BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c88712_g1_i1 len=683 path=[661:0-682]

Length=683
                                                                      Score     E

ref|XP_009606945.1|  PREDICTED: ethylene-responsive transcription...    127   3e-32   
ref|XP_009765938.1|  PREDICTED: ethylene-responsive transcription...    127   6e-32   
emb|CBJ55933.1|  ethylene response factor 2.2                           126   1e-31   
dbj|BAN45684.1|  ethylene response factor                               125   2e-31   
ref|XP_009611801.1|  PREDICTED: ethylene-responsive transcription...    121   1e-29   
gb|AHA93900.1|  ethylene response factor 10                             120   5e-29   
ref|XP_004235186.2|  PREDICTED: ethylene-responsive transcription...    120   5e-29   
gb|AHB33881.1|  ERF transcription factor 10                             120   6e-29   
emb|CDP05380.1|  unnamed protein product                                119   1e-28   
gb|ADJ67441.1|  ethylene response factor 12                             118   2e-28   
ref|XP_009771895.1|  PREDICTED: ethylene-responsive transcription...    117   4e-28   
ref|NP_001275603.1|  ethylene-responsive transcription factor 1-like    116   8e-28   
sp|Q40476.1|ERF1_TOBAC  RecName: Full=Ethylene-responsive transcr...    116   8e-28   Nicotiana tabacum [American tobacco]
gb|AGS80336.1|  ethylene response factor                                116   1e-27   
gb|AAC62619.1|  ethylene response element binding protein 1             114   1e-27   Nicotiana tabacum [American tobacco]
gb|EYU28602.1|  hypothetical protein MIMGU_mgv1a022521mg                115   2e-27   
dbj|BAN45683.1|  ethylene response factor                               113   9e-27   
gb|AGT21474.1|  ethylene responsive element binding factor-like         112   4e-26   
gb|AID51422.1|  ethylene response factor 17                             111   6e-26   
gb|EYU20174.1|  hypothetical protein MIMGU_mgv1a018364mg                108   8e-25   
sp|Q84XB3.1|ERF1_SOLLC  RecName: Full=Ethylene-responsive transcr...    107   3e-24   Solanum lycopersicum
ref|XP_011076437.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    107   3e-24   
ref|XP_006365341.1|  PREDICTED: ethylene-responsive transcription...    107   3e-24   
ref|XP_004239983.1|  PREDICTED: ethylene-responsive transcription...    106   3e-24   
gb|KDP22469.1|  hypothetical protein JCGZ_26300                         106   5e-24   
ref|XP_002279585.2|  PREDICTED: ethylene-responsive transcription...    106   6e-24   Vitis vinifera
ref|XP_011022365.1|  PREDICTED: ethylene-responsive transcription...    105   1e-23   
ref|XP_007038272.1|  AP2/ERF domain-containing transcription fact...    104   4e-23   
ref|NP_001275437.1|  Pti4                                               103   4e-23   
gb|AAC50047.1|  Pti4                                                    103   4e-23   Solanum lycopersicum
ref|XP_002304592.2|  hypothetical protein POPTR_0003s15030g             103   5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011026732.1|  PREDICTED: ethylene-responsive transcription...    103   8e-23   
ref|XP_002297926.1|  hypothetical protein POPTR_0001s11770g             102   2e-22   Populus trichocarpa [western balsam poplar]
gb|ADU76350.1|  ethylene responsive factor                              100   1e-21   
ref|XP_007218833.1|  hypothetical protein PRUPE_ppa010186mg             100   1e-21   
ref|XP_002511013.1|  Ethylene-responsive transcription factor, pu...  99.8    1e-21   Ricinus communis
gb|ACM49848.1|  ethylene responsive transcription factor 1b           99.4    3e-21   Prunus salicina [Japanese plum]
ref|XP_008234446.1|  PREDICTED: ethylene-responsive transcription...  99.0    3e-21   
gb|AEQ93554.1|  AP2/ERF transcription factor                          97.8    7e-21   
gb|AFB35653.1|  ERF8                                                  97.4    1e-20   
ref|XP_009362713.1|  PREDICTED: ethylene-responsive transcription...  97.1    3e-20   
gb|KDO39173.1|  hypothetical protein CISIN_1g028566mg                 94.7    4e-20   
ref|XP_006421523.1|  hypothetical protein CICLE_v10005891mg           94.7    4e-20   
ref|XP_010677103.1|  PREDICTED: ethylene-responsive transcription...  95.5    7e-20   
gb|ADL36574.1|  AP2D domain class transcription factor                95.1    1e-19   
gb|AGB07589.1|  ethylene-responsive transcription factor 6            93.6    1e-19   
ref|NP_001280848.1|  ethylene-responsive transcription factor 2-like  95.1    1e-19   
ref|XP_006490017.1|  PREDICTED: ethylene-responsive transcription...  93.2    2e-19   
ref|XP_008376369.1|  PREDICTED: ethylene-responsive transcription...  94.0    4e-19   
ref|XP_010025350.1|  PREDICTED: ethylene-responsive transcription...  92.8    6e-19   
ref|XP_007039732.1|  AP2/ERF domain-containing transcription fact...  92.4    7e-19   
ref|XP_010109127.1|  Ethylene-responsive transcription factor 2       92.4    8e-19   
ref|XP_009372828.1|  PREDICTED: ethylene-responsive transcription...  92.8    9e-19   
ref|XP_010275428.1|  PREDICTED: ethylene-responsive transcription...  92.4    1e-18   
ref|XP_002271614.1|  PREDICTED: ethylene-responsive transcription...  91.3    1e-18   Vitis vinifera
ref|XP_009370422.1|  PREDICTED: ethylene-responsive transcription...  92.0    1e-18   
ref|XP_009370421.1|  PREDICTED: ethylene-responsive transcription...  92.0    1e-18   
ref|XP_010258782.1|  PREDICTED: ethylene-responsive transcription...  91.3    2e-18   
ref|XP_004152388.1|  PREDICTED: ethylene-responsive transcription...  90.1    3e-18   
gb|EPS62607.1|  hypothetical protein M569_12181                       89.0    4e-18   
ref|XP_004307778.1|  PREDICTED: ethylene-responsive transcription...  90.5    4e-18   
ref|XP_008437026.1|  PREDICTED: ethylene-responsive transcription...  89.7    8e-18   
gb|AID55127.1|  ethylene responsive factor 70                         87.4    8e-18   
emb|CDY65883.1|  BnaAnng21280D                                        88.6    9e-18   
ref|XP_009130667.1|  PREDICTED: ethylene-responsive transcription...  89.0    1e-17   
dbj|BAP92132.1|  ethylene-responsive transcription factor homolog     85.1    1e-17   
gb|ACY74382.1|  ERF2 transcription factor                             88.2    2e-17   Brassica carinata [Abyssinian mustard]
dbj|BAP92157.1|  ethylene-responsive transcription factor homolog     84.7    2e-17   
dbj|BAP92178.1|  ethylene-responsive transcription factor homolog     84.7    2e-17   
gb|ACY74383.1|  ERF2 transcription factor                             88.2    2e-17   Brassica carinata [Abyssinian mustard]
gb|ABD65036.1|  ethylene responsive element binding factor, putative  87.8    2e-17   Brassica oleracea
dbj|BAP93298.1|  ethylene-responsive transcription factor homolog     84.7    2e-17   
emb|CDY68787.1|  BnaCnng60520D                                        87.8    2e-17   
ref|XP_006606323.1|  PREDICTED: ethylene-responsive transcription...  84.7    2e-17   
ref|XP_007209449.1|  hypothetical protein PRUPE_ppa009707mg           88.2    2e-17   
ref|XP_009108325.1|  PREDICTED: ethylene-responsive transcription...  87.8    2e-17   
ref|NP_199533.1|  ethylene-responsive transcription factor 2          87.8    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494952.1|  PREDICTED: ethylene-responsive transcription...  87.4    3e-17   
gb|EPS69901.1|  ethylene-responsive transcription factor 2            86.7    3e-17   
ref|XP_006398419.1|  hypothetical protein EUTSA_v10001003mg           87.8    3e-17   
gb|ADU76349.1|  ethylene responsive factor                            87.8    3e-17   
ref|XP_010053513.1|  PREDICTED: ethylene-responsive transcription...  88.2    3e-17   
ref|XP_002863350.1|  ATERF-2/ATERF2/ERF2                              87.0    3e-17   
ref|XP_009108637.1|  PREDICTED: ethylene-responsive transcription...  87.4    3e-17   
ref|XP_004245806.1|  PREDICTED: ethylene-responsive transcription...  87.0    3e-17   
gb|AAM64544.1|  ethylene responsive element binding factor 2 (ATE...  87.4    3e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAX07459.1|  ethylene-responsive element binding protein ERF5      86.3    3e-17   Gossypium hirsutum [American cotton]
ref|XP_004300354.1|  PREDICTED: ethylene-responsive transcription...  87.8    4e-17   
ref|XP_006279696.1|  hypothetical protein CARUB_v10027108mg           86.7    4e-17   
ref|XP_002304302.1|  hypothetical protein POPTR_0003s07910g           87.4    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_003549934.1|  PREDICTED: ethylene-responsive transcription...  87.0    5e-17   
ref|XP_010538473.1|  PREDICTED: ethylene-responsive transcription...  87.0    5e-17   
gb|ABN50365.2|  ethylene responsive element binding protein 1         87.0    5e-17   Gossypium barbadense [Egyptian cotton]
gb|ACJ54440.1|  AP2/EREBP transcription factor                        87.0    5e-17   
ref|XP_011047596.1|  PREDICTED: ethylene-responsive transcription...  87.0    5e-17   
dbj|BAA87068.2|  ethylene-responsive element binding protein1 hom...  86.7    5e-17   Matricaria chamomilla
ref|XP_011031947.1|  PREDICTED: ethylene-responsive transcription...  87.0    5e-17   
gb|KFK31389.1|  hypothetical protein AALP_AA6G105600                  86.7    5e-17   
ref|XP_002532361.1|  Ethylene-responsive transcription factor 1A,...  87.0    6e-17   Ricinus communis
ref|XP_003538752.2|  PREDICTED: ethylene-responsive transcription...  87.0    6e-17   
ref|XP_006284323.1|  hypothetical protein CARUB_v10005497mg           87.0    6e-17   
ref|XP_010104817.1|  Ethylene-responsive transcription factor 2       87.0    7e-17   
ref|XP_009333695.1|  PREDICTED: ethylene-responsive transcription...  86.7    8e-17   
ref|XP_002271494.1|  PREDICTED: ethylene-responsive transcription...  85.5    8e-17   Vitis vinifera
ref|XP_007157259.1|  hypothetical protein PHAVU_002G055700g           86.3    9e-17   
gb|ADE41120.1|  AP2 domain class transcription factor                 86.3    9e-17   
ref|XP_010441485.1|  PREDICTED: ethylene-responsive transcription...  85.9    1e-16   
gb|ADC55527.1|  ERF transcription factor                              85.5    1e-16   Camellia sinensis [black tea]
gb|AAF63205.1|AF245119_1  AP2-related transcription factor            85.9    1e-16   Mesembryanthemum crystallinum
ref|XP_010055446.1|  PREDICTED: ethylene-responsive transcription...  85.9    1e-16   
ref|XP_010481346.1|  PREDICTED: ethylene-responsive transcription...  85.5    1e-16   
dbj|BAG15867.1|  transcription factor                                 85.9    1e-16   Bruguiera gymnorhiza [Burma mangrove]
emb|CDX76569.1|  BnaA08g08310D                                        84.7    1e-16   
ref|XP_009617605.1|  PREDICTED: ethylene-responsive transcription...  85.5    2e-16   
ref|XP_004508948.1|  PREDICTED: ethylene-responsive transcription...  85.5    2e-16   
ref|XP_002271521.1|  PREDICTED: ethylene-responsive transcription...  84.7    2e-16   Vitis vinifera
emb|CDY38401.1|  BnaC01g10100D                                        84.7    2e-16   
ref|XP_003524070.1|  PREDICTED: ethylene-responsive transcription...  85.1    2e-16   
ref|XP_009775795.1|  PREDICTED: ethylene-responsive transcription...  85.1    2e-16   
emb|CDP10018.1|  unnamed protein product                              84.7    2e-16   
ref|XP_009608915.1|  PREDICTED: ethylene-responsive transcription...  84.7    2e-16   
dbj|BAP92184.1|  ethylene-responsive transcription factor homolog     81.6    3e-16   
gb|ACM49849.1|  ethylene responsive transcription factor 1a           85.1    3e-16   Prunus salicina [Japanese plum]
ref|XP_008352246.1|  PREDICTED: ethylene-responsive transcription...  85.1    3e-16   
gb|KFK24043.1|  hypothetical protein AALP_AAs42697U000400             84.7    3e-16   
ref|XP_008337240.1|  PREDICTED: ethylene-responsive transcription...  84.7    3e-16   
ref|XP_010439993.1|  PREDICTED: ethylene-responsive transcription...  84.7    3e-16   
ref|XP_006359239.1|  PREDICTED: ethylene-responsive transcription...  84.3    3e-16   
ref|XP_010434656.1|  PREDICTED: ethylene-responsive transcription...  84.7    4e-16   
ref|XP_010449604.1|  PREDICTED: ethylene-responsive transcription...  84.7    4e-16   
ref|XP_004164449.1|  PREDICTED: ethylene-responsive transcription...  84.7    4e-16   
ref|XP_004147226.1|  PREDICTED: ethylene-responsive transcription...  84.7    4e-16   
gb|AHN92189.1|  ERF protein 1                                         84.7    4e-16   
ref|XP_010518707.1|  PREDICTED: ethylene-responsive transcription...  84.3    4e-16   
ref|XP_011081402.1|  PREDICTED: ethylene-responsive transcription...  84.0    4e-16   
dbj|BAI52953.1|  ethylene responsive transcription factor 1a          84.3    4e-16   Citrullus lanatus subsp. vulgaris
ref|XP_003633905.1|  PREDICTED: ethylene-responsive transcription...  83.6    4e-16   
emb|CDY27923.1|  BnaCnng05080D                                        84.3    4e-16   
ref|XP_008448804.1|  PREDICTED: ethylene-responsive transcription...  84.3    4e-16   
emb|CAN82632.1|  hypothetical protein VITISV_028134                   83.6    4e-16   Vitis vinifera
ref|XP_006414221.1|  hypothetical protein EUTSA_v10027401mg           84.0    4e-16   
ref|XP_009796413.1|  PREDICTED: ethylene-responsive transcription...  84.0    4e-16   
emb|CAN81895.1|  hypothetical protein VITISV_007029                   83.6    5e-16   Vitis vinifera
ref|XP_006477125.1|  PREDICTED: ethylene-responsive transcription...  84.0    5e-16   
ref|XP_006368978.1|  hypothetical protein POPTR_0001s15390g           84.0    5e-16   
gb|KDO61316.1|  hypothetical protein CISIN_1g044938mg                 84.0    6e-16   
emb|CDY28965.1|  BnaA02g25110D                                        83.6    6e-16   
gb|ACY74381.1|  ERF2 transcription factor                             83.6    6e-16   Brassica napus [oilseed rape]
ref|XP_009128950.1|  PREDICTED: ethylene-responsive transcription...  83.6    6e-16   
gb|ACY74380.1|  ERF2 transcription factor                             83.6    6e-16   Brassica napus [oilseed rape]
ref|XP_004511721.1|  PREDICTED: ethylene-responsive transcription...  83.6    6e-16   
gb|KDP39921.1|  hypothetical protein JCGZ_03452                       84.0    6e-16   
ref|XP_006440234.1|  hypothetical protein CICLE_v10021652mg           83.6    8e-16   
ref|XP_002270581.2|  PREDICTED: ethylene-responsive transcription...  83.6    8e-16   Vitis vinifera
ref|XP_006358332.1|  PREDICTED: ethylene-responsive transcription...  82.8    8e-16   
ref|XP_009628437.1|  PREDICTED: ethylene-responsive transcription...  83.2    8e-16   
gb|EYU33029.1|  hypothetical protein MIMGU_mgv1a022878mg              83.6    8e-16   
ref|XP_004244707.2|  PREDICTED: ethylene-responsive transcription...  82.4    9e-16   
gb|ADE41134.1|  AP2 domain class transcription factor                 83.2    1e-15   
ref|XP_008337947.1|  PREDICTED: ethylene-responsive transcription...  83.2    1e-15   
ref|XP_008352414.1|  PREDICTED: ethylene-responsive transcription...  82.8    1e-15   
ref|XP_009611402.1|  PREDICTED: ethylene-responsive transcription...  82.8    1e-15   
ref|XP_009369100.1|  PREDICTED: ethylene-responsive transcription...  82.8    1e-15   
gb|AEQ64867.1|  ethylene response factor 11                           82.8    2e-15   
gb|AHZ31603.1|  ethylene-responsive transcription factor              82.0    2e-15   
gb|ADE41124.1|  AP2 domain class transcription factor                 82.0    2e-15   
gb|AGL08720.1|  ERF1                                                  80.9    3e-15   
gb|KCW62799.1|  hypothetical protein EUGRSUZ_G00391                   80.9    4e-15   
ref|XP_009800922.1|  PREDICTED: ethylene-responsive transcription...  81.6    4e-15   
ref|XP_007203750.1|  hypothetical protein PRUPE_ppa016903mg           81.3    5e-15   
ref|XP_009761318.1|  PREDICTED: ethylene-responsive transcription...  80.9    5e-15   
ref|NP_567530.4|  ethylene-responsive transcription factor 1A         81.3    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010068078.1|  PREDICTED: ethylene-responsive transcription...  80.9    5e-15   
dbj|BAA32418.1|  ethylene responsive element binding factor 1         80.9    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008232470.1|  PREDICTED: ethylene-responsive transcription...  81.3    6e-15   
dbj|BAG50059.1|  transcription factor AP2-EREBP                       80.9    7e-15   Lotus japonicus
ref|XP_003608658.1|  Ethylene-responsive transcription factor 1A      80.9    7e-15   
ref|XP_002870100.1|  hypothetical protein ARALYDRAFT_493126           79.7    7e-15   
gb|AGL34965.1|  ethylene-responsive transcription factor 6            80.9    7e-15   
emb|CAB45963.1|  EREBP-2 protein                                      80.1    8e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007203292.1|  hypothetical protein PRUPE_ppa025748mg           80.1    9e-15   
ref|XP_008376227.1|  PREDICTED: ethylene-responsive transcription...  80.1    1e-14   
ref|XP_006359238.1|  PREDICTED: ethylene-responsive transcription...  79.7    1e-14   
ref|XP_004308507.1|  PREDICTED: ethylene-responsive transcription...  79.3    1e-14   
emb|CBJ55932.1|  ethylene response factor 2.1                         79.3    1e-14   
ref|XP_010068077.1|  PREDICTED: ethylene-responsive transcription...  80.1    1e-14   
ref|XP_008232505.1|  PREDICTED: ethylene-responsive transcription...  79.3    2e-14   
ref|XP_009335578.1|  PREDICTED: ethylene-responsive transcription...  79.7    2e-14   
gb|KCW62802.1|  hypothetical protein EUGRSUZ_G00394                   80.1    2e-14   
ref|XP_010065367.1|  PREDICTED: ethylene-responsive transcription...  79.3    2e-14   
gb|KCW62805.1|  hypothetical protein EUGRSUZ_G00396                   78.2    2e-14   
gb|KDP28854.1|  hypothetical protein JCGZ_14625                       78.6    2e-14   
gb|KCW62801.1|  hypothetical protein EUGRSUZ_G00393                   79.0    2e-14   
gb|KCW62806.1|  hypothetical protein EUGRSUZ_G00397                   78.2    3e-14   
ref|XP_010065366.1|  PREDICTED: ethylene-responsive transcription...  78.6    3e-14   
ref|XP_010325512.1|  PREDICTED: ethylene-responsive transcription...  78.6    3e-14   
ref|XP_010068081.1|  PREDICTED: ethylene-responsive transcription...  78.6    3e-14   
ref|XP_009341335.1|  PREDICTED: ethylene-responsive transcription...  79.0    3e-14   
ref|XP_006445414.1|  hypothetical protein CICLE_v10022025mg           78.6    3e-14   
ref|XP_006375130.1|  hypothetical protein POPTR_0014s04640g           77.8    4e-14   
ref|XP_010089318.1|  Ethylene-responsive transcription factor 13      77.8    6e-14   
ref|XP_009114286.1|  PREDICTED: ethylene-responsive transcription...  77.8    6e-14   
gb|ABD64951.1|  ethylene responsive element binding factor, putative  77.8    6e-14   Brassica oleracea
emb|CDY25978.1|  BnaC09g20090D                                        77.8    6e-14   
ref|XP_010068083.1|  PREDICTED: ethylene-responsive transcription...  77.8    6e-14   
gb|AHA33628.1|  ERF2 transcription factor protein                     77.8    7e-14   
ref|XP_009335609.1|  PREDICTED: ethylene-responsive transcription...  77.0    7e-14   
emb|CDY43434.1|  BnaAnng07060D                                        77.4    7e-14   
ref|XP_008344394.1|  PREDICTED: ethylene-responsive transcription...  77.0    1e-13   
ref|XP_010068073.1|  PREDICTED: ethylene-responsive transcription...  77.0    1e-13   
gb|KCW62798.1|  hypothetical protein EUGRSUZ_G00390                   76.6    2e-13   
ref|XP_008232503.1|  PREDICTED: ethylene-responsive transcription...  76.3    2e-13   
ref|XP_010068075.1|  PREDICTED: ethylene-responsive transcription...  75.9    2e-13   
emb|CDX77750.1|  BnaC07g20040D                                        75.9    2e-13   
ref|XP_008363915.1|  PREDICTED: ethylene-responsive transcription...  75.5    2e-13   
ref|XP_006414077.1|  hypothetical protein EUTSA_v10027189mg           74.3    2e-13   
ref|XP_008345528.1|  PREDICTED: ethylene-responsive transcription...  75.5    2e-13   
gb|KCW62796.1|  hypothetical protein EUGRSUZ_G00388                   75.9    2e-13   
ref|XP_011031988.1|  PREDICTED: ethylene-responsive transcription...  75.5    3e-13   
emb|CDY33523.1|  BnaA06g35500D                                        75.5    3e-13   
ref|XP_007052303.1|  Ethylene-responsive element binding factor 1...  75.5    3e-13   
ref|XP_010068071.1|  PREDICTED: ethylene-responsive transcription...  75.9    3e-13   
ref|XP_002511592.1|  Ethylene-responsive transcription factor, pu...  75.5    3e-13   Ricinus communis
ref|XP_007052302.1|  Ethylene-responsive element binding factor 1...  75.9    3e-13   
ref|XP_002872976.1|  hypothetical protein ARALYDRAFT_912253           74.3    4e-13   
ref|XP_011101097.1|  PREDICTED: ethylene-responsive transcription...  74.7    4e-13   
ref|XP_007204071.1|  hypothetical protein PRUPE_ppb014367mg           75.5    4e-13   
emb|CDY30489.1|  BnaA04g25900D                                        75.1    4e-13   
ref|XP_002511588.1|  Ethylene-responsive transcription factor, pu...  75.1    4e-13   Ricinus communis
ref|XP_003529037.1|  PREDICTED: ethylene-responsive transcription...  74.7    5e-13   
ref|XP_011016089.1|  PREDICTED: ethylene-responsive transcription...  74.7    5e-13   
gb|KHN34531.1|  Ethylene-responsive transcription factor 2            74.7    5e-13   
ref|XP_006375127.1|  hypothetical protein POPTR_0014s04610g           74.7    5e-13   
gb|KEH17838.1|  AP2 domain class transcription factor                 74.3    6e-13   
ref|XP_011031966.1|  PREDICTED: ethylene-responsive transcription...  74.7    6e-13   
ref|XP_010424028.1|  PREDICTED: ethylene-responsive transcription...  73.9    6e-13   
ref|XP_010508242.1|  PREDICTED: ethylene-responsive transcription...  74.7    7e-13   
ref|XP_010508240.1|  PREDICTED: ethylene-responsive transcription...  74.7    7e-13   
ref|XP_011031975.1|  PREDICTED: ethylene-responsive transcription...  74.3    7e-13   
gb|KDO85528.1|  hypothetical protein CISIN_1g039729mg                 73.6    8e-13   
ref|XP_010508241.1|  PREDICTED: ethylene-responsive transcription...  74.3    8e-13   
ref|XP_009335608.1|  PREDICTED: ethylene-responsive transcription...  74.3    8e-13   
ref|XP_006375126.1|  hypothetical protein POPTR_0014s04600g           74.3    8e-13   
