BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c88509_g1_i1 len=187 path=[165:0-186]

Length=187
                                                                      Score     E

ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3       80.1    1e-15   
ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3       80.1    1e-15   
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease      79.3    3e-15   
ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like         79.0    4e-15   
emb|CDP07365.1|  unnamed protein product                              79.0    4e-15   
ref|XP_011083454.1|  PREDICTED: CO(2)-response secreted protease-...  79.0    4e-15   
ref|XP_002269753.1|  PREDICTED: CO(2)-response secreted protease-...  79.0    4e-15   Vitis vinifera
emb|CBI19918.3|  unnamed protein product                              79.0    4e-15   
ref|XP_004292936.1|  PREDICTED: subtilisin-like protease-like         77.8    1e-14   
ref|XP_011034984.1|  PREDICTED: CO(2)-response secreted protease      77.0    2e-14   
ref|XP_007136109.1|  hypothetical protein PHAVU_009G018600g           76.3    3e-14   
ref|XP_009757105.1|  PREDICTED: subtilisin-like protease SBT5.3       76.3    3e-14   
gb|KHG24601.1|  Cucumisin                                             75.9    4e-14   
ref|XP_009605223.1|  PREDICTED: subtilisin-like protease              75.9    4e-14   
ref|XP_007017870.1|  Subtilisin-like serine endopeptidase family ...  74.3    1e-13   
ref|XP_007017871.1|  Subtilisin-like serine endopeptidase family ...  74.3    2e-13   
ref|XP_008221224.1|  PREDICTED: subtilisin-like protease              74.3    2e-13   
ref|XP_010933350.1|  PREDICTED: LOW QUALITY PROTEIN: CO(2)-respon...  73.9    2e-13   
ref|XP_008800183.1|  PREDICTED: subtilisin-like protease SBT5.3       73.6    3e-13   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...  73.2    3e-13   
ref|XP_010095549.1|  Subtilisin-like protease                         72.8    5e-13   
ref|XP_002510578.1|  Cucumisin precursor, putative                    72.4    6e-13   Ricinus communis
gb|KDO84931.1|  hypothetical protein CISIN_1g004113mg                 72.0    9e-13   
ref|XP_008807400.1|  PREDICTED: subtilisin-like protease              72.0    9e-13   
ref|XP_007051970.1|  Subtilase family protein isoform 2               72.0    1e-12   
ref|XP_007051969.1|  Subtilase family protein isoform 1               72.0    1e-12   
gb|KDO84930.1|  hypothetical protein CISIN_1g004113mg                 72.0    1e-12   
ref|XP_006846917.1|  hypothetical protein AMTR_s00152p00071630        71.6    1e-12   
ref|XP_006435228.1|  hypothetical protein CICLE_v10000339mg           71.6    1e-12   
ref|XP_003592386.1|  Subtilisin-like protease                         71.6    1e-12   
ref|XP_008809445.1|  PREDICTED: subtilisin-like protease SBT5.3       71.6    1e-12   
gb|AES62637.2|  subtilisin-like serine protease                       71.6    1e-12   
ref|XP_007220224.1|  hypothetical protein PRUPE_ppa002172mg           71.2    2e-12   
ref|XP_002300693.2|  putative subtilisin precursor family protein     71.2    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_007221063.1|  hypothetical protein PRUPE_ppa016501mg           70.9    2e-12   
ref|XP_004136374.1|  PREDICTED: subtilisin-like protease-like         70.9    2e-12   
ref|XP_008354238.1|  PREDICTED: subtilisin-like protease              70.1    2e-12   
gb|KFK31536.1|  hypothetical protein AALP_AA6G125100                  70.9    3e-12   
ref|XP_008245946.1|  PREDICTED: cucumisin-like                        70.9    3e-12   
ref|XP_004164801.1|  PREDICTED: cucumisin-like                        70.9    3e-12   
gb|KCW79387.1|  hypothetical protein EUGRSUZ_C00799                   70.5    3e-12   
dbj|BAJ99639.1|  predicted protein                                    70.5    4e-12   
dbj|BAJ53097.1|  JHL20J20.3                                           70.5    4e-12   
ref|XP_010911578.1|  PREDICTED: subtilisin-like protease              69.7    4e-12   
gb|KFK31539.1|  hypothetical protein AALP_AA6G125500                  70.5    4e-12   
ref|XP_008357123.1|  PREDICTED: subtilisin-like protease              70.1    4e-12   
ref|XP_003523395.1|  PREDICTED: subtilisin-like protease-like         70.1    5e-12   
ref|XP_009614808.1|  PREDICTED: cucumisin-like                        70.1    5e-12   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like         69.7    6e-12   
gb|EEC74555.1|  hypothetical protein OsI_10097                        69.7    6e-12   Oryza sativa Indica Group [Indian rice]
gb|AAN06842.1|  Putatvie subtilisin-like serine protease              69.7    6e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010103418.1|  Subtilisin-like protease                         69.7    6e-12   
ref|XP_009587381.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.1    6e-12   
ref|XP_009768389.1|  PREDICTED: cucumisin-like                        69.7    7e-12   
ref|XP_010103096.1|  Subtilisin-like protease                         69.7    7e-12   
ref|XP_007051971.1|  Subtilase family protein                         69.7    7e-12   
ref|XP_006486775.1|  PREDICTED: subtilisin-like protease SDD1-like    66.2    8e-12   
ref|XP_006339058.1|  PREDICTED: subtilisin-like protease-like         69.3    8e-12   
ref|XP_004231532.1|  PREDICTED: subtilisin-like protease              69.3    1e-11   
gb|EMT29814.1|  Subtilisin-like protease                              68.2    1e-11   
ref|XP_008238729.1|  PREDICTED: subtilisin-like protease              68.9    1e-11   
ref|XP_007136108.1|  hypothetical protein PHAVU_009G018500g           68.9    1e-11   
gb|EMS49122.1|  Subtilisin-like protease                              68.9    1e-11   
ref|XP_004245678.1|  PREDICTED: subtilisin-like protease SDD1         68.9    1e-11   
ref|XP_006426784.1|  hypothetical protein CICLE_v10024934mg           68.9    1e-11   
ref|XP_010089708.1|  Subtilisin-like protease                         68.9    1e-11   
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease              68.9    1e-11   
gb|EMT30759.1|  Subtilisin-like protease                              68.9    1e-11   
emb|CBI35805.3|  unnamed protein product                              68.6    1e-11   
ref|XP_004300737.1|  PREDICTED: subtilisin-like protease SDD1-like    68.6    1e-11   
gb|KDP25559.1|  hypothetical protein JCGZ_20715                       68.6    1e-11   
ref|XP_007210956.1|  hypothetical protein PRUPE_ppa023717mg           68.6    1e-11   
ref|NP_001145849.1|  uncharacterized protein LOC100279360 precursor   68.6    2e-11   Zea mays [maize]
ref|XP_006465816.1|  PREDICTED: subtilisin-like protease-like         68.6    2e-11   
ref|XP_006426785.1|  hypothetical protein CICLE_v10024934mg           68.6    2e-11   
gb|KDP25551.1|  hypothetical protein JCGZ_20707                       68.6    2e-11   
gb|EMS54035.1|  Subtilisin-like protease                              67.8    2e-11   
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease              68.6    2e-11   
emb|CDP05276.1|  unnamed protein product                              68.6    2e-11   
ref|XP_010061088.1|  PREDICTED: subtilisin-like protease SBT5.3       68.6    2e-11   
ref|XP_006365833.1|  PREDICTED: subtilisin-like protease-like         68.6    2e-11   
ref|XP_008351622.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  68.2    2e-11   
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease              68.6    2e-11   
ref|XP_010933213.1|  PREDICTED: subtilisin-like protease SDD1         68.6    2e-11   
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease              68.6    2e-11   
gb|KFK42754.1|  hypothetical protein AALP_AA1G035200                  68.6    2e-11   
ref|XP_002275471.2|  PREDICTED: uncharacterized protein LOC100242816  68.6    2e-11   Vitis vinifera
ref|XP_008647197.1|  PREDICTED: uncharacterized protein LOC100501...  68.2    2e-11   
ref|XP_010658505.1|  PREDICTED: cucumisin isoform X1                  68.2    2e-11   
ref|XP_008647202.1|  PREDICTED: uncharacterized protein LOC100501...  68.2    2e-11   
ref|XP_010658506.1|  PREDICTED: cucumisin isoform X2                  68.2    2e-11   
ref|XP_008647217.1|  PREDICTED: uncharacterized protein LOC100501...  68.2    2e-11   
ref|XP_002510196.1|  Cucumisin precursor, putative                    68.2    2e-11   Ricinus communis
ref|XP_009769238.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  68.2    2e-11   
ref|XP_004249505.1|  PREDICTED: subtilisin-like protease              68.2    2e-11   
ref|XP_008647226.1|  PREDICTED: uncharacterized protein LOC100501...  68.2    2e-11   
ref|XP_008647212.1|  PREDICTED: uncharacterized protein LOC100501...  68.2    2e-11   
ref|XP_010230265.1|  PREDICTED: subtilisin-like protease SBT3.5       68.2    2e-11   
ref|XP_010696462.1|  PREDICTED: subtilisin-like protease              68.2    2e-11   
tpg|DAA43450.1|  TPA: putative subtilase family protein               68.2    2e-11   
gb|EYU46755.1|  hypothetical protein MIMGU_mgv1a001548mg              68.2    2e-11   
ref|XP_008647207.1|  PREDICTED: uncharacterized protein LOC100501...  68.2    2e-11   
tpg|DAA43452.1|  TPA: putative subtilase family protein               68.2    2e-11   
ref|XP_009769237.1|  PREDICTED: subtilisin-like protease isoform X1   68.2    2e-11   
tpg|DAA43449.1|  TPA: putative subtilase family protein               67.8    2e-11   
ref|XP_009776224.1|  PREDICTED: subtilisin-like protease              67.8    3e-11   
ref|XP_008235585.1|  PREDICTED: subtilisin-like protease SDD1         67.8    3e-11   
emb|CBI31602.3|  unnamed protein product                              68.2    3e-11   
ref|XP_010552189.1|  PREDICTED: subtilisin-like protease              67.8    3e-11   
ref|XP_008381935.1|  PREDICTED: subtilisin-like protease SDD1         67.8    3e-11   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like         67.8    3e-11   
emb|CDP08910.1|  unnamed protein product                              67.8    3e-11   
ref|XP_011033844.1|  PREDICTED: subtilisin-like protease SDD1         67.8    3e-11   
ref|XP_009381912.1|  PREDICTED: subtilisin-like protease              68.2    3e-11   
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  67.8    3e-11   
ref|XP_002275429.1|  PREDICTED: subtilisin-like protease              67.8    3e-11   Vitis vinifera
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease              67.8    3e-11   
ref|XP_003603807.1|  Subtilisin-type protease                         67.8    3e-11   
ref|XP_009604592.1|  PREDICTED: subtilisin-like protease              67.8    3e-11   
gb|EYU39034.1|  hypothetical protein MIMGU_mgv1a019276mg              67.8    3e-11   
