88.6    3e-16   
ref|XP_002444630.1|  hypothetical protein SORBIDRAFT_07g025040        88.6    3e-16   Sorghum bicolor [broomcorn]
ref|XP_008678883.1|  PREDICTED: kinesin-like protein NACK1 isofor...  88.2    3e-16   
ref|XP_009123681.1|  PREDICTED: kinesin-like protein NACK1            88.6    3e-16   
ref|XP_008678882.1|  PREDICTED: kinesin-like protein NACK1 isofor...  88.2    3e-16   
ref|XP_009777060.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...  88.2    3e-16   
ref|XP_010033468.1|  PREDICTED: kinesin-like protein NACK1            88.2    3e-16   
ref|XP_009407965.1|  PREDICTED: kinesin-like protein NACK2            88.2    4e-16   
ref|XP_008668211.1|  PREDICTED: uncharacterized protein LOC100304...  88.2    4e-16   
ref|XP_006285338.1|  hypothetical protein CARUB_v10006728mg           88.2    4e-16   
ref|XP_009772334.1|  PREDICTED: kinesin-like protein NACK2            88.2    4e-16   
ref|XP_003629353.1|  Kinesin heavy chain DNA binding protein-like...  88.2    4e-16   
ref|XP_008668212.1|  PREDICTED: uncharacterized protein LOC100304...  88.2    4e-16   
gb|AAK91812.1|AF272749_1  kinesin heavy chain                         87.8    4e-16   Zea mays [maize]
gb|EEC83991.1|  hypothetical protein OsI_30145                        87.8    4e-16   Oryza sativa Indica Group [Indian rice]
dbj|BAF02000.1|  kinesin like protein                                 87.8    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195606.2|  ATP binding microtubule motor family protein        87.8    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006340707.1|  PREDICTED: kinesin-like protein NACK1-like       87.8    6e-16   
ref|XP_007226270.1|  hypothetical protein PRUPE_ppa019074mg           87.4    6e-16   
ref|XP_010690757.1|  PREDICTED: kinesin-like protein NACK1            87.4    6e-16   
emb|CAB38815.1|  kinesin like protein                                 87.4    6e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KHN33713.1|  Centromere-associated protein E                       87.4    7e-16   
ref|XP_002868873.1|  kinesin motor family protein                     87.0    8e-16   
ref|XP_011100938.1|  PREDICTED: kinesin-like protein NACK1            87.0    9e-16   
ref|XP_003607070.1|  Kinesin-related protein                          87.0    9e-16   
dbj|BAF00479.1|  hypothetical protein                                 83.2    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452056.1|  PREDICTED: kinesin-like protein NACK1 isofor...  86.7    1e-15   
ref|XP_004160983.1|  PREDICTED: uncharacterized LOC101218717          86.7    1e-15   
gb|KGN53326.1|  hypothetical protein Csa_4G047870                     86.7    1e-15   
ref|XP_003603728.1|  Kinesin-related protein                          86.7    1e-15   
ref|XP_004146557.1|  PREDICTED: uncharacterized protein LOC101218717  86.7    1e-15   
gb|AES73979.2|  ATP-binding microtubule motor family protein          86.7    1e-15   
ref|XP_008775732.1|  PREDICTED: kinesin-like protein NACK1 isofor...  86.7    1e-15   
ref|NP_001063734.2|  Os09g0528000                                     86.3    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEE70089.1|  hypothetical protein OsJ_30085                        86.3    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008775730.1|  PREDICTED: kinesin-like protein NACK1 isofor...  86.3    2e-15   
ref|XP_010436987.1|  PREDICTED: kinesin-like protein NACK1            85.9    2e-15   
dbj|BAK06679.1|  predicted protein                                    85.9    2e-15   
ref|XP_010446407.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.9    2e-15   
emb|CDY13822.1|  BnaA09g43240D                                        85.9    2e-15   
ref|XP_008448048.1|  PREDICTED: kinesin-like protein NACK2            85.9    2e-15   
ref|XP_008452051.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.9    2e-15   
dbj|BAD93933.1|  putative kinesin heavy chain                         85.1    2e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDX82016.1|  BnaC08g35850D                                        85.5    2e-15   
gb|KHF98716.1|  Kinesin-related 11                                    85.5    3e-15   
gb|KGN43176.1|  hypothetical protein Csa_7G006260                     85.5    3e-15   
ref|XP_009117419.1|  PREDICTED: kinesin-like protein NACK1            85.5    3e-15   
emb|CDY42594.1|  BnaC01g00060D                                        85.1    3e-15   
ref|XP_006383133.1|  kinesin motor family protein                     85.1    3e-15   
ref|XP_010271468.1|  PREDICTED: kinesin-like protein NACK2            85.1    3e-15   
ref|XP_010431843.1|  PREDICTED: kinesin-like protein NACK1            85.1    4e-15   
ref|XP_010472110.1|  PREDICTED: kinesin-like protein NACK1            85.1    4e-15   
ref|NP_179726.2|  ATP binding microtubule motor family protein        85.1    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404570.1|  hypothetical protein EUTSA_v10000043mg           85.1    4e-15   
gb|EPS66111.1|  hypothetical protein M569_08665                       84.7    4e-15   
ref|XP_010416871.1|  PREDICTED: kinesin-like protein NACK1            84.7    4e-15   
ref|XP_003527612.1|  PREDICTED: kinesin-like protein NACK1-like i...  84.7    4e-15   
ref|XP_006290553.1|  hypothetical protein CARUB_v10016639mg           84.7    4e-15   
gb|KHN20030.1|  Kinesin-related protein 4                             84.7    5e-15   
ref|XP_006296345.1|  hypothetical protein CARUB_v10025517mg           84.7    5e-15   
ref|XP_006661465.1|  PREDICTED: kinesin-like protein NACK2-like       84.7    5e-15   
ref|XP_010433806.1|  PREDICTED: kinesin-like protein NACK1            84.7    5e-15   
ref|XP_009140424.1|  PREDICTED: kinesin-like protein NACK1            84.3    5e-15   
emb|CDY41952.1|  BnaA01g05240D                                        84.0    7e-15   
ref|XP_010429028.1|  PREDICTED: kinesin-like protein NACK1            84.0    8e-15   
ref|XP_006283113.1|  hypothetical protein CARUB_v10004132mg           84.0    9e-15   
gb|EMT22069.1|  Kinesin-related protein 4                             83.6    1e-14   
ref|XP_002880373.1|  kinesin motor family protein                     83.6    1e-14   
gb|EPS72257.1|  hypothetical protein M569_02502                       79.3    1e-14   
gb|EPS66402.1|  hypothetical protein M569_08376                       79.3    1e-14   
emb|CDX72727.1|  BnaC07g47490D                                        82.0    1e-14   
ref|XP_003578490.1|  PREDICTED: kinesin-like protein NACK1            83.6    1e-14   
emb|CDY61132.1|  BnaCnng37380D                                        78.2    1e-14   
ref|XP_010317235.1|  PREDICTED: kinesin-like protein NACK1 isofor...  83.2    1e-14   
ref|XP_010317234.1|  PREDICTED: kinesin-like protein NACK1 isofor...  83.2    1e-14   
ref|XP_004148539.1|  PREDICTED: kinesin-like protein KIN12B-like      83.2    2e-14   
emb|CDO96988.1|  unnamed protein product                              82.8    2e-14   
emb|CDY29004.1|  BnaC07g32100D                                        82.4    3e-14   
ref|XP_010550454.1|  PREDICTED: kinesin-like protein NACK1 isofor...  82.4    3e-14   
ref|XP_010550452.1|  PREDICTED: kinesin-like protein NACK1 isofor...  82.4    3e-14   
gb|EMS46463.1|  Kinesin-related protein 11                            82.0    3e-14   
tpg|DAA62428.1|  TPA: hypothetical protein ZEAMMB73_515130            81.6    4e-14   
gb|EMS48622.1|  Kinesin-related protein 4                             81.6    5e-14   
gb|KDP35186.1|  hypothetical protein JCGZ_10720                       81.6    5e-14   
ref|XP_008652981.1|  PREDICTED: kinesin-like protein NACK1 isofor...  81.6    5e-14   
ref|XP_008652983.1|  PREDICTED: kinesin-like protein NACK1 isofor...  81.3    5e-14   
ref|XP_009136600.1|  PREDICTED: kinesin-like protein NACK1 isofor...  81.3    5e-14   
ref|XP_010503800.1|  PREDICTED: kinesin-like protein NACK1            81.3    6e-14   
ref|XP_002992286.1|  hypothetical protein SELMODRAFT_135047           81.3    6e-14   
ref|XP_006842375.1|  hypothetical protein AMTR_s00079p00190770        81.3    6e-14   
emb|CDX90660.1|  BnaA03g41210D                                        81.3    7e-14   
ref|XP_009136598.1|  PREDICTED: kinesin-like protein NACK1 isofor...  81.3    7e-14   
gb|EMT18151.1|  Kinesin-related protein 4                             81.3    7e-14   
dbj|BAF00728.1|  hypothetical protein                                 80.9    8e-14   
ref|XP_011088489.1|  PREDICTED: kinesin-like protein NACK1            80.9    9e-14   
ref|XP_010515506.1|  PREDICTED: kinesin-like protein NACK1 isofor...  80.5    1e-13   
gb|KHG01962.1|  Kinesin-related 4                                     80.5    1e-13   
ref|NP_001190049.1|  ATP binding microtubule motor family protein     80.9    1e-13   
ref|XP_010679851.1|  PREDICTED: kinesin-like protein NACK1 isofor...  80.5    1e-13   
ref|XP_010426660.1|  PREDICTED: kinesin-like protein NACK1 isofor...  80.5    1e-13   
ref|XP_002876073.1|  kinesin motor family protein                     80.5    1e-13   
ref|XP_010679850.1|  PREDICTED: kinesin-like protein NACK1 isofor...  80.5    1e-13   
ref|XP_010679852.1|  PREDICTED: kinesin-like protein NACK1 isofor...  80.5    1e-13   
ref|XP_010426656.1|  PREDICTED: kinesin-like protein NACK1 isofor...  80.1    1e-13   
ref|XP_010515505.1|  PREDICTED: kinesin-like protein NACK1 isofor...  80.1    2e-13   
gb|KHG07573.1|  kif4                                                  80.1    2e-13   
ref|XP_007135918.1|  hypothetical protein PHAVU_009G003000g           80.1    2e-13   
ref|XP_010235378.1|  PREDICTED: kinesin-like protein NACK2 isofor...  80.1    2e-13   
gb|EEC84919.1|  hypothetical protein OsI_32119                        80.1    2e-13   
ref|XP_010235379.1|  PREDICTED: kinesin-like protein NACK2 isofor...  80.1    2e-13   
ref|XP_009386558.1|  PREDICTED: kinesin-like protein NACK1            79.7    2e-13   
ref|XP_006403945.1|  hypothetical protein EUTSA_v10010086mg           79.7    2e-13   
gb|KHN23757.1|  Kinesin-related protein 4                             79.7    2e-13   
emb|CDX77978.1|  BnaA09g31730D                                        79.7    2e-13   
ref|XP_003534160.1|  PREDICTED: kinesin-like protein NACK1-like i...  79.3    2e-13   
gb|KDP33977.1|  hypothetical protein JCGZ_07548                       79.3    2e-13   
emb|CDY03481.1|  BnaC01g16010D                                        76.6    2e-13   
ref|XP_007036597.1|  ATP binding microtubule motor family protein...  79.3    3e-13   
emb|CDX72728.1|  BnaC07g47500D                                        79.0    3e-13   
ref|XP_009101918.1|  PREDICTED: kinesin-like protein NACK1            79.0    3e-13   
emb|CDX73746.1|  BnaC08g22570D                                        79.0    3e-13   
ref|XP_002987833.1|  hypothetical protein SELMODRAFT_126650           79.0    3e-13   
ref|XP_011092853.1|  PREDICTED: kinesin-like protein NACK1 isofor...  78.6    4e-13   
ref|XP_006578467.1|  PREDICTED: kinesin-like protein NACK2-like i...  74.7    4e-13   
ref|NP_190684.3|  ATP binding microtubule motor family protein        78.6    5e-13   
ref|XP_010687583.1|  PREDICTED: kinesin-like protein NACK2            78.2    5e-13   
gb|KHN20772.1|  Kinesin-related protein 4                             78.2    5e-13   
ref|XP_003528955.1|  PREDICTED: kinesin-like protein NACK1-like i...  78.2    5e-13   
ref|XP_011092849.1|  PREDICTED: kinesin-like protein NACK1 isofor...  78.2    5e-13   
gb|KHG01464.1|  Kinesin-related 4                                     78.2    7e-13   
ref|XP_006393829.1|  hypothetical protein EUTSA_v10003607mg           77.8    7e-13   
ref|XP_009115793.1|  PREDICTED: kinesin-like protein NACK1 isofor...  77.8    7e-13   
gb|KHN09110.1|  Kinesin-related protein 4                             77.8    8e-13   
gb|ABB45845.1|  hypothetical protein                                  77.8    9e-13   
ref|XP_009115792.1|  PREDICTED: kinesin-like protein NACK1 isofor...  77.8    9e-13   
ref|XP_006582466.1|  PREDICTED: kinesin-like protein NACK1-like       77.8    9e-13   
ref|XP_006442593.1|  hypothetical protein CICLE_v10018724mg           77.4    1e-12   
gb|KDO49802.1|  hypothetical protein CISIN_1g002128mg                 77.4    1e-12   
ref|XP_007152726.1|  hypothetical protein PHAVU_004G154300g           77.4    1e-12   
ref|XP_007136058.1|  hypothetical protein PHAVU_009G014400g           77.4    1e-12   
ref|XP_006477781.1|  PREDICTED: kinesin-like protein NACK1-like       77.4    1e-12   
ref|XP_010036903.1|  PREDICTED: kinesin-like protein NACK1            77.4    1e-12   
gb|EYU37862.1|  hypothetical protein MIMGU_mgv1a001175mg              77.4    1e-12   
ref|XP_010465682.1|  PREDICTED: kinesin-like protein NACK1            77.4    1e-12   
ref|XP_010315335.1|  PREDICTED: kinesin-like protein NACK2 isofor...  77.0    2e-12   
ref|XP_010315333.1|  PREDICTED: kinesin-like protein NACK2 isofor...  77.0    2e-12   
gb|EYU40392.1|  hypothetical protein MIMGU_mgv1a001117mg              77.0    2e-12   
ref|XP_009407329.1|  PREDICTED: kinesin-like protein NACK1            76.6    2e-12   
ref|XP_008460563.1|  PREDICTED: kinesin-like protein NACK2 isofor...  76.6    2e-12   
ref|XP_002516209.1|  microtubule motor, putative                      76.6    2e-12   
ref|XP_008460562.1|  PREDICTED: kinesin-like protein NACK2 isofor...  76.6    2e-12   
gb|KHN45902.1|  Kinesin-related protein 11                            76.6    2e-12   
ref|XP_008393328.1|  PREDICTED: kinesin-like protein NACK1            76.6    2e-12   
ref|XP_010323978.1|  PREDICTED: kinesin-like protein NACK2            76.6    2e-12   
ref|XP_009589619.1|  PREDICTED: kinesin-like protein NACK1            76.3    2e-12   
ref|XP_003620405.1|  Kinesin-like protein KIF3A                       76.3    2e-12   
ref|XP_009804137.1|  PREDICTED: kinesin-like protein NACK1            76.3    2e-12   
gb|AES76623.2|  ATP-binding microtubule motor family protein          76.3    2e-12   
ref|XP_006353764.1|  PREDICTED: kinesin-like protein NACK2-like       76.3    2e-12   
ref|XP_004235748.1|  PREDICTED: kinesin-like protein NACK1            76.3    2e-12   
ref|XP_011078149.1|  PREDICTED: kinesin-like protein NACK2            76.3    3e-12   
ref|XP_010547443.1|  PREDICTED: kinesin-like protein NACK2 isofor...  76.3    3e-12   
emb|CDY22404.1|  BnaA06g37260D                                        75.9    3e-12   
ref|XP_009786270.1|  PREDICTED: kinesin-like protein NACK2 isofor...  76.3    3e-12   
ref|XP_009786271.1|  PREDICTED: kinesin-like protein NACK2 isofor...  76.3    3e-12   
ref|XP_009786269.1|  PREDICTED: kinesin-like protein NACK2 isofor...  76.3    3e-12   
ref|XP_009786272.1|  PREDICTED: kinesin-like protein NACK2 isofor...  76.3    3e-12   
ref|XP_010547440.1|  PREDICTED: kinesin-like protein NACK2 isofor...  76.3    3e-12   
sp|Q8S949.1|NACK2_TOBAC  RecName: Full=Kinesin-like protein NACK2...  76.3    3e-12   
ref|XP_010547442.1|  PREDICTED: kinesin-like protein NACK2 isofor...  76.3    3e-12   
ref|XP_010547439.1|  PREDICTED: kinesin-like protein NACK2 isofor...  76.3    3e-12   
ref|XP_010547438.1|  PREDICTED: kinesin-like protein NACK1 isofor...  76.3    3e-12   
ref|XP_010547436.1|  PREDICTED: kinesin-like protein NACK1 isofor...  76.3    3e-12   
ref|XP_010547441.1|  PREDICTED: kinesin-like protein NACK2 isofor...  75.9    3e-12   
ref|XP_010547437.1|  PREDICTED: kinesin-like protein NACK1 isofor...  75.9    3e-12   
ref|XP_010484663.1|  PREDICTED: kinesin-like protein NACK1 isofor...  75.9    3e-12   
ref|XP_011045827.1|  PREDICTED: kinesin-like protein NACK1 isofor...  75.9    3e-12   
ref|XP_011045826.1|  PREDICTED: kinesin-like protein NACK1 isofor...  75.9    4e-12   
ref|XP_006341574.1|  PREDICTED: kinesin-like protein NACK1-like i...  75.9    4e-12   
ref|XP_002279228.1|  PREDICTED: kinesin-like protein NACK1            75.9    4e-12   
ref|XP_010484662.1|  PREDICTED: kinesin-like protein NACK1 isofor...  75.9    4e-12   
ref|XP_002318539.1|  hypothetical protein POPTR_0012s05060g           75.9    4e-12   
ref|XP_011045825.1|  PREDICTED: kinesin-like protein NACK1 isofor...  75.5    4e-12   
ref|XP_010693857.1|  PREDICTED: kinesin-like protein NACK1            75.5    4e-12   
gb|ADQ43205.1|  kinesin motor family protein                          75.5    4e-12   
ref|XP_010110084.1|  Kinesin-related protein 4                        75.5    5e-12   
emb|CBI15491.3|  unnamed protein product                              75.1    5e-12   
ref|XP_004300503.1|  PREDICTED: uncharacterized protein LOC101315243  75.5    5e-12   
emb|CDO98410.1|  unnamed protein product                              75.1    5e-12   
ref|XP_007210400.1|  hypothetical protein PRUPE_ppa000865mg           75.1    6e-12   
ref|XP_011072914.1|  PREDICTED: kinesin-like protein NACK1            75.1    7e-12   
ref|XP_008240232.1|  PREDICTED: kinesin-like protein NACK1            75.1    7e-12   
ref|XP_002865077.1|  kinesin motor family protein                     75.1    7e-12   
ref|XP_010444813.1|  PREDICTED: kinesin-like protein NACK2            74.7    7e-12   
ref|XP_010250094.1|  PREDICTED: kinesin-like protein NACK1            74.7    7e-12   
ref|XP_008356658.1|  PREDICTED: kinesin-like protein NACK1            74.7    7e-12   
ref|XP_009347467.1|  PREDICTED: kinesin-like protein NACK1            74.7    8e-12   
ref|XP_009418072.1|  PREDICTED: kinesin-like protein NACK1            74.7    8e-12   
gb|KGN51423.1|  hypothetical protein Csa_5G537000                     74.7    8e-12   
ref|XP_009360131.1|  PREDICTED: kinesin-like protein NACK1            74.7    8e-12   
ref|XP_009359691.1|  PREDICTED: kinesin-like protein NACK2            74.7    9e-12   
ref|XP_008337808.1|  PREDICTED: kinesin-like protein NACK2 isofor...  74.7    9e-12   
ref|XP_008337807.1|  PREDICTED: kinesin-like protein NACK2 isofor...  74.3    9e-12   
ref|XP_004512893.1|  PREDICTED: kinesin-II 95 kDa subunit-like is...  74.3    1e-11   
ref|XP_008242294.1|  PREDICTED: kinesin-like protein NACK2            74.3    1e-11   
gb|KFK28301.1|  hypothetical protein AALP_AA8G498700                  73.2    1e-11   
ref|XP_007203229.1|  hypothetical protein PRUPE_ppa000925mg           73.9    1e-11   
ref|XP_001779285.1|  predicted protein                                73.9    1e-11   
ref|XP_002321490.2|  nodulin-25 precursor family protein              73.6    2e-11   
ref|XP_011008305.1|  PREDICTED: kinesin-like protein NACK1            73.6    2e-11   
emb|CDY38692.1|  BnaC01g28050D                                        71.6    2e-11   
ref|XP_002275046.2|  PREDICTED: kinesin-like protein NACK2            73.6    2e-11   
emb|CBI27754.3|  unnamed protein product                              73.6    2e-11   
ref|XP_009625447.1|  PREDICTED: kinesin-like protein NACK2            73.6    2e-11   
ref|XP_010279346.1|  PREDICTED: kinesin-like protein NACK1            73.6    2e-11   
gb|AES92142.2|  ATP-binding microtubule motor family protein          73.6    2e-11   
gb|KHG14242.1|  Kinesin-related 4                                     73.6    2e-11   
ref|XP_010261715.1|  PREDICTED: kinesin-like protein NACK2            73.6    2e-11   
emb|CDP03034.1|  unnamed protein product                              73.6    2e-11   
ref|XP_003609945.1|  Kinesin-like protein                             73.6    2e-11   
ref|XP_010051345.1|  PREDICTED: kinesin-like protein NACK2            73.2    3e-11   
gb|KCW81847.1|  hypothetical protein EUGRSUZ_C03198                   73.2    3e-11   
dbj|BAB10710.1|  kinesin heavy chain DNA binding protein-like         72.8    3e-11   
ref|XP_004287670.1|  PREDICTED: uncharacterized protein LOC101306666  72.8    3e-11   
ref|XP_007154542.1|  hypothetical protein PHAVU_003G127400g           72.8    4e-11   
ref|XP_007012544.1|  ATP binding microtubule motor family protein...  72.8    4e-11   
ref|XP_007012545.1|  ATP binding microtubule motor family protein...  72.8    4e-11   
ref|NP_201432.2|  ATP binding microtubule motor family protein        72.8    4e-11   
ref|XP_010041499.1|  PREDICTED: kinesin-like protein NACK2            71.6    5e-11   
gb|KCW44323.1|  hypothetical protein EUGRSUZ_L02231                   71.6    5e-11   
ref|XP_006281818.1|  hypothetical protein CARUB_v10028003mg           71.6    8e-11   
ref|XP_010906990.1|  PREDICTED: kinesin-like protein NACK1            71.6    8e-11   
gb|EYU21085.1|  hypothetical protein MIMGU_mgv1a000841mg              71.2    9e-11   
ref|XP_004508037.1|  PREDICTED: centromere-associated protein E-l...  71.2    1e-10   
emb|CDY30956.1|  BnaA06g19570D                                        71.2    1e-10   
emb|CDY44836.1|  BnaCnng11920D                                        71.2    1e-10   
ref|XP_009150293.1|  PREDICTED: kinesin-like protein NACK2            71.2    1e-10   
ref|XP_008792831.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...  71.2    1e-10   
ref|XP_004137483.1|  PREDICTED: uncharacterized protein LOC101215425  71.2    1e-10   
ref|XP_004508036.1|  PREDICTED: centromere-associated protein E-l...  70.9    1e-10   
ref|XP_002875601.1|  hypothetical protein ARALYDRAFT_323079           70.9    1e-10   
ref|XP_010503028.1|  PREDICTED: kinesin-like protein NACK2            70.9    1e-10   
ref|XP_010514712.1|  PREDICTED: kinesin-like protein NACK2            70.9    1e-10   
emb|CDY45220.1|  BnaA07g12700D                                        70.9    1e-10   
ref|XP_010540004.1|  PREDICTED: kinesin-like protein NACK1            70.5    2e-10   
ref|XP_010430934.1|  PREDICTED: kinesin-like protein NACK2            70.5    2e-10   
emb|CAB89042.1|  kinesin-like protein                                 70.5    2e-10   
emb|CAD42234.1|  kinesin-like protein                                 70.5    2e-10   
ref|NP_189907.2|  kinesin TETRASPORE                                  70.5    2e-10   
emb|CAD42658.1|  kinesin-like protein                                 70.5    2e-10   
ref|XP_009124667.1|  PREDICTED: kinesin-like protein NACK1            67.8    2e-10   
ref|XP_010107075.1|  Kinesin-related protein 4                        70.5    2e-10   
gb|EMS53749.1|  Kinesin-related protein 4                             70.5    2e-10   
gb|EMT03728.1|  Kinesin-related protein 4                             70.1    2e-10   
ref|XP_004166306.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.1    2e-10   
ref|XP_003541319.1|  PREDICTED: kinesin-like protein NACK2-like i...  70.1    2e-10   
dbj|BAK03253.1|  predicted protein                                    70.1    2e-10   
gb|KGN64145.1|  hypothetical protein Csa_1G042550                     70.1    2e-10   
ref|XP_006290563.1|  hypothetical protein CARUB_v10016650mg           69.7    3e-10   
emb|CDY19208.1|  BnaC05g14090D                                        69.7    3e-10   
ref|XP_010537463.1|  PREDICTED: kinesin-like protein NACK1 isofor...  69.3    3e-10   
ref|XP_006644227.1|  PREDICTED: kinesin-like protein NACK1-like       69.3    4e-10   
ref|XP_008460891.1|  PREDICTED: kinesin-like protein NACK1            69.3    4e-10   
ref|XP_004968822.1|  PREDICTED: kinesin-like protein NACK1-like i...  69.3    4e-10   
ref|XP_010537459.1|  PREDICTED: kinesin-like protein NACK1 isofor...  69.3    4e-10   
gb|KDO73778.1|  hypothetical protein CISIN_1g003967mg                 68.9    5e-10   
ref|XP_008775906.1|  PREDICTED: kinesin-like protein NACK1            69.3    5e-10   
ref|XP_006419132.1|  hypothetical protein EUTSA_v10002392mg           68.9    5e-10   
emb|CDY30779.1|  BnaC07g16790D                                        68.9    5e-10   
ref|XP_006452892.1|  hypothetical protein CICLE_v10007377mg           68.9    5e-10   
gb|EEC70753.1|  hypothetical protein OsI_02166                        68.9    6e-10   
ref|XP_010459448.1|  PREDICTED: kinesin-like protein NACK1            68.9    6e-10   
ref|NP_001043186.1|  Os01g0513900                                     68.9    6e-10   
ref|XP_006474579.1|  PREDICTED: kinesin-like protein NACK2-like       68.9    6e-10   
ref|XP_009149278.1|  PREDICTED: kinesin-like protein NACK1            68.9    6e-10   
ref|XP_010477014.1|  PREDICTED: kinesin-like protein NACK1            68.9    6e-10   
ref|XP_010498223.1|  PREDICTED: kinesin-like protein NACK1            68.9    6e-10   
emb|CDY26167.1|  BnaA06g12500D                                        68.9    6e-10   
ref|XP_006416611.1|  hypothetical protein EUTSA_v10006702mg           68.9    6e-10   
ref|NP_173273.2|  kinesin HINKEL                                      68.6    7e-10   
ref|XP_002893000.1|  hypothetical protein ARALYDRAFT_472057           68.6    7e-10   
ref|XP_006303901.1|  hypothetical protein CARUB_v10008207mg           68.6    7e-10   
ref|XP_003568740.1|  PREDICTED: kinesin-like protein NACK1            68.6    8e-10   
gb|AAF25984.1|AC013354_3  F15H18.12                                   68.6    8e-10   
ref|XP_002437695.1|  hypothetical protein SORBIDRAFT_10g001010        68.2    1e-09   
ref|XP_006381563.1|  TETRASPORE family protein                        68.2    1e-09   
ref|XP_011039916.1|  PREDICTED: kinesin-like protein NACK2            67.8    1e-09   
gb|AAK91813.1|AF272750_1  kinesin heavy chain                         67.0    2e-09   
gb|AFW86156.1|  LOW QUALITY PROTEIN: kinesin heavy chain              67.0    2e-09   
ref|XP_010922342.1|  PREDICTED: kinesin-like protein NACK1            67.0    2e-09   
ref|XP_008659376.1|  PREDICTED: kinesin-like protein NACK1            67.0    3e-09   
gb|ACL52849.1|  unknown                                               66.6    3e-09   
gb|EMS62599.1|  Kinesin-related protein 4                             66.6    3e-09   
ref|XP_010227940.1|  PREDICTED: kinesin-like protein NACK1            66.2    5e-09   