gb|AAM65925.1|  putative ethylene response element binding protei...  74.3    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006375129.1|  ethylene-responsive element binding protein 1    74.3    9e-13   
ref|XP_008232472.1|  PREDICTED: ethylene-responsive transcription...  73.9    9e-13   
gb|AFI98122.1|  ethylene-responsive element-binding protein 6         74.3    9e-13   
ref|XP_010068070.1|  PREDICTED: ethylene-responsive transcription...  74.3    9e-13   
ref|NP_182011.1|  ethylene-responsive transcription factor 13         74.3    9e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506419.1|  PREDICTED: ethylene-responsive transcription...  74.3    9e-13   
ref|XP_010518091.1|  PREDICTED: ethylene-responsive transcription...  74.3    9e-13   
ref|XP_006294915.1|  hypothetical protein CARUB_v10023967mg           74.3    1e-12   
ref|XP_009142287.1|  PREDICTED: ethylene-responsive transcription...  73.9    1e-12   
ref|XP_002880142.1|  hypothetical protein ARALYDRAFT_903921           73.9    1e-12   
ref|XP_011042382.1|  PREDICTED: ethylene-responsive transcription...  73.9    1e-12   
ref|XP_006397665.1|  hypothetical protein EUTSA_v10001758mg           73.9    1e-12   
ref|XP_011016088.1|  PREDICTED: ethylene-responsive transcription...  73.9    1e-12   
ref|XP_007203094.1|  hypothetical protein PRUPE_ppa023698mg           73.6    1e-12   
ref|XP_009335577.1|  PREDICTED: ethylene-responsive transcription...  73.9    1e-12   
ref|XP_006445417.1|  hypothetical protein CICLE_v10023677mg           73.6    1e-12   
ref|NP_001236246.1|  uncharacterized protein LOC100527194             73.6    1e-12   
ref|XP_008370005.1|  PREDICTED: ethylene-responsive transcription...  73.6    1e-12   
emb|CDY23459.1|  BnaC04g49870D                                        73.6    2e-12   
gb|EPS60385.1|  hypothetical protein M569_14419                       72.0    2e-12   
ref|XP_006348008.1|  PREDICTED: ethylene-responsive transcription...  73.2    2e-12   
ref|XP_007204029.1|  hypothetical protein PRUPE_ppa020417mg           73.2    2e-12   
gb|KHN40954.1|  Ethylene-responsive transcription factor 13           73.2    2e-12   
gb|KDP28852.1|  hypothetical protein JCGZ_14623                       73.2    2e-12   
ref|XP_010068079.1|  PREDICTED: ethylene-responsive transcription...  73.6    2e-12   
gb|KDP28855.1|  hypothetical protein JCGZ_14626                       72.8    3e-12   
ref|XP_009101439.1|  PREDICTED: ethylene-responsive transcription...  72.8    3e-12   
ref|XP_010426455.1|  PREDICTED: ethylene-responsive transcription...  72.0    3e-12   
ref|XP_008232471.1|  PREDICTED: ethylene-responsive transcription...  72.4    3e-12   
ref|XP_010058508.1|  PREDICTED: ethylene-responsive transcription...  72.4    3e-12   
gb|KCW62512.1|  hypothetical protein EUGRSUZ_G00002                   72.4    3e-12   
ref|XP_010067932.1|  PREDICTED: ethylene-responsive transcription...  72.8    3e-12   
ref|XP_008370115.1|  PREDICTED: ethylene-responsive transcription...  72.4    3e-12   
ref|XP_008238480.1|  PREDICTED: ethylene-responsive transcription...  72.4    3e-12   
emb|CDY56473.1|  BnaC04g53270D                                        72.4    4e-12   
ref|XP_009144089.1|  PREDICTED: ethylene-responsive transcription...  72.4    4e-12   
emb|CDX74692.1|  BnaA05g04380D                                        72.4    4e-12   
ref|XP_010089319.1|  Ethylene-responsive transcription factor 13      71.6    5e-12   
ref|XP_010544359.1|  PREDICTED: ethylene-responsive transcription...  71.2    5e-12   
ref|XP_011094429.1|  PREDICTED: ethylene-responsive transcription...  71.2    6e-12   
ref|XP_007134480.1|  hypothetical protein PHAVU_010G050800g           70.9    6e-12   
ref|XP_002511589.1|  Ethylene-responsive transcription factor, pu...  71.6    7e-12   
gb|KFK42581.1|  hypothetical protein AALP_AA1G014000                  70.9    7e-12   
ref|XP_006282733.1|  hypothetical protein CARUB_v10005868mg           70.9    7e-12   
ref|XP_008786271.1|  PREDICTED: ethylene-responsive transcription...  72.4    1e-11   
gb|KDO85527.1|  hypothetical protein CISIN_1g026607mg                 71.2    1e-11   
ref|XP_006445418.1|  hypothetical protein CICLE_v10021995mg           71.2    1e-11   
dbj|BAN58169.1|  ethylene response factor 91                          69.7    1e-11   
gb|KDP43273.1|  hypothetical protein JCGZ_22825                       70.9    1e-11   
ref|XP_010089316.1|  Ethylene-responsive transcription factor 13      71.2    1e-11   
ref|XP_010058509.1|  PREDICTED: ethylene-responsive transcription...  70.1    1e-11   
ref|XP_009593488.1|  PREDICTED: ethylene-responsive transcription...  70.5    1e-11   
gb|KEH17839.1|  ethylene response factor                              70.5    1e-11   
ref|XP_010325364.1|  PREDICTED: ethylene-responsive transcription...  70.1    1e-11   
gb|KHN34529.1|  Ethylene-responsive transcription factor 13           69.7    2e-11   
ref|XP_009798817.1|  PREDICTED: ethylene-responsive transcription...  70.5    2e-11   
ref|XP_007052304.1|  Ethylene-responsive element binding factor 1...  70.5    2e-11   
ref|XP_010056401.1|  PREDICTED: ethylene-responsive transcription...  70.1    2e-11   
gb|KCW73110.1|  hypothetical protein EUGRSUZ_E01561                   69.7    2e-11   
ref|XP_011094406.1|  PREDICTED: ethylene-responsive transcription...  70.1    2e-11   
ref|XP_007134477.1|  hypothetical protein PHAVU_010G050500g           70.1    2e-11   
pdb|2GCC|A  Chain A, Solution Structure Of The Gcc-Box Binding Do...  67.4    2e-11   
ref|XP_009401653.1|  PREDICTED: ethylene-responsive transcription...  71.2    2e-11   
ref|XP_010058510.1|  PREDICTED: pathogenesis-related genes transc...  70.1    2e-11   
ref|XP_009593489.1|  PREDICTED: ethylene-responsive transcription...  69.7    2e-11   
gb|ACU15472.1|  unknown                                               69.7    2e-11   
ref|XP_009609535.1|  PREDICTED: ethylene-responsive transcription...  70.1    2e-11   
ref|NP_001237801.1|  ethylene-responsive element binding protein 1    69.7    2e-11   
ref|XP_004515377.1|  PREDICTED: ethylene-responsive transcription...  69.7    2e-11   
gb|ABW77571.1|  AP2-domain DNA-binding protein ORCA3                  69.7    2e-11   
ref|XP_009787891.1|  PREDICTED: ethylene-responsive transcription...  69.3    2e-11   
gb|ABU40945.1|  AP2-domain DNA-binding protein                        69.7    2e-11   
ref|XP_010058507.1|  PREDICTED: ethylene-responsive transcription...  69.7    2e-11   
emb|CAB96899.1|  AP2-domain DNA-binding protein                       69.7    2e-11   
emb|CEF82730.1|  binding protein                                      69.7    3e-11   
gb|AFI98121.1|  ethylene-responsive element-binding protein 5         69.3    3e-11   
ref|XP_009400592.1|  PREDICTED: ethylene-responsive transcription...  70.9    3e-11   
ref|XP_004231147.1|  PREDICTED: ethylene-responsive transcription...  69.3    3e-11   
ref|XP_009781921.1|  PREDICTED: ethylene-responsive transcription...  69.7    3e-11   
ref|XP_004308505.1|  PREDICTED: ethylene-responsive transcription...  69.7    3e-11   
ref|XP_009341338.1|  PREDICTED: ethylene-responsive transcription...  69.7    4e-11   
dbj|BAJ99544.1|  predicted protein                                    70.1    4e-11   
dbj|BAK05766.1|  predicted protein                                    70.1    4e-11   
ref|XP_007052301.1|  Ethylene-responsive element binding factor 1...  68.6    5e-11   
gb|ABQ52686.1|  ethylene-responsive factor                            70.1    5e-11   
dbj|BAN58167.1|  ethylene response factor 168                         68.9    5e-11   
ref|XP_009118887.1|  PREDICTED: ethylene-responsive transcription...  68.2    5e-11   
tpg|DAA36591.1|  TPA: putative AP2/EREBP transcription factor sup...  69.7    6e-11   
ref|XP_010523200.1|  PREDICTED: ethylene-responsive transcription...  68.2    6e-11   
ref|XP_004492940.1|  PREDICTED: ethylene-responsive transcription...  68.6    6e-11   
emb|CAC39058.1|  putative AP2-related transcription factor            70.1    6e-11   
ref|XP_007139636.1|  hypothetical protein PHAVU_008G046400g           68.6    6e-11   
ref|XP_003530145.2|  PREDICTED: ethylene-responsive transcription...  68.6    6e-11   
ref|XP_004956406.1|  PREDICTED: ethylene-responsive transcription...  69.7    6e-11   
ref|XP_009609536.1|  PREDICTED: ethylene-responsive transcription...  68.6    6e-11   
emb|CDY38052.1|  BnaCnng09130D                                        67.8    6e-11   
ref|XP_008809462.1|  PREDICTED: ethylene-responsive transcription...  68.9    6e-11   
gb|EAZ31532.1|  hypothetical protein OsJ_15672                        69.7    7e-11   
dbj|BAN58165.1|  ethylene response factor 115                         68.9    7e-11   
ref|XP_008646008.1|  PREDICTED: ethylene-responsive transcription...  69.7    7e-11   
gb|EAY86936.1|  hypothetical protein OsI_08320                        69.7    7e-11   
ref|NP_001047614.1|  Os02g0654700                                     69.7    7e-11   
dbj|BAN58166.1|  ethylene response factor 179                         68.9    7e-11   
ref|XP_002448280.1|  hypothetical protein SORBIDRAFT_06g024355        69.7    7e-11   
ref|XP_009781920.1|  PREDICTED: ethylene-responsive transcription...  68.6    8e-11   
ref|XP_009384458.1|  PREDICTED: ethylene-responsive transcription...  69.7    8e-11   
ref|NP_001142230.1|  AP2-EREBP transcription factor                   69.3    8e-11   
gb|EAZ24048.1|  hypothetical protein OsJ_07777                        69.7    8e-11   
ref|XP_003570010.1|  PREDICTED: ethylene-responsive transcription...  69.3    8e-11   
ref|NP_001053474.1|  Os04g0546800                                     69.7    9e-11   
ref|XP_009389467.1|  PREDICTED: ethylene-responsive transcription...  68.6    9e-11   
ref|NP_001149871.1|  ethylene responsive protein                      68.9    9e-11   
emb|CAH67263.1|  OSIGBa0101C23.15                                     69.7    9e-11   
gb|EAY95058.1|  hypothetical protein OsI_16873                        69.7    1e-10   
ref|XP_004953322.1|  PREDICTED: ethylene-responsive transcription...  69.3    1e-10   
ref|XP_003521070.1|  PREDICTED: ethylene-responsive transcription...  67.4    1e-10   
gb|AFK42966.1|  unknown                                               67.4    2e-10   
ref|XP_008813598.1|  PREDICTED: ethylene-responsive transcription...  68.9    2e-10   
pdb|1GCC|A  Chain A, Solution Nmr Structure Of The Complex Of Gcc...  64.3    2e-10   
ref|XP_010933603.1|  PREDICTED: ethylene-responsive transcription...  68.6    2e-10   
gb|ABQ52687.1|  pathogen-inducible transcription factor ERF3          68.6    2e-10   
gb|KEH23452.1|  AP2-domain DNA-binding protein                        67.0    2e-10   
ref|XP_011094418.1|  PREDICTED: ethylene-responsive transcription...  66.6    3e-10   
ref|XP_010919713.1|  PREDICTED: ethylene-responsive transcription...  68.2    3e-10   
ref|XP_006345610.1|  PREDICTED: ethylene-responsive transcription...  66.6    3e-10   
gb|KEH23454.1|  AP2-domain DNA-binding protein                        66.6    3e-10   
ref|XP_006602878.1|  PREDICTED: ethylene-responsive transcription...  66.6    3e-10   
ref|XP_003580272.1|  PREDICTED: ethylene-responsive transcription...  67.8    3e-10   
ref|XP_002452817.1|  hypothetical protein SORBIDRAFT_04g033105        67.8    4e-10   
ref|NP_001152050.1|  ethylene-responsive transcription factor 2       67.4    4e-10   
gb|KHN11565.1|  Ethylene-responsive transcription factor 2            65.9    4e-10   
ref|XP_006375128.1|  ethylene-responsive element binding protein 1    64.7    4e-10   
ref|XP_004493050.1|  PREDICTED: ethylene-responsive transcription...  66.2    4e-10   
ref|XP_003534472.1|  PREDICTED: ethylene-responsive transcription...  65.9    5e-10   
gb|KEH17840.1|  ethylene response factor                              65.9    5e-10   
ref|XP_009625878.1|  PREDICTED: ethylene-responsive transcription...  66.2    6e-10   
ref|XP_009794568.1|  PREDICTED: ethylene-responsive transcription...  66.2    6e-10   
gb|KCW62795.1|  hypothetical protein EUGRSUZ_G00386                   65.5    6e-10   
ref|XP_009589160.1|  PREDICTED: ethylene-responsive transcription...  65.1    6e-10   
ref|XP_009407828.1|  PREDICTED: ethylene-responsive transcription...  66.2    7e-10   
ref|XP_009389700.1|  PREDICTED: ethylene-responsive transcription...  65.5    7e-10   
ref|XP_004515359.1|  PREDICTED: ethylene-responsive transcription...  65.1    9e-10   
gb|ADH04266.1|  ERF1                                                  65.5    1e-09   
ref|XP_009628238.1|  PREDICTED: ethylene-responsive transcription...  65.1    1e-09   
ref|XP_010934650.1|  PREDICTED: ethylene-responsive transcription...  65.5    1e-09   
ref|XP_006445413.1|  hypothetical protein CICLE_v10021132mg           66.6    1e-09   
ref|XP_007144191.1|  hypothetical protein PHAVU_007G135900g           64.7    1e-09   
ref|XP_009111538.1|  PREDICTED: ethylene-responsive transcription...  64.3    1e-09   
ref|XP_004143677.1|  PREDICTED: ethylene-responsive transcription...  65.1    1e-09   
gb|KGN50320.1|  hypothetical protein Csa_5G167120                     65.1    1e-09   
ref|XP_007134479.1|  hypothetical protein PHAVU_010G050700g           64.7    1e-09   
ref|XP_010089315.1|  Ethylene-responsive transcription factor 13      64.3    1e-09   
gb|AFK35104.1|  unknown                                               64.7    1e-09   
ref|XP_003520430.1|  PREDICTED: ethylene-responsive transcription...  64.3    2e-09   
ref|XP_009607861.1|  PREDICTED: ethylene-responsive transcription...  64.3    2e-09   
ref|XP_004158119.1|  PREDICTED: ethylene-responsive transcription...  65.1    2e-09   
gb|ACJ84415.1|  unknown                                               64.3    2e-09   
ref|XP_010559083.1|  PREDICTED: ethylene-responsive transcription...  64.7    2e-09   
gb|AEQ64868.1|  ethylene response factor 8                            64.3    2e-09   
ref|NP_001235253.1|  uncharacterized protein LOC100499732             64.3    2e-09   
gb|AFK33872.1|  unknown                                               64.3    2e-09   
gb|KHN37912.1|  Ethylene-responsive transcription factor ERF106       64.3    2e-09   
gb|ACJ85345.1|  unknown                                               64.3    2e-09   
gb|KHN00986.1|  Ethylene-responsive transcription factor ERF106       63.9    2e-09   
ref|NP_001237945.1|  uncharacterized protein LOC100306125             63.9    2e-09   
gb|KDO85532.1|  hypothetical protein CISIN_1g044584mg                 64.3    3e-09   
ref|XP_010058506.1|  PREDICTED: ethylene-responsive transcription...  64.3    3e-09   
ref|XP_003589850.1|  Ethylene-responsive transcription factor         63.9    3e-09   
gb|AEQ93555.1|  AP2/ERF transcription factor                          63.5    3e-09   
ref|XP_006577645.1|  PREDICTED: ethylene-responsive transcription...  62.8    3e-09   
ref|XP_007145470.1|  hypothetical protein PHAVU_007G241800g           63.5    4e-09   
ref|XP_010540289.1|  PREDICTED: ethylene-responsive transcription...  62.4    4e-09   
ref|XP_004308504.1|  PREDICTED: ethylene-responsive transcription...  63.9    4e-09   
ref|XP_009402135.1|  PREDICTED: ethylene-responsive transcription...  63.5    4e-09   
ref|XP_009625877.1|  PREDICTED: ethylene-responsive transcription...  63.2    6e-09   
ref|XP_001780900.1|  predicted protein                                60.1    7e-09   
ref|XP_008436974.1|  PREDICTED: ethylene-responsive transcription...  63.2    7e-09   
ref|XP_010321615.1|  PREDICTED: ethylene-responsive transcription...  62.4    8e-09   
ref|XP_004498071.1|  PREDICTED: ethylene-responsive transcription...  62.4    8e-09   
ref|XP_001759606.1|  predicted protein                                59.7    9e-09   
gb|AID51423.1|  ethylene response factor 18                           62.8    9e-09   
ref|XP_006445416.1|  hypothetical protein CICLE_v10022734mg           61.2    1e-08   
gb|KFK37282.1|  hypothetical protein AALP_AA4G236900                  62.4    1e-08   
ref|NP_001235847.1|  uncharacterized protein LOC100305726             62.0    1e-08   
gb|KEH30939.1|  ethylene response factor                              60.5    1e-08   
ref|XP_006347956.1|  PREDICTED: ethylene-responsive transcription...  62.0    1e-08   
gb|KHN31934.1|  Ethylene-responsive transcription factor ERF106       62.0    1e-08   
gb|KDO40008.1|  hypothetical protein CISIN_1g030002mg                 61.2    2e-08   
ref|XP_004134277.1|  PREDICTED: ethylene-responsive transcription...  60.8    2e-08   
gb|AEX12093.1|  hypothetical protein 0_3792_01                        60.8    2e-08   
gb|KDO40009.1|  hypothetical protein CISIN_1g030002mg                 61.2    2e-08   
gb|AIA57937.1|  ethylene responsive element binding factor            62.8    2e-08   
gb|AEX12092.1|  hypothetical protein 0_3792_01                        60.5    2e-08   
gb|KDP22468.1|  hypothetical protein JCGZ_26299                       62.8    2e-08   
gb|EYU31898.1|  hypothetical protein MIMGU_mgv1a020883mg              61.2    2e-08   
ref|XP_003591657.1|  Ethylene-responsive transcription factor         61.6    2e-08   
ref|NP_001235286.1|  uncharacterized protein LOC100500502             62.0    2e-08   
ref|XP_006396194.1|  hypothetical protein EUTSA_v10029212mg           60.5    2e-08   
gb|KHN30258.1|  Ethylene-responsive transcription factor ERF106       61.6    2e-08   
gb|AGB07588.1|  ethylene-responsive transcription factor 5            62.8    2e-08   
gb|KHN26289.1|  Ethylene-responsive transcription factor 13           61.2    2e-08   
emb|CDP09437.1|  unnamed protein product                              61.6    2e-08   
gb|KCW77824.1|  hypothetical protein EUGRSUZ_D02111                   62.4    2e-08   
ref|XP_006348007.1|  PREDICTED: ethylene-responsive transcription...  61.6    2e-08   
ref|XP_003520428.1|  PREDICTED: ethylene-responsive transcription...  61.2    2e-08   
emb|CDP05379.1|  unnamed protein product                              62.8    3e-08   
gb|ADJ67440.1|  ethylene response factor 11                           62.0    3e-08   
gb|AES92926.1|  transcription factor ERF1                             62.4    3e-08   
ref|XP_009372830.1|  PREDICTED: ethylene-responsive transcription...  61.6    3e-08   
ref|XP_009370425.1|  PREDICTED: ethylene-responsive transcription...  61.2    3e-08   
gb|AEK94317.1|  ERFAP2-like protein                                   61.2    3e-08   
ref|XP_006490013.1|  PREDICTED: ethylene-responsive transcription...  60.8    4e-08   
ref|XP_010315446.1|  PREDICTED: ethylene-responsive transcription...  60.8    4e-08   
ref|XP_006421533.1|  hypothetical protein CICLE_v10005863mg           60.8    4e-08   
gb|AAG43545.1|AF211527_1  Avr9/Cf-9 rapidly elicited protein 1        61.2    4e-08   
gb|AFP90351.1|  transcription factor 3                                60.8    4e-08   
gb|KDP28853.1|  hypothetical protein JCGZ_14624                       60.5    4e-08   
gb|AFP90350.1|  transcription factor 3                                60.8    4e-08   
ref|XP_008439350.1|  PREDICTED: ethylene-responsive transcription...  59.7    4e-08   
ref|XP_010053512.1|  PREDICTED: ethylene-responsive transcription...  62.4    4e-08   
ref|XP_011076436.1|  PREDICTED: ethylene-responsive transcription...  62.0    4e-08   
gb|AHA93911.1|  ethylene response factor 12                           61.2    4e-08   
ref|XP_010034985.1|  PREDICTED: ethylene-responsive transcription...  61.6    4e-08   
gb|AFP90343.1|  transcription factor 3                                60.8    4e-08   
gb|AFP90353.1|  transcription factor 3                                60.8    4e-08   
gb|AFP90335.1|  transcription factor 3                                60.8    4e-08   
gb|AFP90340.1|  transcription factor 3                                60.8    5e-08   
gb|AFP90339.1|  transcription factor 3                                60.8    5e-08   
gb|AFP90345.1|  transcription factor 3                                60.5    5e-08   
gb|AFP90338.1|  transcription factor 3                                60.5    5e-08   
ref|XP_001751961.1|  predicted protein                                57.8    5e-08   
ref|XP_010258783.1|  PREDICTED: ethylene-responsive transcription...  62.0    5e-08   
gb|AFP90356.1|  transcription factor 3                                60.5    5e-08   
gb|AFP90347.1|  transcription factor 3                                60.5    5e-08   
gb|AFP90346.1|  transcription factor 3                                60.5    5e-08   
gb|AFP90336.1|  transcription factor 3                                60.5    5e-08   
gb|AFP90342.1|  transcription factor 3                                60.5    5e-08   
ref|XP_010686479.1|  PREDICTED: pathogenesis-related genes transc...  59.3    5e-08   
ref|XP_004229751.1|  PREDICTED: ethylene-responsive transcription...  60.5    5e-08   
ref|XP_007219565.1|  hypothetical protein PRUPE_ppa022802mg           60.5    5e-08   
gb|ADE41112.1|  AP2 domain class transcription factor                 60.8    5e-08   
ref|XP_008375671.1|  PREDICTED: ethylene-responsive transcription...  60.8    6e-08   
gb|ADP37426.1|  ethylene-responsive-element-binding factor 11         60.5    6e-08   
ref|XP_007134478.1|  hypothetical protein PHAVU_010G050600g           59.7    7e-08   
ref|XP_009362711.1|  PREDICTED: ethylene-responsive transcription...  60.8    7e-08   
ref|XP_003530143.1|  PREDICTED: ethylene-responsive transcription...  60.5    7e-08   
ref|XP_007145843.1|  hypothetical protein PHAVU_007G272900g           58.9    8e-08   
ref|XP_011101098.1|  PREDICTED: ethylene-responsive transcription...  60.8    8e-08   
ref|XP_009598140.1|  PREDICTED: ethylene-responsive transcription...  60.1    8e-08   
ref|XP_009346116.1|  PREDICTED: pathogenesis-related genes transc...  59.7    8e-08   
ref|XP_001751773.1|  predicted protein                                57.0    8e-08   
gb|AFK48150.1|  unknown                                               59.7    9e-08   
ref|XP_008376371.1|  PREDICTED: ethylene-responsive transcription...  60.1    9e-08   
dbj|BAJ92494.1|  predicted protein                                    60.5    9e-08   
gb|EPS73235.1|  hypothetical protein M569_01526                       58.5    1e-07   
dbj|BAF75651.1|  transcription factor DcERF1                          60.8    1e-07   