ref|XP_008246193.1|  PREDICTED: cucumisin-like                        64.7    3e-11   
ref|XP_009619449.1|  PREDICTED: subtilisin-like protease isoform X1   67.8    3e-11   
ref|XP_002303551.2|  hypothetical protein POPTR_0003s11870g           67.8    3e-11   Populus trichocarpa [western balsam poplar]
emb|CAA07250.1|  serine protease                                      67.8    3e-11   Solanum lycopersicum
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease              67.8    3e-11   
emb|CAA06413.1|  P69E protein                                         67.8    3e-11   Solanum lycopersicum
ref|XP_007208831.1|  hypothetical protein PRUPE_ppa025337mg           67.8    3e-11   
ref|XP_002303550.2|  hypothetical protein POPTR_0003s11860g           67.8    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009619450.1|  PREDICTED: subtilisin-like protease isoform X2   67.4    3e-11   
ref|XP_002520491.1|  peptidase, putative                              68.2    3e-11   Ricinus communis
ref|XP_004300738.1|  PREDICTED: subtilisin-like protease SDD1-like    67.4    4e-11   
gb|EYU39036.1|  hypothetical protein MIMGU_mgv1a026993mg              67.4    4e-11   
gb|KDP22364.1|  hypothetical protein JCGZ_26195                       67.4    4e-11   
ref|XP_011003069.1|  PREDICTED: CO(2)-response secreted protease-...  67.4    4e-11   
ref|XP_002509656.1|  Xylem serine proteinase 1 precursor, putative    67.4    4e-11   Ricinus communis
emb|CDP15554.1|  unnamed protein product                              67.4    4e-11   
ref|XP_003580309.1|  PREDICTED: subtilisin-like protease SDD1         67.4    4e-11   
ref|XP_006358961.1|  PREDICTED: subtilisin-like protease-like         67.4    4e-11   
gb|EYU39035.1|  hypothetical protein MIMGU_mgv1a001882mg              67.4    4e-11   
ref|XP_007158029.1|  hypothetical protein PHAVU_002G118200g           67.4    4e-11   
ref|XP_009398828.1|  PREDICTED: subtilisin-like protease SDD1         67.4    4e-11   
ref|XP_004244716.2|  PREDICTED: subtilisin-like protease              67.4    4e-11   
ref|XP_004244591.1|  PREDICTED: subtilisin-like protease              67.4    4e-11   
ref|XP_007210332.1|  hypothetical protein PRUPE_ppa002068mg           67.4    4e-11   
ref|NP_001159342.1|  putative subtilase family protein precursor      67.4    4e-11   Zea mays [maize]
ref|XP_009608768.1|  PREDICTED: subtilisin-like protease SDD1         67.4    4e-11   
gb|KDP41714.1|  hypothetical protein JCGZ_16121                       67.4    4e-11   
gb|ABD64827.1|  putative subtilisin serine protease of stomatal d...  67.4    4e-11   Isatis tinctoria [woad]
ref|XP_009762965.1|  PREDICTED: subtilisin-like protease SDD1         67.4    4e-11   
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease              67.4    4e-11   
ref|XP_006358408.1|  PREDICTED: subtilisin-like protease-like         67.4    4e-11   
ref|XP_008437181.1|  PREDICTED: subtilisin-like protease              67.4    4e-11   
ref|NP_001234288.1|  SBT2 protein precursor                           67.4    4e-11   
ref|XP_006418166.1|  hypothetical protein EUTSA_v10006861mg           67.4    4e-11   
ref|XP_008810058.1|  PREDICTED: subtilisin-like protease SDD1         67.4    4e-11   
ref|XP_010271749.1|  PREDICTED: subtilisin-like protease SBT5.3       67.4    5e-11   
ref|XP_010240233.1|  PREDICTED: subtilisin-like protease SDD1         67.4    5e-11   
ref|XP_006398246.1|  hypothetical protein EUTSA_v10000784mg           67.4    5e-11   
ref|XP_002892197.1|  hypothetical protein ARALYDRAFT_470387           67.4    5e-11   
gb|KHN01461.1|  Subtilisin-like protease                              65.9    5e-11   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like         67.4    5e-11   
tpg|DAA37770.1|  TPA: putative subtilase family protein               66.6    5e-11   
ref|XP_004245677.2|  PREDICTED: subtilisin-like protease              67.0    5e-11   
ref|XP_006304967.1|  hypothetical protein CARUB_v10012040mg           67.0    5e-11   
ref|NP_563701.1|  subtilisin-like protease SDD1                       67.0    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007162604.1|  hypothetical protein PHAVU_001G165300g           67.4    5e-11   
ref|XP_007208984.1|  hypothetical protein PRUPE_ppb022951mg           67.0    5e-11   
ref|XP_009628999.1|  PREDICTED: subtilisin-like protease              67.0    5e-11   
ref|XP_004244590.1|  PREDICTED: subtilisin-like protease              67.0    5e-11   
emb|CDX75757.1|  BnaC03g38400D                                        66.2    5e-11   
ref|XP_004300734.1|  PREDICTED: subtilisin-like protease-like         67.0    5e-11   
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like         67.0    5e-11   
ref|XP_003579757.1|  PREDICTED: subtilisin-like protease              67.0    5e-11   
emb|CDY18206.1|  BnaC05g02290D                                        67.0    5e-11   
ref|XP_009373327.1|  PREDICTED: subtilisin-like protease SDD1         67.0    5e-11   
ref|NP_001234257.1|  subtilisin-like endoprotease precursor           67.0    5e-11   
ref|XP_003570499.1|  PREDICTED: subtilisin-like protease              67.0    5e-11   
ref|XP_008381959.1|  PREDICTED: subtilisin-like protease SDD1         67.4    5e-11   
ref|XP_008238738.1|  PREDICTED: subtilisin-like protease              67.0    5e-11   
ref|XP_008447369.1|  PREDICTED: subtilisin-like protease SDD1         67.0    5e-11   
emb|CDX89843.1|  BnaA10g02390D                                        67.0    5e-11   
ref|XP_007208895.1|  hypothetical protein PRUPE_ppa026788mg           67.0    5e-11   
ref|XP_009762964.1|  PREDICTED: subtilisin-like protease SDD1         67.0    6e-11   
ref|XP_008378050.1|  PREDICTED: subtilisin-like protease              67.0    6e-11   
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease              67.0    6e-11   
ref|XP_009119332.1|  PREDICTED: subtilisin-like protease SDD1         67.0    6e-11   
ref|XP_010229422.1|  PREDICTED: CO(2)-response secreted protease-...  66.6    6e-11   
gb|KHN15704.1|  Subtilisin-like protease                              67.0    6e-11   
ref|XP_009776158.1|  PREDICTED: subtilisin-like protease              67.0    6e-11   
ref|XP_011079622.1|  PREDICTED: subtilisin-like protease              67.0    6e-11   
ref|XP_002325705.1|  hypothetical protein POPTR_0019s00970g           67.0    6e-11   Populus trichocarpa [western balsam poplar]
ref|XP_004954114.1|  PREDICTED: subtilisin-like protease-like         67.0    6e-11   
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g           67.0    6e-11   
ref|XP_010652423.1|  PREDICTED: subtilisin-like protease SDD1         67.0    6e-11   
gb|KCW77656.1|  hypothetical protein EUGRSUZ_D01954                   66.6    6e-11   
gb|EMT11726.1|  Subtilisin-like protease                              67.0    6e-11   
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease              67.0    6e-11   
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg          67.0    6e-11   
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease              67.0    6e-11   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease              67.0    6e-11   
ref|XP_004500923.1|  PREDICTED: subtilisin-like protease-like         67.0    6e-11   
gb|KDP25552.1|  hypothetical protein JCGZ_20708                       67.0    6e-11   
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease              67.0    6e-11   
emb|CAA76727.1|  P69D protein                                         67.0    6e-11   Solanum lycopersicum
gb|KHG02130.1|  Subtilisin-like protease                              67.0    6e-11   
ref|XP_006358372.1|  PREDICTED: subtilisin-like protease-like         66.6    6e-11   
ref|XP_004245680.1|  PREDICTED: subtilisin-like protease              66.6    6e-11   
ref|XP_010053378.1|  PREDICTED: subtilisin-like protease SDD1         66.6    6e-11   
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g           67.0    6e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease              67.0    6e-11   
ref|XP_004147596.1|  PREDICTED: subtilisin-like protease SDD1-like    66.6    6e-11   
ref|XP_002962719.1|  hypothetical protein SELMODRAFT_61337            66.6    6e-11   
ref|XP_002991821.1|  hypothetical protein SELMODRAFT_134229           66.6    7e-11   
ref|XP_008802988.1|  PREDICTED: subtilisin-like protease SDD1         66.6    7e-11   
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like         66.6    7e-11   
ref|XP_009397604.1|  PREDICTED: subtilisin-like protease              66.6    7e-11   
ref|XP_006358145.1|  PREDICTED: subtilisin-like protease-like         66.6    7e-11   
gb|KDP26457.1|  hypothetical protein JCGZ_17615                       66.6    7e-11   
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease              66.6    7e-11   
ref|XP_009781099.1|  PREDICTED: subtilisin-like protease              67.0    7e-11   
ref|XP_006369092.1|  subtilase family protein                         66.6    7e-11   
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like         66.6    7e-11   
ref|XP_006363698.1|  PREDICTED: subtilisin-like protease-like         66.6    7e-11   
ref|XP_002980373.1|  hypothetical protein SELMODRAFT_112475           66.6    7e-11   
ref|XP_008797372.1|  PREDICTED: subtilisin-like protease              66.6    7e-11   
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease              66.6    7e-11   
ref|XP_009351462.1|  PREDICTED: cucumisin-like                        66.2    7e-11   
ref|XP_006826300.1|  hypothetical protein AMTR_s00004p00071240        66.6    7e-11   
ref|XP_002303548.2|  hypothetical protein POPTR_0003s11840g           66.6    8e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease              66.6    8e-11   
ref|XP_006363699.1|  PREDICTED: subtilisin-like protease SDD1-like    66.6    8e-11   
ref|XP_002509668.1|  Xylem serine proteinase 1 precursor, putative    66.6    8e-11   Ricinus communis
gb|KEH42928.1|  subtilisin-like serine protease                       66.6    8e-11   
ref|XP_008238728.1|  PREDICTED: subtilisin-like protease SDD1         66.6    8e-11   
ref|XP_008669405.1|  PREDICTED: subtilisin-like protease              66.6    8e-11   
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  66.6    8e-11   
ref|XP_010091819.1|  Subtilisin-like protease SDD1                    66.6    8e-11   
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like         66.6    8e-11   
ref|XP_010917391.1|  PREDICTED: subtilisin-like protease              66.6    8e-11   
emb|CBI37197.3|  unnamed protein product                              66.6    8e-11   
gb|KGN58306.1|  hypothetical protein Csa_3G610820                     66.6    8e-11   
ref|XP_004166310.1|  PREDICTED: subtilisin-like protease SDD1-like    66.6    8e-11   