>ref|XP_009767346.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009767347.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Nicotiana sylvestris]
Length=907

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 82/125 (66%), Gaps = 2/125 (2%)
 Frame = -3

Query  508  KLCSGTKDAKPNSEKQLY-QLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEM  332
            K+C+  + AK   EKQ    L+ + E I KE      G+ +     S  +PS  S EFE 
Sbjct  677  KICTEAEVAKSVPEKQSGDNLVQDNEPISKEL-GNFIGDSVNSENESELSPSRQSTEFEK  735

Query  331  KMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDG  152
            + +E+ ELWD C  PLVHRTYFFLLFKGDP+D VYMEVELRRL +LKN +S GA+V+ DG
Sbjct  736  QRQEIIELWDACNVPLVHRTYFFLLFKGDPTDSVYMEVELRRLTYLKNAFSLGAKVVKDG  795

Query  151  QVLTK  137
            Q+ ++
Sbjct  796  QIFSQ  800



>ref|XP_009767348.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Nicotiana sylvestris]
Length=905

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 81/124 (65%), Gaps = 2/124 (2%)
 Frame = -3

Query  508  KLCSGTKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMK  329
            K+C+  + AK   EKQ    L + E I KE      G+ +     S  +PS  S EFE +
Sbjct  677  KICTEAEVAKSVPEKQSGDNL-DNEPISKEL-GNFIGDSVNSENESELSPSRQSTEFEKQ  734

Query  328  MKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQ  149
             +E+ ELWD C  PLVHRTYFFLLFKGDP+D VYMEVELRRL +LKN +S GA+V+ DGQ
Sbjct  735  RQEIIELWDACNVPLVHRTYFFLLFKGDPTDSVYMEVELRRLTYLKNAFSLGAKVVKDGQ  794

Query  148  VLTK  137
            + ++
Sbjct  795  IFSQ  798



>ref|XP_006342006.1| PREDICTED: kinesin-like protein NACK2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342007.1| PREDICTED: kinesin-like protein NACK2-like isoform X2 [Solanum 
tuberosum]
Length=924

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = -3

Query  544  LLNEDAKTMLEKKLCSGTKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQ  365
            +L ED+      K+C+  + AK   EKQ    L +  E   +     AG+ L     S  
Sbjct  688  MLGEDST-----KICAEGEVAKSVPEKQSGDNLVQDNEPTSKDLGNFAGDSLNSENESEL  742

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            +PS   +EFE + +E+ ELW+ C  PLVHRTYFFLLFKGDP+D VYMEVELRRL +LKN 
Sbjct  743  SPSRQWMEFEKQRQEIIELWNACNVPLVHRTYFFLLFKGDPTDSVYMEVELRRLSYLKNA  802

Query  184  WSQGAEVITDGQVLTK  137
            +S GA+V+ DGQ+ ++
Sbjct  803  FSLGAKVVKDGQIFSQ  818



>ref|XP_009587868.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
 ref|XP_009587869.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=907

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = -3

Query  505  LCSGTKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKM  326
            +C+  + AK   EKQ    L + E I KE      G+ +     S  +PS  S EFE + 
Sbjct  680  ICTEAEVAKSVPEKQSGDTL-DNEPISKEL-GNFIGDSVNSENESELSPSRQSTEFEKQR  737

Query  325  KEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQV  146
            +E+ ELWD C  PLVHRTYFFLLFKGDP+D VYMEVELRRL +LKN +S GA+V+ DGQ+
Sbjct  738  QEIIELWDACNVPLVHRTYFFLLFKGDPTDSVYMEVELRRLSYLKNAFSLGAKVVKDGQI  797

Query  145  LTKPERYFSL  116
             ++     +L
Sbjct  798  FSQAASLSAL  807



>ref|XP_004238322.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
 ref|XP_010320414.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
Length=926

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 80/124 (65%), Gaps = 0/124 (0%)
 Frame = -3

Query  508  KLCSGTKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMK  329
            K+C+  + AK   EKQ    L + +E   +     A + L     S  +PS   +EFE +
Sbjct  697  KICAEGEVAKSVPEKQSGDNLVQDDEHTSKDLGNFAADSLNSENESELSPSRQWMEFEKQ  756

Query  328  MKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQ  149
             +E+ ELW+ C  PLVHRTYFFLLFKGDP+D VYMEVELRRL +LKN +S GA+V+ DGQ
Sbjct  757  RQEIIELWNACNVPLVHRTYFFLLFKGDPTDSVYMEVELRRLSYLKNAFSLGAKVVKDGQ  816

Query  148  VLTK  137
            + ++
Sbjct  817  IFSQ  820



>ref|XP_006342008.1| PREDICTED: kinesin-like protein NACK2-like isoform X3 [Solanum 
tuberosum]
Length=922

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 86/136 (63%), Gaps = 7/136 (5%)
 Frame = -3

Query  544  LLNEDAKTMLEKKLCSGTKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQ  365
            +L ED+      K+C+  + AK   EKQ    L + E   K+     AG+ L     S  
Sbjct  688  MLGEDST-----KICAEGEVAKSVPEKQSGDNL-DNEPTSKDL-GNFAGDSLNSENESEL  740

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            +PS   +EFE + +E+ ELW+ C  PLVHRTYFFLLFKGDP+D VYMEVELRRL +LKN 
Sbjct  741  SPSRQWMEFEKQRQEIIELWNACNVPLVHRTYFFLLFKGDPTDSVYMEVELRRLSYLKNA  800

Query  184  WSQGAEVITDGQVLTK  137
            +S GA+V+ DGQ+ ++
Sbjct  801  FSLGAKVVKDGQIFSQ  816



>ref|XP_010933747.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=961

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 80/139 (58%), Gaps = 14/139 (10%)
 Frame = -3

Query  553  FTTLLNEDAKTMLEKKLCSGTKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATV  374
            F   L E AK   +K+ C+G ++ +PN+           E+I  E    V   GL     
Sbjct  721  FVAELKEMAKVQHQKQ-CTGGQEVEPNAN----------EDIGAE--GTVRSIGLYTILD  767

Query  373  SHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFL  194
              Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FL
Sbjct  768  PFQSPSRWLLEFERKQQEIIELWHACNVSLVHRTYFFLLFKGDPTDSIYMEVELRRLSFL  827

Query  193  KNKWSQG-AEVITDGQVLT  140
            KN +SQG  +   DG  +T
Sbjct  828  KNTYSQGNLDKTADGSQIT  846



>ref|XP_009378198.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Pyrus x bretschneideri]
Length=945

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 94/181 (52%), Gaps = 22/181 (12%)
 Frame = -3

Query  679  EDFQKNEPKEDFNARQEECSGRQEERDETTQLMGDTTASEPCFTTLLNEDAKTMLEKKLC  500
            E FQK  P  ++ A  E  S     R   +  +GD+ A          +D K+  + K+ 
Sbjct  674  EGFQKKLPSLNYGAETESLS-----RTARSAAIGDSKA----------QDTKSTADDKIT  718

Query  499  SGTKDAKPNSEKQLY-QLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMK  323
                +++ N+  QL   ++ E + +       V   GL    +  + PS    EF    +
Sbjct  719  ----ESQCNT--QLADSMVLETDSMPIPSPRDVKDVGLDPMPIDDENPSRWPSEFNKLQR  772

Query  322  EVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQVL  143
            E+ ELWD C   LVHRTYFFLLFKGDPSD +YMEVELRRL FLK+ +S+G +   DGQ L
Sbjct  773  EIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLSFLKDTFSRGNQTFEDGQTL  832

Query  142  T  140
            T
Sbjct  833  T  833



>ref|XP_009338641.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Pyrus x bretschneideri]
Length=945

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL    +  + PS  + EF    +E+ ELWD C   LVHRTYFFLLFKGDPSD +YMEVE
Sbjct  749  GLDPMPIDDENPSRWTSEFNKLQREIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVE  808

Query  214  LRRLHFLKNKWSQGAEVITDGQVLT  140
            LRRL FLK+ +S+G +   DGQ LT
Sbjct  809  LRRLSFLKDTFSRGNQTFEDGQTLT  833



>ref|XP_009338640.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Pyrus x bretschneideri]
Length=976

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL    +  + PS  + EF    +E+ ELWD C   LVHRTYFFLLFKGDPSD +YMEVE
Sbjct  780  GLDPMPIDDENPSRWTSEFNKLQREIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVE  839

Query  214  LRRLHFLKNKWSQGAEVITDGQVLT  140
            LRRL FLK+ +S+G +   DGQ LT
Sbjct  840  LRRLSFLKDTFSRGNQTFEDGQTLT  864



>ref|XP_010672217.1| PREDICTED: kinesin-like protein NACK2 [Beta vulgaris subsp. vulgaris]
Length=1052

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = -3

Query  388  AVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELR  209
            A++TV  Q+P     EFE +  ++ +LW  C+ PLVHRTYF+LLFKGDPSD +YMEVELR
Sbjct  861  AMSTV--QSPLNWFEEFESQRFKIIQLWHACHIPLVHRTYFYLLFKGDPSDKIYMEVELR  918

Query  208  RLHFLKNKWSQGAEVITDGQVLT  140
            RL F+KN++ QG +++ DGQ+ T
Sbjct  919  RLSFIKNRFDQGQKIVMDGQIYT  941



>ref|XP_008372766.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
 ref|XP_008372767.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=963

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 91/183 (50%), Gaps = 8/183 (4%)
 Frame = -3

Query  679  EDFQKNEPKEDFNARQEECSGRQEERDETTQLMGDTTASEPCFTTLLNEDAKTMLEKKLC  500
            E FQK  P  ++ A  E  S    +    +  + D+ A +   T     D K      L 
Sbjct  674  EGFQKKLPSLNYGAETESLSRNASQASARSAAIXDSKAQDTKSTA----DDKITESTTLV  729

Query  499  SGTK---DAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMK  329
             GT+   D + N++     ++ E +         V   GL    +  + PS    EF   
Sbjct  730  EGTEETTDTQCNTQFS-DSMVPETDSKPIPSLRDVKDVGLDPMPIDDENPSRWPSEFNKL  788

Query  328  MKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQ  149
             +E+ ELWD C   LVHRTYFFLLFKGDPSD +YMEVELRRL FLK+ + +G + + DGQ
Sbjct  789  QREIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLSFLKDTFXRGNQTLEDGQ  848

Query  148  VLT  140
             LT
Sbjct  849  TLT  851



>ref|XP_009378197.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Pyrus x bretschneideri]
Length=976

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL    +  + PS    EF    +E+ ELWD C   LVHRTYFFLLFKGDPSD +YMEVE
Sbjct  780  GLDPMPIDDENPSRWPSEFNKLQREIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVE  839

Query  214  LRRLHFLKNKWSQGAEVITDGQVLT  140
            LRRL FLK+ +S+G +   DGQ LT
Sbjct  840  LRRLSFLKDTFSRGNQTFEDGQTLT  864



>ref|XP_009345268.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009345269.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009345270.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=928

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EFE K + VFELW  CY  +VHRTYFFLLFKGDP+D +YMEVELRRL FLK  +S+G +
Sbjct  750  LEFERKQRAVFELWQTCYISVVHRTYFFLLFKGDPTDSIYMEVELRRLSFLKETFSRGDQ  809

Query  166  VITDGQVLT  140
             + +GQ LT
Sbjct  810  AVENGQALT  818



>ref|XP_007042026.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
 gb|EOX97857.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
Length=965

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            TP    +EFE + + +FELW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLK  
Sbjct  781  TPLDWPLEFERQQRAIFELWQACNVSLVHRTYFFLLFKGDPTDSIYMEVELRRLTFLKET  840

Query  184  WSQGAEVITDGQVLT  140
            +SQG + + DG+ LT
Sbjct  841  FSQGNQAVEDGRTLT  855



>ref|XP_010494185.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=1247

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = -3

Query  496   GTKDAKPN-SEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKE  320
             GT DA  N SE++    L E E+  +  F   + E L +A  S+   S  S +FE + ++
Sbjct  1023  GTTDATNNQSEREQADDLVEEEKPKETDFTAASLEKLQIA--SNGQHSTNSSDFERQRRQ  1080

Query  319   VFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV--ITDGQV  146
             + ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK   S   E   I   + 
Sbjct  1081  IIELWGVCNVPLVHRTYFFLLFKGDPSDYVYMEVELRRLSFLKQTMSNDMEASRIQTVKA  1140

Query  145   LTKPERYFS  119
             LT+ + + S
Sbjct  1141  LTREKEWLS  1149



>ref|XP_010240187.1| PREDICTED: kinesin-like protein NACK1 isoform X3 [Brachypodium 
distachyon]
Length=823

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  CYA LVHRTYFFLLFKGDP+D +YMEVE+RRL FLK+
Sbjct  634  QSPSRWPLEFEKKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRLSFLKD  693

Query  187  KWSQGA  170
             +S+G 
Sbjct  694  TYSKGG  699



>ref|XP_010240186.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Brachypodium 
distachyon]
Length=940

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  CYA LVHRTYFFLLFKGDP+D +YMEVE+RRL FLK+
Sbjct  751  QSPSRWPLEFEKKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRLSFLKD  810

Query  187  KWSQGA  170
             +S+G 
Sbjct  811  TYSKGG  816



>ref|XP_010240185.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brachypodium 
distachyon]
Length=951

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  CYA LVHRTYFFLLFKGDP+D +YMEVE+RRL FLK+
Sbjct  762  QSPSRWPLEFEKKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRLSFLKD  821

Query  187  KWSQGA  170
             +S+G 
Sbjct  822  TYSKGG  827



>ref|XP_010028653.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Eucalyptus 
grandis]
Length=809

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  385  VATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRR  206
            VA+ +   P    +EFE K + +  LW  C  PLVHRTYFFLLF+GDP+D +YMEVELRR
Sbjct  617  VASDALTNPLDWPLEFERKQRSILVLWQICSVPLVHRTYFFLLFRGDPADSIYMEVELRR  676