>ref|XP_009606945.1| PREDICTED: ethylene-responsive transcription factor 2 [Nicotiana 
tomentosiformis]
 sp|Q40479.1|ERF2_TOBAC RecName: Full=Ethylene-responsive transcription factor 2; Short=NtERF2; 
AltName: Full=Ethylene-responsive element-binding 
factor 2; Short=EREBP-2 [Nicotiana tabacum]
 dbj|BAA07324.1| ethylene-responsive element binding protein [Nicotiana tabacum]
 dbj|BAN58170.1| ethylene response factor 32 [Nicotiana tabacum]
Length=233

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 109/127 (86%), Gaps = 1/127 (1%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYDKAAYRMRGSKALLNFPHRIG NEP+PV
Sbjct  108  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDKAAYRMRGSKALLNFPHRIGLNEPEPV  167

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+TAKRRSPEP + S SSA E+GSPKRRRK  AA++ A+ +V+SRSN +   C     P+
Sbjct  168  RLTAKRRSPEPASSSISSALENGSPKRRRKAVAAKK-AELEVQSRSNAMQVGCQMEQFPV  226

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  227  GEQLLVS  233



>ref|XP_009765938.1| PREDICTED: ethylene-responsive transcription factor 2 [Nicotiana 
sylvestris]
 sp|Q9LW50.1|ERF2_NICSY RecName: Full=Ethylene-responsive transcription factor 2; Short=NsERF2; 
AltName: Full=Ethylene-responsive element-binding 
factor 2; Short=EREBP-2 [Nicotiana sylvestris]
 dbj|BAA97122.1| ethylene-responsive element binding factor [Nicotiana sylvestris]
Length=237

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 106/127 (83%), Gaps = 1/127 (1%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYDKAAYRMRGSKALLNFPHRIG NEP+PV
Sbjct  112  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDKAAYRMRGSKALLNFPHRIGLNEPEPV  171

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+T KRRSPEP + S S ASE+  PKRRRK  AA+Q A+ +V+SRSN +   C     P+
Sbjct  172  RLTVKRRSPEPASSSISPASENSLPKRRRKAVAAKQ-AELEVQSRSNVMQVGCQMEQFPV  230

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  231  GEQLLVS  237



>emb|CBJ55933.1| ethylene response factor 2.2 [Bupleurum kaoi]
Length=233

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 98/127 (77%), Gaps = 2/127 (2%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AAYRMRGSKALLNFPHR GSNEPDPV
Sbjct  109  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAYRMRGSKALLNFPHRAGSNEPDPV  168

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+TAKR+       + S +      +R+R   +A+Q  + +VESRSN  P +C    +P+
Sbjct  169  RITAKRK--CSPEPTGSGSGSESPKRRKRGGVSADQKTEPEVESRSNACPIKCEIRQMPV  226

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  227  GEQLLVS  233



>dbj|BAN45684.1| ethylene response factor [Nicotiana umbratica]
Length=216

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET EEAA+AYDKAAYRMRGSKALLNFPHRIG NEP+PV
Sbjct  91   GKFAAEIRDPAKNGARVWLGTYETGEEAALAYDKAAYRMRGSKALLNFPHRIGLNEPEPV  150

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+T KRRSPEP + S SSASE+GSPKRRRK  AA+Q A+ +V+SRSN +   C     P+
Sbjct  151  RLTIKRRSPEPASSSISSASENGSPKRRRKAVAAKQ-AELEVQSRSNVMQIGCQMEQFPV  209

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  210  GEQLLVS  216



>ref|XP_009611801.1| PREDICTED: ethylene-responsive transcription factor 1 [Nicotiana 
tomentosiformis]
Length=236

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 99/127 (78%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET E+AAIAYDKAAYRMRGSKA LNFPHRIG NEP+PV
Sbjct  114  GKFAAEIRDPAKNGARVWLGTYETDEDAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPV  173

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKRR     +   +S+SE+ S KRRRK  AAE++   +VES+SN L   C   +L  
Sbjct  174  RVTAKRR----ASPEPASSSENSSVKRRRKAVAAEKSGAVEVESKSNVLQVGCQVELLTR  229

Query  362  GEQLIVS  382
            G QL+VS
Sbjct  230  GHQLLVS  236



>gb|AHA93900.1| ethylene response factor 10 [Coffea arabica]
 gb|AHB33880.1| ERF transcription factor 09 [Coffea arabica]
Length=264

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 105/136 (77%), Gaps = 9/136 (7%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP+KNGARVWLGTYETAEEAA+AYD+AAYRMRGSKALLNFPHR+G NEP+PV
Sbjct  129  GKFAAEIRDPSKNGARVWLGTYETAEEAALAYDRAAYRMRGSKALLNFPHRVGLNEPEPV  188

Query  182  RVTAKRRs-------pepealstssasesgspKRRRKVAAAEQAA--DSDVESRSNPLPA  334
            RVTAKRRS           + ++ S S S SPKRRRKV AAE +A  + +VES+SN    
Sbjct  189  RVTAKRRSPEQAASSSSSVSSASESGSPSPSPKRRRKVVAAELSAEPEPEVESQSNAYRV  248

Query  335  ECHANILPIGEQLIVS  382
             C    +P+GEQL+VS
Sbjct  249  NCQKTHVPVGEQLLVS  264



>ref|XP_004235186.2| PREDICTED: ethylene-responsive transcription factor 1 [Solanum 
lycopersicum]
Length=277

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 105/128 (82%), Gaps = 2/128 (2%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYE+AEEAA+AYDKAA+RMRG+KALLNFPHRIG NEP+PV
Sbjct  151  GKFAAEIRDPAKNGARVWLGTYESAEEAALAYDKAAFRMRGTKALLNFPHRIGLNEPEPV  210

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRS-NPLPAECHANILP  358
            RVT KRR  E  + S SSASESGSPKRRRK  AA+Q A+ +VESR  N +   C     P
Sbjct  211  RVTVKRRLSESASSSVSSASESGSPKRRRKGVAAKQ-AELEVESRGPNVMKVGCQMEQFP  269

Query  359  IGEQLIVS  382
            +GEQL+VS
Sbjct  270  VGEQLLVS  277



>gb|AHB33881.1| ERF transcription factor 10 [Coffea arabica]
Length=264

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 105/136 (77%), Gaps = 9/136 (7%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP+KNGARVWLGTYETAEEAA+AYD+AAYRMRGSKALLNFPHR+G NEP+PV
Sbjct  129  GKFAAEIRDPSKNGARVWLGTYETAEEAALAYDRAAYRMRGSKALLNFPHRVGLNEPEPV  188

Query  182  RVTAKRRs-------pepealstssasesgspKRRRKVAAAEQAA--DSDVESRSNPLPA  334
            RVTAKRRS           + ++ S S S SPKRRRKV AAE +A  + +VES+SN    
Sbjct  189  RVTAKRRSPEQAASSSSSVSSASESGSPSPSPKRRRKVVAAELSAEPEPEVESQSNAYRV  248

Query  335  ECHANILPIGEQLIVS  382
             C    +P+GEQL+VS
Sbjct  249  NCQKTHVPVGEQLLVS  264



>emb|CDP05380.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 105/136 (77%), Gaps = 9/136 (7%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP+KNGARVWLGTYETAEEAA+AYD+AAYRMRGSKALLNFPHR+G NEP+PV
Sbjct  129  GKFAAEIRDPSKNGARVWLGTYETAEEAALAYDRAAYRMRGSKALLNFPHRVGLNEPEPV  188

Query  182  RVTAKRRs-------pepealstssasesgspKRRRKVAAAEQAA--DSDVESRSNPLPA  334
            RVTAKRRS           + ++ S S S SPKRRRKV AAE +A  + +VES+SN    
Sbjct  189  RVTAKRRSPEQAASSSSSVSSASESGSPSPSPKRRRKVVAAELSAEPEPEVESQSNAYRV  248

Query  335  ECHANILPIGEQLIVS  382
             C    +P+GEQL+VS
Sbjct  249  NCRKTHVPVGEQLLVS  264



>gb|ADJ67441.1| ethylene response factor 12 [Actinidia deliciosa]
Length=248

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYDKAAYRMRGS+ALLNFPHRIGS+EP+PV
Sbjct  126  GKFAAEIRDPAKNGARVWLGTYETAEEAAVAYDKAAYRMRGSRALLNFPHRIGSDEPEPV  185

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVT+KRR        TS +SESGSPKRRRK  AA + A+  VE  S+     C    LP+
Sbjct  186  RVTSKRR----SPEPTSPSSESGSPKRRRKGFAAAKQAELGVERESSVCQVGCQVRQLPV  241

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  242  GEQLLVS  248



>ref|XP_009771895.1| PREDICTED: ethylene-responsive transcription factor 1 [Nicotiana 
sylvestris]
Length=236

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 99/127 (78%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET EEAAIAYDKAAYRMRGSKA LNFPHRIG NEP+PV
Sbjct  114  GKFAAEIRDPAKNGARVWLGTYETDEEAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPV  173

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKRR     +   +S+SE+ SPKRRRK  AAE++   +VES+SN L   C   +L  
Sbjct  174  RVTAKRR----ASPEPASSSENSSPKRRRKAVAAEKSEAVEVESKSNVLQTGCQVELLTR  229

Query  362  GEQLIVS  382
              QL+VS
Sbjct  230  RHQLLVS  236



>ref|NP_001275603.1| ethylene-responsive transcription factor 1-like [Solanum tuberosum]
 gb|ABP35567.1| ERF transcription factor [Solanum tuberosum]
Length=247

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 107/128 (84%), Gaps = 2/128 (2%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYE+AEEAA+AYDKAA+RMRG+KALLNFPHRIG NEP+PV
Sbjct  121  GKFAAEIRDPAKNGARVWLGTYESAEEAALAYDKAAFRMRGTKALLNFPHRIGLNEPEPV  180

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRS-NPLPAECHANILP  358
            RVT KRR PEP + S SSASESGSPKRRRK  AA+Q A+ +V+SR  N +   C     P
Sbjct  181  RVTVKRRLPEPASSSVSSASESGSPKRRRKGVAAKQ-AELEVQSRGPNVIQVGCQMEQFP  239

Query  359  IGEQLIVS  382
            +GEQL+V+
Sbjct  240  VGEQLLVN  247



>sp|Q40476.1|ERF1_TOBAC RecName: Full=Ethylene-responsive transcription factor 1; Short=NtERF1; 
AltName: Full=Ethylene-responsive element-binding 
factor 1; Short=EREBP-1 [Nicotiana tabacum]
 dbj|BAA07321.1| ERF1 [Nicotiana tabacum]
Length=236

 Score =   116 bits (290),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 98/127 (77%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET EEAAIAYDKAAYRMRGSKA LNFPHRIG NEP+PV
Sbjct  114  GKFAAEIRDPAKNGARVWLGTYETDEEAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPV  173

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKRR     +   +S+SE+ SPKRRRK  A E++   +VES+SN L   C   +L  
Sbjct  174  RVTAKRR----ASPEPASSSENSSPKRRRKAVATEKSEAVEVESKSNVLQTGCQVELLTR  229

Query  362  GEQLIVS  382
              QL+VS
Sbjct  230  RHQLLVS  236



>gb|AGS80336.1| ethylene response factor [Actinidia eriantha]
Length=248

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 101/127 (80%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYDKAAYRMRGS+ALLNFPHRIGS++P+P+
Sbjct  126  GKFAAEIRDPAKNGARVWLGTYETAEEAAVAYDKAAYRMRGSRALLNFPHRIGSDDPEPI  185

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVT+KRR        TS ASESGSPKRRRK  AA + A+  VE  S+     C    LP+
Sbjct  186  RVTSKRR----SPEPTSPASESGSPKRRRKGFAAAKQAELGVERESSVCQVGCQVRQLPV  241

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  242  GEQLLVS  248



>gb|AAC62619.1| ethylene response element binding protein 1 [Nicotiana tabacum]
Length=203

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 97/127 (76%), Gaps = 4/127 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            G+FAAEIRDPAKNGARVW  TYET EEAAIAYDKAAYRMRGSKA LNFPHRIG NEP+PV
Sbjct  81   GEFAAEIRDPAKNGARVWHRTYETDEEAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPV  140

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKRR     +   +S+SE+ S KRRRK  AAE++   +VES+SN L   C   +L  
Sbjct  141  RVTAKRR----ASPEPASSSENSSAKRRRKAVAAEKSGAVEVESKSNVLQVGCQVELLTR  196

Query  362  GEQLIVS  382
            G QL+VS
Sbjct  197  GHQLLVS  203



>gb|EYU28602.1| hypothetical protein MIMGU_mgv1a022521mg [Erythranthe guttata]
Length=247

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AAYR+RGSKALLNFPHR GSNEP+PV
Sbjct  121  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAYRIRGSKALLNFPHRAGSNEPEPV  180

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RV  KRRS E   LS  S+       +R K  A  +  +++VESRS+    EC    LP 
Sbjct  181  RVAGKRRSSESVLLSAVSSGSGSGSPKRMKKGAVVENTETEVESRSSVSQVECQMTQLPA  240

Query  362  GEQLIVS  382
            G QL+V+
Sbjct  241  GSQLLVA  247



>dbj|BAN45683.1| ethylene response factor, partial [Nicotiana umbratica]
Length=233

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 95/124 (77%), Gaps = 4/124 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET EEAAIAYDKAAYRMRGSKA LNFPHRIG NEP+PV
Sbjct  114  GKFAAEIRDPAKNGARVWLGTYETDEEAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPV  173

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKRR     +   +S+SE+ SPKRRRK  AAE++   +VES  N L   C   +L  
Sbjct  174  RVTAKRR----ASPEPASSSENSSPKRRRKAVAAEKSEAVEVESELNVLQVGCQVELLTR  229

Query  362  GEQL  373
            G QL
Sbjct  230  GHQL  233



>gb|AGT21474.1| ethylene responsive element binding factor-like [Carica papaya]
Length=247

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA AYD+AAYRMRGSKALLNFPHR+GSNEP+PV
Sbjct  126  GKFAAEIRDPAKNGARVWLGTYETAEEAAFAYDRAAYRMRGSKALLNFPHRLGSNEPEPV  185

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+TAKRR PEP     S +  +    +R K +A+ + A+ D+E R N L  +     +P+
Sbjct  186  RITAKRREPEPSTRLASDSDLA----KRLKASASAKEAELDME-RVNTLQFQYRMGYVPV  240

Query  362  GEQLIV  379
            GEQL+V
Sbjct  241  GEQLLV  246



>gb|AID51422.1| ethylene response factor 17 [Diospyros kaki]
Length=242

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 106/129 (82%), Gaps = 5/129 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AAYRMRGS+ALLNFPHRIG +EP+PV
Sbjct  119  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAYRMRGSRALLNFPHRIGLDEPEPV  178

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+TAKRRSPEP    +SSAS+SGSPKRR+K  AA Q A+  +ESRSN          LP+
Sbjct  179  RITAKRRSPEPTVSGSSSASDSGSPKRRKKALAAGQ-AEFVMESRSNGF----QKGQLPV  233