ref|XP_004985628.1|  PREDICTED: subtilisin-like protease-like         66.2    8e-11   
ref|XP_009767059.1|  PREDICTED: subtilisin-like protease              66.6    8e-11   
ref|XP_004500924.1|  PREDICTED: subtilisin-like protease-like         66.6    9e-11   
gb|EMS46826.1|  Subtilisin-like protease                              65.9    9e-11   
ref|XP_010483084.1|  PREDICTED: subtilisin-like protease SDD1         66.6    9e-11   
gb|ABZ89187.1|  putative protein                                      66.2    9e-11   Coffea canephora [robusta coffee]
emb|CDO99977.1|  unnamed protein product                              66.2    9e-11   
ref|XP_004152066.1|  PREDICTED: subtilisin-like protease SDD1-like    66.2    9e-11   
ref|XP_003517445.1|  PREDICTED: subtilisin-like protease SDD1-like    66.2    9e-11   
ref|XP_009362821.1|  PREDICTED: subtilisin-like protease SDD1         66.2    9e-11   
ref|XP_010262465.1|  PREDICTED: subtilisin-like protease SDD1         66.2    9e-11   
gb|EMT11725.1|  Subtilisin-like protease                              65.9    9e-11   
gb|KHN25749.1|  Subtilisin-like protease SDD1                         66.2    9e-11   
ref|XP_010325680.1|  PREDICTED: subtilisin-like protease              66.6    9e-11   
ref|XP_010692513.1|  PREDICTED: CO(2)-response secreted protease      66.2    9e-11   
ref|XP_010108074.1|  Subtilisin-like protease SDD1                    66.2    9e-11   
ref|XP_008652275.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  66.2    9e-11   
ref|XP_010457444.1|  PREDICTED: subtilisin-like protease SDD1         66.2    1e-10   
gb|AFW73750.1|  putative subtilase family protein                     66.2    1e-10   
gb|EMT24678.1|  Subtilisin-like protease                              66.2    1e-10   
gb|ADZ55305.1|  serine protease                                       66.2    1e-10   
ref|XP_010475053.1|  PREDICTED: subtilisin-like protease SDD1         66.2    1e-10   
gb|KHN13888.1|  Subtilisin-like protease                              66.2    1e-10   
ref|XP_008652277.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  66.2    1e-10   
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...  66.2    1e-10   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease-like         66.2    1e-10   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg           66.2    1e-10   
ref|XP_006440472.1|  hypothetical protein CICLE_v10018976mg           66.2    1e-10   
gb|KHN27220.1|  Subtilisin-like protease                              66.2    1e-10   
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like         66.2    1e-10   
ref|XP_002864596.1|  predicted protein                                64.3    1e-10   
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like         66.2    1e-10   
ref|XP_010051223.1|  PREDICTED: subtilisin-like protease SDD1         65.9    1e-10   
ref|XP_008391037.1|  PREDICTED: cucumisin-like isoform X2             66.2    1e-10   
ref|XP_002299578.1|  hypothetical protein POPTR_0001s08340g           66.2    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006358840.1|  PREDICTED: subtilisin-like protease SDD1-like    66.2    1e-10   
ref|XP_003538510.1|  PREDICTED: subtilisin-like protease-like         66.2    1e-10   
ref|XP_010540359.1|  PREDICTED: subtilisin-like protease              66.2    1e-10   
emb|CDX82491.1|  BnaA03g33300D                                        66.2    1e-10   
gb|EYU29564.1|  hypothetical protein MIMGU_mgv1a023796mg              66.2    1e-10   
ref|XP_010317341.1|  PREDICTED: subtilisin-like protease              66.2    1e-10   
ref|XP_006363697.1|  PREDICTED: subtilisin-like protease-like         66.2    1e-10   
ref|XP_008804041.1|  PREDICTED: subtilisin-like protease SDD1         66.2    1e-10   
emb|CDP09941.1|  unnamed protein product                              65.9    1e-10   
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease              66.2    1e-10   
ref|XP_010909887.1|  PREDICTED: subtilisin-like protease SDD1         66.2    1e-10   
ref|XP_010109072.1|  Subtilisin-like protease                         66.2    1e-10   
ref|XP_006477335.1|  PREDICTED: subtilisin-like protease-like         66.2    1e-10   
ref|XP_010051225.1|  PREDICTED: subtilisin-like protease              66.2    1e-10   
ref|NP_001238252.1|  subtilisin-type protease precursor               66.2    1e-10   
ref|XP_006857965.1|  hypothetical protein AMTR_s00069p00175260        66.2    1e-10   
dbj|BAJ93850.1|  predicted protein                                    66.2    1e-10   
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like         65.9    1e-10   
ref|XP_006479431.1|  PREDICTED: subtilisin-like protease SDD1-like    65.9    1e-10   
ref|XP_009776157.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
gb|ACN26674.1|  unknown                                               65.5    1e-10   
gb|KDO60343.1|  hypothetical protein CISIN_1g004101mg                 65.9    1e-10   
gb|EYU28960.1|  hypothetical protein MIMGU_mgv1a018215mg              65.9    1e-10   
ref|XP_008351272.1|  PREDICTED: cucumisin-like isoform X3             65.9    1e-10   
emb|CAN62248.1|  hypothetical protein VITISV_022540                   66.2    1e-10   
ref|XP_009362845.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
ref|XP_010051224.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
gb|AAL16906.1|AF420014_1  putative subtilisin                         63.5    1e-10   
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
emb|CDO97802.1|  unnamed protein product                              65.9    1e-10   
ref|XP_009410252.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
ref|XP_011034012.1|  PREDICTED: uncharacterized protein LOC105132300  66.2    1e-10   
ref|XP_007158429.1|  hypothetical protein PHAVU_002G152500g           65.9    1e-10   
ref|XP_009373361.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
ref|XP_008351273.1|  PREDICTED: cucumisin-like isoform X4             65.5    1e-10   
ref|XP_008351271.1|  PREDICTED: cucumisin-like isoform X2             65.9    1e-10   
gb|KDP28200.1|  hypothetical protein JCGZ_13971                       65.9    1e-10   
ref|XP_010919951.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
ref|XP_008391035.1|  PREDICTED: cucumisin-like isoform X1             65.9    1e-10   
ref|XP_008351270.1|  PREDICTED: cucumisin-like isoform X1             65.9    1e-10   
gb|ADY38794.1|  serine protease                                       65.9    1e-10   
gb|KCW81560.1|  hypothetical protein EUGRSUZ_C02918                   65.9    1e-10   
ref|XP_009629566.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310        65.9    1e-10   
ref|XP_009396946.1|  PREDICTED: cucumisin-like                        65.9    1e-10   
gb|KCW81559.1|  hypothetical protein EUGRSUZ_C02917                   65.9    1e-10   
ref|XP_010914489.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1   65.9    1e-10   
ref|XP_002510884.1|  Cucumisin precursor, putative                    65.9    1e-10   
ref|XP_008228336.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
ref|XP_009608769.1|  PREDICTED: subtilisin-like protease SDD1         65.9    1e-10   
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g           65.9    1e-10   
gb|KDP40640.1|  hypothetical protein JCGZ_24639                       65.5    1e-10   
gb|EMT29757.1|  Subtilisin-like protease                              65.5    1e-10   
emb|CDX99895.1|  BnaC09g28100D                                        65.9    1e-10   
gb|EPS64737.1|  hypothetical protein M569_10042                       65.5    1e-10   
ref|XP_007217030.1|  hypothetical protein PRUPE_ppa001661mg           65.9    1e-10   
ref|XP_011071709.1|  PREDICTED: subtilisin-like protease              65.9    1e-10   
gb|KHN45945.1|  Subtilisin-like protease                              65.5    2e-10   
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g           65.9    2e-10   
ref|XP_006348565.1|  PREDICTED: subtilisin-like protease-like         65.9    2e-10   
dbj|BAJ97136.1|  predicted protein                                    65.9    2e-10   
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4   65.9    2e-10   
ref|XP_004486283.1|  PREDICTED: subtilisin-like protease-like         65.9    2e-10   
ref|XP_004289987.1|  PREDICTED: subtilisin-like protease SDD1-like    65.9    2e-10   
ref|XP_003623810.1|  Subtilisin-like protease                         65.9    2e-10   
ref|XP_009609835.1|  PREDICTED: subtilisin-like protease SDD1         65.5    2e-10   
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like         65.9    2e-10   
ref|XP_004244588.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease              65.9    2e-10   
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like         65.9    2e-10   
ref|XP_008807888.1|  PREDICTED: cucumisin-like isoform X2             65.5    2e-10   
ref|XP_010536423.1|  PREDICTED: CO(2)-response secreted protease-...  65.5    2e-10   
ref|XP_002509661.1|  Xylem serine proteinase 1 precursor, putative    65.5    2e-10   
gb|AIC80766.1|  subtilase                                             65.5    2e-10   
gb|AES80028.2|  subtilisin-like serine protease                       65.5    2e-10   
ref|XP_010918673.1|  PREDICTED: subtilisin-like protease SDD1         65.5    2e-10   
ref|NP_001159284.1|  putative subtilase family protein precursor      65.5    2e-10   
gb|EYU39033.1|  hypothetical protein MIMGU_mgv1a001909mg              65.5    2e-10   
ref|XP_006358146.1|  PREDICTED: subtilisin-like protease SDD1-like    65.5    2e-10   
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like         65.5    2e-10   
ref|XP_003547873.1|  PREDICTED: subtilisin-like protease-like         65.5    2e-10   
gb|EYU29563.1|  hypothetical protein MIMGU_mgv1a022413mg              65.5    2e-10   
dbj|BAK06854.1|  predicted protein                                    65.5    2e-10   
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
ref|XP_006358907.1|  PREDICTED: subtilisin-like protease-like         65.5    2e-10   
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
ref|XP_010053374.1|  PREDICTED: subtilisin-like protease SDD1         65.5    2e-10   
ref|XP_006854360.1|  hypothetical protein AMTR_s00039p00160190        65.5    2e-10   
ref|XP_002307740.1|  putative subtilisin precursor family protein     65.5    2e-10   
ref|XP_011076782.1|  PREDICTED: cucumisin-like                        65.5    2e-10   
ref|XP_004244715.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
gb|EMT05539.1|  Subtilisin-like protease                              65.5    2e-10   
ref|XP_008807887.1|  PREDICTED: cucumisin-like isoform X1             65.5    2e-10   