Query  205  LHFLKNKWSQGAEVITDGQVLT  140
            L FLK  ++ G   + DG+VLT
Sbjct  677  LTFLKETFASGGHAVADGRVLT  698



>ref|XP_011083601.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011083602.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=913

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = -3

Query  373  SHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFL  194
            + Q+ S    EF+ + KE+ ELWD C+ PLVHRTYFFLLFKGDPSD VY+EVELRRL FL
Sbjct  727  TEQSASDWQTEFQRQKKEIIELWDACHTPLVHRTYFFLLFKGDPSDAVYLEVELRRLQFL  786

Query  193  KNKWSQGAEVITDGQ  149
            KN    GA V+ D Q
Sbjct  787  KNTLHGGA-VLKDDQ  800



>ref|XP_010028651.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55426.1| hypothetical protein EUGRSUZ_I01329 [Eucalyptus grandis]
Length=928

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  385  VATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRR  206
            VA+ +   P    +EFE K + +  LW  C  PLVHRTYFFLLF+GDP+D +YMEVELRR
Sbjct  736  VASDALTNPLDWPLEFERKQRSILVLWQICSVPLVHRTYFFLLFRGDPADSIYMEVELRR  795

Query  205  LHFLKNKWSQGAEVITDGQVLT  140
            L FLK  ++ G   + DG+VLT
Sbjct  796  LTFLKETFASGGHAVADGRVLT  817



>gb|KDO49884.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=841

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TP    +EFE + +E+F+LW  C   LVHRTYFFLLF+GDPSD +YM VEL+RL FLK 
Sbjct  655  ETPENWPVEFERQRRELFQLWQTCNVSLVHRTYFFLLFRGDPSDSIYMGVELKRLSFLKE  714

Query  187  KWSQGAEVITDGQVLT  140
             +SQG   + DG+VL+
Sbjct  715  SFSQGNMAMQDGRVLS  730



>ref|XP_006423484.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423485.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36724.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36725.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=843

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TP    +EFE + +E+F+LW  C   LVHRTYFFLLF+GDPSD +YM VEL+RL FLK 
Sbjct  657  ETPENWPVEFERQRRELFQLWQTCNVSLVHRTYFFLLFRGDPSDSIYMGVELKRLSFLKE  716

Query  187  KWSQGAEVITDGQVLT  140
             +SQG   + DG+VL+
Sbjct  717  SFSQGNMAMQDGRVLS  732



>dbj|BAJ94998.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=873

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  CYA LVHRTYFFLLFKGDP+D +YMEVE+RRL FLK+
Sbjct  684  QSPSRWPLEFERKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRLSFLKD  743

Query  187  KWSQGA  170
             ++ G 
Sbjct  744  TYANGG  749



>gb|EMS68002.1| Kinesin-related protein 11 [Triticum urartu]
Length=928

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  CYA LVHRTYFFLLFKGDP+D +YMEVE+RRL FLK+
Sbjct  739  QSPSRWPLEFERKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRLSFLKD  798

Query  187  KWSQGA  170
             ++ G 
Sbjct  799  TYANGG  804



>dbj|BAJ95863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=936

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  CYA LVHRTYFFLLFKGDP+D +YMEVE+RRL FLK+
Sbjct  747  QSPSRWPLEFERKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRLSFLKD  806

Query  187  KWSQGA  170
             ++ G 
Sbjct  807  TYANGG  812



>ref|XP_006423481.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36721.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=960

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TP    +EFE + +E+F+LW  C   LVHRTYFFLLF+GDPSD +YM VEL+RL FLK 
Sbjct  774  ETPENWPVEFERQRRELFQLWQTCNVSLVHRTYFFLLFRGDPSDSIYMGVELKRLSFLKE  833

Query  187  KWSQGAEVITDGQVLT  140
             +SQG   + DG+VL+
Sbjct  834  SFSQGNMAMQDGRVLS  849



>ref|XP_006423482.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423483.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423486.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36722.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36723.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36726.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=962

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TP    +EFE + +E+F+LW  C   LVHRTYFFLLF+GDPSD +YM VEL+RL FLK 
Sbjct  776  ETPENWPVEFERQRRELFQLWQTCNVSLVHRTYFFLLFRGDPSDSIYMGVELKRLSFLKE  835

Query  187  KWSQGAEVITDGQVLT  140
             +SQG   + DG+VL+
Sbjct  836  SFSQGNMAMQDGRVLS  851



>ref|XP_006487377.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487378.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006487379.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
 ref|XP_006487380.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Citrus 
sinensis]
 ref|XP_006487381.1| PREDICTED: kinesin-like protein NACK1-like isoform X5 [Citrus 
sinensis]
 ref|XP_006487382.1| PREDICTED: kinesin-like protein NACK1-like isoform X6 [Citrus 
sinensis]
 ref|XP_006487383.1| PREDICTED: kinesin-like protein NACK1-like isoform X7 [Citrus 
sinensis]
 ref|XP_006487384.1| PREDICTED: kinesin-like protein NACK1-like isoform X8 [Citrus 
sinensis]
Length=962

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TP    +EFE + +E+F+LW  C   LVHRTYFFLLF+GDPSD +YM VEL+RL FLK 
Sbjct  776  ETPENWPVEFERQRRELFQLWQTCNVSLVHRTYFFLLFRGDPSDSIYMGVELKRLSFLKE  835

Query  187  KWSQGAEVITDGQVLT  140
             +SQG   + DG+VL+
Sbjct  836  SFSQGNMAMQDGRVLS  851



>ref|XP_006487385.1| PREDICTED: kinesin-like protein NACK1-like isoform X9 [Citrus 
sinensis]
Length=960

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TP    +EFE + +E+F+LW  C   LVHRTYFFLLF+GDPSD +YM VEL+RL FLK 
Sbjct  774  ETPENWPVEFERQRRELFQLWQTCNVSLVHRTYFFLLFRGDPSDSIYMGVELKRLSFLKE  833

Query  187  KWSQGAEVITDGQVLT  140
             +SQG   + DG+VL+
Sbjct  834  SFSQGNMAMQDGRVLS  849



>gb|KDO49879.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49880.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49881.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49882.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=960

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TP    +EFE + +E+F+LW  C   LVHRTYFFLLF+GDPSD +YM VEL+RL FLK 
Sbjct  774  ETPENWPVEFERQRRELFQLWQTCNVSLVHRTYFFLLFRGDPSDSIYMGVELKRLSFLKE  833

Query  187  KWSQGAEVITDGQVLT  140
             +SQG   + DG+VL+
Sbjct  834  SFSQGNMAMQDGRVLS  849



>ref|XP_010649060.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649061.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649062.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649063.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649064.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649065.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649066.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649067.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649068.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649069.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 emb|CBI17403.3| unnamed protein product [Vitis vinifera]
Length=973

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            +PS    EF+   KE+ ELW  C   LVHRTYFFLLF+GDP+D +YMEVELRRL FLK+ 
Sbjct  789  SPSRWPFEFKRLQKEIIELWHSCNVSLVHRTYFFLLFQGDPADSIYMEVELRRLSFLKDT  848

Query  184  WSQGAEVITDGQVLT  140
            +S+G + + DG  LT
Sbjct  849  FSRGNQTVVDGHALT  863



>ref|XP_007201806.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
 gb|EMJ03005.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
Length=926

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            ++FE + + + ELW+ CY  +VHRTYFFLLFKGDP+D +YMEVELRRL FLK  +S+G  
Sbjct  748  LKFERQQRAILELWETCYISVVHRTYFFLLFKGDPTDSIYMEVELRRLSFLKETFSRGDH  807

Query  166  VITDGQVLTKPE--RYFSLPLSLHSSCAHTIAKEH*NDQVFYLFSTALKHSRRR  11
             + DGQ LT     R       + S        E    ++F  +  AL   RRR
Sbjct  808  AVEDGQALTLASSIRAIGRERQMLSKLMQKRFSEEERMRLFQKWGVALNSKRRR  861



>gb|KDO49883.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=920

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TP    +EFE + +E+F+LW  C   LVHRTYFFLLF+GDPSD +YM VEL+RL FLK 
Sbjct  734  ETPENWPVEFERQRRELFQLWQTCNVSLVHRTYFFLLFRGDPSDSIYMGVELKRLSFLKE  793

Query  187  KWSQGAEVITDGQVLT  140
             +SQG   + DG+VL+
Sbjct  794  SFSQGNMAMQDGRVLS  809



>ref|XP_008236841.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
 ref|XP_008236842.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
Length=926

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            ++FE + + + ELW+ CY  +VHRTYFFLLFKGDP+D +YMEVELRRL FLK  +S+G  
Sbjct  748  LKFERQQRAILELWETCYISVVHRTYFFLLFKGDPTDSIYMEVELRRLSFLKETFSRGDH  807

Query  166  VITDGQVLT  140
             + DGQ LT
Sbjct  808  AVEDGQALT  816



>ref|XP_008241798.1| PREDICTED: kinesin-like protein NACK1 [Prunus mume]
Length=960

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            ++PS    EF    +E+ ELWD C   LVHRTYFFLLFKGDPSD +YMEVE RRL FLK+
Sbjct  775  ESPSMWPSEFNRLQREIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVEHRRLSFLKD  834

Query  187  KWSQGAEVITDGQVLT  140
             +++G + + DGQ +T
Sbjct  835  TFARGNQTLEDGQTIT  850



>ref|XP_002301999.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE81272.2| kinesin motor family protein [Populus trichocarpa]
Length=915

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -3

Query  382  ATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRL  203
            A+  H   ++  +++E   +++ ELW  C  PLVHR+YFFLLFKGDPSD VYMEVELRRL
Sbjct  729  ASTRHHHSNW-QVKYERYRRKIIELWFRCNVPLVHRSYFFLLFKGDPSDNVYMEVELRRL  787

Query  202  HFLKNKWSQGAEVITDGQV  146
            +FLK+ +S GA  I DG++
Sbjct  788  YFLKDTFSSGANTIIDGKI  806



>ref|XP_010647602.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647606.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647611.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647615.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647617.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647621.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 emb|CAN75924.1| hypothetical protein VITISV_029516 [Vitis vinifera]
 emb|CBI37987.3| unnamed protein product [Vitis vinifera]
Length=969

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 67/114 (59%), Gaps = 2/114 (2%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EFE + +E+ ELW  C   L+HRTYFFLLF+GDP D +YMEVELRRL FLK  +SQG +
Sbjct  791  LEFERQQREIIELWQTCNVSLIHRTYFFLLFRGDPMDSIYMEVELRRLSFLKETFSQGNQ  850

Query  166  VITDGQVLTKPERYFSLPLSLH--SSCAHTIAKEH*NDQVFYLFSTALKHSRRR  11
             + DG+ LT+     +L       S   H    E   +++F  +   L   RRR
Sbjct  851  SLEDGRTLTQASSIRALRRERETLSKLMHKRFSEGERNRLFQKWGIKLDSKRRR  904



>ref|XP_011028953.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Populus euphratica]
Length=915

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -3

Query  382  ATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRL  203
            A+  H   ++  +++E   +++ ELW  C  PLVHR+YFFLLFKGDPSD VYMEVELRRL
Sbjct  729  ASTRHHHSNW-QVKYERYRRKIIELWFRCNVPLVHRSYFFLLFKGDPSDNVYMEVELRRL  787

Query  202  HFLKNKWSQGAEVITDGQV  146
            +FLK+ +S GA  I DG++
Sbjct  788  YFLKDTFSSGANTIIDGKI  806



>ref|XP_011028954.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Populus euphratica]
Length=912

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -3

Query  382  ATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRL  203
            A+  H   ++  +++E   +++ ELW  C  PLVHR+YFFLLFKGDPSD VYMEVELRRL
Sbjct  726  ASTRHHHSNW-QVKYERYRRKIIELWFRCNVPLVHRSYFFLLFKGDPSDNVYMEVELRRL  784

Query  202  HFLKNKWSQGAEVITDGQV  146
            +FLK+ +S GA  I DG++
Sbjct  785  YFLKDTFSSGANTIIDGKI  803



>gb|EMT24668.1| Kinesin-related protein 11 [Aegilops tauschii]
Length=833

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  CYA LVHRTYFFLLFKGDP+D +YMEVE+RRL FLK+
Sbjct  644  QSPSRWPLEFERKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRLSFLKD  703

Query  187  KWSQGA  170
             +  G 
Sbjct  704  TYGNGG  709



>ref|XP_007203241.1| hypothetical protein PRUPE_ppa001146mg [Prunus persica]
 gb|EMJ04440.1| hypothetical protein PRUPE_ppa001146mg [Prunus persica]
Length=896

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            ++PS    EF    +E+ ELWD C   LVHRTYFFLLFKGDPSD +YMEVE RRL FLK 
Sbjct  711  ESPSMWPSEFNRLQREIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVEHRRLSFLKE  770

Query  187  KWSQGAEVITDGQVLT  140
             +++G + + DGQ +T
Sbjct  771  TFARGNQTLEDGQTIT  786



>gb|KHN39844.1| Centromere-associated protein E [Glycine soja]
Length=889

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            TP   S++F+   KE+ ELW  C  PL HRTYFFLLF+GDPSD +YMEVELRRL FLK  
Sbjct  705  TPLDWSLQFKRHQKEIIELWQSCCVPLTHRTYFFLLFRGDPSDSIYMEVELRRLSFLKES  764

Query  184  WSQGAEVITDGQVLT  140
            +S G + + D Q +T
Sbjct  765  FSDGNKSVRDSQTIT  779



>gb|KHN25430.1| Centromere-associated protein E [Glycine soja]
Length=909

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            ++P   S++F+ + KE+ ELW  C  PL HRTYFFLLF+GDP+D +YMEVELRRL FLK 
Sbjct  724  RSPLDWSLQFKRQQKEIIELWQSCCVPLTHRTYFFLLFRGDPTDSIYMEVELRRLSFLKE  783

Query  187  KWSQGAEVITDGQVLT  140
             +S G + ++D Q +T
Sbjct  784  SFSDGNQSVSDSQTIT  799



>ref|XP_008663419.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
 ref|XP_008663420.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
 gb|ACN34614.1| unknown [Zea mays]
 gb|AFW59004.1| kinesin heavy chain [Zea mays]
Length=939

 Score = 99.0 bits (245),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  750  QSPSRWPLEFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  809

Query  187  KWSQGA  170
             +S G+
Sbjct  810  TYSNGS  815



>ref|XP_008663418.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 gb|AFW59005.1| hypothetical protein ZEAMMB73_363128 [Zea mays]
Length=944

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  750  QSPSRWPLEFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  809

Query  187  KWSQGA  170
             +S G+
Sbjct  810  TYSNGS  815



>gb|AAK91822.1|AF272759_1 kinesin heavy chain [Zea mays]
Length=897

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  708  QSPSRWPLEFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  767

Query  187  KWSQGA  170
             +S G+
Sbjct  768  TYSNGS  773



>emb|CDP07439.1| unnamed protein product [Coffea canephora]
Length=937

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -3

Query  373  SHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFL  194
            S ++PS  SI+FE +  E+ +LWD C  PLVHRTYFFL+FKGDPSD +YMEVELRRL FL
Sbjct  756  SQKSPSDWSIQFEKQRAEIIQLWDACDIPLVHRTYFFLVFKGDPSDSIYMEVELRRLSFL  815

Query  193  KNKWSQGAEVITDGQ  149
            K   SQ    + +GQ
Sbjct  816  KA--SQQTNTVKNGQ  828



>ref|XP_008669086.1| PREDICTED: kinesin-like protein NACK1 isoform X4 [Zea mays]
Length=818

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   ++FE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  629  QSPSRWPLDFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  688

Query  187  KWSQGA  170
             +S G+
Sbjct  689  TYSNGS  694



>tpg|DAA36662.1| TPA: hypothetical protein ZEAMMB73_386599 [Zea mays]
Length=808

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   ++FE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  619  QSPSRWPLDFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  678

Query  187  KWSQGA  170
             +S G+
Sbjct  679  TYSNGS  684



>ref|XP_009386197.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=941

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 106/212 (50%), Gaps = 27/212 (13%)
 Frame = -3

Query  706  NVEATNE-PKEDFQKNEPKEDFNARQEECSGRQEERDETTQLMGDTTASEPCFT--TLLN  536
            NVE   E P+E F K  P      R    + R +  +E   + G + ASE   +  T+  
Sbjct  644  NVEQGKETPQETFLKESP-----GRPRLSALRYDVENEKHSVEG-SQASEKLTSNDTIQT  697

Query  535  EDAKTM---LEKKLC---SGTKDA-KPNSEKQL--YQLLYEAEEIHKEFFAQVAGEGLAV  383
            ED KT+    +  L    SGT +  + +  KQL  YQ  +EA    K     V   G+  
Sbjct  698  EDIKTVHGEADANLSTSFSGTNEMDECHCHKQLPSYQTWWEAHGAEK----NVKDVGVEA  753

Query  382  ATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRL  203
                +++PS   +EFE K +E+ ELW  C  PLVHRT FFL+FKGDP+D +YMEVE RRL
Sbjct  754  VLSPYESPSRRPLEFERKRQEIIELWHACNVPLVHRTCFFLVFKGDPADSIYMEVECRRL  813

Query  202  HFLKNKWSQ---GAEVITDGQ--VLTKPERYF  122
             FL+N +S    G  V  DG    L    RY 
Sbjct  814  SFLRNAFSHGKAGGVVAEDGHRVSLASSSRYL  845



>ref|XP_007131749.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
 gb|ESW03743.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
Length=891

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            TP   S++F  + KE+ ELW  C  PL HRTYFFLLF+GDP+D +YMEVELRRL FLK  
Sbjct  707  TPLDWSLQFSRQQKEIIELWQSCCVPLTHRTYFFLLFRGDPTDSIYMEVELRRLSFLKET  766

Query  184  WSQGAEVITDGQVLT  140
            +S G + + D Q +T
Sbjct  767  FSDGNQSVRDSQTIT  781



>ref|XP_008669084.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
Length=934

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   ++FE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  758  QSPSRWPLDFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  817

Query  187  KWSQGA  170
             +S G+
Sbjct  818  TYSNGS  823



>ref|XP_007131750.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
 gb|ESW03744.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
Length=892

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            TP   S++F  + KE+ ELW  C  PL HRTYFFLLF+GDP+D +YMEVELRRL FLK  
Sbjct  708  TPLDWSLQFSRQQKEIIELWQSCCVPLTHRTYFFLLFRGDPTDSIYMEVELRRLSFLKET  767

Query  184  WSQGAEVITDGQVLT  140
            +S G + + D Q +T
Sbjct  768  FSDGNQSVRDSQTIT  782



>ref|XP_008669081.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 ref|XP_008669082.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 ref|XP_008669083.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
Length=947

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   ++FE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  758  QSPSRWPLDFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  817

Query  187  KWSQGA  170
             +S G+
Sbjct  818  TYSNGS  823



>tpg|DAA36661.1| TPA: hypothetical protein ZEAMMB73_386599 [Zea mays]
Length=937

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   ++FE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  748  QSPSRWPLDFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  807

Query  187  KWSQGA  170
             +S G+
Sbjct  808  TYSNGS  813



>ref|XP_008382370.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Malus 
domestica]
Length=929

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EFE + + +FELW  C+  +VHRTYFFLLFKGDP+D +YMEVELRRL FL+  +S+G +
Sbjct  751  LEFERQQRAIFELWQTCHISVVHRTYFFLLFKGDPTDSIYMEVELRRLSFLEETFSRGDQ  810

Query  166  VITDGQVLT  140
             + +GQ LT
Sbjct  811  AVENGQALT  819



>ref|XP_009378441.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378442.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378443.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378444.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=928

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EFE + + +FELW  C+  +VHRTYFFLLFKGDP+D +YMEVELRRL FL+  +S+G +
Sbjct  750  LEFERQQRAIFELWQTCHISVVHRTYFFLLFKGDPTDSIYMEVELRRLSFLEETFSRGDQ  809

Query  166  VITDGQVLT  140
             + +GQ LT
Sbjct  810  AVENGQALT  818



>ref|XP_006435104.1| hypothetical protein CICLE_v10000097mg [Citrus clementina]
 gb|ESR48344.1| hypothetical protein CICLE_v10000097mg [Citrus clementina]
Length=1104

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLK  191
            EFE + KE+ ELWD CY PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK
Sbjct  931  EFERQRKEIIELWDACYVPLVHRTYFFLLFKGDPSDSVYMEVELRRLSFLK  981



>gb|KDO84747.1| hypothetical protein CISIN_1g001290mg [Citrus sinensis]
Length=1106

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLK  191
            EFE + KE+ ELWD CY PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK
Sbjct  931  EFERQRKEIIELWDACYVPLVHRTYFFLLFKGDPSDSVYMEVELRRLSFLK  981



>ref|XP_006473602.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
Length=1100

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLK  191
            EFE + KE+ ELWD CY PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK
Sbjct  925  EFERQRKEIIELWDACYVPLVHRTYFFLLFKGDPSDSVYMEVELRRLSFLK  975



>gb|KDO84748.1| hypothetical protein CISIN_1g001290mg [Citrus sinensis]
Length=1104

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLK  191
            EFE + KE+ ELWD CY PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK
Sbjct  931  EFERQRKEIIELWDACYVPLVHRTYFFLLFKGDPSDSVYMEVELRRLSFLK  981