Query  362  GEQLIVSQL  388
            GEQL+V  +
Sbjct  234  GEQLLVVTI  242



>gb|EYU20174.1| hypothetical protein MIMGU_mgv1a018364mg [Erythranthe guttata]
Length=243

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 95/131 (73%), Gaps = 4/131 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AA+RMRGSKALLNFPH+IG NEP+PV
Sbjct  113  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFRMRGSKALLNFPHKIGLNEPEPV  172

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADS---DVESRSN-PLPAECHAN  349
            R+TAKRRSPE    + S+ +         K    E+ AD    +V+S+S      EC   
Sbjct  173  RITAKRRSPETSGSTVSALTSGSDSGSSPKRVKREETADGAELEVDSQSTFGYQVECQMT  232

Query  350  ILPIGEQLIVS  382
             LP+G QL+V+
Sbjct  233  SLPLGAQLVVA  243



>sp|Q84XB3.1|ERF1_SOLLC RecName: Full=Ethylene-responsive transcription factor 1; Short=LeERF1; 
AltName: Full=ERF1-like protein; AltName: Full=Ethylene-responsive 
element-binding factor 1; Short=EREBP-1 [Solanum 
lycopersicum]
 gb|AAO34703.1| ethylene response factor 1 [Solanum lycopersicum]
Length=244

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 11/130 (8%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYE+AEEAA+AY KAA+RMRG+KALLNFPHRIG NEP+PV
Sbjct  116  GKFAAEIRDPAKNGARVWLGTYESAEEAALAYGKAAFRMRGTKALLNFPHRIGLNEPEPV  175

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVT KRR  E  + S SSASESGSPKRRRK  AA+Q A+ +VESR          N++ +
Sbjct  176  RVTVKRRLSESASSSVSSASESGSPKRRRKGVAAKQ-AELEVESRG--------PNVMKV  226

Query  362  GEQLIVSQLA  391
            G Q+   QLA
Sbjct  227  GCQMF--QLA  234



>ref|XP_011076437.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor 2-like [Sesamum indicum]
Length=240

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 97/126 (77%), Gaps = 4/126 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AAY+MRGSKALLNFPH+IG NEP+PV
Sbjct  118  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAYKMRGSKALLNFPHKIGLNEPEPV  177

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKR+SPEP A + S+ +        RK   A + A+ +VES+SN    +     LP+
Sbjct  178  RVTAKRKSPEPSASTASTVTSGS----ERKGKXAVEKAELEVESQSNVCQVDHQMTPLPV  233

Query  362  GEQLIV  379
            G QL+V
Sbjct  234  GGQLLV  239



>ref|XP_006365341.1| PREDICTED: ethylene-responsive transcription factor 1-like [Solanum 
tuberosum]
Length=270

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 96/127 (76%), Gaps = 7/127 (6%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKA LNFPHRIG NEP+PV
Sbjct  151  GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPV  210

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKRR     +    S+SE+GS KRRRK   A +  D +VESRS+ +   C    L  
Sbjct  211  RVTAKRR----ASPEPVSSSENGSMKRRRK---AVRKCDGEVESRSSVMQVGCQIEQLTG  263

Query  362  GEQLIVS  382
              QL+VS
Sbjct  264  VHQLLVS  270



>ref|XP_004239983.1| PREDICTED: ethylene-responsive transcription factor 1 [Solanum 
lycopersicum]
Length=234

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 95/126 (75%), Gaps = 7/126 (6%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKA LNFPHRIG NEP+PV
Sbjct  115  GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPV  174

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKRR     +   +S+S +GS KRRRK   A Q  D ++ SRS+ +  EC    L  
Sbjct  175  RVTAKRR----ASPEPASSSGNGSMKRRRK---AVQKCDGEMASRSSVMQVECQIEQLTG  227

Query  362  GEQLIV  379
              QL+V
Sbjct  228  VHQLLV  233



>gb|KDP22469.1| hypothetical protein JCGZ_26300 [Jatropha curcas]
Length=254

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 92/127 (72%), Gaps = 11/127 (9%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AA+RMRGS+ALLNFPH+IGSNEP+PV
Sbjct  139  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFRMRGSRALLNFPHKIGSNEPEPV  198

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+T+KR   E  A +           +RRK+ A ++A + + E          H   +P+
Sbjct  199  RITSKRSETEIAASA-----------KRRKIMAGDEANELEPEREEKRHNVVFHVGPMPV  247

Query  362  GEQLIVS  382
            GEQL+V+
Sbjct  248  GEQLLVN  254



>ref|XP_002279585.2| PREDICTED: ethylene-responsive transcription factor 2-like [Vitis 
vinifera]
Length=240

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 93/126 (74%), Gaps = 11/126 (9%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AAYRMRGS+ALLNFPHR+GS EPDPV
Sbjct  125  GKFAAEIRDPAKNGARVWLGTYETAEEAAVAYDRAAYRMRGSRALLNFPHRVGSGEPDPV  184

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+TAKRR     +     + ESGSPKR +   AAE      VE RSN          LP+
Sbjct  185  RITAKRR-----SPEPEPSPESGSPKRLKNGLAAE------VERRSNVFQVGHQMGALPV  233

Query  362  GEQLIV  379
            GEQL+V
Sbjct  234  GEQLLV  239



>ref|XP_011022365.1| PREDICTED: ethylene-responsive transcription factor 2-like [Populus 
euphratica]
Length=252

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 94/127 (74%), Gaps = 8/127 (6%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEA +AYD+AAYRMRGSKALLNFPH+IGSNEPDPV
Sbjct  134  GKFAAEIRDPAKNGARVWLGTYETAEEAGLAYDRAAYRMRGSKALLNFPHKIGSNEPDPV  193

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVT KRR    E  +   A +SGS K RR + A     + + E  SN      H  I+P+
Sbjct  194  RVTTKRR----EPETGLPAVDSGSAKTRRILVA--NGDELERERGSNVFQVAHH--IMPL  245

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  246  GEQLLVS  252



>ref|XP_007038272.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
 gb|EOY22773.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
Length=272

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 97/128 (76%), Gaps = 9/128 (7%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AAYRMRGS+ALLNFPHRIG+NEP+PV
Sbjct  153  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAYRMRGSRALLNFPHRIGNNEPEPV  212

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECH-ANILP  358
            RVTAKRR          +   S SPKR++ +AA E  A+ +  SR   +    H   ++P
Sbjct  213  RVTAKRR------EHDPALYNSSSPKRKKSLAANE--AELERASRGLDVFQLGHQMGLMP  264

Query  359  IGEQLIVS  382
            +GEQL+V+
Sbjct  265  VGEQLLVN  272



>ref|NP_001275437.1| Pti4 [Solanum tuberosum]
 gb|ACF57857.1| Pti4 [Solanum tuberosum]
Length=234

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 94/126 (75%), Gaps = 7/126 (6%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKA LNFPHRIG NEP+PV
Sbjct  115  GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPV  174

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKRR     +    S+SE+GS KRRRK   A +  D  VESRS+ +   C    L  
Sbjct  175  RVTAKRR----ASPEPVSSSENGSMKRRRK---AVRKCDGGVESRSSAIQIGCQIEQLTG  227

Query  362  GEQLIV  379
              QL+V
Sbjct  228  VHQLLV  233



>gb|AAC50047.1| Pti4 [Solanum lycopersicum]
Length=234

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 94/126 (75%), Gaps = 7/126 (6%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKA LNFPHRIG NEP+PV
Sbjct  115  GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPV  174

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKRR     +   +S+S +GS KRRRK   A Q  D ++ SRS+ +   C    L  
Sbjct  175  RVTAKRR----ASPEPASSSGNGSMKRRRK---AVQKCDGEMASRSSVMQVGCQIEQLTG  227

Query  362  GEQLIV  379
              QL+V
Sbjct  228  VHQLLV  233



>ref|XP_002304592.2| hypothetical protein POPTR_0003s15030g [Populus trichocarpa]
 gb|EEE79571.2| hypothetical protein POPTR_0003s15030g [Populus trichocarpa]
Length=259

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 94/127 (74%), Gaps = 8/127 (6%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEA +AYD+AAYRMRGSKALLNFPH+IGSNEPDPV
Sbjct  134  GKFAAEIRDPAKNGARVWLGTYETAEEAGLAYDRAAYRMRGSKALLNFPHKIGSNEPDPV  193

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVT KRR    E  +   A +SGS K RR + A     D     R + +    H +I+P+
Sbjct  194  RVTTKRR----EPETGLPAVDSGSAKTRRILVA---NGDELERERGSKVFQVAH-HIMPL  245

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  246  GEQLLVS  252



>ref|XP_011026732.1| PREDICTED: ethylene-responsive transcription factor 2-like [Populus 
euphratica]
Length=262

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 90/127 (71%), Gaps = 6/127 (5%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAE RDPAKNGARVWLGTYETA+EAA+AYD+AAYRMRGSKALLNFPH+IGSNEPDPV
Sbjct  142  GKFAAETRDPAKNGARVWLGTYETAKEAALAYDRAAYRMRGSKALLNFPHKIGSNEPDPV  201

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+TAKRR P+    +  + S       + +    ++ A+ +     N      H  ++P+
Sbjct  202  RITAKRRQPDTGLTAGDTGSA------KMRNMLVDEGAELERGVGYNVFQVGHHKGLMPV  255

Query  362  GEQLIVS  382
            GEQL+ S
Sbjct  256  GEQLLAS  262



>ref|XP_002297926.1| hypothetical protein POPTR_0001s11770g [Populus trichocarpa]
 gb|EEE82731.1| hypothetical protein POPTR_0001s11770g [Populus trichocarpa]
Length=262

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 88/127 (69%), Gaps = 6/127 (5%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAE RDPAKNGARVWLGTYETA+EAA+AYD+AAYRMRGSKALLNFPH+IGSNEPDPV
Sbjct  142  GKFAAETRDPAKNGARVWLGTYETAKEAALAYDRAAYRMRGSKALLNFPHKIGSNEPDPV  201

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+TAKRR P+    +  + S         + A  E+     V    +      H  ++P+
Sbjct  202  RITAKRRQPDTGLTAVDTGSAKMRKMLVDEGAELERGVGYSVFQVGH------HKGLMPV  255

Query  362  GEQLIVS  382
            GEQL+ S
Sbjct  256  GEQLLAS  262



>gb|ADU76350.1| ethylene responsive factor, partial [Prunus persica]
Length=260

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AAYRMRGSKALLNFPHRIG NEP PV
Sbjct  135  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAYRMRGSKALLNFPHRIGLNEPPPV  194

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLP-AECHANILP  358
            RVT KR+ PE EA + + AS +     +R  A++   A+ D    +  L   +    +LP
Sbjct  195  RVTGKRKEPEAEAAAAADASTTTPKSAKRTKASS--VAEHDHHQANVCLTRQKTSMGLLP  252

Query  359  IGEQLIVS  382
            +GEQL+VS
Sbjct  253  LGEQLLVS  260



>ref|XP_007218833.1| hypothetical protein PRUPE_ppa010186mg [Prunus persica]
 gb|EMJ20032.1| hypothetical protein PRUPE_ppa010186mg [Prunus persica]
Length=260

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AAYRMRGSKALLNFPHRIG NEP PV
Sbjct  135  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAYRMRGSKALLNFPHRIGLNEPPPV  194

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLP-AECHANILP  358
            RVT KR+ PE EA + + AS +     +R  A++   A+ D    +  L   +    +LP
Sbjct  195  RVTGKRKEPEAEAAAAADASTTTPKSAKRTKASS--VAEHDHHQANVCLTRQKTSMGLLP  252

Query  359  IGEQLIVS  382
            +GEQL+VS
Sbjct  253  LGEQLLVS  260



>ref|XP_002511013.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF51615.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=256

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 92/127 (72%), Gaps = 14/127 (11%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD AA+RMRGS+ALLNFPHR+GS  P+PV
Sbjct  144  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDIAAFRMRGSRALLNFPHRVGS--PEPV  201

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKRR        +  A  SGS KRR+ +AA E       E+ +  L       ++P+
Sbjct  202  RVTAKRR-------ESEMAPGSGSAKRRKSLAANE-----GYETGTVALQVGHKIEMMPV  249

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  250  GEQLLVS  256



>gb|ACM49848.1| ethylene responsive transcription factor 1b [Prunus salicina]
Length=261

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AAYRMRG KALLNFPHRIG NEP PV
Sbjct  135  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAYRMRGCKALLNFPHRIGLNEPPPV  194

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVT KR+ PE EA + ++ + + +PK  ++  A+  A     ++       +    +LP+
Sbjct  195  RVTGKRKEPEAEAAAAAADASTTTPKSAKRTKASSVAEHDHHQANVLRTRQKNSMGLLPL  254

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  255  GEQLLVS  261



>ref|XP_008234446.1| PREDICTED: ethylene-responsive transcription factor 2-like [Prunus 
mume]
Length=263

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 95/129 (74%), Gaps = 5/129 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AAYRMRGSKALLNFPHRIG NEP PV
Sbjct  138  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAYRMRGSKALLNFPHRIGLNEPPPV  197

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPA--ECHANIL  355
            RVT KR+ PE EA + + AS +     +R  A++    D     ++N L    +    +L
Sbjct  198  RVTGKRKEPEAEAAAAADASTTTPKSAKRTKASSVAEHD---HHQANVLRTRQKNSMGLL  254

Query  356  PIGEQLIVS  382
            P+GEQL+VS
Sbjct  255  PLGEQLLVS  263



>gb|AEQ93554.1| AP2/ERF transcription factor [Artemisia annua]
Length=253

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA AYD AAYRMRGSKALLNFPHRIG NEP+PV
Sbjct  143  GKFAAEIRDPAKNGARVWLGTYETAEEAATAYDIAAYRMRGSKALLNFPHRIGLNEPEPV  202

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSN  322
            RVT+KRR        +SS S + S KRR    +  +  + +V+SRS+
Sbjct  203  RVTSKRR----SPEPSSSVSSASSSKRRNTKVSLAEVVEPEVQSRSS  245



>gb|AFB35653.1| ERF8 [Gossypium hirsutum]
Length=265

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 8/127 (6%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRD AKNGARVWLGTYETAEEAA+AYD+AA++MRGS+ALLNFPHRIG+NEP PV
Sbjct  147  GKFAAEIRDSAKNGARVWLGTYETAEEAALAYDRAAFKMRGSRALLNFPHRIGNNEPAPV  206

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+TAKRR       +  S+  + SPKRR+ +   +   + D+      L  +    ++P+
Sbjct  207  RITAKRR------ENEPSSYNTPSPKRRKSLVTKQTELERDMGLTVFQLGYQ--MGLMPL  258

Query  362  GEQLIVS  382
            GEQL+V+
Sbjct  259  GEQLLVN  265



>ref|XP_009362713.1| PREDICTED: ethylene-responsive transcription factor 1-like [Pyrus 
x bretschneideri]
Length=335

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 99/141 (70%), Gaps = 20/141 (14%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AA+R+RGSKALLNFPHRIG NEP PV
Sbjct  201  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFPHRIGLNEPPPV  260

Query  182  RVTAKRRspepealstssasesgsp-------KRRRKVAAAEQAADSDVESRSNPLPAEC  340
            RVT KR+ PE EA ++SS S S S        KR +   +   +AD D ++        C
Sbjct  261  RVTGKRKEPEQEAAASSSTSSSSSSATPTAAIKRSKLDKSVSSSADHDDQANV------C  314

Query  341  H-------ANILPIGEQLIVS  382
            H       + +LP+GEQL+VS
Sbjct  315  HTRQKNNTSYMLPLGEQLLVS  335



>gb|KDO39173.1| hypothetical protein CISIN_1g028566mg [Citrus sinensis]
Length=207

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 86/127 (68%), Gaps = 25/127 (20%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AA+ +RGSKALLNFPHRIGS+EP PV
Sbjct  106  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFDIRGSKALLNFPHRIGSDEPPPV  165

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKR         + S   + + KRR+  AAA+                E    +LP 
Sbjct  166  RVTAKR---------SHSVDSAAAAKRRKDSAAAK----------------EHQLTMLPA  200

Query  362  GEQLIVS  382
            GE L+V+
Sbjct  201  GEHLLVN  207



>ref|XP_006421523.1| hypothetical protein CICLE_v10005891mg [Citrus clementina]
 gb|ADI34108.1| putative ethylene-responsive element binding protein [Citrus 
unshiu]
 gb|ESR34763.1| hypothetical protein CICLE_v10005891mg [Citrus clementina]
Length=207

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 86/127 (68%), Gaps = 25/127 (20%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AA+ +RGSKALLNFPHRIGS+EP PV
Sbjct  106  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFDIRGSKALLNFPHRIGSDEPPPV  165

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKR         + S   + + KRR+  AAA+                E    +LP 
Sbjct  166  RVTAKR---------SHSVDSAAAAKRRKDSAAAK----------------EHQLTMLPA  200

Query  362  GEQLIVS  382
            GE L+V+
Sbjct  201  GEHLLVN  207



>ref|XP_010677103.1| PREDICTED: ethylene-responsive transcription factor 2 [Beta vulgaris 
subsp. vulgaris]
Length=273

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 99/133 (74%), Gaps = 11/133 (8%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGSKALLNFP RI S EPDPV
Sbjct  146  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSKALLNFPLRINSGEPDPV  205

Query  182  RVTAKR----RspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHAN  349
            R+T+KR    RS    + S+ ++S++GSPKRR+K +   Q  +  VE     L   C   
Sbjct  206  RITSKRSSPERSTSSLSSSSCTSSDNGSPKRRKKGSVVGQVGNG-VEG----LQVGCQVG  260

Query  350  I--LPIGEQLIVS  382
            +  +P+G+QL+VS
Sbjct  261  VGSMPLGDQLLVS  273



>gb|ADL36574.1| AP2D domain class transcription factor [Malus domestica]
 gb|AGI41322.1| ethylene response factor [Malus domestica]
Length=334

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 19/140 (14%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AA+R+RGSKALLNFPHRIG NEP PV
Sbjct  201  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFPHRIGLNEPPPV  260

Query  182  RVTAKRRspepe------alstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECH  343
            RVT KR+ PE E        S+SSA+ + + KR +   +   +AD D ++        CH
Sbjct  261  RVTGKRKEPEQEAAASSSTSSSSSATPTAATKRSKLDKSVSSSADHDHQANV------CH  314

Query  344  -------ANILPIGEQLIVS  382
                   + +L IGEQL+VS
Sbjct  315  TRQKNNTSYMLAIGEQLLVS  334



>gb|AGB07589.1| ethylene-responsive transcription factor 6 [Artemisia annua]
Length=207

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 6/109 (6%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYD+AAYRMRGSKAL+NFPHR+G NEP+PV
Sbjct  104  GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDRAAYRMRGSKALVNFPHRVGLNEPEPV  163

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPL  328
            RVT+KR+S  P A  +S +    + +R  KV      A+ +V+SRS  L
Sbjct  164  RVTSKRKSASPSASLSSGSETGSAKRRNVKV------AEPEVQSRSPKL  206



>ref|NP_001280848.1| ethylene-responsive transcription factor 2-like [Malus domestica]
 dbj|BAF43420.1| ethylene response factor [Malus domestica]
Length=334

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 19/140 (14%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AA+R+RGSKALLNFPHRIG NEP PV
Sbjct  201  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFPHRIGLNEPPPV  260

Query  182  RVTAKRRspepe------alstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECH  343
            RVT KR+ P+ E        S+SSA+ + + KR +   +   +AD D ++        CH
Sbjct  261  RVTGKRKEPDQEAAASSSTSSSSSATPTAATKRSKLDKSVSSSADHDHQANV------CH  314

Query  344  -------ANILPIGEQLIVS  382
                   + +L IGEQL+VS
Sbjct  315  TRQKNNTSYMLAIGEQLLVS  334



>ref|XP_006490017.1| PREDICTED: ethylene-responsive transcription factor 2-like [Citrus 
sinensis]
Length=207

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 86/127 (68%), Gaps = 25/127 (20%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AA+ +RGSKALLNFPHRIGS+EP PV
Sbjct  106  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFDIRGSKALLNFPHRIGSDEPPPV  165

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVTAKR           SA  + + KRR+  AAA+                E    +LP 
Sbjct  166  RVTAKRS---------HSADSAAAAKRRKDSAAAK----------------EHQLTMLPA  200

Query  362  GEQLIVS  382
            GE L+V+
Sbjct  201  GEHLLVN  207



>ref|XP_008376369.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=336

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 98/134 (73%), Gaps = 7/134 (5%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AA+R+RGSKALLNFPHRIG NEP PV
Sbjct  203  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFPHRIGLNEPPPV  262

Query  182  RVTAKRRspepe------alstssasesgspKRRRKVAAAEQAADSDVESRS-NPLPAEC  340
            RVT KR+ PE E        S+SSA+ + + KR +   +   +AD D ++   +      
Sbjct  263  RVTGKRKEPEQEAAASSSTSSSSSATPTAATKRTKLDKSVSSSADHDHQANVRHKRQKNN  322

Query  341  HANILPIGEQLIVS  382
             + +LP+GEQL+VS
Sbjct  323  TSYLLPLGEQLLVS  336



>ref|XP_010025350.1| PREDICTED: ethylene-responsive transcription factor 2-like [Eucalyptus 
grandis]
 gb|KCW90884.1| hypothetical protein EUGRSUZ_A02924 [Eucalyptus grandis]
Length=281

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNGARVWLGTYETAEEAA+AYD+AAYRMRG+KALLNFPHRIGS EP PV
Sbjct  159  GKYAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAYRMRGAKALLNFPHRIGSGEPAPV  218