gb|EYU29554.1|  hypothetical protein MIMGU_mgv1a0256351mg             64.7    2e-10   
gb|EMT05795.1|  Subtilisin-like protease                              65.5    2e-10   
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
ref|XP_009767058.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
gb|EYU28961.1|  hypothetical protein MIMGU_mgv1a020058mg              65.5    2e-10   
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
emb|CDY00497.1|  BnaA10g07760D                                        65.5    2e-10   
ref|XP_009362844.1|  PREDICTED: subtilisin-like protease SDD1         65.5    2e-10   
ref|XP_004963825.1|  PREDICTED: subtilisin-like protease-like         65.5    2e-10   
gb|KCW77653.1|  hypothetical protein EUGRSUZ_D01951                   65.5    2e-10   
gb|KHN10472.1|  Subtilisin-like protease                              65.5    2e-10   
gb|EYU29364.1|  hypothetical protein MIMGU_mgv1a022867mg              65.5    2e-10   
ref|XP_006379261.1|  hypothetical protein POPTR_0009s12610g           65.1    2e-10   
ref|XP_009590448.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
ref|XP_006440471.1|  hypothetical protein CICLE_v10024346mg           65.5    2e-10   
ref|XP_010932346.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  65.5    2e-10   
gb|EYU29555.1|  hypothetical protein MIMGU_mgv1a022042mg              65.5    2e-10   
gb|KHN31561.1|  Subtilisin-like protease                              65.5    2e-10   
ref|XP_011029125.1|  PREDICTED: subtilisin-like protease SDD1         65.5    2e-10   
emb|CAA76726.1|  P69C protein                                         65.5    2e-10   
ref|XP_009772256.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
ref|XP_002509669.1|  Cucumisin precursor, putative                    65.5    2e-10   
ref|XP_003538718.1|  PREDICTED: subtilisin-like protease-like         65.5    2e-10   
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg              65.5    2e-10   
ref|XP_008382710.1|  PREDICTED: subtilisin-like protease SDD1         65.5    2e-10   
ref|XP_007201801.1|  hypothetical protein PRUPE_ppa001773mg           65.5    2e-10   
ref|XP_002275410.2|  PREDICTED: subtilisin-like protease SDD1         65.5    2e-10   
dbj|BAF95754.1|  subtilase                                            65.5    2e-10   
ref|XP_002982546.1|  hypothetical protein SELMODRAFT_422004           65.5    2e-10   
ref|XP_010910929.1|  PREDICTED: subtilisin-like protease SDD1         65.5    2e-10   
emb|CDX98438.1|  BnaC05g39370D                                        65.5    2e-10   
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g           65.5    2e-10   
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease              65.5    2e-10   
ref|XP_006857977.1|  hypothetical protein AMTR_s00069p00178740        65.5    2e-10   
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                  65.1    2e-10   
ref|XP_011024491.1|  PREDICTED: subtilisin-like protease SDD1         65.1    2e-10   
ref|XP_002301847.2|  STOMATAL DENSITY AND DISTRIBUTION family pro...  65.1    2e-10   
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg           65.1    2e-10   
ref|XP_009380222.1|  PREDICTED: subtilisin-like protease              65.1    2e-10   
ref|XP_004300735.1|  PREDICTED: subtilisin-like protease-like         65.1    2e-10   
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease              65.1    2e-10   
ref|XP_009599111.1|  PREDICTED: subtilisin-like protease              65.1    2e-10   
ref|XP_002987800.1|  hypothetical protein SELMODRAFT_126868           65.1    2e-10   
ref|XP_004954112.1|  PREDICTED: subtilisin-like protease-like         65.1    2e-10   
ref|XP_002972591.1|  hypothetical protein SELMODRAFT_97292            65.1    2e-10   
ref|XP_009382355.1|  PREDICTED: subtilisin-like protease              65.1    2e-10   
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                   65.1    2e-10   
gb|EYU28146.1|  hypothetical protein MIMGU_mgv1a001696mg              65.1    2e-10   
ref|XP_010103095.1|  Subtilisin-like protease                         65.1    2e-10   
ref|XP_002972044.1|  hypothetical protein SELMODRAFT_96495            65.1    2e-10   
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like         65.1    2e-10   
ref|XP_003561281.1|  PREDICTED: cucumisin-like                        65.1    2e-10   
ref|XP_004958127.1|  PREDICTED: subtilisin-like protease-like         65.1    2e-10   
gb|EMT22548.1|  Subtilisin-like protease                              65.1    2e-10   
ref|XP_010917817.1|  PREDICTED: subtilisin-like protease SBT3.5       65.1    2e-10   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g           65.1    3e-10   
ref|XP_006358406.1|  PREDICTED: subtilisin-like protease-like         65.1    3e-10   
gb|EYU28633.1|  hypothetical protein MIMGU_mgv1a023843mg              65.1    3e-10   
gb|ACN27570.1|  unknown                                               64.7    3e-10   
ref|XP_003603196.1|  Subtilisin-type protease                         65.1    3e-10   
ref|XP_007024750.1|  Subtilase family protein isoform 1               65.1    3e-10   
gb|KGN50586.1|  hypothetical protein Csa_5G187840                     64.7    3e-10   
ref|XP_006664000.1|  PREDICTED: subtilisin-like protease SDD1-like    65.1    3e-10   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease              65.1    3e-10   
ref|XP_008779567.1|  PREDICTED: cucumisin-like                        65.1    3e-10   
gb|EPS61757.1|  hypothetical protein M569_13035                       65.1    3e-10   
gb|EYU37178.1|  hypothetical protein MIMGU_mgv1a001832mg              65.1    3e-10   
gb|EYU37168.1|  hypothetical protein MIMGU_mgv1a026826mg              65.1    3e-10   
gb|KDO63675.1|  hypothetical protein CISIN_1g048043mg                 65.1    3e-10   
ref|XP_006439186.1|  hypothetical protein CICLE_v10018942mg           65.1    3e-10   
ref|XP_009614059.1|  PREDICTED: subtilisin-like protease              65.1    3e-10   
ref|XP_006477585.1|  PREDICTED: subtilisin-like protease-like         65.1    3e-10   
ref|XP_010068435.1|  PREDICTED: subtilisin-like protease SDD1         65.1    3e-10   
ref|XP_006850442.1|  hypothetical protein AMTR_s00165p00065060        65.1    3e-10   
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841           65.1    3e-10   
emb|CDP15047.1|  unnamed protein product                              65.1    3e-10   
ref|XP_009370534.1|  PREDICTED: subtilisin-like protease SDD1         65.1    3e-10   
ref|XP_008337629.1|  PREDICTED: subtilisin-like protease              65.1    3e-10   
gb|KDO47505.1|  hypothetical protein CISIN_1g042259mg                 65.1    3e-10   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease              65.1    3e-10   
gb|EAY95140.1|  hypothetical protein OsI_16958                        65.1    3e-10   
ref|XP_006658495.1|  PREDICTED: subtilisin-like protease-like         65.1    3e-10   
ref|NP_199378.1|  subtilase family protein                            65.1    3e-10   
gb|AES74035.2|  subtilisin-like serine protease                       64.3    3e-10   
ref|XP_007158428.1|  hypothetical protein PHAVU_002G152400g           64.7    3e-10   
ref|XP_008437722.1|  PREDICTED: subtilisin-like protease              65.1    3e-10   
gb|ABG37022.1|  serine protease                                       64.7    3e-10   
emb|CDY57437.1|  BnaAnng14520D                                        64.7    3e-10   
ref|XP_009357945.1|  PREDICTED: subtilisin-like protease              64.7    3e-10   
ref|XP_008679257.1|  PREDICTED: subtilisin-like protease              64.7    3e-10   
ref|XP_006358405.1|  PREDICTED: subtilisin-like protease-like         64.7    3e-10   
ref|XP_008367176.1|  PREDICTED: cucumisin-like                        63.9    3e-10   
ref|XP_002864145.1|  predicted protein                                64.7    3e-10   
gb|EEC77294.1|  hypothetical protein OsI_15934                        64.7    3e-10   
ref|XP_010108080.1|  Subtilisin-like protease SDD1                    64.7    3e-10   
ref|XP_003566321.1|  PREDICTED: subtilisin-like protease              64.7    3e-10   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like         64.7    3e-10   
ref|XP_004165285.1|  PREDICTED: cucumisin-like                        64.7    3e-10   
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  64.7    3e-10   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease-like         64.7    3e-10   
ref|XP_008356216.1|  PREDICTED: subtilisin-like protease SDD1         64.7    3e-10   
emb|CDX97560.1|  BnaA05g25190D                                        64.7    3e-10   
ref|XP_002990396.1|  hypothetical protein SELMODRAFT_131663           64.7    3e-10   
ref|XP_009335230.1|  PREDICTED: subtilisin-like protease SDD1         64.7    3e-10   
gb|EYU33437.1|  hypothetical protein MIMGU_mgv1a001845mg              64.7    3e-10   
ref|XP_004149954.1|  PREDICTED: cucumisin-like                        64.7    3e-10   
tpg|DAA51518.1|  TPA: putative subtilase family protein               64.7    3e-10   
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease              64.7    3e-10   
ref|XP_009146389.1|  PREDICTED: subtilisin-like protease              64.7    4e-10   
emb|CDP16605.1|  unnamed protein product                              64.7    4e-10   
ref|XP_007040055.1|  Subtilase family protein                         64.7    4e-10   
ref|XP_011080122.1|  PREDICTED: subtilisin-like protease SDD1         64.7    4e-10   
ref|XP_011071267.1|  PREDICTED: subtilisin-like protease SDD1         64.7    4e-10   
ref|XP_004514927.1|  PREDICTED: subtilisin-like protease-like         64.7    4e-10   
ref|NP_001174909.1|  Os06g0624100                                     64.7    4e-10   
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease              64.7    4e-10   
ref|XP_004235537.1|  PREDICTED: subtilisin-like protease              64.7    4e-10   
ref|XP_002452917.1|  hypothetical protein SORBIDRAFT_04g034940        64.7    4e-10   
ref|NP_001151463.1|  LOC100285096 precursor                           64.7    4e-10   
ref|NP_001236511.1|  subtilisin-type protease precursor               64.7    4e-10   
ref|XP_010269647.1|  PREDICTED: subtilisin-like protease              64.7    4e-10   
ref|XP_008238763.1|  PREDICTED: cucumisin-like                        64.7    4e-10   
emb|CDP10008.1|  unnamed protein product                              64.7    4e-10   
ref|XP_002452918.1|  hypothetical protein SORBIDRAFT_04g034950        64.7    4e-10   
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease              64.7    4e-10   
ref|NP_001233982.1|  subtilisin-like protease precursor               64.7    4e-10   