>ref|XP_006473600.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
Length=1114

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLK  191
            EFE + KE+ ELWD CY PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK
Sbjct  939  EFERQRKEIIELWDACYVPLVHRTYFFLLFKGDPSDSVYMEVELRRLSFLK  989



>ref|NP_001053433.1| Os04g0538800 [Oryza sativa Japonica Group]
 emb|CAE02777.2| OSJNBa0011L07.1 [Oryza sativa Japonica Group]
 dbj|BAF15347.1| Os04g0538800 [Oryza sativa Japonica Group]
 dbj|BAG95469.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61418.1| hypothetical protein OsJ_15615 [Oryza sativa Japonica Group]
Length=945

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL   T + Q+PS   +EFE K +E+ + W  C   LVHRTYFFLLFKGDP+D +YMEVE
Sbjct  752  GLDPITDALQSPSRWPLEFEKKQQEIIDFWHACNVSLVHRTYFFLLFKGDPADSIYMEVE  811

Query  214  LRRLHFLKNKWSQGA  170
            LRRL FLK+ +S GA
Sbjct  812  LRRLSFLKDTYSNGA  826



>gb|EEC77720.1| hypothetical protein OsI_16807 [Oryza sativa Indica Group]
Length=945

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL   T + Q+PS   +EFE K +E+ + W  C   LVHRTYFFLLFKGDP+D +YMEVE
Sbjct  752  GLDPITDALQSPSRWPLEFEKKQQEIIDFWHACNVSLVHRTYFFLLFKGDPADSIYMEVE  811

Query  214  LRRLHFLKNKWSQGA  170
            LRRL FLK+ +S GA
Sbjct  812  LRRLSFLKDTYSNGA  826



>ref|XP_006473601.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
Length=1112

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLK  191
            EFE + KE+ ELWD CY PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK
Sbjct  939  EFERQRKEIIELWDACYVPLVHRTYFFLLFKGDPSDSVYMEVELRRLSFLK  989



>emb|CAE03025.3| OSJNBa0091D06.23 [Oryza sativa Japonica Group]
Length=915

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL   T + Q+PS   +EFE K +E+ + W  C   LVHRTYFFLLFKGDP+D +YMEVE
Sbjct  722  GLDPITDALQSPSRWPLEFEKKQQEIIDFWHACNVSLVHRTYFFLLFKGDPADSIYMEVE  781

Query  214  LRRLHFLKNKWSQGA  170
            LRRL FLK+ +S GA
Sbjct  782  LRRLSFLKDTYSNGA  796



>ref|XP_010263901.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Nelumbo nucifera]
Length=894

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 97/199 (49%), Gaps = 31/199 (16%)
 Frame = -3

Query  679  EDFQKNEPKEDFNARQEECSGRQEERDE----TTQLMGDTT-------ASEPCFTTLLNE  533
            + FQKN    ++ +  E  SG+  +  E    T +L  D          S   F   L E
Sbjct  692  DGFQKNLSALNYGSNTESLSGKDSQNSEGSASTNELKADNVKTSVEDVTSIQSFVEELKE  751

Query  532  DAKTMLEKKLCSGTKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSY  353
             AK   + +   G ++ +P ++K                   V   GL     S ++PS+
Sbjct  752  MAKLQYDNQAIDG-QETEPKADKS---------------GKTVKDVGLDPVENSSESPSW  795

Query  352  GSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQG  173
              +EFE + KE+ ELW+ C   LVHRTYFFLLF GDP+D +YM+VELRRL FL++ +S G
Sbjct  796  -PLEFERQRKEIIELWNTCNVSLVHRTYFFLLFIGDPADSIYMKVELRRLSFLRDIFSSG  854

Query  172  ---AEVITDGQVLTKPERY  125
                  + DG +L+   RY
Sbjct  855  NLAKHSMVDGCILSPASRY  873



>ref|XP_011037209.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037210.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037211.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037212.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037214.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037215.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
Length=973

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TP    +EFE + + + ELW  C   LVHRTYFFLLF+GDP+D +YMEVELRRL FLK 
Sbjct  786  ETPRNWPLEFERQQRAILELWQTCNVSLVHRTYFFLLFQGDPTDSIYMEVELRRLSFLKE  845

Query  187  KWSQGAEVITDGQVLT  140
             +SQG + +  G+ LT
Sbjct  846  TFSQGNQGVGGGRTLT  861



>ref|XP_002305465.1| kinesin motor family protein [Populus trichocarpa]
 gb|EEE85976.1| kinesin motor family protein [Populus trichocarpa]
Length=842

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TP    +EFE + + + ELW  C   LVHRTYFFLLF+GDP+D +YMEVELRRL FLK 
Sbjct  655  ETPRNWPLEFERQQRAILELWQTCNVSLVHRTYFFLLFQGDPTDSIYMEVELRRLSFLKE  714

Query  187  KWSQGAEVITDGQVLT  140
             +SQG + +  G+ LT
Sbjct  715  TFSQGNQGVGGGRTLT  730



>gb|EYU38855.1| hypothetical protein MIMGU_mgv1a000996mg [Erythranthe guttata]
Length=917

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            IEFE + KE+ ELW+ C+ PLVHRTYFFLLFKGDPSD VY+EVELRRL FLKN
Sbjct  748  IEFERQKKEIIELWNSCHIPLVHRTYFFLLFKGDPSDSVYLEVELRRLSFLKN  800



>ref|XP_002510482.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF52669.1| ATP binding protein, putative [Ricinus communis]
Length=939

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 71/115 (62%), Gaps = 10/115 (9%)
 Frame = -3

Query  484  AKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELW  305
            AKP SE+Q+     EA     + +   AG G      + Q  +   ++FE   +++ ELW
Sbjct  723  AKPQSEEQI-----EASTRTADLWRD-AGRG----NSARQNRANSILKFERYRRKIIELW  772

Query  304  DECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQVLT  140
              C  PLVHR+YFFL+FKGDPSD VY+EVELRRL+FLK+  ++G   + D Q+++
Sbjct  773  ARCNVPLVHRSYFFLIFKGDPSDNVYLEVELRRLYFLKDTSARGTNTLIDTQIVS  827



>ref|XP_010919403.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Elaeis guineensis]
Length=803

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL     S Q+PS   +EFE K +E+ ELW +C   LVHRTYFFLLFKGDP+D +YMEVE
Sbjct  603  GLDPILDSLQSPSRWPLEFERKQQEIIELWHKCDVSLVHRTYFFLLFKGDPTDSIYMEVE  662

Query  214  LRRLHFLKNKWSQG--AEVITDGQVLTKP  134
            LRRL FLK+ +S+    +    GQ LT P
Sbjct  663  LRRLSFLKSAFSREDIDKAAGGGQSLTPP  691



>ref|XP_011074636.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Sesamum indicum]
 ref|XP_011074637.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Sesamum indicum]
Length=989

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+ S  S +FE + +E+ +LWD C  PLV+RTYFFLLFKGDPS+ VYMEVELRRL FLK 
Sbjct  808  QSASDWSTQFERQRQEILDLWDTCNVPLVYRTYFFLLFKGDPSEAVYMEVELRRLSFLKK  867

Query  187  KWSQGAEVITDGQVLT  140
            K  + + V  D QVLT
Sbjct  868  KLDR-STVTKDDQVLT  882



>ref|XP_011074638.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Sesamum indicum]
Length=974

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+ S  S +FE + +E+ +LWD C  PLV+RTYFFLLFKGDPS+ VYMEVELRRL FLK 
Sbjct  793  QSASDWSTQFERQRQEILDLWDTCNVPLVYRTYFFLLFKGDPSEAVYMEVELRRLSFLKK  852

Query  187  KWSQGAEVITDGQVLT  140
            K  + + V  D QVLT
Sbjct  853  KLDR-STVTKDDQVLT  867



>ref|XP_008796871.1| PREDICTED: kinesin-like protein NACK1 [Phoenix dactylifera]
Length=962

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  771  QSPSRWLLEFERKQQEIIELWHACNVSLVHRTYFFLLFKGDPTDSIYMEVELRRLSFLKN  830

Query  187  KWSQ  176
              SQ
Sbjct  831  TCSQ  834



>ref|XP_004976382.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
 ref|XP_004976383.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
Length=946

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLK+
Sbjct  758  QSPSRWPLEFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKD  817

Query  187  KWSQGA  170
             +S G+
Sbjct  818  TYSNGS  823



>gb|KHF98979.1| Kinesin-related 11 [Gossypium arboreum]
Length=949

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            TP +   EFE   + + ELW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLK  
Sbjct  765  TPLHWPQEFERLQRAILELWQACNVSLVHRTYFFLLFKGDPADSIYMEVELRRLTFLKES  824

Query  184  WSQGAEVITDGQVLTKPERYFSL  116
            +S+G +   DG+ LT      SL
Sbjct  825  FSEGNQAAEDGRTLTLASSVRSL  847



>ref|XP_010919401.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Elaeis guineensis]
 ref|XP_010919402.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Elaeis guineensis]
Length=966

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL     S Q+PS   +EFE K +E+ ELW +C   LVHRTYFFLLFKGDP+D +YMEVE
Sbjct  766  GLDPILDSLQSPSRWPLEFERKQQEIIELWHKCDVSLVHRTYFFLLFKGDPTDSIYMEVE  825

Query  214  LRRLHFLKNKWSQG--AEVITDGQVLTKP  134
            LRRL FLK+ +S+    +    GQ LT P
Sbjct  826  LRRLSFLKSAFSREDIDKAAGGGQSLTPP  854



>ref|XP_010481985.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1162

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 73/127 (57%), Gaps = 4/127 (3%)
 Frame = -3

Query  493   TKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVF  314
             T DA   SE++    L E E+  +      + E L +A  S+   S  S +FE + +++ 
Sbjct  940   TTDATNQSEREQADDLVEEEKPKETDSTAASLEKLQLA--SNGQHSTNSSDFERQRRQII  997

Query  313   ELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV--ITDGQVLT  140
             ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK   S   E   I   + LT
Sbjct  998   ELWGVCNVPLVHRTYFFLLFKGDPSDYVYMEVELRRLSFLKQTMSNDMEASRIQTVKALT  1057

Query  139   KPERYFS  119
             + + + S
Sbjct  1058  REKEWLS  1064



>ref|XP_004974128.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
Length=1044

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 66/103 (64%), Gaps = 2/103 (2%)
 Frame = -3

Query  454  QLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHR  275
            QL+ +A          V   G+ +A    ++PS+ +++FE K +++ ELW EC   +VHR
Sbjct  832  QLVMQAIRDESTAMKTVKDVGVDIALSPIESPSHPTVDFEKKQQQIIELWHECNVSIVHR  891

Query  274  TYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQV  146
            TYFFLLF+GDP+D +YMEVE RRL F+KN +S  AE    G++
Sbjct  892  TYFFLLFRGDPADNIYMEVEHRRLSFIKNSFS--AESTAQGEL  932



>gb|KHG01762.1| Kinesin-related 11 [Gossypium arboreum]
Length=909

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -3

Query  400  GEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYME  221
            G GL     +  TP    +EFE   + + ELW  C   LVHRTYFFLLFKGD +D +YME
Sbjct  713  GAGLDPMHEASGTPLDWPLEFERLQRAILELWQACNVSLVHRTYFFLLFKGDRTDSIYME  772

Query  220  VELRRLHFLKNKWSQGAEVITDGQVLT  140
            VE+RRL FLK  +SQG + + DG+ LT
Sbjct  773  VEIRRLTFLKETFSQGNQAVEDGRTLT  799



>ref|XP_010445916.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=228

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -3

Query  379  TVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLH  200
            T S+   S  S +FE + +++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL 
Sbjct  42   TASNGQHSTNSSDFERQRRQIIELWGVCNVPLVHRTYFFLLFKGDPSDYVYMEVELRRLS  101

Query  199  FLKNKWSQGAEV--ITDGQVLTKPERYFS  119
            FLK   S   E   I   + LT+ + + S
Sbjct  102  FLKQTMSNDMEASRIQTVKALTREKEWLS  130



>dbj|BAD18096.1| kinesin heavy chain-like protein [Ipomoea batatas]
Length=561

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -3

Query  361  PSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKW  182
            PS   +EFE   K + ELW  C   L+HRTYFFLLFKGDP D +YMEVE+RRL FLK  +
Sbjct  487  PSDWPLEFERLQKRIIELWQTCNVSLIHRTYFFLLFKGDPMDSIYMEVEVRRLSFLKESF  546

Query  181  SQGAEVITDGQVLT  140
            + G+  +  G++LT
Sbjct  547  ANGSPAVQGGKILT  560



>ref|XP_007017694.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007017695.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14919.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14920.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
Length=1062

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q  S  + EFE + +++ ELWD C  PL+HRTYF LLFKGDPSD VYMEVELRRL F+KN
Sbjct  877  QLHSSWASEFEKQQRKIIELWDACNVPLIHRTYFILLFKGDPSDSVYMEVELRRLSFIKN  936

Query  187  KWSQGAEVITDG  152
              S G    T+ 
Sbjct  937  SMSSGTNARTNS  948



>ref|XP_002448243.1| hypothetical protein SORBIDRAFT_06g023880 [Sorghum bicolor]
 gb|EES12571.1| hypothetical protein SORBIDRAFT_06g023880 [Sorghum bicolor]
Length=941

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  750  QSPSRWPLEFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  809

Query  187  ----KWSQGAEVITDG  152
                  S G  V+  G
Sbjct  810  TTYSNGSMGRNVVVAG  825



>ref|XP_011090438.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=991

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+   +E+ ELW  C   LVHRTYFF+LF+GDPSD +Y+EVELRR+ FLK+K+S G +
Sbjct  813  VEFKRLQQEILELWHACNVSLVHRTYFFMLFRGDPSDAIYLEVELRRMKFLKDKFSHGEK  872

Query  166  VITDGQVLT  140
             I +G+ LT
Sbjct  873  TIVNGRRLT  881



>ref|XP_006599344.1| PREDICTED: kinesin-like protein NACK1-like isoform X5 [Glycine 
max]
Length=866

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+   KE+ ELW  C   LVHRTYFFLLFKGDPSD +YMEVELRRL +LK  + QG + 
Sbjct  691  EFKRLQKEIIELWHACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLFYLKQTFDQGNQT  750

Query  163  ITDGQVLTKPERYF  122
            + DG      +RY 
Sbjct  751  VEDGLTPESSKRYL  764



>gb|KHN41676.1| Kinesin-related protein 4 [Glycine soja]
Length=935

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+   KE+ ELW  C   LVHRTYFFLLFKGDPSD +YMEVELRRL +LK  + QG + 
Sbjct  760  EFKRLQKEIIELWHACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLFYLKQTFDQGNQT  819

Query  163  ITDGQVLTKPERYF  122
            + DG      +RY 
Sbjct  820  VEDGLTPESSKRYL  833



>gb|EEC73688.1| hypothetical protein OsI_08259 [Oryza sativa Indica Group]
Length=217

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKG+ +D +YMEVELRRL FL++
Sbjct  26   QSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRLSFLRD  85

Query  187  KWSQGA  170
             +S+G+
Sbjct  86   TYSRGS  91



>ref|XP_002280678.2| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010664763.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010664764.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
Length=937

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -3

Query  349  SIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA  170
            ++EF+ + +E+  LWD C  PLVHRTYFFLLFKG+  D VYMEVELRRL+FLK  +S G+
Sbjct  756  ALEFKRQQREIIALWDSCNVPLVHRTYFFLLFKGNKLDSVYMEVELRRLYFLKESFSHGS  815

Query  169  EVITDGQVLT  140
              + D Q LT
Sbjct  816  GAVKDDQPLT  825



>ref|XP_006599340.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006599341.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
 ref|XP_006599342.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Glycine 
max]
 ref|XP_006599343.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Glycine 
max]
Length=935

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+   KE+ ELW  C   LVHRTYFFLLFKGDPSD +YMEVELRRL +LK  + QG + 
Sbjct  760  EFKRLQKEIIELWHACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLFYLKQTFDQGNQT  819

Query  163  ITDGQVLTKPERYF  122
            + DG      +RY 
Sbjct  820  VEDGLTPESSKRYL  833



>ref|XP_010531480.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010531481.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010531482.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
Length=830

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE K +E+ ELW  C+  LVHRTYFFLLFKGD +D +Y+ VELRRL FLK+ +SQG + 
Sbjct  655  EFERKRQEILELWQSCHVSLVHRTYFFLLFKGDEADSIYVGVELRRLSFLKDSFSQGTQA  714

Query  163  ITDGQVLT  140
            +  G+ LT
Sbjct  715  VEGGRTLT  722



>ref|NP_001047565.2| Os02g0644400 [Oryza sativa Japonica Group]
 dbj|BAF09479.2| Os02g0644400, partial [Oryza sativa Japonica Group]
Length=204

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKG+ +D +YMEVELRRL FL++
Sbjct  13   QSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRLSFLRD  72

Query  187  KWSQGA  170
             +S+G+
Sbjct  73   TYSRGS  78



>emb|CBI19799.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -3

Query  349  SIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA  170
            ++EF+ + +E+  LWD C  PLVHRTYFFLLFKG+  D VYMEVELRRL+FLK  +S G+
Sbjct  827  ALEFKRQQREIIALWDSCNVPLVHRTYFFLLFKGNKLDSVYMEVELRRLYFLKESFSHGS  886

Query  169  EVITDGQVLT  140
              + D Q LT
Sbjct  887  GAVKDDQPLT  896



>ref|XP_004974129.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Setaria 
italica]
 ref|XP_004974130.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Setaria 
italica]
Length=1028

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            G+ +A    ++PS+ +++FE K +++ ELW EC   +VHRTYFFLLF+GDP+D +YMEVE
Sbjct  836  GVDIALSPIESPSHPTVDFEKKQQQIIELWHECNVSIVHRTYFFLLFRGDPADNIYMEVE  895

Query  214  LRRLHFLKNKWSQGAEVITDGQV  146
             RRL F+KN +S  AE    G++
Sbjct  896  HRRLSFIKNSFS--AESTAQGEL  916



>ref|XP_004974127.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
Length=1045

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            G+ +A    ++PS+ +++FE K +++ ELW EC   +VHRTYFFLLF+GDP+D +YMEVE
Sbjct  853  GVDIALSPIESPSHPTVDFEKKQQQIIELWHECNVSIVHRTYFFLLFRGDPADNIYMEVE  912

Query  214  LRRLHFLKNKWSQGAEVITDGQV  146
             RRL F+KN +S  AE    G++
Sbjct  913  HRRLSFIKNSFS--AESTAQGEL  933



>ref|XP_009389113.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389114.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=947

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS  S+EFE K +E+ +LW +C   LVHRTYF++LFKGDP+D +YMEVELRRL FLK+
Sbjct  760  QSPSVWSLEFEKKQQEIIKLWHDCNVSLVHRTYFYMLFKGDPTDSIYMEVELRRLSFLKS  819

Query  187  KWSQG  173
              S G
Sbjct  820  NLSLG  824



>ref|XP_003538873.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006590716.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
 gb|KHN41913.1| Kinesin-related protein 4 [Glycine soja]
Length=953

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 4/77 (5%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            +F+   +E+ E WD C   LVHRTYFFLLFKG+PSD +YMEVELRRL +LK  +SQG + 
Sbjct  776  KFQRLQREIIEFWDACNVSLVHRTYFFLLFKGEPSDSIYMEVELRRLSYLKQTFSQGNQT  835

Query  163  ITDGQVLTKPE---RYF  122
            + DG+ L  PE   RY 
Sbjct  836  VEDGRTLA-PELSMRYL  851



>ref|XP_010113382.1| Kinesin-related protein 4 [Morus notabilis]
 gb|EXC35389.1| Kinesin-related protein 4 [Morus notabilis]
Length=1016

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+   +E+ E W  C   LVHRTYFFLLF+GDP+D +YMEVE+RRL FLK+ +S+G + 
Sbjct  839  EFKRLQREIIEFWHACNVSLVHRTYFFLLFRGDPTDSIYMEVEMRRLSFLKDTFSRGNQT  898

Query  163  ITDGQVLT  140
            + DG+ LT
Sbjct  899  VEDGRTLT  906



>ref|XP_007156119.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 ref|XP_007156120.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 gb|ESW28113.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 gb|ESW28114.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
Length=961

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 2/78 (3%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+   +E+  LW  C+  LVHRTYFFLLFKGDPSD +YMEVELRRL +LK  +++G E 
Sbjct  784  EFKRLQEEIIGLWHACHVSLVHRTYFFLLFKGDPSDSIYMEVELRRLFYLKQTFAKGNET  843

Query  163  ITDGQVLT--KPERYFSL  116
            + DG++L     +RY  +
Sbjct  844  VEDGRILNPETSQRYLRV  861



>ref|XP_006652585.1| PREDICTED: kinesin-like protein NACK1-like [Oryza brachyantha]
Length=941

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL   T + ++PS   +EFE K +E+ +LW  C   LVHRTYFFLLFKGD +D +YMEVE
Sbjct  750  GLNPITDALRSPSRWPLEFEKKQEEIIDLWHACNVSLVHRTYFFLLFKGDAADSIYMEVE  809