Query  182  RVTAKRR  202
            RVTAKR+
Sbjct  219  RVTAKRK  225



>ref|XP_007039732.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
 gb|EOY24233.1| AP2/ERF domain-containing transcription factor, putative [Theobroma 
cacao]
Length=271

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  146  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  205

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVT+KR SPEP + S+S +      +RR+  A+A   A + ++  S    AE    +   
Sbjct  206  RVTSKRASPEPSSSSSSGSENGSPKRRRKVAASAPVVAQAGLDMGSG---AEVKYQVESC  262

Query  362  --GEQLIVS  382
              GEQL+VS
Sbjct  263  THGEQLLVS  271



>ref|XP_010109127.1| Ethylene-responsive transcription factor 2 [Morus notabilis]
 gb|EXC21056.1| Ethylene-responsive transcription factor 2 [Morus notabilis]
Length=275

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYD+AA+ MRGSKALLNFPHRIGS EP PV
Sbjct  157  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDRAAFGMRGSKALLNFPHRIGSGEPPPV  216

Query  182  RVTAKRR  202
            R+TAKRR
Sbjct  217  RITAKRR  223



>ref|XP_009372828.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=343

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 101/147 (69%), Gaps = 26/147 (18%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AA+R+RGSKALLNFPHRIG NEP PV
Sbjct  203  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFPHRIGLNEPPPV  262

Query  182  RVTAKRRspepe-------------alstssasesgspKRRRKVAAAEQAADSDVES---  313
            RVT KR+ PE E             + S+SSA+ + + KR +   +   +AD D ++   
Sbjct  263  RVTGKRKEPEQEAAASSSTFSSSSSSSSSSSATPTAATKRTKLDKSVSSSADHDHQANMR  322

Query  314  ----RSNPLPAECHANILPIGEQLIVS  382
                ++N L       +LP+GEQL+VS
Sbjct  323  HKRQKNNTL------YLLPLGEQLLVS  343



>ref|XP_010275428.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nelumbo 
nucifera]
Length=304

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP RIGSNEP+PV
Sbjct  169  GKFAAEIRDPAKNGARVWLGTFETAEDAAMAYDRAAYRMRGSRALLNFPLRIGSNEPEPV  228

Query  182  RVTAKR  199
            RVT+KR
Sbjct  229  RVTSKR  234



>ref|XP_002271614.1| PREDICTED: ethylene-responsive transcription factor 2-like [Vitis 
vinifera]
Length=214

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNG+RVWLGTYETAE+AA+AYD+AAYRMRGS+ALLNFP RIGS EP+PV
Sbjct  101  GKYAAEIRDPAKNGSRVWLGTYETAEDAALAYDQAAYRMRGSRALLNFPLRIGSGEPEPV  160

Query  182  RVTAKRR  202
            R+TAKRR
Sbjct  161  RITAKRR  167



>ref|XP_009370422.1| PREDICTED: ethylene-responsive transcription factor 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=315

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AA+R+RGSKALLNFPHRIG NEP PV
Sbjct  173  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFPHRIGLNEPPPV  232

Query  182  RVTAKRR  202
            RVT KR+
Sbjct  233  RVTGKRK  239



>ref|XP_009370421.1| PREDICTED: ethylene-responsive transcription factor 2-like isoform 
X1 [Pyrus x bretschneideri]
Length=360

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET+EEAA+AYD+AA+R+RGSKALLNFPHRIG NEP PV
Sbjct  218  GKFAAEIRDPAKNGARVWLGTYETSEEAALAYDRAAFRIRGSKALLNFPHRIGLNEPPPV  277

Query  182  RVTAKRR  202
            RVT KR+
Sbjct  278  RVTGKRK  284



>ref|XP_010258782.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nelumbo 
nucifera]
Length=309

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP RIGSN+P+PV
Sbjct  173  GKFAAEIRDPAKNGARVWLGTFETAEDAAMAYDRAAYRMRGSRALLNFPLRIGSNDPEPV  232

Query  182  RVTAKR  199
            RVTAKR
Sbjct  233  RVTAKR  238



>ref|XP_004152388.1| PREDICTED: ethylene-responsive transcription factor 2-like [Cucumis 
sativus]
 gb|KGN50290.1| AP2/ERF domain-containing transcription factor [Cucumis sativus]
Length=250

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 90/129 (70%), Gaps = 19/129 (15%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EP+PV
Sbjct  141  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPEPV  200

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVT+KR          SS   S SPKRR+KV +A ++    VE +   + +  H      
Sbjct  201  RVTSKR----------SSPEVSSSPKRRKKVGSAVESVGVQVEQQ---VASFTH------  241

Query  362  GEQLIVSQL  388
            G QL VSQ 
Sbjct  242  GGQLFVSQC  250



>gb|EPS62607.1| hypothetical protein M569_12181, partial [Genlisea aurea]
Length=175

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 66/67 (99%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPA+NG+RVWLGTYETAEEAA+AYD+AAY++RG+KALLNFPH+IG NEP+PV
Sbjct  100  GKFAAEIRDPARNGSRVWLGTYETAEEAALAYDRAAYKIRGTKALLNFPHKIGLNEPEPV  159

Query  182  RVTAKRR  202
            R+TAKRR
Sbjct  160  RITAKRR  166



>ref|XP_004307778.1| PREDICTED: ethylene-responsive transcription factor 2-like [Fragaria 
vesca subsp. vesca]
Length=275

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTYET+EEAA+AYD+AAYRMRG+KALLNFPHRIG NEP PV
Sbjct  152  GKFAAEIRDPKKNGARVWLGTYETSEEAAVAYDRAAYRMRGAKALLNFPHRIGLNEPPPV  211

Query  182  RVTAKRR  202
            RVT KR+
Sbjct  212  RVTGKRK  218



>ref|XP_008437026.1| PREDICTED: ethylene-responsive transcription factor 2-like [Cucumis 
melo]
Length=300

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 89/129 (69%), Gaps = 19/129 (15%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EP+PV
Sbjct  191  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPEPV  250

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RVT+KR          SS   S SPKRR+KV +A  +    VE +   + +  H      
Sbjct  251  RVTSKR----------SSPEVSSSPKRRKKVGSAVDSVGVQVEQQ---VASFTH------  291

Query  362  GEQLIVSQL  388
            G QL VSQ 
Sbjct  292  GGQLFVSQC  300



>gb|AID55127.1| ethylene responsive factor 70, partial [Solanum melongena]
Length=154

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAA+RMRGSKA LNFPHRIG NEP+PV
Sbjct  92   GKFAAEIRDPAKNGARVWLGTYETAEEAAIAYDKAAFRMRGSKAHLNFPHRIGLNEPEPV  151

Query  182  RVT  190
            RVT
Sbjct  152  RVT  154



>emb|CDY65883.1| BnaAnng21280D [Brassica napus]
Length=225

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 79/99 (80%), Gaps = 10/99 (10%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYDKAA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  127  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDKAAFRMRGSRALLNFPLRVNSGEPDPV  186

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAAD  298
            R+ +KR           S+SE+ +PKRRR VA+A Q  D
Sbjct  187  RIKSKR----------GSSSENRAPKRRRTVASAGQGTD  215



>ref|XP_009130667.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Brassica 
rapa]
Length=240

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 79/99 (80%), Gaps = 10/99 (10%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYDKAA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  142  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDKAAFRMRGSRALLNFPLRVNSGEPDPV  201

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAAD  298
            R+ +KR           S+SE+ +PKRRR VA+A Q  D
Sbjct  202  RIKSKR----------GSSSENRAPKRRRTVASAGQGTD  230



>dbj|BAP92132.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92133.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92134.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92135.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92136.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92137.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92138.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92139.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92140.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92141.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92142.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92143.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92144.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92145.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92146.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92147.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92148.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92149.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92150.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92151.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92152.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92153.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92154.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92155.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92156.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92158.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92159.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92160.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92161.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92162.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92163.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92164.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92165.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92166.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92167.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92168.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92169.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92170.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92171.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92172.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92173.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92174.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92175.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92176.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92177.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92180.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92181.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92182.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92183.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92185.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92186.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92187.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92188.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92189.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92190.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92191.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92192.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92193.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92194.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92195.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92196.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92197.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92198.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92199.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92200.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92201.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92202.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92203.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92204.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92205.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92206.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92207.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92208.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92209.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92210.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92211.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92212.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92213.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92214.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92215.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92216.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92217.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92218.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92219.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92220.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92221.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92222.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92223.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92224.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92225.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92226.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92227.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92228.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92229.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92230.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92231.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92232.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP92233.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
Length=89

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  25   GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  84

Query  182  RVTAK  196
            RVT+K
Sbjct  85   RVTSK  89



>gb|ACY74382.1| ERF2 transcription factor [Brassica carinata]
Length=243

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  147  GKFAAEIRDPAKNGARVWLGTFETAEDAAFAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  206

Query  182  RVTAKR  199
            R+T+KR
Sbjct  207  RITSKR  212



>dbj|BAP92157.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP92179.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
Length=89

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  25   GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  84

Query  182  RVTAK  196
            RVT+K
Sbjct  85   RVTSK  89



>dbj|BAP92178.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
Length=89

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  25   GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  84

Query  182  RVTAK  196
            RVT+K
Sbjct  85   RVTSK  89



>gb|ACY74383.1| ERF2 transcription factor [Brassica carinata]
Length=232

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  132  GKFAAEIRDPAKNGARVWLGTFETAEDAAFAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  191

Query  182  RVTAKR  199
            R+T+KR
Sbjct  192  RITSKR  197



>gb|ABD65036.1| ethylene responsive element binding factor, putative [Brassica 
oleracea]
 gb|ACY74388.1| ERF2 transcription factor [Brassica napus]
 gb|ACY74389.1| ERF2 transcription factor [Brassica carinata]
Length=232

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  132  GKFAAEIRDPAKNGARVWLGTFETAEDAAFAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  191

Query  182  RVTAKR  199
            R+T+KR
Sbjct  192  RITSKR  197



>dbj|BAP93298.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP93299.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP93300.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP93301.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP93302.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP93303.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP93304.1| ethylene-responsive transcription factor homolog, partial [Rubus 
grayanus]
 dbj|BAP93305.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93306.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93307.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93308.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93309.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93310.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93311.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93312.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93313.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93314.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93315.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93316.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93317.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93318.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93319.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93320.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93321.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93322.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93323.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93324.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93325.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93326.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93327.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93328.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93329.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93330.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93331.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93332.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93333.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93334.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93335.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93336.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93337.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP93338.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP93339.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP93340.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP93341.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP93342.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP93343.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP93344.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
 dbj|BAP93345.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93346.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93347.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93348.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93349.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93350.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93351.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93352.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93353.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93354.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93355.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93356.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93357.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93358.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93359.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93360.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93361.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93362.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93363.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93364.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93365.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93366.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93367.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93368.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93369.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93370.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93371.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93372.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93373.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
 dbj|BAP93374.1| ethylene-responsive transcription factor homolog, partial [Rubus 
sp. MM-2014]
Length=86

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  22   GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  81

Query  182  RVTAK  196
            RVT+K
Sbjct  82   RVTSK  86



>emb|CDY68787.1| BnaCnng60520D [Brassica napus]
Length=225

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  125  GKFAAEIRDPAKNGARVWLGTFETAEDAAFAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  184

Query  182  RVTAKR  199
            R+T+KR
Sbjct  185  RITSKR  190



>ref|XP_006606323.1| PREDICTED: ethylene-responsive transcription factor 2-like [Glycine 
max]
Length=91

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKF AEIRDPA+NGAR WLGTY+TAE+AA+AYD+AA+++RGSKALLNFPHRI  NEP PV
Sbjct  14   GKFTAEIRDPARNGARAWLGTYQTAEDAALAYDRAAFKLRGSKALLNFPHRINFNEPPPV  73

Query  182  RVTAKRR  202
            RVTAK+R
Sbjct  74   RVTAKKR  80



>ref|XP_007209449.1| hypothetical protein PRUPE_ppa009707mg [Prunus persica]
 gb|EMJ10648.1| hypothetical protein PRUPE_ppa009707mg [Prunus persica]
Length=281

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 92/134 (69%), Gaps = 17/134 (13%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  158  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  217

Query  182  RVTAKRRspepealstssasesgspKRRRKV-------AAAEQAADSDVESRSNPLPAEC  340
            RVT+KR      +   SS+SESGSPKRR+KV       A  E  A    E     +   C
Sbjct  218  RVTSKRS-----SPEPSSSSESGSPKRRKKVAVLNPAQAGLEMGAGIGQEQVGGQVVVSC  272

Query  341  HANILPIGEQLIVS  382
                   GEQL+VS
Sbjct  273  TR-----GEQLLVS  281



>ref|XP_009108325.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Brassica 
rapa]
Length=254

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 8/99 (8%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  143  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  202

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAAD  298
            RV +KR         +SS +E+G+ KRRR VA+  Q  D
Sbjct  203  RVKSKR--------GSSSENENGASKRRRTVASGGQGTD  233



>ref|NP_199533.1| ethylene-responsive transcription factor 2 [Arabidopsis thaliana]
 sp|O80338.1|EF101_ARATH RecName: Full=Ethylene-responsive transcription factor 2; Short=AtERF2; 
AltName: Full=Ethylene-responsive element-binding 
factor 2; Short=EREBP-2 [Arabidopsis thaliana]
 dbj|BAA32419.1| ethylene responsive element binding factor 2 [Arabidopsis thaliana]
 dbj|BAA97155.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis 
thaliana]
 dbj|BAD42914.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis 
thaliana]
 dbj|BAD42992.1| ethylene responsive element binding factor 2 [Arabidopsis thaliana]
 dbj|BAD44295.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis 
thaliana]
 dbj|BAD44369.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis 
thaliana]
 dbj|BAD44588.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis 
thaliana]
 gb|ABD19651.1| At5g47220 [Arabidopsis thaliana]
 gb|AED95487.1| ethylene-responsive transcription factor 2 [Arabidopsis thaliana]
Length=243

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  126  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDIAAFRMRGSRALLNFPLRVNSGEPDPV  185

Query  182  RVTAKR  199
            R+T+KR
Sbjct  186  RITSKR  191



>ref|XP_010494952.1| PREDICTED: ethylene-responsive transcription factor 2-like [Camelina 
sativa]
Length=231

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  122  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  181

Query  182  RVTAKR  199
            R+T+KR
Sbjct  182  RITSKR  187



>gb|EPS69901.1| ethylene-responsive transcription factor 2, partial [Genlisea 
aurea]
Length=179

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPA+ GARVWLGTYETAEEAA AYD+AAYRMRG KALLNFPH+IGS EP+P+
Sbjct  94   GKFAAEIRDPARKGARVWLGTYETAEEAASAYDRAAYRMRGCKALLNFPHKIGSGEPEPI  153

Query  182  RVTAKRR  202
            R++ KRR
Sbjct  154  RISPKRR  160



>ref|XP_006398419.1| hypothetical protein EUTSA_v10001003mg [Eutrema salsugineum]
 gb|ESQ39872.1| hypothetical protein EUTSA_v10001003mg [Eutrema salsugineum]
Length=252

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  150  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  209

Query  182  RVTAKR  199
            R+T+KR
Sbjct  210  RITSKR  215



>gb|ADU76349.1| ethylene responsive factor, partial [Prunus persica]
Length=287

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 92/134 (69%), Gaps = 17/134 (13%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  164  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  223

Query  182  RVTAKRRspepealstssasesgspKRRRKV-------AAAEQAADSDVESRSNPLPAEC  340
            RVT+KR      +   SS+SESGSPKRR+KV       A  E  A    E     +   C
Sbjct  224  RVTSKRS-----SPEPSSSSESGSPKRRKKVAVLNPAQAGLEMGAGIGQEQVGGQVVVSC  278

Query  341  HANILPIGEQLIVS  382
                   GEQL+VS
Sbjct  279  TR-----GEQLLVS  287



>ref|XP_010053513.1| PREDICTED: ethylene-responsive transcription factor 2 [Eucalyptus 
grandis]
Length=324

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  171  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  230

Query  182  RVTAKR  199
            RVT+KR
Sbjct  231  RVTSKR  236



>ref|XP_002863350.1| ATERF-2/ATERF2/ERF2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39609.1| ATERF-2/ATERF2/ERF2 [Arabidopsis lyrata subsp. lyrata]
Length=225

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  109  GKFAAEIRDPAKNGARVWLGTFETAEAAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  168

Query  182  RVTAKR  199
            R+T+KR
Sbjct  169  RITSKR  174



>ref|XP_009108637.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Brassica 
rapa]
Length=239

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  128  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  187

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRS  319
            RV +KR         +SS +E+G+ KRRR VA+  Q  D  ++ + 
Sbjct  188  RVKSKR--------GSSSENENGASKRRRTVASGGQGTDMGLKVKC  225



>ref|XP_004245806.1| PREDICTED: ethylene-responsive transcription factor 2-like [Solanum 
lycopersicum]
Length=234

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 5/92 (5%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYDKAA+RMRGS+ALLNFP RI S EPDPV
Sbjct  143  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDKAAFRMRGSRALLNFPLRINSGEPDPV  202

Query  182  RVTAKRRspepealstssasesgspKRRRKVA  277
            RV +KR      ++S    S + S KRR+KVA
Sbjct  203  RVGSKR-----SSMSPEHCSSASSTKRRKKVA  229



>gb|AAM64544.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis 
thaliana]
Length=243

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD AA+RMRGS ALLNFP R+ S EPDPV
Sbjct  126  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDIAAFRMRGSSALLNFPLRVNSGEPDPV  185

Query  182  RVTAKR  199
            R+T+KR
Sbjct  186  RITSKR  191



>gb|AAX07459.1| ethylene-responsive element binding protein ERF5 [Gossypium hirsutum]
Length=179

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYDKAAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  72   GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDKAAYRMRGSRALLNFPLRVNSGEPDPV  131

Query  182  RVTAKR  199
            R+T+KR
Sbjct  132  RITSKR  137



>ref|XP_004300354.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Fragaria 
vesca subsp. vesca]
Length=296

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  167  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  226

Query  182  RVTAKR  199
            RVT+KR
Sbjct  227  RVTSKR  232



>ref|XP_006279696.1| hypothetical protein CARUB_v10027108mg [Capsella rubella]
 gb|EOA12594.1| hypothetical protein CARUB_v10027108mg [Capsella rubella]
Length=217

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  124  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  183

Query  182  RVTAKR  199
            R+T+KR
Sbjct  184  RITSKR  189



>ref|XP_002304302.1| hypothetical protein POPTR_0003s07910g [Populus trichocarpa]
 gb|EEE79281.1| hypothetical protein POPTR_0003s07910g [Populus trichocarpa]
Length=280

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  160  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  219

Query  182  RVTAKR  199
            RVT+KR
Sbjct  220  RVTSKR  225



>ref|XP_003549934.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Glycine 
max]
Length=251

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  143  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  202

Query  182  RVTAKR  199
            RVT+KR
Sbjct  203  RVTSKR  208



>ref|XP_010538473.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Tarenaya 
hassleriana]
Length=269

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 91/127 (72%), Gaps = 14/127 (11%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  157  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  216

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+T+KR        S+SS+ E+GSPKRRRK   + +  D   +        +C  +    
Sbjct  217  RITSKR-------SSSSSSLENGSPKRRRKAEISPERGDKAGQ-------VKCEVDPCTR  262

Query  362  GEQLIVS  382
            G QL+VS
Sbjct  263  GGQLLVS  269



>gb|ABN50365.2| ethylene responsive element binding protein 1 [Gossypium barbadense]
Length=255

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYDKAAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  148  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDKAAYRMRGSRALLNFPLRVNSGEPDPV  207

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAA  283
            R+T+K R+    + S+SS SE+GSPKRRRKV +A
Sbjct  208  RITSK-RATPEPSTSSSSGSENGSPKRRRKVGSA  240



>gb|ACJ54440.1| AP2/EREBP transcription factor [Gossypium hirsutum]
Length=255

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 83/94 (88%), Gaps = 1/94 (1%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYDKAAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  148  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDKAAYRMRGSRALLNFPLRVNSGEPDPV  207

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAA  283
            R+T+K R+    + S+SS SE+GSPKRRRKV +A
Sbjct  208  RITSK-RATPEPSTSSSSGSENGSPKRRRKVGSA  240



>ref|XP_011047596.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Populus 
euphratica]
Length=283

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ TAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  164  GKFAAEIRDPAKNGARVWLGTFATAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  223

Query  182  RVTAKR  199
            RVT+KR
Sbjct  224  RVTSKR  229



>dbj|BAA87068.2| ethylene-responsive element binding protein1 homolog [Matricaria 
chamomilla]
Length=235

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNGARVWLGTYETAE+AA+AYD AAYRMRGS+ALLNFP RI S EP+PV
Sbjct  124  GKYAAEIRDPAKNGARVWLGTYETAEDAAVAYDMAAYRMRGSRALLNFPLRINSGEPEPV  183

Query  182  RVTAKRR  202
            R+T+KR+
Sbjct  184  RITSKRK  190



>ref|XP_011031947.1| PREDICTED: ethylene-responsive transcription factor 2 [Populus 
euphratica]
Length=280

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  160  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  219

Query  182  RVTAKR  199
            RVT+KR
Sbjct  220  RVTSKR  225



>gb|KFK31389.1| hypothetical protein AALP_AA6G105600 [Arabis alpina]
Length=255

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  151  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  210