>ref|XP_009780984.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=768

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + NLLKPDI APGV ILAAWP  D  E +P +  P +NL+SGTSM+CPH SGI 
Sbjct  502  RGPAYNTPNLLKPDITAPGVAILAAWPGNDTSEALPGQKPPIFNLLSGTSMSCPHVSGIA  561

Query  182  AT  187
            AT
Sbjct  562  AT  563



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + NLLKPDI APGV ILAAWP  D  E +P +  P +NL+SGTSM+CPH SGI 
Sbjct  502  RGPAYNTPNLLKPDITAPGVAILAAWPGNDTSEALPGQKPPIFNLLSGTSMSCPHVSGIA  561

Query  182  AT  187
            AT
Sbjct  562  AT  563



>ref|XP_004238378.1| PREDICTED: CO(2)-response secreted protease [Solanum lycopersicum]
Length=783

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + NLLKPDI APGV ILAAWP  D  E +  ++ P YN+ISGTSM+CPH SGI 
Sbjct  503  RGPTYNTHNLLKPDITAPGVAILAAWPGNDTTEAVAGQALPLYNIISGTSMSCPHVSGIA  562

Query  182  A  184
            A
Sbjct  563  A  563



>ref|XP_006342240.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + NLLKPDI APGV ILAAWP  D +E +  ++ P YN+ISGTSM+CPH SGI 
Sbjct  503  RGPTYNTHNLLKPDITAPGVAILAAWPGNDTNEAVAGQAPPLYNIISGTSMSCPHVSGIA  562

Query  182  A  184
            A
Sbjct  563  A  563



>emb|CDP07365.1| unnamed protein product [Coffea canephora]
Length=762

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+  + NLLKPDI APGVDILAAWP ++  D     ++ P +N++SGTSMACPH SGI
Sbjct  496  RGPAFNTRNLLKPDIAAPGVDILAAWPSNVTEDATEDAETSPPFNILSGTSMACPHASGI  555

Query  179  VAT  187
             AT
Sbjct  556  AAT  558



>ref|XP_011083454.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=729

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+    NLLKPDI APGV ILAAWP  D  E +P K  P ++++SGTSMACPH SG+ 
Sbjct  464  RGPTFGIKNLLKPDIAAPGVAILAAWPSNDKREALPEKEPPVFDILSGTSMACPHVSGLA  523

Query  182  A  184
            A
Sbjct  524  A  524



>ref|XP_002269753.1| PREDICTED: CO(2)-response secreted protease-like [Vitis vinifera]
Length=768

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS A+ NLLKPDI APGV+ILAAW   D  E    K  P +NL+SGTSMACPH SGI 
Sbjct  499  RGPSYATKNLLKPDIAAPGVNILAAWIGNDTAEAPAGKEPPLFNLLSGTSMACPHVSGIA  558

Query  182  AT  187
            AT
Sbjct  559  AT  560



>emb|CBI19918.3| unnamed protein product [Vitis vinifera]
Length=743

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS A+ NLLKPDI APGV+ILAAW   D  E    K  P +NL+SGTSMACPH SGI 
Sbjct  474  RGPSYATKNLLKPDIAAPGVNILAAWIGNDTAEAPAGKEPPLFNLLSGTSMACPHVSGIA  533

Query  182  AT  187
            AT
Sbjct  534  AT  535



>ref|XP_004292936.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=779

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS A+ N+LKPDI APGVDILAAW   D    +  K  P +N++SGTSMACPH SGI 
Sbjct  512  RGPSAATNNILKPDIAAPGVDILAAWIGNDTAVTLAGKEAPKFNVLSGTSMACPHVSGIA  571

Query  182  AT  187
            A+
Sbjct  572  AS  573



>ref|XP_011034984.1| PREDICTED: CO(2)-response secreted protease [Populus euphratica]
Length=762

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  S N+LKPDI APGVDILAAW   D +  +  K  P +N+ISGTSM+CPH SG+ 
Sbjct  494  RGPSSLSRNILKPDIAAPGVDILAAWMANDTEVTLKGKESPKFNIISGTSMSCPHVSGLA  553

Query  182  A  184
            A
Sbjct  554  A  554



>ref|XP_007136109.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
 gb|ESW08103.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
Length=768

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG-YNLISGTSMACPHTSGI  178
            RGPS  S N+LKPDI APGV+ILAAW +   D+ +P    P  YN+ISGTSMACPH SG+
Sbjct  501  RGPSTLSSNILKPDIAAPGVNILAAWTENSSDDDVPKGRKPSLYNIISGTSMACPHVSGL  560

Query  179  VAT  187
             ++
Sbjct  561  ASS  563



>ref|XP_009757105.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + NLLKPDI APGV ILAAWP  D  E +  +  P +N++SGTSM+CPH SGIV
Sbjct  502  RGPAYNTHNLLKPDITAPGVAILAAWPGNDTKEAVLGQEPPLFNILSGTSMSCPHVSGIV  561

Query  182  A  184
            A
Sbjct  562  A  562



>gb|KHG24601.1| Cucumisin [Gossypium arboreum]
Length=768

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS    N+LKPDI APGV+ILAAW   D  E    K  P YNLISGTSMACPH SGI 
Sbjct  498  RGPSTIPENILKPDIAAPGVNILAAWMGNDTAEAPEGKDPPLYNLISGTSMACPHVSGIA  557

Query  182  AT  187
            AT
Sbjct  558  AT  559



>ref|XP_009605223.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=783

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  ++NLLKPD  APGV ILAAWP  D  E +  +  P +N++SGTSM+CPH SGIV
Sbjct  502  RGPAYNTLNLLKPDTTAPGVAILAAWPGNDTKEAVLGQEPPLFNILSGTSMSCPHVSGIV  561

Query  182  A  184
            A
Sbjct  562  A  562



>ref|XP_007017870.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOY15095.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=735

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS    N+LKPDI APGV+ILAAW   D  E    K  P YN+ISGTSMACPH SGI 
Sbjct  465  RGPSTIPKNILKPDIAAPGVNILAAWLGNDTAEAPEGKDPPLYNVISGTSMACPHVSGIA  524

Query  182  AT  187
            AT
Sbjct  525  AT  526



>ref|XP_007017871.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOY15096.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=761

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS    N+LKPDI APGV+ILAAW   D  E    K  P YN+ISGTSMACPH SGI 
Sbjct  491  RGPSTIPKNILKPDIAAPGVNILAAWLGNDTAEAPEGKDPPLYNVISGTSMACPHVSGIA  550

Query  182  AT  187
            AT
Sbjct  551  AT  552



>ref|XP_008221224.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  + N+LKPDI APGV+ILAAW   D    +  K  P +N+ISGTSMACPH SGI 
Sbjct  509  RGPSHGTRNILKPDIAAPGVNILAAWMANDTGIALEGKEPPLFNVISGTSMACPHVSGIA  568

Query  182  AT  187
            AT
Sbjct  569  AT  570



>ref|XP_010933350.1| PREDICTED: LOW QUALITY PROTEIN: CO(2)-response secreted protease 
[Elaeis guineensis]
Length=778

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  + N+LKPD+ APGV+ILA+W   D  E+   +    +NL+SGTSMACPH +GI 
Sbjct  511  RGPSTQTSNILKPDVAAPGVNILASWIPSDSSEVPQGQKPSAFNLVSGTSMACPHVTGIA  570

Query  182  AT  187
            AT
Sbjct  571  AT  572



>ref|XP_008800183.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=779

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  + N+LKPDI APGV+ILAAW   D  E+   +    + L+SGTSMACPH SGI 
Sbjct  512  RGPSPQTSNILKPDIAAPGVNILAAWIPSDSSEVPQGQKSSAFKLVSGTSMACPHVSGIA  571

Query  182  AT  187
            AT
Sbjct  572  AT  573



>ref|XP_010266013.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=780

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG-YNLISGTSMACPHTSGI  178
            RGP+  + N+LKPD+ APGV+ILA+W + +    +P    P  +NL+SGTSMACPH SGI
Sbjct  510  RGPNQQTENILKPDVVAPGVNILASWIETNSSSGVPAGQKPSQFNLLSGTSMACPHVSGI  569

Query  179  VAT  187
             AT
Sbjct  570  AAT  572



>ref|XP_010095549.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB60669.1| Subtilisin-like protease [Morus notabilis]
Length=669

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  S N+LKPDI APGV+ILAAW     ++    K    +N+ISGTSMACPH SG+V
Sbjct  401  RGPSYVSPNILKPDIAAPGVNILAAWIGNSAEDANEGKEPSLFNVISGTSMACPHVSGVV  460

Query  182  AT  187
            AT
Sbjct  461  AT  462



>ref|XP_002510578.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52765.1| Cucumisin precursor, putative [Ricinus communis]
Length=578

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  + N+LKPDI APGV+I+AAW   D  E +  +  P +N+ISGTSM+CPH SGI 
Sbjct  307  RGPSSIARNILKPDIAAPGVNIIAAWKGNDTGEALKGQEPPLFNVISGTSMSCPHVSGIA  366

Query  182  A  184
            A
Sbjct  367  A  367



>gb|KDO84931.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=606

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  + N+LKPDI APGV+ILAAW   D  E    K  P +N+ISGTSM+CPH SG+V
Sbjct  333  RGPSPLTRNILKPDITAPGVNILAAWMGNDTGEAPEGKEPPLFNVISGTSMSCPHISGVV  392

Query  182  A  184
            A
Sbjct  393  A  393



>ref|XP_008807400.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=699

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSL S N++KPD+ APGV ILAAWPD +   E+   +    +N+ISGTSM+CPH +G+
Sbjct  520  RGPSLHSTNVIKPDVIAPGVGILAAWPDGVSPTELKADRRRTEFNIISGTSMSCPHVAGV  579

Query  179  VA  184
             A
Sbjct  580  AA  581



>ref|XP_007051970.1| Subtilase family protein isoform 2, partial [Theobroma cacao]
 gb|EOX96127.1| Subtilase family protein isoform 2, partial [Theobroma cacao]
Length=641