Query  214  LRRLHFLKNKWSQGA  170
            LRRL FLK+ +S GA
Sbjct  810  LRRLTFLKDTYSSGA  824



>gb|KDP38590.1| hypothetical protein JCGZ_04515 [Jatropha curcas]
Length=941

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  373  SHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFL  194
            + Q  S  +++FE   +++ +LW +C  PLVHR+YFFLLFKGDPSD VYMEVELRRL+FL
Sbjct  754  NRQNHSNWAVKFERYRRKIIDLWVKCNVPLVHRSYFFLLFKGDPSDNVYMEVELRRLYFL  813

Query  193  KNKWSQGAEVITDGQVLT  140
            K+  ++G   + D ++++
Sbjct  814  KDTSARGTNAMIDTKIVS  831



>ref|XP_003516550.1| PREDICTED: kinesin-like protein NACK2-like isoform X1 [Glycine 
max]
 ref|XP_006573564.1| PREDICTED: kinesin-like protein NACK2-like isoform X2 [Glycine 
max]
Length=966

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 4/77 (5%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            +F+   +E+ E WD C   LVHRTYFFLLFKG+PSD +YMEVELRRL +L   +SQG + 
Sbjct  789  KFQRLQREIIEFWDACNVSLVHRTYFFLLFKGEPSDSIYMEVELRRLSYLTQTFSQGNQT  848

Query  163  ITDGQVLTKPE---RYF  122
            + DG+ LT PE   RY 
Sbjct  849  VEDGRTLT-PELSMRYL  864



>ref|XP_008791670.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
 ref|XP_008791671.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
Length=975

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 8/88 (9%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLK+
Sbjct  784  QSPSRWPLEFERKQQEIIELWHTCDVSLVHRTYFFLLFKGDPTDSIYMEVELRRLSFLKS  843

Query  187  KWSQ--------GAEVITDGQVLTKPER  128
             +S+        G + IT    + K  R
Sbjct  844  AFSREDIDKAAGGGQNITPSSSMKKLRR  871



>gb|EYU31140.1| hypothetical protein MIMGU_mgv1a000697mg [Erythranthe guttata]
Length=1015

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+   +E+ ELW +C   LVHRTYFF+LF+GDPSD +Y++VE+RR+ FLK+K+S+G +
Sbjct  836  LEFKRLQREIIELWHDCNVSLVHRTYFFMLFQGDPSDAIYLQVEMRRVKFLKDKFSRGDK  895

Query  166  VITDGQVLT  140
             + +G+ LT
Sbjct  896  TVVNGRCLT  904



>ref|XP_008791672.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Phoenix dactylifera]
Length=867

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLK+
Sbjct  784  QSPSRWPLEFERKQQEIIELWHTCDVSLVHRTYFFLLFKGDPTDSIYMEVELRRLSFLKS  843

Query  187  KWSQ  176
             +S+
Sbjct  844  AFSR  847



>gb|KHN36049.1| Kinesin-related protein 4 [Glycine soja]
Length=928

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 4/77 (5%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            +F+   +E+ E WD C   LVHRTYFFLLFKG+PSD +YMEVELRRL +L   +SQG + 
Sbjct  751  KFQRLQREIIEFWDACNVSLVHRTYFFLLFKGEPSDSIYMEVELRRLSYLTQTFSQGNQT  810

Query  163  ITDGQVLTKPE---RYF  122
            + DG+ LT PE   RY 
Sbjct  811  VEDGRTLT-PELSMRYL  826



>ref|XP_004512117.1| PREDICTED: kinesin-related protein 4-like isoform X1 [Cicer arietinum]
Length=948

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            +F+   K++ ELWD C   LVHRTYFFLLFKGDPSD +YMEVELRRL +L   +SQG   
Sbjct  769  KFKRLQKDIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLSYLNQTFSQGNNT  828

Query  163  ITDGQVLTKPE  131
            + DG+  T PE
Sbjct  829  LGDGRTNT-PE  838



>ref|XP_009398104.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398105.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398106.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=957

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 69/110 (63%), Gaps = 8/110 (7%)
 Frame = -3

Query  478  PNSEKQLY---QLLYEAE---EIHKEFFAQ--VAGEGLAVATVSHQTPSYGSIEFEMKMK  323
            PN   Q++   QL+ + E    + ++F A+  V   GL     S Q+PS    EFE K +
Sbjct  725  PNKMTQVHRKKQLIIDQETELNVVEDFGAESTVKDVGLESTMDSLQSPSRWPQEFEKKQQ  784

Query  322  EVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQG  173
            E+ ELW +C   LVHRTYF++LFKGDP+D +YMEVELRRL FL++   QG
Sbjct  785  EIIELWHDCNVSLVHRTYFYMLFKGDPTDSIYMEVELRRLSFLRSNLFQG  834



>ref|XP_004512118.1| PREDICTED: kinesin-related protein 4-like isoform X2 [Cicer arietinum]
Length=937

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            +F+   K++ ELWD C   LVHRTYFFLLFKGDPSD +YMEVELRRL +L   +SQG   
Sbjct  758  KFKRLQKDIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLSYLNQTFSQGNNT  817

Query  163  ITDGQVLTKPE  131
            + DG+  T PE
Sbjct  818  LGDGRTNT-PE  827



>gb|EEE57467.1| hypothetical protein OsJ_07707 [Oryza sativa Japonica Group]
Length=659

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKG+ +D +YMEVELRRL FL++
Sbjct  468  QSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRLSFLRD  527

Query  187  KWSQGA  170
             +S+G+
Sbjct  528  TYSRGS  533



>ref|XP_004958729.1| PREDICTED: kinesin-like protein NACK1-like [Setaria italica]
Length=913

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = -3

Query  412  AQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDL  233
            A+  G  +++ATV   +PS  +I FE K KE+ ELW EC   +VHRTYFFLLFKGD +D 
Sbjct  732  AKDVGTDISMATV--DSPSRWAINFEKKQKEIIELWHECNVSIVHRTYFFLLFKGDKADN  789

Query  232  VYMEVELRRLHFLKNKWSQGAEV  164
            +Y+EVE RRL F+K  +S G E 
Sbjct  790  IYLEVEHRRLSFIKGSFSTGFET  812



>ref|XP_009630368.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Nicotiana tomentosiformis]
Length=1028

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 80/135 (59%), Gaps = 2/135 (1%)
 Frame = -3

Query  538  NEDAKTMLEKKLCSGTKDAKPNSEKQLYQL-LYEAEEIHKEFFAQVAGEGLAVATVSHQT  362
            NE+ K + +       ++ +P  EK++ +  ++EAE  H++    V   GL       + 
Sbjct  785  NENVKDVDDTCDAGNRENDEPQPEKEVRECPVHEAEPEHQKLSKCVRDVGLDPIEDELKN  844

Query  361  PSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKG-DPSDLVYMEVELRRLHFLKNK  185
             S  + EF++  KE+ ELW  C   LVHRTYFFLLF+G DP D VYMEVE+RRL FL N 
Sbjct  845  LSSWTSEFKILQKEIMELWHVCNISLVHRTYFFLLFQGDDPKDAVYMEVEIRRLTFLNNI  904

Query  184  WSQGAEVITDGQVLT  140
            +S+G + + +G+ L+
Sbjct  905  YSRGEKTVVNGRTLS  919



>ref|XP_002512997.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF49500.1| ATP binding protein, putative [Ricinus communis]
Length=842

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -3

Query  349  SIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA  170
            S+ FE +  E+ ELW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLK  +SQG 
Sbjct  663  SLTFERQRSEILELWQTCNVSLVHRTYFFLLFKGDPTDSIYMEVELRRLSFLKENFSQGN  722

Query  169  EVITDGQVLT  140
            + +  G   +
Sbjct  723  QALGGGGTFS  732



>ref|XP_010263900.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Nelumbo nucifera]
Length=972

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 95/194 (49%), Gaps = 31/194 (16%)
 Frame = -3

Query  679  EDFQKNEPKEDFNARQEECSGRQEERDE----TTQLMGDTT-------ASEPCFTTLLNE  533
            + FQKN    ++ +  E  SG+  +  E    T +L  D          S   F   L E
Sbjct  692  DGFQKNLSALNYGSNTESLSGKDSQNSEGSASTNELKADNVKTSVEDVTSIQSFVEELKE  751

Query  532  DAKTMLEKKLCSGTKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSY  353
             AK   + +   G ++ +P ++K                   V   GL     S ++PS+
Sbjct  752  MAKLQYDNQAIDG-QETEPKADKS---------------GKTVKDVGLDPVENSSESPSW  795

Query  352  GSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQG  173
              +EFE + KE+ ELW+ C   LVHRTYFFLLF GDP+D +YM+VELRRL FL++ +S G
Sbjct  796  -PLEFERQRKEIIELWNTCNVSLVHRTYFFLLFIGDPADSIYMKVELRRLSFLRDIFSSG  854

Query  172  ---AEVITDGQVLT  140
                  + DG +L+
Sbjct  855  NLAKHSMVDGCILS  868



>ref|XP_009630370.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Nicotiana tomentosiformis]
Length=1023

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = -3

Query  475  NSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDEC  296
            N E Q  + ++EAE  H++    V   GL       +  S  + EF++  KE+ ELW  C
Sbjct  802  NDEPQPEKEVHEAEPEHQKLSKCVRDVGLDPIEDELKNLSSWTSEFKILQKEIMELWHVC  861

Query  295  YAPLVHRTYFFLLFKG-DPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQVLT  140
               LVHRTYFFLLF+G DP D VYMEVE+RRL FL N +S+G + + +G+ L+
Sbjct  862  NISLVHRTYFFLLFQGDDPKDAVYMEVEIRRLTFLNNIYSRGEKTVVNGRTLS  914



>gb|KDO71126.1| hypothetical protein CISIN_1g001693mg [Citrus sinensis]
Length=745

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+   +E+ ELW  C   LVHRTYFFLLFKGDP D +YMEVE RRL FLK+ +S+G +
Sbjct  568  LEFKRLQREIIELWHACNVSLVHRTYFFLLFKGDPKDSIYMEVEQRRLSFLKDSFSRGND  627

Query  166  VITDGQVLT  140
             I DG+ ++
Sbjct  628  AIEDGRTVS  636



>ref|XP_006647603.1| PREDICTED: kinesin-like protein NACK1-like [Oryza brachyantha]
Length=868

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 71/113 (63%), Gaps = 4/113 (4%)
 Frame = -3

Query  460  LYQLLYEAEEIHKEFFAQVAGEGLAVATV--SHQTPSYGSIEFEMKMKEVFELWDECYAP  287
            + + + E +E+ +  +    G+ + +  +  + Q+PS   +EFE K +E+ ELW  C   
Sbjct  645  IGEFVAELKEMAQVHYQNANGKSIGLDPIEGALQSPSRWPLEFEKKQQEIIELWQACSIS  704

Query  286  LVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA--EVITDGQVLTKP  134
            LVHRTYFFLLFKG+ +D +YMEVELRRL FL++ +S+G+    +  G + T P
Sbjct  705  LVHRTYFFLLFKGETADSIYMEVELRRLSFLRDTYSRGSTPSNVIVGSLSTSP  757



>gb|KDO71125.1| hypothetical protein CISIN_1g001693mg [Citrus sinensis]
Length=909

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+   +E+ ELW  C   LVHRTYFFLLFKGDP D +YMEVE RRL FLK+ +S+G +
Sbjct  732  LEFKRLQREIIELWHACNVSLVHRTYFFLLFKGDPKDSIYMEVEQRRLSFLKDSFSRGND  791

Query  166  VITDGQVLT  140
             I DG+ ++
Sbjct  792  AIEDGRTVS  800



>dbj|BAD25802.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAD25793.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
Length=650

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKG+ +D +YMEVELRRL FL++
Sbjct  459  QSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRLSFLRD  518

Query  187  KWSQGA  170
             +S+G+
Sbjct  519  TYSRGS  524



>ref|XP_006380794.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380795.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380796.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58591.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58592.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58593.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
Length=998

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+ K  ++ ELW  C   LVHRTYFFLLFKGDP+D  YMEVE+RR+  LK+  S+G  
Sbjct  818  LEFKRKQSKIIELWHACDVSLVHRTYFFLLFKGDPADSFYMEVEIRRISLLKDTLSRGGG  877

Query  166  VITDGQVLT  140
             I  GQVLT
Sbjct  878  TIVQGQVLT  886



>ref|XP_010091188.1| Kinesin-related protein 11 [Morus notabilis]
 gb|EXB43288.1| Kinesin-related protein 11 [Morus notabilis]
Length=940

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 72/138 (52%), Gaps = 18/138 (13%)
 Frame = -3

Query  553  FTTLLNEDAKTMLEKKLCSGTKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATV  374
            F T L E AK   EK+L  G                 +A+E   +    V   G+     
Sbjct  711  FVTGLKEMAKLEYEKQLVDG-----------------QAQETQCKAEKNVKDIGVDPMLE  753

Query  373  SHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFL  194
            + +TP +  +EFE   K + ELW  C+  LVHRTYFFLLFKGDPSD +YM VELRRL FL
Sbjct  754  TEETPDW-PLEFERLQKAILELWQACHVSLVHRTYFFLLFKGDPSDSIYMGVELRRLSFL  812

Query  193  KNKWSQGAEVITDGQVLT  140
            K  +S G + + D +  T
Sbjct  813  KETYSCGNQAMEDSRTPT  830



>gb|KDO71124.1| hypothetical protein CISIN_1g001693mg [Citrus sinensis]
Length=1027

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+   +E+ ELW  C   LVHRTYFFLLFKGDP D +YMEVE RRL FLK+ +S+G +
Sbjct  850  LEFKRLQREIIELWHACNVSLVHRTYFFLLFKGDPKDSIYMEVEQRRLSFLKDSFSRGND  909

Query  166  VITDGQVLT  140
             I DG+ ++
Sbjct  910  AIEDGRTVS  918



>gb|AES95091.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=956

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            ++F+   KE+ ELWD C   LVHRTYFFLLFKGDP D +Y+EVE RRL +LK  +SQG +
Sbjct  776  LKFKRLQKEIIELWDACNVSLVHRTYFFLLFKGDPLDSIYLEVEHRRLLYLKQTFSQGNK  835

Query  166  VITDGQVLTKPE---RYF  122
             + DG+ LT PE   RY 
Sbjct  836  TLQDGRTLT-PETSMRYL  852



>ref|XP_003612133.1| Kinesin-related protein [Medicago truncatula]
Length=963

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            ++F+   KE+ ELWD C   LVHRTYFFLLFKGDP D +Y+EVE RRL +LK  +SQG +
Sbjct  783  LKFKRLQKEIIELWDACNVSLVHRTYFFLLFKGDPLDSIYLEVEHRRLLYLKQTFSQGNK  842

Query  166  VITDGQVLTKPE---RYF  122
             + DG+ LT PE   RY 
Sbjct  843  TLQDGRTLT-PETSMRYL  859



>ref|XP_006466916.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
Length=910

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+   +E+ ELW  C   LVHRTYFFLLFKGDP D +YMEVE RRL FLK+ +S+G +
Sbjct  733  LEFKRLQREIIELWHACNVSLVHRTYFFLLFKGDPKDSIYMEVEQRRLSFLKDSFSRGND  792

Query  166  VITDGQVLT  140
             I DG+ ++
Sbjct  793  AIEDGRTVS  801



>ref|XP_006425531.1| hypothetical protein CICLE_v10024791mg [Citrus clementina]
 gb|ESR38771.1| hypothetical protein CICLE_v10024791mg [Citrus clementina]
Length=1028

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+   +E+ ELW  C   LVHRTYFFLLFKGDP D +YMEVE RRL FLK+ +S+G +
Sbjct  851  LEFKRLQREIIELWHACNVSLVHRTYFFLLFKGDPKDSIYMEVEQRRLSFLKDSFSRGND  910

Query  166  VITDGQVLT  140
             I DG+ ++
Sbjct  911  AIEDGRTVS  919



>ref|XP_008444776.1| PREDICTED: kinesin-like protein NACK1 [Cucumis melo]
Length=948

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q  S   +EFE + +++ ELWD C  PLVHR+YFF+LFKGDPSD VYMEVELRRL F++ 
Sbjct  763  QAHSEWMLEFEGQQRDIIELWDACNVPLVHRSYFFILFKGDPSDAVYMEVELRRLFFIRE  822

Query  187  KWSQGAEVITDGQVLTK  137
              S+ A     G  +T+
Sbjct  823  AISRSANGSGRGDTVTQ  839



>ref|XP_006466914.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466915.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
Length=1028

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+   +E+ ELW  C   LVHRTYFFLLFKGDP D +YMEVE RRL FLK+ +S+G +
Sbjct  851  LEFKRLQREIIELWHACNVSLVHRTYFFLLFKGDPKDSIYMEVEQRRLSFLKDSFSRGND  910

Query  166  VITDGQVLT  140
             I DG+ ++
Sbjct  911  AIEDGRTVS  919



>ref|XP_010535298.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010535299.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010535300.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
Length=1118

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQ  176
            EFE + K++ ELW+ C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK   S 
Sbjct  944  EFERQQKQIIELWEVCNVPLVHRTYFFLLFKGDPSDFVYMEVELRRLSFLKESLSH  999



>gb|KDP27640.1| hypothetical protein JCGZ_19645 [Jatropha curcas]
Length=965

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            + FE + +E+ ELW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FL    SQG +
Sbjct  787  LTFERQRREILELWQACNVSLVHRTYFFLLFKGDPTDSIYMEVELRRLSFLTETLSQGNQ  846

Query  166  VITDGQVLT  140
             +  GQ  T
Sbjct  847  DLGGGQTFT  855



>ref|XP_002452843.1| hypothetical protein SORBIDRAFT_04g033456 [Sorghum bicolor]
 gb|EES05819.1| hypothetical protein SORBIDRAFT_04g033456 [Sorghum bicolor]
Length=584

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL     + Q+PS   +EFE K +E+  LW  C   LVHRTYFFLLFKGD +D +YMEVE
Sbjct  383  GLDPIADASQSPSRWPLEFEKKQQEIIGLWHACSISLVHRTYFFLLFKGDQADSIYMEVE  442

Query  214  LRRLHFLKNKWSQGA  170
            LRRL FL++ +S+G+
Sbjct  443  LRRLSFLRDTYSRGS  457



>gb|KDP46700.1| hypothetical protein JCGZ_06488 [Jatropha curcas]
Length=1012

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+    ++ ELW +C   LVHRTYFFLL+KGDP+D  YMEVELR+L FLK+ +S+G E 
Sbjct  827  EFKRLQGQIIELWHDCSVSLVHRTYFFLLYKGDPTDSFYMEVELRKLSFLKDTFSRGDET  886

Query  163  ITDGQVLT  140
            I DG++++
Sbjct  887  IVDGRIVS  894



>emb|CDY15900.1| BnaA04g12110D [Brassica napus]
Length=844

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE K +++ ELW+ C   LVHRTYFFLLFKGD +D +YM VELRRL F+K  +SQG E 
Sbjct  666  EFERKREQILELWETCNVSLVHRTYFFLLFKGDQADSIYMGVELRRLSFMKESFSQGNEA  725

Query  163  ITDGQVLT  140
               GQ LT
Sbjct  726  FERGQTLT  733



>ref|XP_002863777.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40036.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=1088

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 56/86 (65%), Gaps = 4/86 (5%)
 Frame = -3

Query  355  YGSI--EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKW  182
            Y SI  +FE + +++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK   
Sbjct  907  YSSISSDFERQQRQIIELWAVCNVPLVHRTYFFLLFKGDPSDYVYMEVELRRLSFLKQTI  966

Query  181  SQGAEV--ITDGQVLTKPERYFSLPL  110
            S   E   I   + LT+ + + S  L
Sbjct  967  SNDMEASRIQTVKALTREKEWLSKQL  992



>gb|KCW53110.1| hypothetical protein EUGRSUZ_J02401 [Eucalyptus grandis]
Length=849

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 4/80 (5%)
 Frame = -3

Query  352  GSIE----FEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            GS+E    F+   KE+ +LW EC   LVHR+YFFLLFKGDP+D +Y+EVELRRL FL++K
Sbjct  768  GSLEWLSHFKNLQKEIVKLWKECNVSLVHRSYFFLLFKGDPTDSIYLEVELRRLSFLRDK  827

Query  184  WSQGAEVITDGQVLTKPERY  125
             ++  + + D Q LT   RY
Sbjct  828  SARCNQALEDSQALTAVSRY  847



>gb|EEC73693.1| hypothetical protein OsI_08272 [Oryza sativa Indica Group]
Length=854

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKG+ +D +YMEVELRRL FL++
Sbjct  663  QSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRLSFLRD  722

Query  187  KWSQGA  170
             +S+G+
Sbjct  723  TYSRGS  728



>ref|NP_001047571.1| Os02g0645100 [Oryza sativa Japonica Group]
 dbj|BAD25811.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAF09485.1| Os02g0645100 [Oryza sativa Japonica Group]
 dbj|BAG94862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01337.1| unnamed protein product [Oryza sativa Japonica Group]
Length=884

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKG+ +D +YMEVELRRL FL++
Sbjct  693  QSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRLSFLRD  752

Query  187  KWSQGA  170
             +S+G+
Sbjct  753  TYSRGS  758



>ref|XP_009760421.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
 ref|XP_009760422.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
 ref|XP_009760423.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
Length=929

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -3

Query  373  SHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFL  194
            S + PS   +EF    K + ELW  C+  L+HRTYFFLLFKGDP D +YMEVE+RRL FL
Sbjct  743  SSEAPSDWPLEFGRLQKMIIELWQTCHISLIHRTYFFLLFKGDPMDSIYMEVEVRRLSFL  802