Query  182  RVTAKR  199
            R+T+KR
Sbjct  211  RITSKR  216



>ref|XP_002532361.1| Ethylene-responsive transcription factor 1A, putative [Ricinus 
communis]
 gb|EEF30034.1| Ethylene-responsive transcription factor 1A, putative [Ricinus 
communis]
Length=284

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ + EPDPV
Sbjct  164  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNNGEPDPV  223

Query  182  RVTAKR  199
            RVT+KR
Sbjct  224  RVTSKR  229



>ref|XP_003538752.2| PREDICTED: ethylene-responsive transcription factor 1A-like [Glycine 
max]
Length=269

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP RI S EP+PV
Sbjct  181  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRINSGEPEPV  240

Query  182  RVTAKR  199
            RVTAKR
Sbjct  241  RVTAKR  246



>ref|XP_006284323.1| hypothetical protein CARUB_v10005497mg [Capsella rubella]
 gb|EOA17221.1| hypothetical protein CARUB_v10005497mg [Capsella rubella]
Length=268

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 90/126 (71%), Gaps = 18/126 (14%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  160  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  219

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            R+ +KR          +S+SE+G+PK+RR VAA + A           L  +C    +  
Sbjct  220  RIKSKR----------ASSSENGAPKKRRTVAAGDGAVKG--------LTVKCEMVEVTR  261

Query  362  GEQLIV  379
            G++L+V
Sbjct  262  GDRLLV  267



>ref|XP_010104817.1| Ethylene-responsive transcription factor 2 [Morus notabilis]
 gb|EXC02053.1| Ethylene-responsive transcription factor 2 [Morus notabilis]
Length=289

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  154  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  213

Query  182  RVTAKR  199
            RVT+KR
Sbjct  214  RVTSKR  219



>ref|XP_009333695.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=279

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP RI S EPDPV
Sbjct  155  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRINSGEPDPV  214

Query  182  RVTAKR  199
            R+T+KR
Sbjct  215  RLTSKR  220



>ref|XP_002271494.1| PREDICTED: ethylene-responsive transcription factor 2 [Vitis 
vinifera]
 emb|CBI16660.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNGARVWLGTYETAE+AA+AYD+AA+R+RGS+A+LNFP RIGS +P+PV
Sbjct  92   GKYAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAFRIRGSRAILNFPLRIGSGDPEPV  151

Query  182  RVTAKRR  202
            R+T KRR
Sbjct  152  RITTKRR  158



>ref|XP_007157259.1| hypothetical protein PHAVU_002G055700g [Phaseolus vulgaris]
 gb|ESW29253.1| hypothetical protein PHAVU_002G055700g [Phaseolus vulgaris]
Length=270

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP RI S EP+PV
Sbjct  152  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRINSGEPEPV  211

Query  182  RVTAKR  199
            RVT+KR
Sbjct  212  RVTSKR  217



>gb|ADE41120.1| AP2 domain class transcription factor [Malus domestica]
Length=276

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ET E+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  152  GKFAAEIRDPAKNGARVWLGTFETGEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  211

Query  182  RVTAKR  199
            R+T+KR
Sbjct  212  RLTSKR  217



>ref|XP_010441485.1| PREDICTED: ethylene-responsive transcription factor 2-like [Camelina 
sativa]
Length=226

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EP+PV
Sbjct  123  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPEPV  182

Query  182  RVTAKR  199
            R+T+KR
Sbjct  183  RITSKR  188



>gb|ADC55527.1| ERF transcription factor [Camellia sinensis]
Length=212

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP RI S EP+PV
Sbjct  118  GKFAAEIRDPTKNGARVWLGTFETAEDAAVAYDRAAYRMRGSRALLNFPLRINSGEPEPV  177

Query  182  RVTAKR  199
            RVT+KR
Sbjct  178  RVTSKR  183



>gb|AAF63205.1|AF245119_1 AP2-related transcription factor [Mesembryanthemum crystallinum]
 gb|AAP80810.1| ethylene responsive protein [Mesembryanthemum crystallinum]
Length=282

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 93/136 (68%), Gaps = 9/136 (7%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGSKALLNFP R+ S EPDPV
Sbjct  147  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSKALLNFPLRVNSGEPDPV  206

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAE---------QAADSDVESRSNPLPA  334
            R+T+KR SPE    S+SS S S   +++ +V             Q   + VE     +  
Sbjct  207  RITSKRSSPERSVSSSSSESASPKRRKKEEVVVGPVAGQARPGLQQVGNVVEGMQVGVGC  266

Query  335  ECHANILPIGEQLIVS  382
            +     +P+G+QL+V+
Sbjct  267  QVGVGTMPLGDQLLVT  282



>ref|XP_010055446.1| PREDICTED: ethylene-responsive transcription factor 2 [Eucalyptus 
grandis]
Length=279

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYD+AAYRMRGS+ALLNFP RI S EP+PV
Sbjct  144  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRMRGSRALLNFPLRINSGEPEPV  203

Query  182  RVTAKR  199
            RVT KR
Sbjct  204  RVTVKR  209



>ref|XP_010481346.1| PREDICTED: ethylene-responsive transcription factor 2-like [Camelina 
sativa]
Length=230

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  123  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  182

Query  182  RVTAK  196
            R+T+K
Sbjct  183  RITSK  187



>dbj|BAG15867.1| transcription factor [Bruguiera gymnorhiza]
Length=272

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP ++ S EPDPV
Sbjct  169  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLKVNSGEPDPV  228

Query  182  RVTAKR  199
            R+T+KR
Sbjct  229  RITSKR  234



>emb|CDX76569.1| BnaA08g08310D [Brassica napus]
Length=180

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 81/106 (76%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  69   GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  128

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRS  319
            RV +KR         +SS +E+G+ KR R VA+  Q  D  ++ + 
Sbjct  129  RVKSKR--------GSSSENENGASKRGRTVASGGQGTDMGLKVKC  166



>ref|XP_009617605.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
tomentosiformis]
Length=245

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYDKAA+RMRGS+ALLNFP R+ S EP+P+
Sbjct  146  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDKAAFRMRGSRALLNFPLRVNSGEPEPI  205

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQ  289
            RV +KR S  PE  S+SS S +  PKRR+KV+   +
Sbjct  206  RVASKRSSMSPEYSSSSSTSSASPPKRRKKVSQGTE  241



>ref|XP_004508948.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Cicer 
arietinum]
Length=265

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYDKAAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  154  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDKAAYRMRGSRALLNFPLRVNSGEPDPV  213

Query  182  RVTAKR  199
            RV +KR
Sbjct  214  RVASKR  219



>ref|XP_002271521.1| PREDICTED: ethylene-responsive transcription factor 2 [Vitis 
vinifera]
 emb|CBI16659.3| unnamed protein product [Vitis vinifera]
Length=207

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNGARVWLGTYETAE+AA+AYD+AA+R+RGS+ALLNFP R+GS EP+PV
Sbjct  92   GKYAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAFRIRGSRALLNFPLRVGSGEPEPV  151

Query  182  RVTAKRR  202
            R+T +RR
Sbjct  152  RITPRRR  158



>emb|CDY38401.1| BnaC01g10100D [Brassica napus]
Length=227

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYDKAA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  132  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDKAAFRMRGSRALLNFPLRVNSGEPDPV  191

Query  182  RVTAKR  199
            R+ +KR
Sbjct  192  RIKSKR  197



>ref|XP_003524070.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Glycine 
max]
Length=255

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 84/127 (66%), Gaps = 18/127 (14%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  147  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  206

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RV +KR S    A +  +        +R+KV          V+ +     AEC       
Sbjct  207  RVKSKRSSSPESAAALPA--------KRKKVVVV-----GTVQEQVGSQVAECTR-----  248

Query  362  GEQLIVS  382
            GEQL+VS
Sbjct  249  GEQLLVS  255



>ref|XP_009775795.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
sylvestris]
Length=242

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA AYDKAA+RMRGS+ALLNFP RI S EPDP+
Sbjct  142  GKFAAEIRDPAKNGARVWLGTYETAEDAAFAYDKAAFRMRGSRALLNFPLRINSGEPDPI  201

Query  182  RVTAKR  199
            RV +KR
Sbjct  202  RVGSKR  207



>emb|CDP10018.1| unnamed protein product [Coffea canephora]
Length=227

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AAIAYD+AAYRMRG++ALLNFP RI S EP+PV
Sbjct  98   GKFAAEIRDPAKNGARVWLGTFETAEDAAIAYDRAAYRMRGARALLNFPLRINSGEPEPV  157

Query  182  RVTAKR  199
            R+T+KR
Sbjct  158  RITSKR  163



>ref|XP_009608915.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Nicotiana 
tomentosiformis]
Length=242

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            G+FAAEIRDPAKNGARVWLGTYETAE+AA AYDKAA+RMRGS+ALLNFP RI S+EPDP+
Sbjct  146  GRFAAEIRDPAKNGARVWLGTYETAEDAAFAYDKAAFRMRGSRALLNFPLRINSDEPDPI  205

Query  182  RVTAKR  199
            RV +KR
Sbjct  206  RVGSKR  211



>dbj|BAP92184.1| ethylene-responsive transcription factor homolog, partial [Rubus 
palmatus]
Length=89

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AY +AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  25   GKFAAEIRDPAKNGARVWLGTFETAEDAALAYXRAAYRMRGSRALLNFPLRVNSGEPDPV  84

Query  182  RVTAK  196
            RVT+K
Sbjct  85   RVTSK  89



>gb|ACM49849.1| ethylene responsive transcription factor 1a [Prunus salicina]
Length=282

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EP+PV
Sbjct  158  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPEPV  217

Query  182  RVTAKR  199
            RVT+KR
Sbjct  218  RVTSKR  223



>ref|XP_008352246.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=276

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ET E+AA+AYD+AAYRMRGS ALLNFP R+ S EPDPV
Sbjct  152  GKFAAEIRDPAKNGARVWLGTFETGEDAALAYDRAAYRMRGSXALLNFPLRVNSGEPDPV  211

Query  182  RVTAKR  199
            R+T+KR
Sbjct  212  RLTSKR  217



>gb|KFK24043.1| hypothetical protein AALP_AAs42697U000400 [Arabis alpina]
Length=248

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  145  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  204

Query  182  RVTAKR  199
            RV +KR
Sbjct  205  RVKSKR  210



>ref|XP_008337240.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=276

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ET E+AA+AYD+AAYRMRGS ALLNFP R+ S EPDPV
Sbjct  152  GKFAAEIRDPAKNGARVWLGTFETGEDAALAYDRAAYRMRGSXALLNFPLRVNSGEPDPV  211

Query  182  RVTAKR  199
            R+T+KR
Sbjct  212  RLTSKR  217



>ref|XP_010439993.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Camelina 
sativa]
Length=269

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  159  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  218

Query  182  RVTAKR  199
            R+ +KR
Sbjct  219  RIKSKR  224



>ref|XP_006359239.1| PREDICTED: ethylene-responsive transcription factor 2-like [Solanum 
tuberosum]
Length=234

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYDKAA+RMRGS+ALLNFP RI S EP+PV
Sbjct  143  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDKAAFRMRGSRALLNFPLRINSGEPEPV  202

Query  182  RVTAKR  199
            RV +KR
Sbjct  203  RVGSKR  208



>ref|XP_010434656.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Camelina 
sativa]
Length=269

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  159  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  218

Query  182  RVTAKR  199
            R+ +KR
Sbjct  219  RIKSKR  224



>ref|XP_010449604.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Camelina 
sativa]
Length=270

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  160  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  219

Query  182  RVTAKR  199
            R+ +KR
Sbjct  220  RIKSKR  225



>ref|XP_004164449.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Cucumis 
sativus]
Length=279

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGSKALLNFP R+ S EPDPV
Sbjct  150  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSKALLNFPLRVNSGEPDPV  209

Query  182  RVT  190
            RVT
Sbjct  210  RVT  212



>ref|XP_004147226.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Cucumis 
sativus]
 gb|KGN55838.1| Ethylene responsive transcription factor 1a [Cucumis sativus]
Length=279

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGSKALLNFP R+ S EPDPV
Sbjct  150  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSKALLNFPLRVNSGEPDPV  209

Query  182  RVT  190
            RVT
Sbjct  210  RVT  212



>gb|AHN92189.1| ERF protein 1 [Citrullus lanatus]
Length=286

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT ETAE+AA+AYD+AAYRMRGSKALLNFP R+ S EPDPV
Sbjct  156  GKFAAEIRDPAKNGARVWLGTLETAEDAALAYDRAAYRMRGSKALLNFPLRVNSGEPDPV  215

Query  182  RVT  190
            RVT
Sbjct  216  RVT  218



>ref|XP_010518707.1| PREDICTED: ethylene-responsive transcription factor 1A [Tarenaya 
hassleriana]
Length=247

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EP+PV
Sbjct  139  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPEPV  198

Query  182  RVTAKR  199
            RVT KR
Sbjct  199  RVTTKR  204



>ref|XP_011081402.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Sesamum 
indicum]
Length=238

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYD+AAYRMRGS+A+LNFP RI S EP PV
Sbjct  129  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAYRMRGSRAMLNFPLRINSGEPAPV  188

Query  182  RVTAKR  199
            R+T KR
Sbjct  189  RITVKR  194



>dbj|BAI52953.1| ethylene responsive transcription factor 1a [Citrullus lanatus 
subsp. vulgaris]
Length=286

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT ETAE+AA+AYD+AAYRMRGSKALLNFP R+ S EPDPV
Sbjct  156  GKFAAEIRDPAKNGARVWLGTLETAEDAALAYDRAAYRMRGSKALLNFPLRVNSGEPDPV  215

Query  182  RVT  190
            RVT
Sbjct  216  RVT  218



>ref|XP_003633905.1| PREDICTED: ethylene-responsive transcription factor 2 [Vitis 
vinifera]
 emb|CBI16661.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            G++AAEIRDPAKNGARVWLGTYETAE+AA+AYD+AA+R+RGS+AL+NFP RIGS +P+PV
Sbjct  92   GRYAAEIRDPAKNGARVWLGTYETAEDAALAYDRAAFRIRGSRALVNFPQRIGSGDPEPV  151

Query  182  RVTAKRR  202
            R+T KRR
Sbjct  152  RITPKRR  158



>emb|CDY27923.1| BnaCnng05080D [Brassica napus]
Length=255

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  143  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  202

Query  182  RVTAKR  199
            RV +KR
Sbjct  203  RVKSKR  208



>ref|XP_008448804.1| PREDICTED: ethylene-responsive transcription factor 2 [Cucumis 
melo]
Length=275

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGSKALLNFP R+ S EPDPV
Sbjct  150  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSKALLNFPLRVNSGEPDPV  209

Query  182  RVT  190
            RVT
Sbjct  210  RVT  212



>emb|CAN82632.1| hypothetical protein VITISV_028134 [Vitis vinifera]
Length=202

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNG+RVWLGTYETAE+AA+AYD+AA+R+RGS+ALLNFP R+GS EP+PV
Sbjct  92   GKYAAEIRDPAKNGSRVWLGTYETAEDAALAYDRAAFRIRGSRALLNFPLRVGSGEPEPV  151

Query  182  RVTAKRR  202
            R+T +RR
Sbjct  152  RITPRRR  158



>ref|XP_006414221.1| hypothetical protein EUTSA_v10027401mg [Eutrema salsugineum]
 gb|ESQ55674.1| hypothetical protein EUTSA_v10027401mg [Eutrema salsugineum]
Length=243

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ TAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  144  GKFAAEIRDPAKNGARVWLGTFGTAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  203

Query  182  RVTAKR  199
            R+ +KR
Sbjct  204  RIKSKR  209



>ref|XP_009796413.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Nicotiana 
sylvestris]
Length=248

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA AYDKAA+RMRGS+ALLNFP RI S +PDP+
Sbjct  152  GKFAAEIRDPAKNGARVWLGTYETAEDAAFAYDKAAFRMRGSRALLNFPLRINSGDPDPI  211

Query  182  RVTAKR  199
            RV +KR
Sbjct  212  RVGSKR  217



>emb|CAN81895.1| hypothetical protein VITISV_007029 [Vitis vinifera]
Length=202

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 64/67 (96%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNG+RVWLGTYETAE+AA+AYD+AA+R+RGS+ALLNFP R+GS EP+PV
Sbjct  92   GKYAAEIRDPAKNGSRVWLGTYETAEDAALAYDRAAFRIRGSRALLNFPLRVGSGEPEPV  151

Query  182  RVTAKRR  202
            R+T +RR
Sbjct  152  RITPRRR  158



>ref|XP_006477125.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Citrus 
sinensis]
Length=271

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 3/93 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP RI S EP+PV
Sbjct  148  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRINSGEPEPV  207

Query  182  RVTAKRRspepealstssasesgspKRRRKVAA  280
            R+ +KR        S+S+ S S SPKRRRKVAA
Sbjct  208  RIKSKR---STPEPSSSTDSGSVSPKRRRKVAA  237



>ref|XP_006368978.1| hypothetical protein POPTR_0001s15390g [Populus trichocarpa]
 gb|ERP65547.1| hypothetical protein POPTR_0001s15390g [Populus trichocarpa]
Length=283

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EP PV
Sbjct  164  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPAPV  223

Query  182  RVTAKR  199
            RVT+KR
Sbjct  224  RVTSKR  229



>gb|KDO61316.1| hypothetical protein CISIN_1g044938mg [Citrus sinensis]
Length=271

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 3/93 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP RI S EP+PV
Sbjct  148  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRINSGEPEPV  207

Query  182  RVTAKRRspepealstssasesgspKRRRKVAA  280
            R+ +KR        S+S+ S S SPKRRRKVAA
Sbjct  208  RIKSKR---STPEPSSSTDSGSVSPKRRRKVAA  237



>emb|CDY28965.1| BnaA02g25110D [Brassica napus]
Length=230

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  133  GKFAAEIRDPAKNGARVWLGTFETAEDAAFAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  192

Query  182  RVT  190
            R+T
Sbjct  193  RIT  195



>gb|ACY74381.1| ERF2 transcription factor [Brassica napus]
Length=229

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  132  GKFAAEIRDPAKNGARVWLGTFETAEDAAFAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  191

Query  182  RVT  190
            R+T
Sbjct  192  RIT  194



>ref|XP_009128950.1| PREDICTED: ethylene-responsive transcription factor 2-like [Brassica 
rapa]
Length=230

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  133  GKFAAEIRDPAKNGARVWLGTFETAEDAAFAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  192

Query  182  RVT  190
            R+T
Sbjct  193  RIT  195



>gb|ACY74380.1| ERF2 transcription factor [Brassica napus]
Length=229

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  132  GKFAAEIRDPAKNGARVWLGTFETAEDAAFAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  191

Query  182  RVT  190
            R+T
Sbjct  192  RIT  194



>ref|XP_004511721.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Cicer 
arietinum]
Length=256

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+A+LNFP R+ S EPDPV
Sbjct  150  GKYAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRAMLNFPLRVNSGEPDPV  209

Query  182  RVTAKR  199
            RV AKR
Sbjct  210  RVPAKR  215



>gb|KDP39921.1| hypothetical protein JCGZ_03452 [Jatropha curcas]
Length=300

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  170  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  229

Query  182  RVT  190
            RVT
Sbjct  230  RVT  232



>ref|XP_006440234.1| hypothetical protein CICLE_v10021652mg [Citrus clementina]
 gb|ESR53474.1| hypothetical protein CICLE_v10021652mg [Citrus clementina]
Length=271

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 3/93 (3%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP RI S EP+PV
Sbjct  148  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRINSGEPEPV  207

Query  182  RVTAKRRspepealstssasesgspKRRRKVAA  280
            R+ +KR        S+S+ S S SPKRRRKVAA
Sbjct  208  RIKSKR---STPEPSSSTDSGSVSPKRRRKVAA  237



>ref|XP_002270581.2| PREDICTED: ethylene-responsive transcription factor 2 [Vitis 
vinifera]
Length=282

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  147  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  206

Query  182  RVT  190
            RVT
Sbjct  207  RVT  209



>ref|XP_006358332.1| PREDICTED: ethylene-responsive transcription factor 2-like [Solanum 
tuberosum]
Length=199

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYDKAAYR+RGS+ALLNFP R+ S EP+PV
Sbjct  101  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDKAAYRIRGSRALLNFPLRVNSGEPEPV  160

Query  182  RVTAKR  199
            RV +KR
Sbjct  161  RVGSKR  166



>ref|XP_009628437.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
tomentosiformis]
Length=243

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA AYDKAA+R+RGS+ALLNFP RI S EPDP+
Sbjct  142  GKFAAEIRDPAKNGARVWLGTYETAEDAAFAYDKAAFRIRGSRALLNFPLRINSGEPDPI  201

Query  182  RVTAKR  199
            RV +KR
Sbjct  202  RVGSKR  207



>gb|EYU33029.1| hypothetical protein MIMGU_mgv1a022878mg [Erythranthe guttata]
Length=262

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYD+AAY MRGS+ALLNFP RI S EP PV
Sbjct  142  GKFAAEIRDPAKNGARVWLGTYETAEDAAVAYDRAAYCMRGSRALLNFPLRINSGEPAPV  201

Query  182  RVTAKR  199
            RVTAKR
Sbjct  202  RVTAKR  207



>ref|XP_004244707.2| PREDICTED: ethylene-responsive transcription factor 2-like [Solanum 
lycopersicum]
Length=199

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYDKAAYR+RGS+ALLNFP R+ S EP+PV
Sbjct  101  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDKAAYRIRGSRALLNFPLRVNSGEPEPV  160