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDG-DEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+L  ++++KPD+ APGVDILAAWP I    E+   K    +N+ISGTSM+CPH SGI
Sbjct  502  RGPNLVGLDVIKPDVTAPGVDILAAWPAITSPSELKSDKRRVLFNIISGTSMSCPHVSGI  561

Query  179  VA  184
             A
Sbjct  562  AA  563



>ref|XP_007051969.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX96126.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=773

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDG-DEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+L  ++++KPD+ APGVDILAAWP I    E+   K    +N+ISGTSM+CPH SGI
Sbjct  501  RGPNLVGLDVIKPDVTAPGVDILAAWPAITSPSELKSDKRRVLFNIISGTSMSCPHVSGI  560

Query  179  VA  184
             A
Sbjct  561  AA  562



>gb|KDO84930.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=773

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  + N+LKPDI APGV+ILAAW   D  E    K  P +N+ISGTSM+CPH SG+V
Sbjct  500  RGPSPLTRNILKPDITAPGVNILAAWMGNDTGEAPEGKEPPLFNVISGTSMSCPHISGVV  559

Query  182  A  184
            A
Sbjct  560  A  560



>ref|XP_006846917.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
 gb|ERN08498.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
Length=784

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  + N+LKPD+ APGV+ILAA+    G  + P +S   +NL+SGTSMACPH SGI 
Sbjct  517  RGPSTDTKNILKPDVAAPGVNILAAYIPTSGSSVPPGQSPSQFNLLSGTSMACPHVSGIA  576

Query  182  A  184
            A
Sbjct  577  A  577



>ref|XP_006435228.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
 gb|ESR48468.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
Length=787

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  + N+LKPDI APGV+ILAAW   D  E    K  P +N+ISGTSM+CPH SG+V
Sbjct  514  RGPSPLTRNILKPDITAPGVNILAAWMGNDTGEAPEGKEPPLFNVISGTSMSCPHISGVV  573

Query  182  A  184
            A
Sbjct  574  A  574



>ref|XP_003592386.1| Subtilisin-like protease [Medicago truncatula]
Length=830

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPSL ++ +LKPDI APGV+ILAAW  + G   +P+      +N++SGTSM+CPH SGI
Sbjct  513  RGPSLLTLEILKPDIVAPGVNILAAWSGLTGPSSLPIDHRRVKFNILSGTSMSCPHVSGI  572

Query  179  VA  184
             A
Sbjct  573  AA  574



>ref|XP_008809445.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=796

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  + N+LKPDI APGV+ILAAW   D  E+   +    +N  SGTSMACPH SGI 
Sbjct  529  RGPSPQTSNILKPDIAAPGVNILAAWIPSDSSEVPQGQKPSAFNFDSGTSMACPHVSGIA  588

Query  182  AT  187
            AT
Sbjct  589  AT  590



>gb|AES62637.2| subtilisin-like serine protease [Medicago truncatula]
Length=782

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPSL ++ +LKPDI APGV+ILAAW  + G   +P+      +N++SGTSM+CPH SGI
Sbjct  513  RGPSLLTLEILKPDIVAPGVNILAAWSGLTGPSSLPIDHRRVKFNILSGTSMSCPHVSGI  572

Query  179  VA  184
             A
Sbjct  573  AA  574



>ref|XP_007220224.1| hypothetical protein PRUPE_ppa002172mg [Prunus persica]
 gb|EMJ21423.1| hypothetical protein PRUPE_ppa002172mg [Prunus persica]
Length=706

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG------YNLISGTSMACP  163
            RGP+  + N+LKPDI APG  ILAAWP      I PV +YPG      YN+ISGTSMACP
Sbjct  446  RGPNPVTPNILKPDIAAPGASILAAWP-----PIAPVSAYPGDDRVASYNVISGTSMACP  500

Query  164  HTSGIVA  184
            H +G+ A
Sbjct  501  HATGVAA  507



>ref|XP_002300693.2| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE79966.2| putative subtilisin precursor family protein [Populus trichocarpa]
Length=767

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    RGPSLASVNLLK---PDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTS  172
            RGPS  S N+LK   PDI APGVDILAAW   D +  +  K  P +N+ISGTSM+CPH S
Sbjct  496  RGPSSLSRNILKAKPPDIAAPGVDILAAWMANDTEVTLKGKESPKFNIISGTSMSCPHVS  555

Query  173  GIVA  184
            G+ A
Sbjct  556  GMAA  559



>ref|XP_007221063.1| hypothetical protein PRUPE_ppa016501mg [Prunus persica]
 gb|EMJ22262.1| hypothetical protein PRUPE_ppa016501mg [Prunus persica]
Length=707

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 44/67 (66%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG------YNLISGTSMACP  163
            RGP+  S N+LKPDI APG  ILA+WP      I PV  YPG      YN+ISGTSMACP
Sbjct  447  RGPNPVSPNILKPDIAAPGASILASWP-----PIAPVSDYPGDDRVASYNVISGTSMACP  501

Query  164  HTSGIVA  184
            H +GI A
Sbjct  502  HATGIAA  508



>ref|XP_004136374.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN60051.1| hypothetical protein Csa_3G873800 [Cucumis sativus]
Length=772

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+ A +N++KPDI APGV+ILAAW   D          P +N+ISGTSM+CPH SG+V
Sbjct  501  RGPNPAVLNIIKPDISAPGVNILAAWLGNDSSSTPQATKSPLFNVISGTSMSCPHVSGVV  560

Query  182  AT  187
            A+
Sbjct  561  AS  562



>ref|XP_008354238.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=440

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+L S+ +LKPD+ APGV+ILAAW    G   +PV +    +N++SGTSM+CPH SGI
Sbjct  171  RGPNLVSLEILKPDMVAPGVNILAAWTGALGPSSLPVDRRNVKFNILSGTSMSCPHVSGI  230

Query  179  VA  184
             A
Sbjct  231  AA  232



>gb|KFK31536.1| hypothetical protein AALP_AA6G125100 [Arabis alpina]
Length=788

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS+   N+LKPDI APG++ILAAW   DG   I V +    YN +SGTSM+CPH SG 
Sbjct  525  RGPSMIDPNILKPDITAPGLNILAAWSGADGPSKISVDQRVAEYNFVSGTSMSCPHVSGA  584

Query  179  VA  184
            +A
Sbjct  585  IA  586



>ref|XP_008245946.1| PREDICTED: cucumisin-like [Prunus mume]
Length=708

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 44/67 (66%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG------YNLISGTSMACP  163
            RGP+  + N+LKPDI APG  ILAAWP      I PV  YPG      YN+ISGTSMACP
Sbjct  447  RGPNPVTPNILKPDIAAPGASILAAWP-----PIAPVSDYPGDDRVASYNVISGTSMACP  501

Query  164  HTSGIVA  184
            H +G+ A
Sbjct  502  HATGVAA  508



>ref|XP_004164801.1| PREDICTED: cucumisin-like [Cucumis sativus]
Length=777

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+ A +N++KPDI APGV+ILAAW   D          P +N+ISGTSM+CPH SG+V
Sbjct  506  RGPNPAVLNIIKPDISAPGVNILAAWLGNDSSSTPQATKSPLFNVISGTSMSCPHVSGVV  565

Query  182  AT  187
            A+
Sbjct  566  AS  567



>gb|KCW79387.1| hypothetical protein EUGRSUZ_C00799 [Eucalyptus grandis]
Length=729

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP   SV +LKPD+  PGV+ILA+WPD      +P+ K    +N+ISGTSM+CPH SG+
Sbjct  489  RGPYFQSVQILKPDVIGPGVNILASWPDYVSPTELPIDKRSVQFNIISGTSMSCPHVSGV  548

Query  179  VA  184
             A
Sbjct  549  AA  550



>dbj|BAJ99639.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPDI APGVDILAAW P+ +  EI   K Y  Y L+SGTSMA PH +G+
Sbjct  498  RGPSQQSPAILKPDIVAPGVDILAAWVPNKEIMEIGKQKVYTKYMLVSGTSMASPHIAGV  557

Query  179  VA  184
            VA
Sbjct  558  VA  559



>dbj|BAJ53097.1| JHL20J20.3 [Jatropha curcas]
Length=756

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  S N+LKPDI APGV+I+AAW   D    +  K  P +N +SGTSMACPH SG+ 
Sbjct  488  RGPSAISRNILKPDIAAPGVEIIAAWIGNDTQIALKGKEPPLFNALSGTSMACPHVSGLA  547

Query  182  AT  187
            A+
Sbjct  548  AS  549



>ref|XP_010911578.1| PREDICTED: subtilisin-like protease, partial [Elaeis guineensis]
Length=444

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 4/61 (7%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS A  N+LKPDI  PG++ILAAWP     E+ P  +   YN+ISGTSMA PH SGI 
Sbjct  181  RGPSKADRNILKPDIVGPGMNILAAWP----FEVGPSDTATRYNMISGTSMATPHLSGIA  236

Query  182  A  184
            A
Sbjct  237  A  237



>gb|KFK31539.1| hypothetical protein AALP_AA6G125500 [Arabis alpina]
Length=942

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPSL   N+LKPDI APGV+ILAAW   DG   I V +    YN  SGTSMACPH SG 
Sbjct  169  RGPSLLDPNILKPDITAPGVNILAAWSGADGPSKISVDQRVVEYNFDSGTSMACPHVSGA  228

Query  179  VA  184
            +A
Sbjct  229  IA  230


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+    N+LKPDI APG++ILAAW   D    + + +    YN  SGTSM+CPH +G 
Sbjct  727  RGPNWVDPNILKPDITAPGLNILAAWSGADSANRVSIDRRVLDYNFDSGTSMSCPHVAGA  786

Query  179  VA  184
            +A
Sbjct  787  IA  788



>ref|XP_008357123.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=794

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + N+LKPDI APGV+ILA W   D    +  K  P YN++SGTSM+CPH SGI 
Sbjct  527  RGPASGTRNILKPDIAAPGVNILAPWIGNDSSVALEGKDPPLYNVLSGTSMSCPHVSGIA  586

Query  182  AT  187
            AT
Sbjct  587  AT  588



>ref|XP_003523395.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45942.1| Subtilisin-like protease [Glycine soja]
Length=769

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  S N+LKPDI APGV+ILAAW   D  E+   +    YN+ISGTSMA PH SG+V
Sbjct  504  RGPSTLSSNILKPDIAAPGVNILAAWIGDDTSEVPKGRKPSLYNIISGTSMATPHVSGLV  563



>ref|XP_009614808.1| PREDICTED: cucumisin-like [Nicotiana tomentosiformis]
Length=768