Query  193  KNKWSQGAEVITDGQVLT  140
            K   S G   +  GQ +T
Sbjct  803  KEILSSGNSAVQGGQTIT  820



>ref|XP_006413467.1| hypothetical protein EUTSA_v10026976mg [Eutrema salsugineum]
 gb|ESQ54920.1| hypothetical protein EUTSA_v10026976mg [Eutrema salsugineum]
Length=997

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  358  SYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            S    EFE + +++ ELW+ C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK+
Sbjct  821  SGAKAEFERQQRQIIELWEVCNVPLVHRTYFFLLFKGDPSDFVYMEVELRRLSFLKD  877



>ref|NP_199064.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 dbj|BAB10490.1| kinesin heavy chain-like protein [Arabidopsis thaliana]
 gb|AED94816.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1087

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = -3

Query  358  SYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWS  179
            S  S +FE + +++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK   S
Sbjct  907  SISSSDFERQQRKIIELWAACNVPLVHRTYFFLLFKGDPSDYVYMEVELRRLSFLKQTIS  966

Query  178  QGAEV--ITDGQVLTKPERYFSLPL  110
               E   +   + LT+ + + S  L
Sbjct  967  NDMETSRMQTVKALTREKEWISKQL  991



>gb|KHG01461.1| Kinesin-related 11 [Gossypium arboreum]
Length=953

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 55/90 (61%), Gaps = 0/90 (0%)
 Frame = -3

Query  406  VAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVY  227
            V   GL   +  + +P   S EF    +E+ ELW  C   LVHRTYF +LFKGDP D +Y
Sbjct  754  VTDIGLDPISDYYGSPRTWSSEFTRLQREIIELWHACNVTLVHRTYFLMLFKGDPKDYIY  813

Query  226  MEVELRRLHFLKNKWSQGAEVITDGQVLTK  137
            MEVE RRL FL N  S G + + +G+VLT+
Sbjct  814  MEVEHRRLSFLNNVISHGNQTVENGRVLTR  843



>ref|XP_006279726.1| hypothetical protein CARUB_v10027496mg [Capsella rubella]
 gb|EOA12624.1| hypothetical protein CARUB_v10027496mg [Capsella rubella]
Length=1054

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 58/94 (62%), Gaps = 4/94 (4%)
 Frame = -3

Query  397  EGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEV  218
            E L  A++     S  S +FE + +++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEV
Sbjct  864  EKLQAASIGQH--STNSSDFERQQRQIIELWAICNVPLVHRTYFFLLFKGDPSDYVYMEV  921

Query  217  ELRRLHFLKNKWSQ--GAEVITDGQVLTKPERYF  122
            ELRRL FLK   S    A  I   + LT+ + + 
Sbjct  922  ELRRLSFLKQTISNDMDASRIQTMKALTREKEWL  955



>ref|XP_008669085.1| PREDICTED: kinesin-like protein NACK1 isoform X3 [Zea mays]
Length=893

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   ++FE K +E+ +LW  C   LVHRTYFFLLFKGDP+D +YMEVELRRL FLKN
Sbjct  758  QSPSRWPLDFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  817

Query  187  KWSQGA  170
             +S G+
Sbjct  818  TYSNGS  823



>ref|XP_002313758.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE87713.2| kinesin motor family protein [Populus trichocarpa]
Length=975

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EFE + + + ELW  C   LVHRTYFFLLF+GDP+D +YMEVE RRL FLK  +SQG +
Sbjct  795  LEFERQQRAMLELWQTCNVSLVHRTYFFLLFQGDPTDSIYMEVEHRRLSFLKETFSQGNQ  854

Query  166  VITDGQVLT  140
             +  G+ LT
Sbjct  855  GVGGGRALT  863



>ref|XP_007046742.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
 gb|EOX90899.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
Length=982

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            +PS    EF+    E+ ELW  C   LVHRTYFFLLF GDP D +YMEVE RRL FLKN 
Sbjct  797  SPSAWPSEFKRLQGEIIELWHACNVSLVHRTYFFLLFTGDPKDYIYMEVEHRRLSFLKNV  856

Query  184  WSQGAEVITDGQVLT  140
            ++ G + +  G+VLT
Sbjct  857  FAHGNQTVEAGRVLT  871



>emb|CDX99601.1| BnaC04g33580D [Brassica napus]
Length=818

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE K +++ ELW+ C   LVHRTYFFLLFKGD +D +YM VELRRL F+K  +SQG + 
Sbjct  640  EFERKREQILELWETCNVSLVHRTYFFLLFKGDQADSIYMGVELRRLSFMKESFSQGNQA  699

Query  163  ITDGQVLT  140
               GQ LT
Sbjct  700  FERGQTLT  707



>ref|XP_006854867.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
 gb|ERN16334.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
Length=969

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 56/79 (71%), Gaps = 3/79 (4%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+ S   +EFE + +E+ ELW  C+  L HRTYFFLLF+GDP+D +Y+EVELRRL FLKN
Sbjct  785  QSLSNWPLEFERQRREIIELWHTCHVSLFHRTYFFLLFRGDPADSIYIEVELRRLSFLKN  844

Query  187  KWSQ---GAEVITDGQVLT  140
            K++    G  ++ DG  +T
Sbjct  845  KFADRNPGILMLEDGHSMT  863



>ref|XP_002462712.1| hypothetical protein SORBIDRAFT_02g030680 [Sorghum bicolor]
 gb|EER99233.1| hypothetical protein SORBIDRAFT_02g030680 [Sorghum bicolor]
Length=879

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = -3

Query  436  EEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLL  257
            EEI     A+     ++V TV  ++PS   I+FE K KE+ ELW EC   +VHRTYFFLL
Sbjct  681  EEISNMKNAKDVDRDISVTTV--ESPSRWPIDFEKKQKEIIELWHECNVSIVHRTYFFLL  738

Query  256  FKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            FKGD +D +Y+EVE RRL F+++ ++ G E
Sbjct  739  FKGDKADNIYLEVEHRRLSFIRSSFNAGCE  768



>ref|XP_009336756.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=1068

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TPS   ++FE +   + ELW+ C+ PLVHRT+FF+L+KGDPSD +Y+EVELRRL  LK+
Sbjct  884  RTPSNWRLDFETQRGLIIELWEACFVPLVHRTHFFILYKGDPSDFLYLEVELRRLTILKD  943

Query  187  KWSQGAEV  164
             +S+G+ +
Sbjct  944  TFSEGSNL  951



>ref|XP_008388151.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=1104

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TPS   ++FE +   + ELW+ C+ PLVHRT+FF+L+KGDPSD +Y+EVELRRL  LK+
Sbjct  920  RTPSNWRLDFETQRGLIIELWEACFVPLVHRTHFFILYKGDPSDFLYLEVELRRLTILKD  979

Query  187  KWSQGAEV  164
             +S+G+ +
Sbjct  980  TFSEGSNL  987



>ref|XP_008388149.1| PREDICTED: kinesin-like protein NACK2 [Malus domestica]
Length=1054

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TPS   ++FE +   + ELW+ C+ PLVHRT+FF+L+KGDPSD +Y+EVELRRL  LK+
Sbjct  870  RTPSNWRLDFETQRGLIIELWEACFVPLVHRTHFFILYKGDPSDFLYLEVELRRLTILKD  929

Query  187  KWSQGAEV  164
             +S+G+ +
Sbjct  930  TFSEGSNL  937



>ref|XP_003569980.1| PREDICTED: kinesin-like protein NACK2 [Brachypodium distachyon]
Length=866

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            Q+PS   +EFE K +E+ ELW  C   LVHRTYFFLLFKG+ +D +YMEVELRRL FL++
Sbjct  676  QSPSRWPLEFEKKQQEIIELWHACSISLVHRTYFFLLFKGESADSIYMEVELRRLLFLRD  735

Query  187  KWSQGA  170
             +S+G+
Sbjct  736  TYSRGS  741



>ref|XP_009140272.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=842

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE K +++ ELW+ C   LVHRTYFFLLFKGD +D +Y+ VELRRL F+K  +SQG E 
Sbjct  664  EFERKREQILELWETCNVSLVHRTYFFLLFKGDQADSIYIGVELRRLSFMKESFSQGNEA  723

Query  163  ITDGQVLT  140
               GQ LT
Sbjct  724  FERGQTLT  731



>ref|XP_011047336.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Populus euphratica]
Length=976

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EFE + + + ELW  C   L+HRTYFFLLF+GDP+D VYMEVE RRL FLK  +SQG +
Sbjct  796  LEFERQQRAMLELWQTCNVSLIHRTYFFLLFQGDPTDSVYMEVEHRRLSFLKETFSQGNQ  855

Query  166  VITDGQVLT  140
             +  G+ +T
Sbjct  856  GVGGGRAIT  864



>tpg|DAA40602.1| TPA: hypothetical protein ZEAMMB73_556467, partial [Zea mays]
Length=199

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  385  VATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRR  206
            ++  S  +PS   I FE K KE+ ELW EC   +VHRTYFFLLFKGD  D +Y+EVE RR
Sbjct  20   ISVTSVDSPSRCPINFEKKQKEIIELWHECNVSIVHRTYFFLLFKGDKEDNIYLEVEHRR  79

Query  205  LHFLKNKWSQGAE  167
            L F+K+ +S  +E
Sbjct  80   LSFIKSSFSVASE  92



>ref|XP_011047311.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047320.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047328.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
Length=983

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EFE + + + ELW  C   L+HRTYFFLLF+GDP+D VYMEVE RRL FLK  +SQG +
Sbjct  803  LEFERQQRAMLELWQTCNVSLIHRTYFFLLFQGDPTDSVYMEVEHRRLSFLKETFSQGNQ  862

Query  166  VITDGQVLT  140
             +  G+ +T
Sbjct  863  GVGGGRAIT  871



>ref|XP_008671753.1| PREDICTED: kinesin-like protein NACK1 [Zea mays]
Length=207

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  385  VATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRR  206
            ++  S  +PS   I FE K KE+ ELW EC   +VHRTYFFLLFKGD  D +Y+EVE RR
Sbjct  28   ISVTSVDSPSRCPINFEKKQKEIIELWHECNVSIVHRTYFFLLFKGDKEDNIYLEVEHRR  87

Query  205  LHFLKNKWSQGAE  167
            L F+K+ +S  +E
Sbjct  88   LSFIKSSFSVASE  100



>ref|XP_007157943.1| hypothetical protein PHAVU_002G111200g [Phaseolus vulgaris]
 gb|ESW29937.1| hypothetical protein PHAVU_002G111200g [Phaseolus vulgaris]
Length=963

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 4/77 (5%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            +F+   +E+ E WD C   LVHRTYFFLLFKG+ +D  YMEVELRRL +LK  +SQG + 
Sbjct  786  KFKRLQREIIEFWDACNVSLVHRTYFFLLFKGEQTDSFYMEVELRRLSYLKQAFSQGNQT  845

Query  163  ITDGQVLTKPE---RYF  122
            + DG++L KPE   RY 
Sbjct  846  VEDGRIL-KPESSMRYL  861



>ref|XP_009137750.1| PREDICTED: kinesin-like protein NACK2 [Brassica rapa]
Length=1183

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  343   EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
             EFE +  ++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK+
Sbjct  1009  EFERQQSQIIELWGVCNVPLVHRTYFFLLFKGDPSDFVYMEVELRRLSFLKD  1060



>emb|CDY03482.1| BnaC01g16000D [Brassica napus]
Length=955

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            EFE +  ++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK+
Sbjct  781  EFERQQSQIIELWGVCNVPLVHRTYFFLLFKGDPSDFVYMEVELRRLSFLKD  832



>ref|XP_004953277.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
 ref|XP_004953278.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
Length=880

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -3

Query  457  YQLLYEAEEIHKEFF-AQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLV  281
            YQ  Y  +  + EF    +   GL     + Q+PS   +EFE K +E+ ELW  C   LV
Sbjct  659  YQKQYGDQNANGEFGEGTIKSIGLDPIADASQSPSRWPLEFEKKQQEIIELWHACSISLV  718

Query  280  HRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA  170
            HRTYFFLLFKGD +D +YMEVELRRL FL++ +S+G 
Sbjct  719  HRTYFFLLFKGDQADSIYMEVELRRLSFLRDTYSRGG  755



>ref|XP_003519876.1| PREDICTED: kinesin-like protein NACK1-like [Glycine max]
Length=949

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+   KE+ ELW+ C   LVHRTYFFLLFKGDPSD +YMEVE RRL +LK  +  G + 
Sbjct  774  EFKRLQKEIIELWNACNVSLVHRTYFFLLFKGDPSDSIYMEVERRRLFYLKQNFDHGNQT  833

Query  163  ITDGQVLTKPERYF  122
            + DG      +R+ 
Sbjct  834  VEDGLTPESSKRHL  847



>ref|XP_004289095.1| PREDICTED: uncharacterized protein LOC101300397 [Fragaria vesca 
subsp. vesca]
Length=1040

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL    ++ ++ S    EF+   +E+ ELW  C   LVHRTYFFLLFKGDPSD +YMEVE
Sbjct  846  GLDPMPMNEESDSMWPSEFKRLQREIVELWHACNVSLVHRTYFFLLFKGDPSDSIYMEVE  905

Query  214  LRRLHFLKNKWSQGAEVITDG  152
            LRRL FLK  + +G +   DG
Sbjct  906  LRRLSFLKRTFLKGDQAFDDG  926



>gb|KHN00495.1| Kinesin-related protein 11 [Glycine soja]
Length=914

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+   KE+ ELW+ C   LVHRTYFFLLFKGDPSD +YMEVE RRL +LK  +  G + 
Sbjct  739  EFKRLQKEIIELWNACNVSLVHRTYFFLLFKGDPSDSIYMEVERRRLFYLKQNFDHGNQT  798

Query  163  ITDGQVLTKPERYF  122
            + DG      +R+ 
Sbjct  799  VEDGLTPESSKRHL  812



>ref|XP_011025920.1| PREDICTED: kinesin-like protein NACK2 [Populus euphratica]
Length=998

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+ K  ++ ELW  C   LVHRTYFFLLFKGDP+D  YMEVE+RR+  LK+  S+ + 
Sbjct  818  LEFKRKQSKIIELWHACDVSLVHRTYFFLLFKGDPADSFYMEVEIRRISLLKDTLSRDSG  877

Query  166  VITDGQVLT  140
             I  GQVLT
Sbjct  878  TIVHGQVLT  886



>ref|XP_010448602.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1087

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            EFE +  ++ ELW+ C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK+
Sbjct  915  EFERQQSQIVELWEVCNVPLVHRTYFFLLFKGDPSDFVYMEVELRRLSFLKD  966



>ref|XP_009597015.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana tomentosiformis]
Length=1007

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 7/126 (6%)
 Frame = -3

Query  496  GTKDAKPNSEKQLYQ-------LLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEF  338
            G +DA+ N    L          + EAE  H +    V   GL      +++     +EF
Sbjct  775  GARDARTNGMDGLQHEMDVKDCHVQEAELEHDKPSKSVRDVGLEPVEDDYKSRYSWPLEF  834

Query  337  EMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVIT  158
            +   KE+ ELW  C   L HRTYFFLLF+GD +D +YMEVE+RRL FLK+ +S+G + + 
Sbjct  835  KRLQKEIIELWHACNVSLAHRTYFFLLFQGDSTDAIYMEVEIRRLTFLKDTFSRGEKTVV  894

Query  157  DGQVLT  140
            +G+ L+
Sbjct  895  NGRTLS  900



>emb|CDY34261.1| BnaA01g13640D [Brassica napus]
Length=847

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            EFE +  ++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK+
Sbjct  673  EFERQQSQIIELWGVCNVPLVHRTYFFLLFKGDPSDFVYMEVELRRLSFLKD  724



>ref|XP_006659658.1| PREDICTED: kinesin-like protein NACK2-like [Oryza brachyantha]
Length=998

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            G+  A  +  +PS   I+FE   +E+ +LW EC  P+VHRTYFFLLFKGDP+D +YMEVE
Sbjct  811  GIDSALSTIDSPSRWPIDFEKMQQEIIQLWHECNVPIVHRTYFFLLFKGDPADNIYMEVE  870

Query  214  LRRLHFLKNKWSQGA  170
             RRL F++  +S  +
Sbjct  871  HRRLSFIRRSFSANS  885



>ref|NP_001159162.1| uncharacterized protein LOC100304245 [Zea mays]
 gb|ACN25281.1| unknown [Zea mays]
Length=283

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  385  VATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRR  206
            ++  S  +PS   I FE K KE+ ELW EC   +VHRTYFFLLFKGD  D +Y+EVE RR
Sbjct  104  ISVTSVDSPSRWPINFEKKQKEIIELWHECNVSIVHRTYFFLLFKGDKEDNIYLEVEHRR  163

Query  205  LHFLKNKWSQGAE  167
            L F+K+ +S  +E
Sbjct  164  LSFIKSSFSVASE  176



>ref|XP_009791027.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana sylvestris]
Length=1028

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 7/126 (6%)
 Frame = -3

Query  496  GTKDAKPNSEKQL-YQL------LYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEF  338
            G +DA+ N   QL Y++      + EAE  H +    V   G+      +++     +EF
Sbjct  796  GARDARMNGMDQLQYEMDVKDCHVQEAELEHDKPSKSVREVGVEPVEDDYKSRYSWPLEF  855

Query  337  EMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVIT  158
            +   KE+ ELW  C   L HR YFFLLF+GD +D +YMEVE+RRL FLK+ +S+G + + 
Sbjct  856  KRLQKEIIELWHACNVSLAHRAYFFLLFQGDSTDAIYMEVEIRRLTFLKDTFSRGEKTVV  915

Query  157  DGQVLT  140
            +G+ L+
Sbjct  916  NGRTLS  921



>ref|XP_010909958.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=970

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 58/89 (65%), Gaps = 5/89 (6%)
 Frame = -3

Query  391  LAVATVSH--QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEV  218
            +++ T+S+  + P    +EFE K +E+ ELW  C   L+HRTYFF+LFKGDP+D +YMEV
Sbjct  771  VSLDTISNSLEVPLQWPMEFEKKQQEIVELWQACNVSLIHRTYFFILFKGDPADSIYMEV  830

Query  217  ELRRLHFLKNKWSQG---AEVITDGQVLT  140
            E RRL FLKN  S G    E   DG  LT
Sbjct  831  EHRRLSFLKNTISHGNLDKEDAGDGHDLT  859



>emb|CAB51660.1| putative protein [Arabidopsis thaliana]
 emb|CAB79327.1| putative protein [Arabidopsis thaliana]
Length=1263

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            EFE +  ++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK+
Sbjct  831  EFERQQSQIIELWQVCNVPLVHRTYFFLLFKGDPSDFVYMEVELRRLSFLKD  882



>ref|NP_567695.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE84858.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1004

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            EFE +  ++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK+
Sbjct  831  EFERQQSQIIELWQVCNVPLVHRTYFFLLFKGDPSDFVYMEVELRRLSFLKD  882



>emb|CDY22403.1| BnaA06g37250D [Brassica napus]
Length=409

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            +FE K +E+ ELW  C A LV RTYF+LLFKGD +D VY+ VELRRL F+K+++SQG + 
Sbjct  230  DFERKRQEILELWQSCNASLVRRTYFYLLFKGDEADSVYIGVELRRLLFIKDRFSQGKQA  289

Query  163  ITDGQVLTKPERYFSL--PLSLHSSCAHTIAKEH*NDQVFYLFSTALKHSRRR  11
               G+ LT      +L     + S        E    ++++ F  A+   RRR
Sbjct  290  SDGGETLTLSSSLKALHKERKMLSKLVRKRFSEEEMTRIYHKFGIAVNSKRRR  342



>gb|EEE69110.1| hypothetical protein OsJ_28179 [Oryza sativa Japonica Group]
Length=987

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            +PS   I+FE   +E+ +LW EC AP+VHRTYFFLLFKGDP+D +YMEVE RRL F++  
Sbjct  810  SPSRWPIDFEKMRQEIIQLWHECNAPIVHRTYFFLLFKGDPADNIYMEVEHRRLSFIRRS  869

Query  184  WS  179
            +S
Sbjct  870  FS  871



>ref|NP_001062429.1| Os08g0547500 [Oryza sativa Japonica Group]
 dbj|BAD09938.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAF24343.1| Os08g0547500 [Oryza sativa Japonica Group]
Length=986

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            +PS   I+FE   +E+ +LW EC AP+VHRTYFFLLFKGDP+D +YMEVE RRL F++  
Sbjct  809  SPSRWPIDFEKMRQEIIQLWHECNAPIVHRTYFFLLFKGDPADNIYMEVEHRRLSFIRRS  868

Query  184  WS  179
            +S
Sbjct  869  FS  870



>ref|XP_009617690.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
 ref|XP_009617691.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=928

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -3

Query  373  SHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFL  194
            S + PS   +EF    K + ELW  C+  ++HRTYFFLLFKGDP D +YMEVE+RRL FL
Sbjct  742  SSEAPSDWPLEFGRLQKMIIELWQTCHISVIHRTYFFLLFKGDPMDSIYMEVEVRRLSFL  801