Query  182  RVTAKR  199
            RV +KR
Sbjct  161  RVGSKR  166



>gb|ADE41134.1| AP2 domain class transcription factor [Malus domestica]
Length=276

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  152  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  211

Query  182  RVT  190
            RVT
Sbjct  212  RVT  214



>ref|XP_008337947.1| PREDICTED: ethylene-responsive transcription factor 1A [Malus 
domestica]
Length=276

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  152  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  211

Query  182  RVT  190
            RVT
Sbjct  212  RVT  214



>ref|XP_008352414.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Malus 
domestica]
Length=276

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  152  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  211

Query  182  RVT  190
            RVT
Sbjct  212  RVT  214



>ref|XP_009611402.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
tomentosiformis]
Length=242

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYD AAYR+RGS+ALLNFP R+ S EP+PV
Sbjct  148  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDNAAYRIRGSRALLNFPLRVNSGEPEPV  207

Query  182  RVTAKR  199
            RV +KR
Sbjct  208  RVGSKR  213



>ref|XP_009369100.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
 ref|XP_009369170.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=269

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  145  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  204

Query  182  RVT  190
            RVT
Sbjct  205  RVT  207



>gb|AEQ64867.1| ethylene response factor 11 [Medicago sativa]
Length=268

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  154  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  213

Query  182  RVTAK  196
            R+ +K
Sbjct  214  RIASK  218



>gb|AHZ31603.1| ethylene-responsive transcription factor [Brassica juncea var. 
tumida]
Length=221

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAK GARVWLGT+ET E+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  124  GKFAAEIRDPAKKGARVWLGTFETGEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  183

Query  182  RVTAKR  199
            R+ +KR
Sbjct  184  RIKSKR  189



>gb|ADE41124.1| AP2 domain class transcription factor [Malus domestica]
Length=278

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 91/140 (65%), Gaps = 11/140 (8%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGARVWLGTYETAE AA+AYD+AA+++RGSKA LNFPH IGS   +PV
Sbjct  139  GKYAAEIRDPKKNGARVWLGTYETAEGAALAYDQAAFKIRGSKAKLNFPHLIGSEGYEPV  198

Query  182  RVTAKRRspepealstssasesgspKRR----RKVAAAEQAADSDVE-------SRSNPL  328
            RVT KRR PE    S+ S S S  PKRR    R  A AE  + S VE       +  +  
Sbjct  199  RVTVKRRVPEFSTSSSLSESGSPKPKRRNIGLRTAAEAESGSTSRVEMVEMSQLAAVDQW  258

Query  329  PAECHANILPIGEQLIVSQL  388
              + +  + P+  +L++S L
Sbjct  259  LGDLNTTVSPMAHELLISGL  278



>gb|AGL08720.1| ERF1 [Salvia miltiorrhiza]
Length=182

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP+KNGARVWLGTYETAE+AA+AYD+AAY MRGS+ALLNFP RI S EP PV
Sbjct  79   GKFAAEIRDPSKNGARVWLGTYETAEDAALAYDQAAYAMRGSRALLNFPLRINSGEPAPV  138

Query  182  RVTAKR  199
            R+T+KR
Sbjct  139  RITSKR  144



>gb|KCW62799.1| hypothetical protein EUGRSUZ_G00391 [Eucalyptus grandis]
Length=208

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAE+RDP KNGAR+WLGTYET E+AA+AYD+AA++MRG KA LNFPH IGS + +P+
Sbjct  86   GKYAAEMRDPKKNGARIWLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDYEPI  145

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAE-CHANILP  358
            RV+ KRRS EP + STSS     +  +RRK    E   D+ V+ RS P+P       +L 
Sbjct  146  RVSLKRRSAEPSSPSTSSGESFLTGTKRRK---REVNVDAKVDFRS-PIPFHILDVGLLS  201

Query  359  IGEQLIV  379
            + EQ + 
Sbjct  202  VDEQFLF  208



>ref|XP_009800922.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
sylvestris]
Length=281

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYDKAA+RMRGS+AL+NFP R+ S EP+P+
Sbjct  185  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDKAAFRMRGSRALINFPLRVNSGEPEPI  244

Query  182  RVTAKR  199
            RV +KR
Sbjct  245  RVGSKR  250



>ref|XP_007203750.1| hypothetical protein PRUPE_ppa016903mg [Prunus persica]
 gb|EMJ04949.1| hypothetical protein PRUPE_ppa016903mg [Prunus persica]
Length=256

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGARVWLGTYETAE+AA+AYDKAA++MRGSKA LNFPH IGS   +PV
Sbjct  137  GKYAAEIRDPKKNGARVWLGTYETAEDAALAYDKAAFKMRGSKAKLNFPHLIGSEGCEPV  196

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVE  310
            R+T KRR+PE  + S+SS S S  PKRR     +   A+SD+E
Sbjct  197  RITPKRRAPESSSSSSSSDSGSPRPKRRNTGVGSVAGAESDME  239



>ref|XP_009761318.1| PREDICTED: ethylene-responsive transcription factor 2-like [Nicotiana 
sylvestris]
Length=246

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYETAE+AA+AYDKAAYR+RGS+A+LNFP R+ S EP+PV
Sbjct  152  GKFAAEIRDPAKNGARVWLGTYETAEDAALAYDKAAYRIRGSRAVLNFPLRVNSGEPEPV  211

Query  182  RVTAKR  199
            RV +KR
Sbjct  212  RVGSKR  217



>ref|NP_567530.4| ethylene-responsive transcription factor 1A [Arabidopsis thaliana]
 sp|O80337.2|EF100_ARATH RecName: Full=Ethylene-responsive transcription factor 1A; Short=AtERF1A; 
AltName: Full=Ethylene-responsive element-binding 
factor 1A; Short=EREBP-1A [Arabidopsis thaliana]
 gb|AAL25588.1| AT4g17500/dl4785w [Arabidopsis thaliana]
 gb|AAL32611.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO00938.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE83903.1| ethylene-responsive transcription factor 1A [Arabidopsis thaliana]
Length=268

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  157  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  216

Query  182  RV  187
            R+
Sbjct  217  RI  218



>ref|XP_010068078.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=242

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAE+RDP KNGAR+WLGTYET E+AA+AYD+AA++MRG KA LNFPH IGS + +P+
Sbjct  120  GKYAAEMRDPKKNGARIWLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDYEPI  179

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAE-CHANILP  358
            RV+ KRRS EP + STSS     +  +RRK    E   D+ V+ RS P+P       +L 
Sbjct  180  RVSLKRRSAEPSSPSTSSGESFLTGTKRRK---REVNVDAKVDFRS-PIPFHILDVGLLS  235

Query  359  IGEQLIV  379
            + EQ + 
Sbjct  236  VDEQFLF  242



>dbj|BAA32418.1| ethylene responsive element binding factor 1 [Arabidopsis thaliana]
Length=266

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  155  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  214

Query  182  RV  187
            R+
Sbjct  215  RI  216



>ref|XP_008232470.1| PREDICTED: ethylene-responsive transcription factor 2-like [Prunus 
mume]
Length=272

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGARVWLGTYETAE+AA+AYDKAA++MRGSKA LNFPH IGS   +PV
Sbjct  137  GKYAAEIRDPKKNGARVWLGTYETAEDAALAYDKAAFKMRGSKAKLNFPHLIGSEGCEPV  196

Query  182  RVTAKRRspepealstssasesgspKRRR----KVAAAEQAADSDVE  310
            R+T KRR+PE  + S+SS S S  PKRR      VA AE  ++S VE
Sbjct  197  RITPKRRAPESSSWSSSSDSGSPRPKRRNTGVGSVAGAESGSESLVE  243



>dbj|BAG50059.1| transcription factor AP2-EREBP [Lotus japonicus]
Length=285

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  148  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  207

Query  182  RV  187
            RV
Sbjct  208  RV  209



>ref|XP_003608658.1| Ethylene-responsive transcription factor 1A [Medicago truncatula]
 gb|ABO40237.1| ethylene-responsive transcription factor 1A [Medicago truncatula]
 gb|AES90855.1| ethylene response factor [Medicago truncatula]
Length=268

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  154  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  213

Query  182  RV  187
            R+
Sbjct  214  RI  215



>ref|XP_002870100.1| hypothetical protein ARALYDRAFT_493126 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46359.1| hypothetical protein ARALYDRAFT_493126 [Arabidopsis lyrata subsp. 
lyrata]
Length=182

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  73   GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  132

Query  182  RV  187
            R+
Sbjct  133  RI  134



>gb|AGL34965.1| ethylene-responsive transcription factor 6 [Hevea brasiliensis]
Length=267

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAK GARVWLGT+ETAE+AA+AYD+AAYRMRGS+ALLNFP R+ S EPDPV
Sbjct  160  GKFAAEIRDPAKKGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGEPDPV  219

Query  182  RVT  190
            RVT
Sbjct  220  RVT  222



>emb|CAB45963.1| EREBP-2 protein, partial [Arabidopsis thaliana]
 emb|CAB78753.1| EREBP-2 protein [Arabidopsis thaliana]
Length=225

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  114  GKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  173

Query  182  RV  187
            R+
Sbjct  174  RI  175



>ref|XP_007203292.1| hypothetical protein PRUPE_ppa025748mg [Prunus persica]
 gb|EMJ04491.1| hypothetical protein PRUPE_ppa025748mg [Prunus persica]
Length=223

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET E+A +AYD+AA+++RG KA LNFPH IGS+  +PV
Sbjct  117  GKFAAEIRDPAKNGARVWLGTYETPEDAGLAYDQAAFKIRGCKAKLNFPHLIGSSNMEPV  176

Query  182  RVTAKRR  202
            RVT KRR
Sbjct  177  RVTPKRR  183



>ref|XP_008376227.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=278

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGARVWLGTYETAE AA+AYD+AA++MRGSKA LNFPH IGS   +PV
Sbjct  139  GKYAAEIRDPKKNGARVWLGTYETAEGAALAYDQAAFKMRGSKAKLNFPHLIGSEGYEPV  198

Query  182  RVTAKRR  202
            RVT KRR
Sbjct  199  RVTXKRR  205



>ref|XP_006359238.1| PREDICTED: ethylene-responsive transcription factor 2-like [Solanum 
tuberosum]
Length=233

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNG RVWLGTYETAE+AA AYDKAA+RMRGS+A+LNFP RI S EP+P+
Sbjct  140  GKFAAEIRDPAKNGQRVWLGTYETAEDAAFAYDKAAFRMRGSRAMLNFPLRINSGEPEPI  199

Query  182  RVTAKR  199
            RV +K+
Sbjct  200  RVRSKK  205



>ref|XP_004308507.1| PREDICTED: ethylene-responsive transcription factor 13-like [Fragaria 
vesca subsp. vesca]
Length=213

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNGARVWLGTYET E+A +AYD+AA+++RG KA LNFPH IGSN  +PV
Sbjct  122  GKYAAEIRDPAKNGARVWLGTYETPEDAGLAYDRAAFKLRGRKAKLNFPHLIGSNNVEPV  181

Query  182  RVTAKRR  202
            RVT KRR
Sbjct  182  RVTPKRR  188



>emb|CBJ55932.1| ethylene response factor 2.1 [Bupleurum kaoi]
Length=230

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAK+GARVWLGTYETAE+AA+AYD+AAYRMRGS+A+LNFP R+ S EP+P 
Sbjct  97   GKFAAEIRDPAKDGARVWLGTYETAEDAALAYDQAAYRMRGSRAMLNFPLRVNSGEPEPK  156

Query  182  RVTAKR  199
            R+ +KR
Sbjct  157  RIMSKR  162



>ref|XP_010068077.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=303

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAE+RDP KNGAR+WLGTYET E+AA+AYD+AA++MRG KA LNFPH IGS + +P+
Sbjct  181  GKYAAEMRDPKKNGARIWLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDYEPI  240

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAE-CHANILP  358
            RV+ KRRS EP + STSS     +  +RRK    E   D+ V+ +S P+P       +L 
Sbjct  241  RVSLKRRSAEPSSPSTSSGESFLTGTKRRK---REVNVDAKVDFQS-PIPFHILDVGLLS  296

Query  359  IGEQLIV  379
            + EQ + 
Sbjct  297  VDEQFLF  303



>ref|XP_008232505.1| PREDICTED: ethylene-responsive transcription factor 1-like [Prunus 
mume]
Length=217

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET E+A +AYD+AA+++RG KA LNFPH IGS+  +PV
Sbjct  115  GKFAAEIRDPAKNGARVWLGTYETPEDAGLAYDRAAFKIRGCKAKLNFPHLIGSSNVEPV  174

Query  182  RVTAKRR  202
            RVT KRR
Sbjct  175  RVTPKRR  181



>ref|XP_009335578.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
 ref|XP_009335605.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=263

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP K GARVWLGTYETAE AA+AYD+AA++MRGSKA LNFPH IGS   +PV
Sbjct  139  GKYAAEIRDPKKKGARVWLGTYETAEGAALAYDQAAFKMRGSKAKLNFPHLIGSEGCEPV  198

Query  182  RVTAKRRspepealstssasesgspKRR----RKVAAAEQAADSDVE  310
            RVTAKRR+PE    S+SS S S  PKRR    R  A AE  + S VE
Sbjct  199  RVTAKRRAPEFSTSSSSSESGSPKPKRRNIGLRTAAEAESGSTSRVE  245



>gb|KCW62802.1| hypothetical protein EUGRSUZ_G00394 [Eucalyptus grandis]
Length=321

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYE  E+AA+AYD+AA++MRGSKA LNFPH IGS E +PV
Sbjct  136  GKYAAEIRDPKKNGARIWLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEYEPV  195

Query  182  RVTAKRR  202
            RV++KRR
Sbjct  196  RVSSKRR  202



>ref|XP_010065367.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=239

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYE  E+AA+AYD+AA++MRGSKA LNFPH IGS E +PV
Sbjct  120  GKYAAEIRDPKKNGARIWLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEYEPV  179

Query  182  RVTAKRR  202
            RV++KRR
Sbjct  180  RVSSKRR  186



>gb|KCW62805.1| hypothetical protein EUGRSUZ_G00396, partial [Eucalyptus grandis]
Length=181

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYE  E+AA+AYD+AA++MRGSKA LNFPH IGS E +PV
Sbjct  70   GKYAAEIRDPKKNGARIWLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEYEPV  129

Query  182  RVTAKRR  202
            RV+ KRR
Sbjct  130  RVSPKRR  136



>gb|KDP28854.1| hypothetical protein JCGZ_14625 [Jatropha curcas]
Length=196

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNG+R+WLGTYET E+AA+AYD+AA++MRGSKA LNFPH IGS++ +P+
Sbjct  122  GKYAAEIRDPKKNGSRIWLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLIGSDDYEPI  181

Query  182  RVTAKR  199
            RVT KR
Sbjct  182  RVTNKR  187



>gb|KCW62801.1| hypothetical protein EUGRSUZ_G00393 [Eucalyptus grandis]
Length=226

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYE  E+AA+AYD+AA++MRGSKA LNFPH IGS E +PV
Sbjct  131  GKYAAEIRDPKKNGARIWLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEYEPV  190

Query  182  RVTAKRR  202
            RV+ KRR
Sbjct  191  RVSPKRR  197



>gb|KCW62806.1| hypothetical protein EUGRSUZ_G00397 [Eucalyptus grandis]
Length=190

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 76/113 (67%), Gaps = 8/113 (7%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEI+DP KNGAR+WLGTYET E+A +AYD+AA++MRGSKA LNFPH IGS E +PV
Sbjct  71   GKYAAEIKDPKKNGARIWLGTYETPEDAGLAYDRAAFKMRGSKAKLNFPHLIGSAEHEPV  130

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAEC  340
            RV+ KRRS EP + S+   S      +R          DSD E  +N    +C
Sbjct  131  RVSPKRRSMEPSSPSSDDGSTGMKRAKRE--------VDSDAEVWTNNFYFDC  175



>ref|XP_010065366.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=231

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYE  E+AA+AYD+AA++MRGSKA LNFPH IGS E +PV
Sbjct  136  GKYAAEIRDPKKNGARIWLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEYEPV  195

Query  182  RVTAKRR  202
            RV+ KRR
Sbjct  196  RVSPKRR  202



>ref|XP_010325512.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Solanum 
lycopersicum]
Length=237

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNG RVWLGTYETAE+AA AYDKAA+RMRGS+A+LNFP R+ S EP+P+
Sbjct  145  GKFAAEIRDPAKNGQRVWLGTYETAEDAAFAYDKAAFRMRGSRAMLNFPLRVNSGEPEPI  204

Query  182  RVTAKR  199
            RV +K+
Sbjct  205  RVRSKK  210



>ref|XP_010068081.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=250

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYE  E+AA+AYD+AA++MRGSKA LNFPH IGS E +PV
Sbjct  131  GKYAAEIRDPKKNGARIWLGTYEMPEDAALAYDRAAFKMRGSKAKLNFPHLIGSVEYEPV  190

Query  182  RVTAKRR  202
            RV+ KRR
Sbjct  191  RVSPKRR  197



>ref|XP_009341335.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
 ref|XP_009341336.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
 ref|XP_009348378.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=273

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGARVWLGTYETAE AA+AYD+AA++MRGSKA LNFPH IGS   +PV
Sbjct  139  GKYAAEIRDPKKNGARVWLGTYETAEGAALAYDQAAFKMRGSKAKLNFPHLIGSG-CEPV  197

Query  182  RVTAKRR  202
            RVTAKRR
Sbjct  198  RVTAKRR  204



>ref|XP_006445414.1| hypothetical protein CICLE_v10022025mg [Citrus clementina]
 gb|ESR58654.1| hypothetical protein CICLE_v10022025mg [Citrus clementina]
 gb|KDO85531.1| hypothetical protein CISIN_1g047100mg [Citrus sinensis]
Length=233

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTY+T E AA AYD+AA++MRGSKA LNFPH IGSN   PV
Sbjct  144  GKFAAEIRDPKKNGARVWLGTYDTPEGAAFAYDRAAFKMRGSKAKLNFPHLIGSNVEPPV  203

Query  182  RVTAKR  199
            RVT KR
Sbjct  204  RVTKKR  209



>ref|XP_006375130.1| hypothetical protein POPTR_0014s04640g [Populus trichocarpa]
 gb|ERP52927.1| hypothetical protein POPTR_0014s04640g [Populus trichocarpa]
Length=193

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYET E+AA+AYD+AA+++RGSKA LNFPH IGS E +PV
Sbjct  109  GKYAAEIRDPKKNGARMWLGTYETPEDAALAYDQAAFKIRGSKAKLNFPHLIGSEEYEPV  168

Query  182  RVTAKRR  202
            R+++KRR
Sbjct  169  RLSSKRR  175



>ref|XP_010089318.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
 gb|EXB37643.1| Ethylene-responsive transcription factor 13 [Morus notabilis]
Length=254

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNG RVWLGTYET E+AA+AYD+AA+ MRG+KA LNFPH IGS  P+PV
Sbjct  139  GKYAAEIRDPKKNGKRVWLGTYETPEDAALAYDRAAFEMRGAKAKLNFPHLIGSEAPEPV  198

Query  182  RVTAKRR  202
            R+T KRR
Sbjct  199  RITPKRR  205



>ref|XP_009114286.1| PREDICTED: ethylene-responsive transcription factor 2-like [Brassica 
rapa]
Length=245

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAK GARVWLGT+E AE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  147  GKFAAEIRDPAKFGARVWLGTFEKAEDAALAYDRAAFRMRGSRALLNFPWRVNSGEPDPV  206

Query  182  RV  187
            R+
Sbjct  207  RI  208



>gb|ABD64951.1| ethylene responsive element binding factor, putative [Brassica 
oleracea]
Length=240

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAK GARVWLGT+E AE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  142  GKFAAEIRDPAKFGARVWLGTFEKAEDAALAYDRAAFRMRGSRALLNFPWRVNSGEPDPV  201

Query  182  RV  187
            R+
Sbjct  202  RI  203



>emb|CDY25978.1| BnaC09g20090D [Brassica napus]
Length=240

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAK GARVWLGT+E AE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  142  GKFAAEIRDPAKFGARVWLGTFEKAEDAALAYDRAAFRMRGSRALLNFPWRVNSGEPDPV  201

Query  182  RV  187
            R+
Sbjct  202  RI  203



>ref|XP_010068083.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=255

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEI+DP KNGAR+WLGTYET E+A +AYD+AA++MRGSKA LNFPH IGS E +PV
Sbjct  136  GKYAAEIKDPKKNGARIWLGTYETPEDAGLAYDRAAFKMRGSKAKLNFPHLIGSAEHEPV  195

Query  182  RVTAKRR  202
            RV+ KRR
Sbjct  196  RVSPKRR  202



>gb|AHA33628.1| ERF2 transcription factor protein [Brassica oleracea var. italica]
Length=267

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAK GARVWLGT+E AE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  169  GKFAAEIRDPAKFGARVWLGTFEKAEDAALAYDRAAFRMRGSRALLNFPWRVNSGEPDPV  228

Query  182  RV  187
            R+
Sbjct  229  RI  230



>ref|XP_009335609.1| PREDICTED: ethylene-responsive transcription factor 1-like [Pyrus 
x bretschneideri]
 ref|XP_009335623.1| PREDICTED: ethylene-responsive transcription factor 1-like [Pyrus 
x bretschneideri]
Length=198