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + NLLKPDI APG  ILAAWP  D +     +  P +N +SGTS++CPH S IV
Sbjct  500  RGPAYNTRNLLKPDIAAPGTAILAAWPANDTEVARSGQEPPLFNFVSGTSVSCPHVSAIV  559

Query  182  AT  187
            AT
Sbjct  560  AT  561



>ref|XP_004496644.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=786

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  ++ +LKPDI APGV+ILAAW  + G   +P  +    +N++SGTSM+CPH SGI
Sbjct  517  RGPNFLTLEILKPDIVAPGVNILAAWSGVTGPSSLPTDRRRVKFNILSGTSMSCPHVSGI  576

Query  179  VA  184
             A
Sbjct  577  AA  578



>gb|EEC74555.1| hypothetical protein OsI_10097 [Oryza sativa Indica Group]
Length=702

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S ++LKPD+ APGV+ILAAWP +    +IP+ K    +N  SGTSM+CPH SGI
Sbjct  401  RGPSSISPHILKPDVTAPGVNILAAWPPMSSPTVIPLDKRSVTWNFDSGTSMSCPHVSGI  460

Query  179  VA  184
            VA
Sbjct  461  VA  462



>gb|AAN06842.1| Putatvie subtilisin-like serine protease [Oryza sativa Japonica 
Group]
 gb|ABF94081.1| PA domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=663

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S ++LKPD+ APGV+ILAAWP +    +IP+ K    +N  SGTSM+CPH SGI
Sbjct  362  RGPSSISPHILKPDVTAPGVNILAAWPPMSSPTVIPLDKRSVTWNFDSGTSMSCPHVSGI  421

Query  179  VA  184
            VA
Sbjct  422  VA  423



>ref|XP_010103418.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB95737.1| Subtilisin-like protease [Morus notabilis]
Length=799

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+L S+++LKPD+ APGVDILAAWPD I    +        +N++SGTSM+CPH SG+
Sbjct  522  RGPNLLSLDVLKPDVIAPGVDILAAWPDEIPLSYVTTDTRRSEFNIMSGTSMSCPHLSGV  581

Query  179  VA  184
             A
Sbjct  582  AA  583



>ref|XP_009587381.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104085130 
[Nicotiana tomentosiformis]
Length=2420

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  2     RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
             RGPS AS  +LKPDI  PGV+ILAAWP  ++ +      +   +N+ISGTSM+CPH SGI
Sbjct  2158  RGPSWASPGILKPDIIGPGVNILAAWPTSVENN----TNTKSTFNIISGTSMSCPHLSGI  2213

Query  179   VA  184
              A
Sbjct  2214  AA  2215



>ref|XP_009768389.1| PREDICTED: cucumisin-like [Nicotiana sylvestris]
Length=765

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + NLLKPDI APG  ILAAWP  D +     +  P +N +SGTS++CPH S IV
Sbjct  497  RGPAYNTRNLLKPDIAAPGTAILAAWPANDTEVARSGQEPPLFNFLSGTSVSCPHVSAIV  556

Query  182  AT  187
            AT
Sbjct  557  AT  558



>ref|XP_010103096.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB94819.1| Subtilisin-like protease [Morus notabilis]
Length=688

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP---GYNLISGTSMACPHTS  172
            RGPS  + ++LKPDI APGV+ILAAWP      ++P   Y     +N+ISGTSM+CPH S
Sbjct  397  RGPSSLAPDILKPDISAPGVNILAAWPTKTPPTVVPSDFYKQPVSWNIISGTSMSCPHVS  456

Query  173  GIVA  184
            GIVA
Sbjct  457  GIVA  460



>ref|XP_007051971.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96128.1| Subtilase family protein [Theobroma cacao]
Length=768

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDG-DEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+L  ++++KPD+ APGV+ILAAWP I   +E+   K    +N+++GTSM+CPH SGI
Sbjct  501  RGPNLVGLDVIKPDVTAPGVNILAAWPAITSPNELKSDKRRVLFNILTGTSMSCPHVSGI  560

Query  179  VA  184
             A
Sbjct  561  AA  562



>ref|XP_006486775.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=166

 Score = 66.2 bits (160),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS+AS  +LKPDI  PGV ILAAWP +  +     KS   +N+ISGTSM+CPH SG+ 
Sbjct  68   RGPSMASPGILKPDIIGPGVSILAAWP-VSVENNTNTKST--FNIISGTSMSCPHLSGVA  124

Query  182  A  184
            A
Sbjct  125  A  125



>ref|XP_006339058.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG--YNLISGTSMACPHTSG  175
            RGPSL+ + + KPDI APG  ILAAWP  + D +I V ++ G  Y L+SGTSMA PH +G
Sbjct  490  RGPSLSYLQVAKPDIMAPGELILAAWPSNNSDTVIGVNTFLGSDYRLVSGTSMAAPHIAG  549

Query  176  IVA  184
            I A
Sbjct  550  IAA  552



>ref|XP_004231532.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=794

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+ APGV+ILAAWPD +   E+   + +  +N+ SGTSM+CPH SG+
Sbjct  518  RGPSAESTFVLKPDVIAPGVNILAAWPDGVAPTELSSDQRHTQFNIASGTSMSCPHVSGL  577

Query  179  VA  184
             A
Sbjct  578  AA  579



>gb|EMT29814.1| Subtilisin-like protease [Aegilops tauschii]
Length=380

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S N+LKPD+ APGV+ILAAWP      ++P+ K    +N  +GTSM+CPH +GI
Sbjct  186  RGPSSISPNILKPDVTAPGVNILAAWPPKSSPTMLPLDKRSTEWNFDTGTSMSCPHVTGI  245

Query  179  VA  184
            VA
Sbjct  246  VA  247



>ref|XP_008238729.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=758

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+ AS  +LKPDI  PGVDILAAWP  +D       +S   +N+ISGTSMACPH SGI
Sbjct  494  RGPNKASPGILKPDIIGPGVDILAAWPVSVDN----ATQSKATFNIISGTSMACPHLSGI  549

Query  179  VA  184
             A
Sbjct  550  AA  551



>ref|XP_007136108.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
 gb|ESW08102.1| hypothetical protein PHAVU_009G018500g [Phaseolus vulgaris]
Length=768

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS  S N+LKPDI APGV+ILAAW +   D +   +    YN+ISGTSMACPH SG+
Sbjct  504  RGPSRLSSNILKPDIAAPGVNILAAWNN-STDHVPKGREPSRYNIISGTSMACPHVSGL  561



>gb|EMS49122.1| Subtilisin-like protease [Triticum urartu]
Length=787

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPDI APGVDILAAW P+ +  EI   K Y  Y L+SGTSMA PH +G+
Sbjct  324  RGPTQMSPAILKPDIVAPGVDILAAWVPNKEIMEIGKQKLYAKYMLVSGTSMASPHVAGV  383

Query  179  VA  184
            VA
Sbjct  384  VA  385



>ref|XP_004245678.1| PREDICTED: subtilisin-like protease SDD1 [Solanum lycopersicum]
 emb|CAA06412.1| P69C protein [Solanum lycopersicum]
Length=754

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+ AS  +LKPDI  PGV+ILAAWP  +DG++     +   +N+ISGTSM+CPH SG+
Sbjct  486  RGPNTASRGILKPDIIGPGVNILAAWPTSVDGNK----NTKSTFNIISGTSMSCPHLSGV  541

Query  179  VA  184
             A
Sbjct  542  AA  543



>ref|XP_006426784.1| hypothetical protein CICLE_v10024934mg [Citrus clementina]
 gb|ESR40024.1| hypothetical protein CICLE_v10024934mg [Citrus clementina]
 gb|KDO53785.1| hypothetical protein CISIN_1g040458mg [Citrus sinensis]
Length=732

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  +  +LKPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  456  RGPNPETPEILKPDVIAPGLNILAAWPDKVGPSGIPTDKRKTEFNILSGTSMACPHVSGL  515

Query  179  VA  184
             A
Sbjct  516  AA  517



>ref|XP_010089708.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38258.1| Subtilisin-like protease [Morus notabilis]
Length=787

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  511  RGPNPESPEILKPDVIAPGLNILAAWPDRVGPSGIPSDKRRTEFNILSGTSMACPHVSGL  570

Query  179  VA  184
             A
Sbjct  571  AA  572



>ref|XP_009343496.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=783

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+L S+ +LKPD+ APGV+ILAAW    G   +P  +    +N++SGTSM+CPH SGI
Sbjct  514  RGPNLVSLEILKPDMVAPGVNILAAWTGALGPSSLPADRRRVKFNILSGTSMSCPHVSGI  573

Query  179  VA  184
             A
Sbjct  574  AA  575



>gb|EMT30759.1| Subtilisin-like protease [Aegilops tauschii]
Length=771

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPDI APGVDILAAW P+ +  EI   K Y  Y L+SGTSMA PH +G+
Sbjct  498  RGPTQMSPAILKPDIVAPGVDILAAWVPNKEIMEIGKQKLYAKYMLVSGTSMASPHIAGV  557

Query  179  VA  184
            VA
Sbjct  558  VA  559



>emb|CBI35805.3| unnamed protein product [Vitis vinifera]
Length=619

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  285  RGPNPESPEILKPDVIAPGLNILAAWPDRVGPSGIPSDKRRTEFNILSGTSMACPHISGL  344

Query  179  VA  184
             A
Sbjct  345  AA  346



>ref|XP_004300737.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=721

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+AS  +LKPDI  PGV ILAAWP  +D       +S   +N++SGTSM+CPH SGI
Sbjct  456  RGPSIASTGILKPDIIGPGVSILAAWPVSVDNG----TESTETFNMVSGTSMSCPHLSGI  511

Query  179  VA  184
             A
Sbjct  512  AA  513



>gb|KDP25559.1| hypothetical protein JCGZ_20715 [Jatropha curcas]
Length=745

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS+AS  +LKPDI  PGV ILAAWP I  D  I  KS   +N +SGTSM+CPH SG+ 
Sbjct  486  RGPSVASPGILKPDITGPGVSILAAWP-ISVDNRIKSKST--FNFLSGTSMSCPHLSGVA  542

Query  182  A  184
            A
Sbjct  543  A  543



>ref|XP_007210956.1| hypothetical protein PRUPE_ppa023717mg [Prunus persica]
 gb|EMJ12155.1| hypothetical protein PRUPE_ppa023717mg [Prunus persica]
Length=729

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+ AS  +LKPDI  PGVDILAAWP  +D       +S   +N+ISGTSMACPH SGI
Sbjct  465  RGPNKASPGILKPDIIGPGVDILAAWPVSVDN----ATQSKATFNIISGTSMACPHLSGI  520