Query  193  KNKWSQGAEVITDGQVLT  140
            K   S G   +  G+ +T
Sbjct  802  KEILSSGNSAVQGGRTIT  819



>ref|XP_004293191.1| PREDICTED: uncharacterized protein LOC101301847 [Fragaria vesca 
subsp. vesca]
Length=1009

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA--  170
            EFE + + + ELWD CY PLVHR++FFLL+KGDPSD +Y+EVELRRL  L++ +S G+  
Sbjct  831  EFERQRELIIELWDACYVPLVHRSHFFLLYKGDPSDFLYLEVELRRLTALRDTFSDGSNR  890

Query  169  EVITDGQVLT  140
              ++D   LT
Sbjct  891  SSVSDRHALT  900



>gb|EYU24075.1| hypothetical protein MIMGU_mgv1a001308mg [Erythranthe guttata]
Length=843

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -3

Query  370  HQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLK  191
            H+  +   +EF+   +E+ ELW  C   LVHRTYFFLLF+GDPSD +Y+EVELRR+ FLK
Sbjct  657  HKGLTSWPVEFKRLQREIIELWHACNVSLVHRTYFFLLFQGDPSDAIYLEVELRRMKFLK  716

Query  190  NKWSQGAEVITDGQVLT  140
            +K+++G + + +G+ LT
Sbjct  717  DKFARGDKTVVNGKRLT  733



>ref|XP_002531511.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30865.1| conserved hypothetical protein [Ricinus communis]
Length=959

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+    E+ ELW  C   L+HRTYFFLLFKGD +D  YMEVE+R+L FLK+ +S G E 
Sbjct  780  EFKRLQGEIIELWHVCSVSLIHRTYFFLLFKGDSTDSFYMEVEIRKLSFLKDTFSNGRET  839

Query  163  ITDGQVLT  140
            + DG++L+
Sbjct  840  MVDGRILS  847



>ref|XP_006403375.1| hypothetical protein EUTSA_v10003349mg [Eutrema salsugineum]
 gb|ESQ44828.1| hypothetical protein EUTSA_v10003349mg [Eutrema salsugineum]
Length=1118

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = -3

Query  343   EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
             +FE + +++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK   +   E 
Sbjct  943   DFERQQRQIIELWAVCNVPLVHRTYFFLLFKGDPSDYVYMEVELRRLSFLKQTITNDPET  1002

Query  163   --ITDGQVLTKPERYFS  119
               I   + LT+ + + S
Sbjct  1003  SRIQTVKALTREKEWLS  1019



>ref|XP_009101917.1| PREDICTED: uncharacterized protein LOC103828075 [Brassica rapa]
Length=437

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            +FE K +E+ ELW  C A LV RTYF+LLFKGD +D VY+ VELRRL F+K+++SQG + 
Sbjct  258  DFERKRQEILELWQSCNASLVRRTYFYLLFKGDEADSVYIGVELRRLLFIKDRFSQGKQA  317

Query  163  ITDGQVLTKPERYFSL--PLSLHSSCAHTIAKEH*NDQVFYLFSTALKHSRRR  11
               G+ LT      +L     + S        E    ++++ F  A+   RRR
Sbjct  318  SDGGETLTLSSSLKALHKERKMLSKLVRKRFSEEEMTRIYHKFGIAVNSKRRR  370



>dbj|BAD09937.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
Length=1003

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            +PS   I+FE   +E+ +LW EC AP+VHRTYFFLLFKGDP+D +YMEVE RRL F++  
Sbjct  826  SPSRWPIDFEKMRQEIIQLWHECNAPIVHRTYFFLLFKGDPADNIYMEVEHRRLSFIRRS  885

Query  184  WS  179
            +S
Sbjct  886  FS  887



>ref|XP_009393646.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=913

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            G+     + ++PS    EFE K +E+ +LW  C  PLVHRT FFLLF GDP+D  YMEVE
Sbjct  726  GMDAVLCALESPSRWPREFERKQREIIQLWHACDVPLVHRTCFFLLFDGDPADSFYMEVE  785

Query  214  LRRLHFLKNKWSQG  173
             RRL FL+N +S+G
Sbjct  786  CRRLSFLRNTFSRG  799



>emb|CDP01925.1| unnamed protein product [Coffea canephora]
Length=959

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+   KE+ ELW+ C   L HRTYF+LLF+GDP+D +YMEVE+RR+ FLK+ +S+G + 
Sbjct  782  EFKRLQKEIIELWEACSVSLAHRTYFYLLFQGDPTDAIYMEVEMRRMIFLKDTFSRGEKT  841

Query  163  ITDGQVLT  140
            + +GQ ++
Sbjct  842  MLNGQTVS  849



>ref|XP_010526582.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Tarenaya hassleriana]
Length=732

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + KE+ ELW  C+  LVHRTYFFLLFKGD +D +Y+ VELRRL +LK  +SQG   
Sbjct  668  EFERQRKEIIELWQSCHVSLVHRTYFFLLFKGDQADSIYIGVELRRLSYLKESFSQGNRA  727

Query  163  ITDG  152
            I  G
Sbjct  728  IEGG  731



>ref|XP_004509341.1| PREDICTED: kinesin-related protein 4-like isoform X4 [Cicer arietinum]
Length=960

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 52/78 (67%), Gaps = 7/78 (9%)
 Frame = -3

Query  349  SIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA  170
            S EF+   KE+ ELW  C   LVHRTYFFLLFKGDPSD +YMEVELRRL +LK       
Sbjct  786  SSEFKQLQKEIIELWHSCNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLSYLKEN-----  840

Query  169  EVITDGQVLT--KPERYF  122
            +++ DG+ LT    +RY 
Sbjct  841  QILEDGRTLTPESSKRYL  858



>ref|XP_004167109.1| PREDICTED: uncharacterized LOC101212680 [Cucumis sativus]
Length=956

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+ + +++ ELWD C  PLVHR+YFF+LFKGDP+D VYMEVELRRL F++   S+   
Sbjct  778  LEFQGQQRDIIELWDACNVPLVHRSYFFILFKGDPTDAVYMEVELRRLFFIREAISRSVN  837

Query  166  VITDGQVLTK  137
                G  +T+
Sbjct  838  GSGRGDAVTQ  847



>ref|XP_004152764.1| PREDICTED: uncharacterized protein LOC101212680 [Cucumis sativus]
 gb|KGN62654.1| hypothetical protein Csa_2G365120 [Cucumis sativus]
Length=956

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+ + +++ ELWD C  PLVHR+YFF+LFKGDP+D VYMEVELRRL F++   S+   
Sbjct  778  LEFQGQQRDIIELWDACNVPLVHRSYFFILFKGDPTDAVYMEVELRRLFFIREAISRSVN  837

Query  166  VITDGQVLTK  137
                G  +T+
Sbjct  838  GSGRGDAVTQ  847



>gb|AFW63202.1| hypothetical protein ZEAMMB73_949881 [Zea mays]
Length=770

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = -3

Query  466  KQLYQLLYEAE---EIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDEC  296
            K++ Q+ Y+ +   +I    F  +   GL     + Q+PS   +EFE K +E+  LW  C
Sbjct  652  KEMAQVHYQKQLGNQITNGEFVDIKNIGLDPIADASQSPSRWPLEFEKKQQEIIGLWHAC  711

Query  295  YAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQG  173
               LVHRTYFFLLFKG+ +D +YMEVELRRL FL++ +S+G
Sbjct  712  CISLVHRTYFFLLFKGEQADSIYMEVELRRLSFLRDTYSRG  752



>emb|CDY12957.1| BnaC02g29640D [Brassica napus]
Length=826

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLK  191
            +FE + +++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK
Sbjct  650  DFERQQRQIIELWAVCNVPLVHRTYFFLLFKGDPSDYVYMEVELRRLSFLK  700



>ref|XP_010526578.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526579.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526580.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526581.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=840

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + KE+ ELW  C+  LVHRTYFFLLFKGD +D +Y+ VELRRL +LK  +SQG   
Sbjct  668  EFERQRKEIIELWQSCHVSLVHRTYFFLLFKGDQADSIYIGVELRRLSYLKESFSQGNRA  727

Query  163  ITDG  152
            I  G
Sbjct  728  IEGG  731



>ref|XP_004509338.1| PREDICTED: kinesin-related protein 4-like isoform X1 [Cicer arietinum]
 ref|XP_004509339.1| PREDICTED: kinesin-related protein 4-like isoform X2 [Cicer arietinum]
 ref|XP_004509340.1| PREDICTED: kinesin-related protein 4-like isoform X3 [Cicer arietinum]
Length=985

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 52/78 (67%), Gaps = 7/78 (9%)
 Frame = -3

Query  349  SIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA  170
            S EF+   KE+ ELW  C   LVHRTYFFLLFKGDPSD +YMEVELRRL +LK       
Sbjct  811  SSEFKQLQKEIIELWHSCNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLSYLKEN-----  865

Query  169  EVITDGQVLT--KPERYF  122
            +++ DG+ LT    +RY 
Sbjct  866  QILEDGRTLTPESSKRYL  883



>gb|EMT03608.1| Kinesin-related protein 4 [Aegilops tauschii]
Length=866

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 59/169 (35%), Positives = 87/169 (51%), Gaps = 12/169 (7%)
 Frame = -3

Query  619  GRQEERDETTQLMGDTTASEPCFTTLLNEDAKTMLEKKLCSGTKDAKPNSEKQLYQLLYE  440
            GR EE       +     SE      L+     +   K  S T DA+     +    L E
Sbjct  592  GRPEEYQRRGSALNYDAGSET-----LSRAGSEISTSKGASKTGDAEFTGIGEFVAELKE  646

Query  439  AEEIH-KEFFAQVAGEGLAVA----TVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHR  275
              ++H ++     +G G ++       + Q+PS   +EFE K +E+ ELW  C   LVHR
Sbjct  647  MAQVHYQKQLGDQSGNGKSIGLDPIMDALQSPSRWPLEFEKKQQEIIELWHACSISLVHR  706

Query  274  TYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA--EVITDGQVLTKP  134
            TYFFLLFKG+ +D +YMEVELRRL FL++ +S+G+    +T G + + P
Sbjct  707  TYFFLLFKGESADSIYMEVELRRLSFLRDTYSRGSTPSNVTVGSLSSSP  755



>gb|EMS48860.1| Kinesin-related protein 4 [Triticum urartu]
Length=862

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 60/165 (36%), Positives = 84/165 (51%), Gaps = 8/165 (5%)
 Frame = -3

Query  619  GRQEERDETTQLMGDTTASEPCFTTLLNEDAKTMLEKKLCSGTKDAKPNSEKQLYQLLYE  440
            GR EE       +     SE      L+     +   K  S T DA+     +    L E
Sbjct  592  GRPEEYQRRGSALNYDAGSET-----LSRAGSEISTSKGASKTGDAEFTGIGEFVAELKE  646

Query  439  AEEIH-KEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFF  263
              ++H ++  A     GL       Q+PS   +EFE K +E+ ELW  C   LVHRTYFF
Sbjct  647  MAQVHYQKQSANGKSIGLDPIMDGLQSPSRWPLEFEKKQQEIIELWHACSISLVHRTYFF  706

Query  262  LLFKGDPSDLVYMEVELRRLHFLKNKWSQGA--EVITDGQVLTKP  134
            LLFKG+ +D +YMEVELRRL FL++ +S+G+    +T G + + P
Sbjct  707  LLFKGESADSIYMEVELRRLSFLRDTYSRGSTPSNVTVGSLSSSP  751



>emb|CDY02395.1| BnaA02g23040D [Brassica napus]
Length=672

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLK  191
            +FE + +++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK
Sbjct  496  DFERQQRQIIELWAVCNVPLVHRTYFFLLFKGDPSDYVYMEVELRRLSFLK  546



>ref|XP_009336747.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=1073

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +TPS   ++FE +   + +LW+ C+ PLVHRT+FF+L+ GDPSD +Y+EVELRRL  LK+
Sbjct  889  RTPSNWRLDFETQRGLIIQLWEACFVPLVHRTHFFILYNGDPSDFLYLEVELRRLTILKD  948

Query  187  KWSQGAEV  164
             +S+G+ +
Sbjct  949  TFSEGSNL  956



>tpg|DAA40600.1| TPA: hypothetical protein ZEAMMB73_646629 [Zea mays]
Length=657

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  385  VATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRR  206
            ++  S  +PS   I FE K KE+ ELW EC   +VHRTYFFLLFKGD  D +Y+EVE RR
Sbjct  478  ISVTSVDSPSRWPINFEKKQKEIIELWHECNVSIVHRTYFFLLFKGDKEDNIYLEVEHRR  537

Query  205  LHFLKNKWSQGAE  167
            L F+K+ +S  +E
Sbjct  538  LSFIKSSFSVASE  550



>ref|XP_006411686.1| hypothetical protein EUTSA_v10024409mg [Eutrema salsugineum]
 gb|ESQ53139.1| hypothetical protein EUTSA_v10024409mg [Eutrema salsugineum]
Length=828

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + +E+ ELW  C   LVHRTYF+LLFKGD +D +Y+ VELRRL F+K+++SQG + 
Sbjct  649  EFERQRQEILELWQTCNVSLVHRTYFYLLFKGDEADSIYIGVELRRLVFMKDRFSQGNQA  708

Query  163  ITDGQVLT  140
            +  G+ LT
Sbjct  709  LEAGETLT  716



>gb|AET03829.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1139

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = -3

Query  349   SIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA  170
             S EF++  KE+ ELW  C   LVHRTYFFLLFKG+PSD +YMEVELRRL +LK+      
Sbjct  966   SSEFKLLQKEIVELWHSCDVSLVHRTYFFLLFKGEPSDSIYMEVELRRLSYLKDN-----  1020

Query  169   EVITDGQVLT--KPERYF  122
             +++ DG+ LT    +RY 
Sbjct  1021  QILEDGRTLTPESSKRYL  1038



>ref|XP_004232466.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
Length=1019

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+M  KE+ ELW+ C   LVHRTYFFLLF+GD  D VY+EVE+RRL FL + +S G + 
Sbjct  843  EFKMLQKEIIELWNVCNISLVHRTYFFLLFQGDAKDAVYLEVEIRRLTFLNDTYSHGEKT  902

Query  163  ITDGQVLT  140
              +G++L+
Sbjct  903  EVNGRILS  910



>ref|XP_008221318.1| PREDICTED: kinesin-like protein NACK1 [Prunus mume]
Length=1069

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +T S   ++FE +   + ELWD C+ PLVHR +FFLL+KGDPSD +Y+EVELRRL  LK+
Sbjct  885  RTHSNWRLDFETQRGLIIELWDACFVPLVHRAHFFLLYKGDPSDFLYLEVELRRLTILKD  944

Query  187  KWSQGAEV  164
             +S+G+ +
Sbjct  945  TFSEGSNL  952



>gb|KEH20388.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1146

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = -3

Query  349   SIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA  170
             S EF++  KE+ ELW  C   LVHRTYFFLLFKG+PSD +YMEVELRRL +LK+      
Sbjct  973   SSEFKLLQKEIVELWHSCDVSLVHRTYFFLLFKGEPSDSIYMEVELRRLSYLKDN-----  1027

Query  169   EVITDGQVLT--KPERYF  122
             +++ DG+ LT    +RY 
Sbjct  1028  QILEDGRTLTPESSKRYL  1045



>ref|XP_002444630.1| hypothetical protein SORBIDRAFT_07g025040 [Sorghum bicolor]
 gb|EES14125.1| hypothetical protein SORBIDRAFT_07g025040 [Sorghum bicolor]
Length=1032

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = -3

Query  451  LLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRT  272
            ++ +A+   K     V   G+  A    ++PS+ + +FE K + + ELW EC   +VHRT
Sbjct  821  IMQQADRDEKTSTKTVRDIGVDSALSPFESPSHLTFDFEKKQQLIIELWHECNVSIVHRT  880

Query  271  YFFLLFKGDPSDLVYMEVELRRLHFLKNKWS  179
            YFFLLFKGDP+D +YMEVE RRL F+K+ +S
Sbjct  881  YFFLLFKGDPADNIYMEVEHRRLSFIKSSFS  911



>ref|XP_008678883.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
Length=850

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = -3

Query  466  KQLYQLLYEAE---EIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDEC  296
            K++ Q+ Y+ +   +I    F  +   GL     + Q+PS   +EFE K +E+  LW  C
Sbjct  622  KEMAQVHYQKQLGNQITNGEFVDIKNIGLDPIADASQSPSRWPLEFEKKQQEIIGLWHAC  681

Query  295  YAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQG  173
               LVHRTYFFLLFKG+ +D +YMEVELRRL FL++ +S+G
Sbjct  682  CISLVHRTYFFLLFKGEQADSIYMEVELRRLSFLRDTYSRG  722



>ref|XP_009123681.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=1060

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLK  191
            +FE + +++ ELW  C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK
Sbjct  884  DFERQQRQIIELWAVCNVPLVHRTYFFLLFKGDPSDYVYMEVELRRLSFLK  934



>ref|XP_008678882.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 gb|AFW63203.1| kinesin heavy chain [Zea mays]
Length=880

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = -3

Query  466  KQLYQLLYEAE---EIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDEC  296
            K++ Q+ Y+ +   +I    F  +   GL     + Q+PS   +EFE K +E+  LW  C
Sbjct  652  KEMAQVHYQKQLGNQITNGEFVDIKNIGLDPIADASQSPSRWPLEFEKKQQEIIGLWHAC  711

Query  295  YAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQG  173
               LVHRTYFFLLFKG+ +D +YMEVELRRL FL++ +S+G
Sbjct  712  CISLVHRTYFFLLFKGEQADSIYMEVELRRLSFLRDTYSRG  752



>ref|XP_009777060.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Nicotiana 
sylvestris]
Length=889

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 68/131 (52%), Gaps = 4/131 (3%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            GL     S + PS   +EF    K + ELW  C+  L+HRTYFFLLFKGDP D +YMEVE
Sbjct  718  GLDPMPDSLEVPSDWPLEFGKLQKRIIELWQTCHISLIHRTYFFLLFKGDPLDSIYMEVE  777

Query  214  LRRLHFLKNKWSQGAEVITDGQVLTKPERYFSLPLSLHSSCAHTIAKEH*ND---QVFYL  44
            +RRL FLK  + +G      GQ +       +L     ++ +  I K    D   ++F+ 
Sbjct  778  VRRLSFLKETFLKGNSAFQGGQTVGLASSLKALRRE-RATLSRLIYKRFPGDERNEIFHK  836

Query  43   FSTALKHSRRR  11
            +   L   RRR
Sbjct  837  WGIKLSSKRRR  847



>ref|XP_010033468.1| PREDICTED: kinesin-like protein NACK1 [Eucalyptus grandis]
 gb|KCW53109.1| hypothetical protein EUGRSUZ_J02401 [Eucalyptus grandis]
Length=952

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = -3

Query  352  GSIE----FEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            GS+E    F+   KE+ +LW EC   LVHR+YFFLLFKGDP+D +Y+EVELRRL FL++K
Sbjct  768  GSLEWLSHFKNLQKEIVKLWKECNVSLVHRSYFFLLFKGDPTDSIYLEVELRRLSFLRDK  827

Query  184  WSQGAEVITDGQVLT  140
             ++  + + D Q LT
Sbjct  828  SARCNQALEDSQALT  842



>ref|XP_009407965.1| PREDICTED: kinesin-like protein NACK2 [Musa acuminata subsp. 
malaccensis]
Length=959

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -3

Query  394  GLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVE  215
            G+     S ++PS   IEF+ K +E+ ELW  C   LVHRTYFFLLFKGDPSD  Y+EVE
Sbjct  763  GVDSVLYSIESPSRWPIEFQRKQQEIIELWHACNVSLVHRTYFFLLFKGDPSDSFYLEVE  822

Query  214  LRRLHFLKN  188
             RRL FL+N
Sbjct  823  NRRLSFLRN  831



>ref|XP_008668211.1| PREDICTED: uncharacterized protein LOC100304245 isoform X1 [Zea 
mays]
Length=874

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  385  VATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRR  206
            ++  S  +PS   I FE K KE+ ELW EC   +VHRTYFFLLFKGD  D +Y+EVE RR
Sbjct  695  ISVTSVDSPSRWPINFEKKQKEIIELWHECNVSIVHRTYFFLLFKGDKEDNIYLEVEHRR  754

Query  205  LHFLKNKWSQGAE  167
            L F+K+ +S  +E
Sbjct  755  LSFIKSSFSVASE  767



>ref|XP_006285338.1| hypothetical protein CARUB_v10006728mg [Capsella rubella]
 gb|EOA18236.1| hypothetical protein CARUB_v10006728mg [Capsella rubella]
Length=1014

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            EF+ +  ++ ELW+ C  PLVHRTYFFLLFKGDPSD VYMEVELRRL FLK+
Sbjct  842  EFKRQQSQIMELWELCNVPLVHRTYFFLLFKGDPSDFVYMEVELRRLSFLKD  893



>ref|XP_009772334.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
Length=1027

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (63%), Gaps = 1/104 (1%)
 Frame = -3

Query  448  LYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTY  269
            ++EAE  H +    V   GL       ++ S  + EF++  KE+ ELW  C   LVHRTY
Sbjct  815  VHEAEPEHHKLSKCVRDVGLDPIEDELKSLSSWTSEFKILQKEIMELWHVCNISLVHRTY  874

Query  268  FFLLFKG-DPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQVLT  140
            FFLLF+G DP D VYMEVE+RRL FL + +++G + + +G+ L+
Sbjct  875  FFLLFQGDDPKDAVYMEVEIRRLTFLNDIYTRGEKTVVNGRTLS  918