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNGAR+WLG YET  +A +AYD+AA+++RG KA LNFPH IGS+  +PV
Sbjct  99   GKYAAEIRDPAKNGARLWLGIYETPVDAGLAYDRAAFKLRGCKAKLNFPHLIGSSSIEPV  158

Query  182  RVTAKRR  202
            RVT KRR
Sbjct  159  RVTPKRR  165



>emb|CDY43434.1| BnaAnng07060D [Brassica napus]
Length=228

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAK GARVWLGT+E AE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  130  GKFAAEIRDPAKFGARVWLGTFEKAEDAALAYDRAAFRMRGSRALLNFPWRVNSGEPDPV  189

Query  182  RV  187
            R+
Sbjct  190  RI  191



>ref|XP_008344394.1| PREDICTED: ethylene-responsive transcription factor 2-like [Malus 
domestica]
Length=269

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGARVWLGTYETAE AA+AYD+AA++MRGSKA LNFPH IGS   +PV
Sbjct  136  GKYAAEIRDPKKNGARVWLGTYETAEGAALAYDQAAFKMRGSKAKLNFPHLIGSG-CEPV  194

Query  182  RVTAKRR  202
            RVT KRR
Sbjct  195  RVTGKRR  201



>ref|XP_010068073.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=270

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 89/131 (68%), Gaps = 13/131 (10%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYET E+AA+AYD+AA++M+GSKA +NFPH IG+ E +PV
Sbjct  148  GKYAAEIRDPKKNGARIWLGTYETPEDAALAYDRAAFKMKGSKAKVNFPHLIGAAEYEPV  207

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAECHANILPI  361
            RV+ KR S E  + ST       +  +RRK    E   D++V+ R+ P+P      IL I
Sbjct  208  RVSRKRFSAEHSSPSTPGDDGLVTRTKRRK---GEVNVDAEVDFRT-PIPFP----ILDI  259

Query  362  G-----EQLIV  379
            G     EQL++
Sbjct  260  GFWSCDEQLVL  270



>gb|KCW62798.1| hypothetical protein EUGRSUZ_G00390 [Eucalyptus grandis]
Length=237

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAE+RDP KNGAR+WLGTYET E+AA+AYD+AA++MRG KA LNFPH IGS + +P+
Sbjct  103  GKYAAEMRDPKKNGARIWLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSTDYEPI  162

Query  182  RVTAKRR  202
            RV+ KRR
Sbjct  163  RVSLKRR  169



>ref|XP_008232503.1| PREDICTED: ethylene-responsive transcription factor 13-like [Prunus 
mume]
Length=241

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGARVWLGTYETAE+A++AYD+AAY+MRGSKA LNFPH IGS++ +P 
Sbjct  105  GKYAAEIRDPKKNGARVWLGTYETAEDASLAYDRAAYKMRGSKAKLNFPHLIGSHDSEPG  164

Query  182  RVTAKR  199
            RV  KR
Sbjct  165  RVAPKR  170



>ref|XP_010068075.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=208

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAE+RDP KNGAR+WLGTYET E+AA+AYD+AA++MRGSKA LNFPH IG  E DPV
Sbjct  99   GKYAAEMRDPKKNGARIWLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLIGLAEYDPV  158

Query  182  RVTAKRR  202
            RV +KR+
Sbjct  159  RVRSKRQ  165



>emb|CDX77750.1| BnaC07g20040D [Brassica napus]
Length=222

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAK GAR WLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  132  GKFAAEIRDPAKKGAREWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  191

Query  182  RV  187
            R+
Sbjct  192  RI  193



>ref|XP_008363915.1| PREDICTED: ethylene-responsive transcription factor 1-like [Malus 
domestica]
Length=198

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNGAR+WLGTYET E+A +AYD+AA+++RG KA LNFPH IGS+  +PV
Sbjct  99   GKYAAEIRDPAKNGARLWLGTYETPEDAGLAYDRAAFKLRGCKAKLNFPHLIGSSSIEPV  158

Query  182  RVTAKR  199
            RVT KR
Sbjct  159  RVTPKR  164



>ref|XP_006414077.1| hypothetical protein EUTSA_v10027189mg, partial [Eutrema salsugineum]
 gb|ESQ55530.1| hypothetical protein EUTSA_v10027189mg, partial [Eutrema salsugineum]
Length=136

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTYET E+AA+AYD+AA+++RGSKA LNFPH IGS + +PV
Sbjct  18   GKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPV  77

Query  182  RVTAKRR  202
            R+  +RR
Sbjct  78   RIRPRRR  84



>ref|XP_008345528.1| PREDICTED: ethylene-responsive transcription factor 1-like [Malus 
domestica]
Length=198

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDPAKNGAR+WLGTYET E+A +AYD+AA+++RG KA LNFPH IGS+  +PV
Sbjct  99   GKYAAEIRDPAKNGARLWLGTYETPEDAGLAYDRAAFKLRGCKAKLNFPHLIGSSSIEPV  158

Query  182  RVTAKR  199
            RVT KR
Sbjct  159  RVTPKR  164



>gb|KCW62796.1| hypothetical protein EUGRSUZ_G00388 [Eucalyptus grandis]
Length=242

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAE+RDP KNGAR+WLGTYET E+AA+AYD+AA++MRGSKA LNFPH IG  E DPV
Sbjct  133  GKYAAEMRDPKKNGARIWLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLIGLAEYDPV  192

Query  182  RVTAKRR  202
            RV +KR+
Sbjct  193  RVRSKRQ  199



>ref|XP_011031988.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=191

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR WLGTYET E+AA+AYD+AA+++RGSKA LNFPH IGS E +PV
Sbjct  109  GKYAAEIRDPKKNGARRWLGTYETPEDAALAYDQAAFKIRGSKAKLNFPHLIGSKEYEPV  168

Query  182  RVTAKRR  202
            R+++KRR
Sbjct  169  RLSSKRR  175



>emb|CDY33523.1| BnaA06g35500D [Brassica napus]
Length=216

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAK GAR WLGT+ETAE+AA+AYD+AA+RMRGS+ALLNFP R+ S EPDPV
Sbjct  128  GKFAAEIRDPAKKGAREWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPV  187

Query  182  RV  187
            R+
Sbjct  188  RI  189



>ref|XP_007052303.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
 gb|EOX96460.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
Length=229

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            G +AAEIRDP KNGARVWLGTYET E+AA+AYD+AA++MRG+KA LNFPH IGS++ +PV
Sbjct  103  GTYAAEIRDPKKNGARVWLGTYETPEDAALAYDRAAFKMRGAKAKLNFPHLIGSDQVEPV  162

Query  182  RVTAKRR  202
            RVT  +R
Sbjct  163  RVTNNKR  169



>ref|XP_010068071.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=250

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYE  E+AA+AYD+AA++MRGSKA LNFPH IGS E +PV
Sbjct  128  GKYAAEIRDPKKNGARIWLGTYEAPEDAALAYDRAAFKMRGSKAKLNFPHLIGSAEYEPV  187

Query  182  RVTAKR  199
            RV  KR
Sbjct  188  RVGRKR  193



>ref|XP_002511592.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF50261.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=223

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            G +AAEIRDP KNGARVWLGTYET E+AA+AYD+AA++MRG+KA LNFPH IGS++ +PV
Sbjct  109  GTYAAEIRDPKKNGARVWLGTYETPEDAALAYDRAAFKMRGTKAKLNFPHLIGSDDLEPV  168

Query  182  RVTAKRR  202
            RV+ +RR
Sbjct  169  RVSNRRR  175



>ref|XP_007052302.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
 gb|EOX96459.1| Ethylene-responsive element binding factor 13, putative [Theobroma 
cacao]
Length=270

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP +NGAR+WLGTYET E+AA+AYD+AA++MRG+KA LNFPH IGSN  +P+
Sbjct  143  GKYAAEIRDPKRNGARIWLGTYETPEDAALAYDRAAFKMRGAKAKLNFPHLIGSNTWEPI  202

Query  182  RVTAKRRspepealstssasesgspKRRRKVAA  280
            RV  +RRSPE  A +T+S+    S KRR+  A+
Sbjct  203  RVGGRRRSPESSAPTTASSLSDCSRKRRKSSAS  235



>ref|XP_002872976.1| hypothetical protein ARALYDRAFT_912253 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49235.1| hypothetical protein ARALYDRAFT_912253 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYET EEAA+AYD+AA++MRGSKA LNFPH IG ++ +PV
Sbjct  54   GKYAAEIRDPNKNGARIWLGTYETPEEAAVAYDQAAFKMRGSKAKLNFPHLIGIDQAEPV  113

Query  182  RVT  190
            RVT
Sbjct  114  RVT  116



>ref|XP_011101097.1| PREDICTED: ethylene-responsive transcription factor 2-like [Sesamum 
indicum]
Length=174

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIG  160
            GKFAAEIRDPAKNGARVWLGTYETAEEAA+AYDKAAYRMRGSKALLNFPHRIG
Sbjct  122  GKFAAEIRDPAKNGARVWLGTYETAEEAALAYDKAAYRMRGSKALLNFPHRIG  174



>ref|XP_007204071.1| hypothetical protein PRUPE_ppb014367mg [Prunus persica]
 gb|EMJ05270.1| hypothetical protein PRUPE_ppb014367mg [Prunus persica]
Length=237

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGARVWLGTYETAE+A +AYD+AA++MRGSKA LNFPH IGS++ +P 
Sbjct  101  GKYAAEIRDPKKNGARVWLGTYETAEDAGLAYDRAAFKMRGSKAKLNFPHLIGSHDSEPG  160

Query  182  RVTAKR  199
            RV  KR
Sbjct  161  RVAPKR  166



>emb|CDY30489.1| BnaA04g25900D [Brassica napus]
Length=232

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTYET E+AA+AYD+AA++++GSKA LNFPH IGS E +PV
Sbjct  111  GKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLKGSKAKLNFPHLIGSCEYEPV  170

Query  182  RVTAKRR  202
            R+  +RR
Sbjct  171  RIRPRRR  177



>ref|XP_002511588.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF50257.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=221

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPD-P  178
            GK+AAEIRDP KNGARVWLGTYET E+AA+AYD+AA++MRG KA LNFPH IGSN+   P
Sbjct  136  GKYAAEIRDPKKNGARVWLGTYETPEDAALAYDQAAFKMRGCKAKLNFPHLIGSNDYQPP  195

Query  179  VRVTAKRR  202
            VRV+ KRR
Sbjct  196  VRVSPKRR  203



>ref|XP_003529037.1| PREDICTED: ethylene-responsive transcription factor 13-like [Glycine 
max]
Length=205

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNE-PDP  178
            GKFAAEIRDP KNGAR+WLGTYET E A +AYD+AA++MRGSKA LNFPH IGS+  P P
Sbjct  95   GKFAAEIRDPKKNGARIWLGTYETEEAAGLAYDRAAFKMRGSKAKLNFPHLIGSHAPPQP  154

Query  179  VRVT  190
            VRVT
Sbjct  155  VRVT  158



>ref|XP_011016089.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=227

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR WLGTYET E+AA+AYD+AA++MRG+KA LNFPH IGS+  +PV
Sbjct  128  GKYAAEIRDPKKNGARQWLGTYETPEDAAMAYDRAAFKMRGAKAKLNFPHLIGSSNYEPV  187

Query  182  RVTAKR  199
            RVT KR
Sbjct  188  RVTNKR  193



>gb|KHN34531.1| Ethylene-responsive transcription factor 2 [Glycine soja]
Length=205

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNE-PDP  178
            GKFAAEIRDP KNGAR+WLGTYET E A +AYD+AA++MRGSKA LNFPH IGS+  P P
Sbjct  95   GKFAAEIRDPKKNGARIWLGTYETEEAAGLAYDRAAFKMRGSKAKLNFPHLIGSHAPPQP  154

Query  179  VRVT  190
            VRVT
Sbjct  155  VRVT  158



>ref|XP_006375127.1| hypothetical protein POPTR_0014s04610g [Populus trichocarpa]
 gb|ERP52924.1| hypothetical protein POPTR_0014s04610g [Populus trichocarpa]
Length=227

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR WLGTYET E+AA+AYD+AA++MRG+KA LNFPH IGS+  +PV
Sbjct  128  GKYAAEIRDPKKNGARQWLGTYETPEDAAMAYDRAAFKMRGAKAKLNFPHLIGSSNYEPV  187

Query  182  RVTAKR  199
            RVT KR
Sbjct  188  RVTNKR  193



>gb|KEH17838.1| AP2 domain class transcription factor [Medicago truncatula]
Length=199

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTYE+AE+AA+AYD+AA++MRGSKA LNFPH I S+  + +
Sbjct  105  GKFAAEIRDPNKNGARVWLGTYESAEDAALAYDRAAFKMRGSKAKLNFPHLIDSDVSESM  164

Query  182  RVTAKRR  202
             VTAKRR
Sbjct  165  VVTAKRR  171



>ref|XP_011031966.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=227

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR WLGTYET E+AA+AYD+AA++MRG+KA LNFPH IGS+  +PV
Sbjct  128  GKYAAEIRDPKKNGARQWLGTYETPEDAAMAYDRAAFKMRGAKAKLNFPHLIGSSNYEPV  187

Query  182  RVTAKR  199
            RVT KR
Sbjct  188  RVTNKR  193



>ref|XP_010424028.1| PREDICTED: ethylene-responsive transcription factor 13-like [Camelina 
sativa]
Length=175

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYET+EEAA+AYD+AA++MRGSKA LNFPH IG ++ +PV
Sbjct  66   GKYAAEIRDPNKNGARMWLGTYETSEEAAVAYDRAAFKMRGSKAKLNFPHLIGIDQAEPV  125

Query  182  RVT  190
            RVT
Sbjct  126  RVT  128



>ref|XP_010508242.1| PREDICTED: ethylene-responsive transcription factor 13-like isoform 
X3 [Camelina sativa]
Length=236

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTYET E+AA+AYD+AA+++RGSKA LNFPH IGS + +PV
Sbjct  128  GKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPV  187

Query  182  RVTAKRR  202
            R+  +RR
Sbjct  188  RIRPRRR  194



>ref|XP_010508240.1| PREDICTED: ethylene-responsive transcription factor 13-like isoform 
X1 [Camelina sativa]
Length=252

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTYET E+AA+AYD+AA+++RGSKA LNFPH IGS + +PV
Sbjct  128  GKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPV  187

Query  182  RVTAKRR  202
            R+  +RR
Sbjct  188  RIRPRRR  194



>ref|XP_011031975.1| PREDICTED: ethylene-responsive transcription factor 13-like [Populus 
euphratica]
Length=230

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYET E+AA+AYD A+++MRG+KA LNFPH IG ++  PV
Sbjct  128  GKYAAEIRDPKKNGARIWLGTYETPEDAALAYDHASFKMRGAKAKLNFPHLIGFSDYQPV  187

Query  182  RVTAKR  199
            RVT KR
Sbjct  188  RVTHKR  193



>gb|KDO85528.1| hypothetical protein CISIN_1g039729mg [Citrus sinensis]
Length=179

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +2

Query  2    GKFAAEIRDP-AKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDP  178
            GKFAAEIRDP  KNGARVWLGTY+T E AA+AYD+AA+ MRGSKA LNFPH IGSN   P
Sbjct  77   GKFAAEIRDPNKKNGARVWLGTYDTPEGAALAYDRAAFNMRGSKAKLNFPHLIGSNVAPP  136

Query  179  VRVTAKRRspepealstssasesgspKRRRKV  274
            +RVT KR S      +    SES + KRR+ +
Sbjct  137  LRVTKKRGSSSSSNYTLHLQSESPNSKRRKDI  168



>ref|XP_010508241.1| PREDICTED: ethylene-responsive transcription factor 13-like isoform 
X2 [Camelina sativa]
Length=237

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTYET E+AA+AYD+AA+++RGSKA LNFPH IGS + +PV
Sbjct  128  GKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPV  187

Query  182  RVTAKRR  202
            R+  +RR
Sbjct  188  RIRPRRR  194



>ref|XP_009335608.1| PREDICTED: ethylene-responsive transcription factor 2-like [Pyrus 
x bretschneideri]
Length=229

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTYETAE+A +AYD+AA++MRGSKA LNFPH IG+++ +P 
Sbjct  104  GKYAAEIRDPKKNGARIWLGTYETAEDAGLAYDRAAFKMRGSKAKLNFPHLIGTHDSEPG  163

Query  182  RVTAKR  199
            RV +KR
Sbjct  164  RVASKR  169



>ref|XP_006375126.1| hypothetical protein POPTR_0014s04600g [Populus trichocarpa]
 gb|ERP52923.1| hypothetical protein POPTR_0014s04600g [Populus trichocarpa]
Length=226

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEP-DP  178
            GK+AAEIRDP KNGAR+WLGTYET E+AA+AYD+AA++MRGSKA LNFPH IGSN   +P
Sbjct  127  GKYAAEIRDPKKNGARMWLGTYETPEDAALAYDRAAFKMRGSKAKLNFPHLIGSNNNWEP  186

Query  179  VRVTAKRR  202
             RVT+K+R
Sbjct  187  TRVTSKKR  194



>gb|AAM65925.1| putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
Length=226

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTYET E+AA+AYD+AA+++RGSKA LNFPH IGS + +PV
Sbjct  101  GKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPV  160

Query  182  RVTAKRR  202
            R+  +RR
Sbjct  161  RIRPRRR  167



>ref|XP_006375129.1| ethylene-responsive element binding protein 1 [Populus trichocarpa]
 gb|ERP52926.1| ethylene-responsive element binding protein 1 [Populus trichocarpa]
Length=227

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGARVWLGTYET E+AA+AYD AA++MRG+KA LNFPH IG ++  PV
Sbjct  128  GKYAAEIRDPKKNGARVWLGTYETPEDAALAYDDAAFKMRGAKAKLNFPHLIGFSDYQPV  187

Query  182  RVTAKR  199
            RVT KR
Sbjct  188  RVTHKR  193



>ref|XP_008232472.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Prunus 
mume]
Length=215

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDPAKNGARVWLGTYET E+A +AYD+AA+++RG KA LNFPH IGS+  +PV
Sbjct  117  GKFAAEIRDPAKNGARVWLGTYETPEDAGLAYDRAAFKLRGCKARLNFPHLIGSSNVEPV  176

Query  182  RVTAK  196
            RV+ K
Sbjct  177  RVSPK  181



>gb|AFI98122.1| ethylene-responsive element-binding protein 6 [Gossypium barbadense]
Length=222

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            G +AAEIRDP KNGAR+WLGTYET E+AA+AYD+AA++MRGSKA LNFPH IGS++  PV
Sbjct  114  GTYAAEIRDPKKNGARIWLGTYETLEDAALAYDRAAFKMRGSKAKLNFPHLIGSDQVQPV  173

Query  182  RVTAKRR  202
            R++  +R
Sbjct  174  RLSNNKR  180



>ref|XP_010068070.1| PREDICTED: ethylene-responsive transcription factor 13-like [Eucalyptus 
grandis]
Length=248

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 85/127 (67%), Gaps = 5/127 (4%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GK+AAEIRDP KNGAR+WLGTY+T ++AA+AYD+AA++M+GSKA LNFP  IGS E +PV
Sbjct  126  GKYAAEIRDPKKNGARMWLGTYKTPQDAALAYDRAAFKMKGSKAKLNFPLLIGSAEYEPV  185

Query  182  RVTAKRRspepealstssasesgspKRRRKVAAAEQAADSDVESRSNPLPAE-CHANILP  358
            RV  KRRS EP +LSTS         ++RK    E   D++V+   NP+P       IL 
Sbjct  186  RVNPKRRSAEPRSLSTSIDDGLTKRMKKRK---EEINVDAEVDF-GNPIPFHILEMGILS  241

Query  359  IGEQLIV  379
              EQ + 
Sbjct  242  GDEQFLF  248



>ref|NP_182011.1| ethylene-responsive transcription factor 13 [Arabidopsis thaliana]
 sp|Q8L9K1.2|ERF99_ARATH RecName: Full=Ethylene-responsive transcription factor 13; Short=AtERF13; 
AltName: Full=Ethylene-responsive element-binding 
factor 13; Short=EREBP-13 [Arabidopsis thaliana]
 gb|AAK17157.1|AF325089_1 putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
 gb|AAK48967.1|AF370540_1 putative ethylene response element binding protein; EREBP [Arabidopsis 
thaliana]
 gb|AAC31840.1| putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
 gb|AAL66886.1| putative ethylene response element binding protein (EREBP) [Arabidopsis 
thaliana]
 gb|AEC10473.1| ethylene-responsive transcription factor 13 [Arabidopsis thaliana]
Length=226

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTYET E+AA+AYD+AA+++RGSKA LNFPH IGS + +PV
Sbjct  101  GKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPV  160

Query  182  RVTAKRR  202
            R+  +RR
Sbjct  161  RIRPRRR  167



>ref|XP_010506419.1| PREDICTED: ethylene-responsive transcription factor 13-like [Camelina 
sativa]
Length=250

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    GKFAAEIRDPAKNGARVWLGtyetaeeaaiaydkaayRMRGSKALLNFPHRIGSNEPDPV  181
            GKFAAEIRDP KNGARVWLGTYET E+AA+AYD+AA+++RGSKA LNFPH IGS + +PV
Sbjct  129  GKFAAEIRDPKKNGARVWLGTYETPEDAAVAYDRAAFQLRGSKAKLNFPHLIGSCKYEPV  188

Query  182  RVTAKRR  202
            R+  +RR
Sbjct  189  RIRPRRR  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1029984871572