>ref|XP_003629353.1| Kinesin heavy chain DNA binding protein-like protein [Medicago 
truncatula]
Length=1167

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 7/78 (9%)
 Frame = -3

Query  349   SIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGA  170
             S EF++  KE+ ELW  C   LVHRTYFFLLFKG+PSD +YMEVELRRL +LK+      
Sbjct  994   SSEFKLLQKEIVELWHSCDVSLVHRTYFFLLFKGEPSDSIYMEVELRRLSYLKDN-----  1048

Query  169   EVITDGQVLT--KPERYF  122
             +++ DG+ LT    +RY 
Sbjct  1049  QILEDGRTLTPESSKRYL  1066



>ref|XP_008668212.1| PREDICTED: uncharacterized protein LOC100304245 isoform X2 [Zea 
mays]
Length=873

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  385  VATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRR  206
            ++  S  +PS   I FE K KE+ ELW EC   +VHRTYFFLLFKGD  D +Y+EVE RR
Sbjct  694  ISVTSVDSPSRWPINFEKKQKEIIELWHECNVSIVHRTYFFLLFKGDKEDNIYLEVEHRR  753

Query  205  LHFLKNKWSQGAE  167
            L F+K+ +S  +E
Sbjct  754  LSFIKSSFSVASE  766



>gb|AAK91812.1|AF272749_1 kinesin heavy chain [Zea mays]
Length=766

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = -3

Query  466  KQLYQLLYEAE---EIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDEC  296
            K++ Q+ Y+ +   +I    F  +   GL     + Q+PS   +EFE K +E+  LW  C
Sbjct  538  KEMAQVHYQKQLGNQITNGEFVDIKNIGLDPIADASQSPSRWPLEFEKKQQEIIGLWHAC  597

Query  295  YAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQG  173
               LVHRTYFFLLFKG+ +D +YMEVELRRL FL++ +S+G
Sbjct  598  CISLVHRTYFFLLFKGEQADSIYMEVELRRLSFLRDTYSRG  638



>gb|EEC83991.1| hypothetical protein OsI_30145 [Oryza sativa Indica Group]
Length=969

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +PS   I+FE   +E+ +LW EC AP+VHRTYFFLLFKGDP+D +YMEVE RRL F+++
Sbjct  810  SPSRWPIDFEKMRQEIIQLWHECNAPIVHRTYFFLLFKGDPADNIYMEVEHRRLSFIRS  868



>dbj|BAF02000.1| kinesin like protein [Arabidopsis thaliana]
Length=836

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + +E+ ELW  C   LVHRTYF+LLFKGD +D +Y+ VELRRL F+K+ +SQG + 
Sbjct  657  EFERQRQEILELWQTCNISLVHRTYFYLLFKGDEADSIYIGVELRRLLFMKDSFSQGNQA  716

Query  163  ITDGQVLT  140
            +  G+ LT
Sbjct  717  LEGGETLT  724



>ref|NP_195606.2| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 ref|NP_001119143.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE86997.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE86998.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=836

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + +E+ ELW  C   LVHRTYF+LLFKGD +D +Y+ VELRRL F+K+ +SQG + 
Sbjct  657  EFERQRQEILELWQTCNISLVHRTYFYLLFKGDEADSIYIGVELRRLLFMKDSFSQGNQA  716

Query  163  ITDGQVLT  140
            +  G+ LT
Sbjct  717  LEGGETLT  724



>ref|XP_006340707.1| PREDICTED: kinesin-like protein NACK1-like [Solanum tuberosum]
Length=1023

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+M  KE+ ELW+ C   LVHRTYFFLLF+GD  D VY+EVE+RRL FL + +S G + 
Sbjct  847  EFKMLQKEIIELWNACNISLVHRTYFFLLFQGDAKDAVYLEVEIRRLTFLNDTYSHGEKT  906

Query  163  ITDGQVLT  140
              +G+ L+
Sbjct  907  EVNGRTLS  914



>ref|XP_007226270.1| hypothetical protein PRUPE_ppa019074mg [Prunus persica]
 gb|EMJ27469.1| hypothetical protein PRUPE_ppa019074mg [Prunus persica]
Length=1044

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -3

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            +T S   ++FE +   + ELWD C+ PLVHR +FFLL+KGDPSD +Y+EVELRRL  +K+
Sbjct  860  RTHSNWRLDFETQRGLIIELWDACFVPLVHRAHFFLLYKGDPSDFLYLEVELRRLIIIKD  919

Query  187  KWSQGAEV  164
             +S+G+ +
Sbjct  920  TFSEGSNL  927



>ref|XP_010690757.1| PREDICTED: kinesin-like protein NACK1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690758.1| PREDICTED: kinesin-like protein NACK1 [Beta vulgaris subsp. vulgaris]
Length=894

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 62/120 (52%), Gaps = 5/120 (4%)
 Frame = -3

Query  505  LCSGTKDAKPNSEKQLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKM  326
              +G KDAK   EKQ     +   ++  E    +   GL        T     ++FE   
Sbjct  665  FVAGLKDAKLQYEKQ-----FGDSQVPSEMRKTLRDVGLDPMFDGEATTLDWRLQFEKLQ  719

Query  325  KEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQV  146
            K + ELW  C   LVHRTYFFLLF GDP+D +Y+EVELRRL FLK+ +S G   +  G  
Sbjct  720  KAIIELWQTCNVSLVHRTYFFLLFTGDPTDSIYLEVELRRLTFLKDTFSHGNRSVDGGHA  779



>emb|CAB38815.1| kinesin like protein [Arabidopsis thaliana]
 emb|CAB80558.1| kinesin like protein [Arabidopsis thaliana]
Length=834

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + +E+ ELW  C   LVHRTYF+LLFKGD +D +Y+ VELRRL F+K+ +SQG + 
Sbjct  655  EFERQRQEILELWQTCNISLVHRTYFYLLFKGDEADSIYIGVELRRLLFMKDSFSQGNQA  714

Query  163  ITDGQVLT  140
            +  G+ LT
Sbjct  715  LEGGETLT  722



>gb|KHN33713.1| Centromere-associated protein E [Glycine soja]
Length=899

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 73/136 (54%), Gaps = 5/136 (4%)
 Frame = -3

Query  538  NEDAKTMLEKKLCSGTKD-AKPNSEKQLYQLLYE--AEEIHKEFFAQVAGEGLAVATVSH  368
            NED  ++  +   +G K+  K   EKQL     +  AE     F   +   G+     + 
Sbjct  660  NEDVTSL--QTFVAGMKEMVKLEYEKQLVDDDQDQQAETTTFRFEKNMKDVGVGSMLEAP  717

Query  367  QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKN  188
            ++P    ++F+ +  E+ ELW  C   L HRTYFFLLF+GDP+D +YMEVELRRL FLK 
Sbjct  718  ESPVEWPLQFKQQQTEIVELWQACNVSLFHRTYFFLLFRGDPTDSIYMEVELRRLSFLKE  777

Query  187  KWSQGAEVITDGQVLT  140
             ++ G +   D   +T
Sbjct  778  TFASGNQSTNDAHTVT  793



>ref|XP_002868873.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45132.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=836

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + +E+ +LW  C   LVHRTYF+LLFKGD +D +Y+ VE+RRL F+K+ +SQG + 
Sbjct  657  EFERQRQEILDLWQTCNISLVHRTYFYLLFKGDEADSIYIGVEIRRLLFMKDSFSQGNQA  716

Query  163  ITDGQVLTKPERYFSL--PLSLHSSCAHTIAKEH*NDQVFYLFSTALKHSRRR  11
            +  G+ LT      +L     + S        E    ++++ F  A+   RRR
Sbjct  717  LEGGETLTLASSRKALHRERKMLSKLVGKRFSEEERKRIYHKFGIAVNSKRRR  769



>ref|XP_011100938.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=998

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -3

Query  346  IEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAE  167
            +EF+   +E+  LW  C   L HRTYFFLLF+GDPSD +Y+E+E+RR+ FLK K+S+G +
Sbjct  820  VEFKRLQREIINLWHACNISLAHRTYFFLLFQGDPSDAIYLEIEMRRMKFLKEKFSRGEK  879

Query  166  VITDGQVLT  140
                G+ LT
Sbjct  880  ATVYGKRLT  888



>ref|XP_003607070.1| Kinesin-related protein [Medicago truncatula]
 gb|AES89267.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=853

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNK  185
            TP   S++F+ + KE+ ELW  CY PL HRTYFFLLF+G+ +D +YMEVELRRL FLK  
Sbjct  692  TPLDWSLQFKRQQKEIIELWQSCYVPLTHRTYFFLLFRGEQTDSIYMEVELRRLCFLKET  751

Query  184  WSQGAEVITDGQVLT  140
            +    +   D Q +T
Sbjct  752  FFDENQSEKDSQTIT  766



>dbj|BAF00479.1| hypothetical protein [Arabidopsis thaliana]
Length=231

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + +++  LW  C+  LVHRTYFFLLF GD +D +Y+ VELRRL F+K  +SQG   
Sbjct  53   EFERQREQILGLWQTCHVSLVHRTYFFLLFTGDQADSIYIGVELRRLSFMKESFSQGNHA  112

Query  163  ITDGQVLT  140
               GQ LT
Sbjct  113  FERGQTLT  120



>ref|XP_008452056.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Cucumis melo]
Length=891

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKG-DPSDLVYMEVELRRLHFLKN  188
            +PS    EF    K++ ELW  C   LVHRTYFFLLF+G DP+D +Y+EVELRRL FL++
Sbjct  806  SPSKWPSEFRRLQKDIIELWHICNVSLVHRTYFFLLFQGGDPADSIYLEVELRRLSFLRD  865

Query  187  KWSQGAEVITDGQVLTKPER  128
             + +G   + +G+ LT+  R
Sbjct  866  TFGRGNPTVRNGETLTQALR  885



>ref|XP_004160983.1| PREDICTED: uncharacterized LOC101218717 [Cucumis sativus]
Length=992

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKG-DPSDLVYMEVELRRLHFLKN  188
            +PS    EF    K++ ELW  C   LVHRTYFFLLF+G DP+D +YMEVELRRL FL++
Sbjct  805  SPSKWPSEFRRLQKDIIELWHICNVSLVHRTYFFLLFQGGDPADSIYMEVELRRLSFLRD  864

Query  187  KWSQGAEVITDGQVLTKPERYFSL  116
             + +G   + +G+ LT+     SL
Sbjct  865  TFCRGNPTVRNGETLTQALSLKSL  888



>gb|KGN53326.1| hypothetical protein Csa_4G047870 [Cucumis sativus]
Length=993

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKG-DPSDLVYMEVELRRLHFLKN  188
            +PS    EF    K++ ELW  C   LVHRTYFFLLF+G DP+D +YMEVELRRL FL++
Sbjct  806  SPSKWPSEFRRLQKDIIELWHICNVSLVHRTYFFLLFQGGDPADSIYMEVELRRLSFLRD  865

Query  187  KWSQGAEVITDGQVLTKPERYFSL  116
             + +G   + +G+ LT+     SL
Sbjct  866  TFCRGNPTVRNGETLTQALSLKSL  889



>ref|XP_003603728.1| Kinesin-related protein [Medicago truncatula]
Length=1529

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = -3

Query  343   EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
             +FEM+ +++ ELWD C  PLVHR+YFFLL KG+ SD VY++VELRRL FLK+ +S G + 
Sbjct  1352  KFEMQQRDIVELWDACNVPLVHRSYFFLLIKGELSDSVYLDVELRRLSFLKDTFSSGNQT  1411

Query  163   I-TDGQVLTKPERYFSL  116
                +G  +T      SL
Sbjct  1412  TGVEGHDVTPNSSLLSL  1428



>ref|XP_004146557.1| PREDICTED: uncharacterized protein LOC101218717 [Cucumis sativus]
Length=1000

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKG-DPSDLVYMEVELRRLHFLKN  188
            +PS    EF    K++ ELW  C   LVHRTYFFLLF+G DP+D +YMEVELRRL FL++
Sbjct  813  SPSKWPSEFRRLQKDIIELWHICNVSLVHRTYFFLLFQGGDPADSIYMEVELRRLSFLRD  872

Query  187  KWSQGAEVITDGQVLTKPERYFSL  116
             + +G   + +G+ LT+     SL
Sbjct  873  TFCRGNPTVRNGETLTQALSLKSL  896



>gb|AES73979.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1520

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = -3

Query  343   EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
             +FEM+ +++ ELWD C  PLVHR+YFFLL KG+ SD VY++VELRRL FLK+ +S G + 
Sbjct  1343  KFEMQQRDIVELWDACNVPLVHRSYFFLLIKGELSDSVYLDVELRRLSFLKDTFSSGNQT  1402

Query  163   I-TDGQVLTKPERYFSL  116
                +G  +T      SL
Sbjct  1403  TGVEGHDVTPNSSLLSL  1419



>ref|XP_008775732.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Phoenix dactylifera]
Length=918

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = -3

Query  391  LAVATVSH--QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEV  218
            +++ T+S+  + P    +EFE K +E+ ELW  C   L+HRTYFF+LFKGDP+D +YMEV
Sbjct  823  VSLDTISNSLEVPFQWHMEFEKKQQEIVELWHTCNVSLIHRTYFFILFKGDPADSIYMEV  882

Query  217  ELRRLHFLKNKWSQ  176
            E RRL FLKN  S 
Sbjct  883  EHRRLSFLKNTISH  896



>ref|NP_001063734.2| Os09g0528000 [Oryza sativa Japonica Group]
 dbj|BAD46370.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAG93071.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF25648.2| Os09g0528000 [Oryza sativa Japonica Group]
Length=862

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 9/80 (11%)
 Frame = -3

Query  385  VATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRR  206
            VATVS    S   I+FE K +E+ ELW +C   +VHRTYFFLLFKGD +D +YMEVE RR
Sbjct  683  VATVS---LSKWHIDFERKQQEIIELWHDCNVSIVHRTYFFLLFKGDQTDSIYMEVEHRR  739

Query  205  LHFLKNKWSQGAEVITDGQV  146
            L F+KN       +I DG++
Sbjct  740  LSFIKNS------LIADGEL  753



>gb|EEE70089.1| hypothetical protein OsJ_30085 [Oryza sativa Japonica Group]
Length=870

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 9/80 (11%)
 Frame = -3

Query  385  VATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRR  206
            VATVS    S   I+FE K +E+ ELW +C   +VHRTYFFLLFKGD +D +YMEVE RR
Sbjct  691  VATVS---LSKWHIDFERKQQEIIELWHDCNVSIVHRTYFFLLFKGDQTDSIYMEVEHRR  747

Query  205  LHFLKNKWSQGAEVITDGQV  146
            L F+KN       +I DG++
Sbjct  748  LSFIKNS------LIADGEL  761



>ref|XP_008775730.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Phoenix dactylifera]
Length=1022

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = -3

Query  391  LAVATVSH--QTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEV  218
            +++ T+S+  + P    +EFE K +E+ ELW  C   L+HRTYFF+LFKGDP+D +YMEV
Sbjct  823  VSLDTISNSLEVPFQWHMEFEKKQQEIVELWHTCNVSLIHRTYFFILFKGDPADSIYMEV  882

Query  217  ELRRLHFLKNKWSQ  176
            E RRL FLKN  S 
Sbjct  883  EHRRLSFLKNTISH  896



>ref|XP_010436987.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010436988.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010436989.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=837

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 63/114 (55%), Gaps = 3/114 (3%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + +E+ ELW  C   LVHRTYF+LLFKGD +D +Y+ VELRRL F+K+ +SQG + 
Sbjct  657  EFERQRQEILELWQTCNISLVHRTYFYLLFKGDEADSIYIGVELRRLLFMKDSFSQGNQA  716

Query  163  ITDGQ---VLTKPERYFSLPLSLHSSCAHTIAKEH*NDQVFYLFSTALKHSRRR  11
            + +G     L    +       + S        E    ++++ F  A+   RRR
Sbjct  717  LEEGGETITLASSRKALHRERKMLSKLVGKRFSEEERRRIYHKFGIAVNSKRRR  770



>dbj|BAK06679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = -3

Query  409  QVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLV  230
            QV     +  + + ++PS  S +F  K +E+ ELW EC+  +VHRTYFFLLF GD +D +
Sbjct  703  QVQAGTDSSTSTTFESPSRWSFDFPKKQQEIIELWHECHISIVHRTYFFLLFNGDHTDHI  762

Query  229  YMEVELRRLHFLKNKWSQGAEVITDGQ  149
            YMEVE RRL F+KN +      I DG+
Sbjct  763  YMEVEHRRLSFIKNSF------IADGE  783



>ref|XP_010446407.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010446408.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010446410.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010446411.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Camelina sativa]
 ref|XP_010446412.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010446413.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=837

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + +E+ ELW  C   LVHRTYF+LLFKGD +D +YM VELRRL F+K+ +SQG + 
Sbjct  657  EFERQRQEILELWQTCNISLVHRTYFYLLFKGDEADSIYMGVELRRLLFMKDSFSQGNQA  716

Query  163  ITDG  152
            + +G
Sbjct  717  LEEG  720



>emb|CDY13822.1| BnaA09g43240D [Brassica napus]
Length=862

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 85/168 (51%), Gaps = 21/168 (13%)
 Frame = -3

Query  631  EECSGRQEERDETTQLMG-DTTASEPCFTTLLNEDAKTMLEKKLCSGTKD--AKP-NSEK  464
            E  SG +  R+++    G D+T +    T ++ ED      +    G K+  + P NS K
Sbjct  601  ESGSGNKLLRNDSMSSRGTDSTEAHSVGTPMVGEDGGITSIRSFVEGLKEMVSDPDNSGK  660

Query  463  QLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPL  284
                +  EA E       +V+G           T +  + EF  + +++ ELW  C+  L
Sbjct  661  MGNDIGLEAME------KEVSG-----------TMTNWAEEFNRQREQILELWQTCHVSL  703

Query  283  VHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQVLT  140
            VHRTYFFLLF GD +D +Y+ VELRRL F+K  +SQG +    GQ LT
Sbjct  704  VHRTYFFLLFTGDQADSIYIGVELRRLSFMKESFSQGNKAFERGQTLT  751



>ref|XP_008448048.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
 ref|XP_008448049.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
 ref|XP_008448050.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
Length=930

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EF+ + + + ELW  C   +VHRTYFFLLF+GDP+D +YMEVELRRL FLK  +  G   
Sbjct  753  EFQRQQRMIIELWQTCNVSIVHRTYFFLLFQGDPADSIYMEVELRRLTFLKQTFYYGNSA  812

Query  163  ITDGQVLT  140
            + DG+ ++
Sbjct  813  MDDGRKVS  820



>ref|XP_008452051.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452052.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452053.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452054.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452055.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
Length=993

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = -3

Query  364  TPSYGSIEFEMKMKEVFELWDECYAPLVHRTYFFLLFKG-DPSDLVYMEVELRRLHFLKN  188
            +PS    EF    K++ ELW  C   LVHRTYFFLLF+G DP+D +Y+EVELRRL FL++
Sbjct  806  SPSKWPSEFRRLQKDIIELWHICNVSLVHRTYFFLLFQGGDPADSIYLEVELRRLSFLRD  865

Query  187  KWSQGAEVITDGQVLTKPERYFSL  116
             + +G   + +G+ LT+     SL
Sbjct  866  TFGRGNPTVRNGETLTQALSLKSL  889



>dbj|BAD93933.1| putative kinesin heavy chain [Arabidopsis thaliana]
Length=619

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -3

Query  343  EFEMKMKEVFELWDECYAPLVHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEV  164
            EFE + +++  LW  C+  LVHRTYFFLLF GD +D +Y+ VELRRL F+K  +SQG   
Sbjct  441  EFERQREQILGLWQTCHVSLVHRTYFFLLFTGDQADSIYIGVELRRLSFMKESFSQGNHA  500

Query  163  ITDGQVLT  140
               GQ LT
Sbjct  501  FERGQTLT  508



>emb|CDX82016.1| BnaC08g35850D [Brassica napus]
Length=862

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 85/168 (51%), Gaps = 21/168 (13%)
 Frame = -3

Query  631  EECSGRQEERDETTQLMG-DTTASEPCFTTLLNEDAKTMLEKKLCSGTKD--AKP-NSEK  464
            E  SG +  R+++    G D+T +    T ++ ED      +    G K+  + P NS K
Sbjct  601  ESGSGNKLLRNDSMSSRGSDSTEAHSVGTPMVGEDGGITSIRSFVEGLKEMVSDPDNSGK  660

Query  463  QLYQLLYEAEEIHKEFFAQVAGEGLAVATVSHQTPSYGSIEFEMKMKEVFELWDECYAPL  284
                +  EA E       +V+G           T +  + EF  + +++ ELW  C+  L
Sbjct  661  LGNDISLEAME------KEVSG-----------TMTNWAEEFNRQREQILELWQTCHVSL  703

Query  283  VHRTYFFLLFKGDPSDLVYMEVELRRLHFLKNKWSQGAEVITDGQVLT  140
            VHRTYFFLLF GD +D +Y+ VELRRL F+K  +SQG +    GQ LT
Sbjct  704  VHRTYFFLLFTGDQADSIYIGVELRRLSFMKESFSQGNKAFERGQTLT  751



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1259863733868