Query  179  VA  184
             A
Sbjct  521  AA  522



>ref|NP_001145849.1| uncharacterized protein LOC100279360 precursor [Zea mays]
 gb|ACL52723.1| unknown [Zea mays]
Length=786

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 9/66 (14%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-----PDIDGDEIIPVKSYPGYNLISGTSMACPH  166
            RGP+L +  +LKPD+ APGVDILAAW     P   G ++  VK    YN+ISGTSM+CPH
Sbjct  508  RGPNLLAPEILKPDVTAPGVDILAAWTGENSPSQLGSDLRRVK----YNIISGTSMSCPH  563

Query  167  TSGIVA  184
             SGI A
Sbjct  564  VSGIAA  569



>ref|XP_006465816.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=778

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  +  +LKPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  502  RGPNPETPEILKPDVIAPGLNILAAWPDKVGPSGIPTDKRKTEFNILSGTSMACPHVSGL  561

Query  179  VA  184
             A
Sbjct  562  AA  563



>ref|XP_006426785.1| hypothetical protein CICLE_v10024934mg [Citrus clementina]
 gb|ESR40025.1| hypothetical protein CICLE_v10024934mg [Citrus clementina]
Length=778

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  +  +LKPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  502  RGPNPETPEILKPDVIAPGLNILAAWPDKVGPSGIPTDKRKTEFNILSGTSMACPHVSGL  561

Query  179  VA  184
             A
Sbjct  562  AA  563



>gb|KDP25551.1| hypothetical protein JCGZ_20707 [Jatropha curcas]
Length=757

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+LAS  +LKPDI  PGV ILAAWP    D     KS   +NL+SGTSMACPH SGI 
Sbjct  498  RGPNLASPGILKPDIIGPGVSILAAWP-FPLDNTTNTKST--FNLVSGTSMACPHLSGIA  554

Query  182  A  184
            A
Sbjct  555  A  555



>gb|EMS54035.1| Subtilisin-like protease [Triticum urartu]
Length=474

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S N+LKPD+ APGV+ILAAWP      ++P+ K    +N  +GTSM+CPH +GI
Sbjct  186  RGPSSISPNILKPDVTAPGVNILAAWPPKSSPTMLPLDKRSTEWNFDTGTSMSCPHVTGI  245

Query  179  VA  184
            VA
Sbjct  246  VA  247



>ref|XP_009348638.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=846

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+L S+ +LKPD+ APGV+ILAAW    G   +P  +    +N++SGTSM+CPH SGI
Sbjct  577  RGPNLVSLEILKPDMVAPGVNILAAWTGALGPSSLPADRRRVKFNILSGTSMSCPHVSGI  636

Query  179  VA  184
             A
Sbjct  637  AA  638



>emb|CDP05276.1| unnamed protein product [Coffea canephora]
Length=778

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVK-SYPGYNLISGTSMACPHTSGI  178
            RGP+  S+ +LKPD+ APGV+ILAAW  + G   +P       +N++SGTSM+CPH SGI
Sbjct  509  RGPNFLSLEILKPDVVAPGVNILAAWTGVTGPSSLPTDPRRTWFNILSGTSMSCPHVSGI  568

Query  179  VA  184
             A
Sbjct  569  AA  570



>ref|XP_010061088.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW67983.1| hypothetical protein EUGRSUZ_F01673 [Eucalyptus grandis]
Length=767

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 3/63 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEI-IPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS  + ++LKPD+ APGV ILAAW  I  D    P K+ P +N++SGTSMACPH SG+
Sbjct  497  RGPSSITKDILKPDVTAPGVAILAAW--IGNDTAGTPGKAAPSFNVLSGTSMACPHVSGL  554

Query  179  VAT  187
             AT
Sbjct  555  AAT  557



>ref|XP_006365833.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=798

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS  S+ +LKPD+ APGV+ILAAWPD +   E+   +    +N+ SGTSM+CPH SG+
Sbjct  518  RGPSAESIFVLKPDVIAPGVNILAAWPDGVAPTELSSDQRRTQFNIASGTSMSCPHVSGL  577

Query  179  VA  184
             A
Sbjct  578  AA  579



>ref|XP_008351622.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SDD1 
[Malus domestica]
Length=638

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSL+S  +LKPDI  PGVDILAAWP+   +  +P      +N+ISGTSMA PH SGI 
Sbjct  368  RGPSLSSPGILKPDIIGPGVDILAAWPESVDNATLP-NPKATFNIISGTSMATPHLSGIA  426

Query  182  A  184
            A
Sbjct  427  A  427



>ref|XP_003632775.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=787

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  511  RGPNPESPEILKPDVIAPGLNILAAWPDRVGPSGIPSDKRRTEFNILSGTSMACPHISGL  570

Query  179  VA  184
             A
Sbjct  571  AA  572



>ref|XP_010933213.1| PREDICTED: subtilisin-like protease SDD1 [Elaeis guineensis]
Length=776

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSL + ++LKPDI APGV+I+AAWP ++    +   +    ++++SGTSMACPH SGI
Sbjct  507  RGPSLTNPSILKPDIIAPGVNIIAAWPANLGPSGLQEDRRRSNFSVLSGTSMACPHVSGI  566

Query  179  VA  184
            VA
Sbjct  567  VA  568



>ref|XP_008354210.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=783

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+L S+ +LKPD+ APGV+ILAAW    G   +P  +    +N++SGTSM+CPH SGI
Sbjct  514  RGPNLVSLEILKPDMVAPGVNILAAWTGALGPSSLPADRRNVKFNILSGTSMSCPHVSGI  573

Query  179  VA  184
             A
Sbjct  574  AA  575



>gb|KFK42754.1| hypothetical protein AALP_AA1G035200 [Arabis alpina]
Length=781

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSLA+ ++LKPDI APGV+I+AAWP   G   +P  S    + ++SGTSM+CPH SGI
Sbjct  508  RGPSLANPSILKPDIIAPGVNIIAAWPQNLGPTGLPYDSRRVNFTVMSGTSMSCPHVSGI  567

Query  179  VA  184
             A
Sbjct  568  TA  569



>ref|XP_002275471.2| PREDICTED: uncharacterized protein LOC100242816 [Vitis vinifera]
Length=1485

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSL S  +LKPDI  PGV ILAAWP  ++ D      S P +N+ISGTSM+CPH SGI
Sbjct  511  RGPSLESPGILKPDIIGPGVSILAAWPFPLEND----TTSKPTFNVISGTSMSCPHLSGI  566

Query  179  VA  184
             A
Sbjct  567  AA  568


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  2     RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
             RGPS AS  +LKPDI  PGV ILAAWP  +D +    + S   +N+ISGTSM+CPH SGI
Sbjct  1226  RGPSFASPGILKPDIIGPGVSILAAWPFPLDNN----INSKSTFNIISGTSMSCPHLSGI  1281

Query  179   VA  184
              A
Sbjct  1282  AA  1283



>ref|XP_008647197.1| PREDICTED: uncharacterized protein LOC100501587 isoform X1 [Zea 
mays]
Length=801

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+ APGV+ILAAWP      +IP+ K    +N+ SGTSM+CPH SGI
Sbjct  504  RGPSSVSPKILKPDVTAPGVNILAAWPPKSSPTVIPLDKRLTEWNMDSGTSMSCPHVSGI  563

Query  179  VA  184
             A
Sbjct  564  AA  565



>ref|XP_010658505.1| PREDICTED: cucumisin isoform X1 [Vitis vinifera]
Length=746

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 43/67 (64%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG------YNLISGTSMACP  163
            RGP+ AS +LLKPDI APGV ILAAWP      I PV    G      YN+ISGTSM+CP
Sbjct  489  RGPNPASFDLLKPDIAAPGVRILAAWP-----PIAPVSGVKGDNREVLYNIISGTSMSCP  543

Query  164  HTSGIVA  184
            H SG  A
Sbjct  544  HASGAAA  550



>ref|XP_008647202.1| PREDICTED: uncharacterized protein LOC100501587 isoform X2 [Zea 
mays]
Length=799

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+ APGV+ILAAWP      +IP+ K    +N+ SGTSM+CPH SGI
Sbjct  502  RGPSSVSPKILKPDVTAPGVNILAAWPPKSSPTVIPLDKRLTEWNMDSGTSMSCPHVSGI  561

Query  179  VA  184
             A
Sbjct  562  AA  563



>ref|XP_010658506.1| PREDICTED: cucumisin isoform X2 [Vitis vinifera]
Length=745

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 43/67 (64%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG------YNLISGTSMACP  163
            RGP+ AS +LLKPDI APGV ILAAWP      I PV    G      YN+ISGTSM+CP
Sbjct  488  RGPNPASFDLLKPDIAAPGVRILAAWP-----PIAPVSGVKGDNREVLYNIISGTSMSCP  542

Query  164  HTSGIVA  184
            H SG  A
Sbjct  543  HASGAAA  549



>ref|XP_008647217.1| PREDICTED: uncharacterized protein LOC100501587 isoform X5 [Zea 
mays]
 ref|XP_008647221.1| PREDICTED: uncharacterized protein LOC100501587 isoform X5 [Zea 
mays]
Length=771

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+ APGV+ILAAWP      +IP+ K    +N+ SGTSM+CPH SGI
Sbjct  474  RGPSSVSPKILKPDVTAPGVNILAAWPPKSSPTVIPLDKRLTEWNMDSGTSMSCPHVSGI  533

Query  179  VA  184
             A
Sbjct  534  AA  535



>ref|XP_002510196.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52383.1| Cucumisin precursor, putative [Ricinus communis]
Length=777

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSLA  ++LKPDI APG  ILAAWP+ I  D I   + +  +NL SGTSMACPH +GI
Sbjct  499  RGPSLACPSVLKPDIMAPGSLILAAWPENIIVDRIDDQEIFNNFNLQSGTSMACPHVAGI  558

Query  179  VA  184
             A
Sbjct  559  AA  560



>ref|XP_009769238.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=761

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 41/62 (66%), Gaps = 9/62 (15%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + NLLKPDI APGV ILAAWP             P +N++SGTSM+CPH SGI 
Sbjct  503  RGPAGNTPNLLKPDITAPGVTILAAWPG---------NKQPMFNILSGTSMSCPHVSGIA  553

Query  182  AT  187
            AT
Sbjct  554  AT  555



>ref|XP_004249505.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=765

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG--YNLISGTSMACPHTSG  175
            RGPSL+ + + KPDI APG  IL+AWP  + D +I V ++ G  Y L+SGTSMA PH +G
Sbjct  490  RGPSLSYLQVAKPDIMAPGELILSAWPSNNSDTVIGVNTFLGSDYRLVSGTSMAAPHIAG  549

Query  176  IVA  184
            I A
Sbjct  550  IAA  552



>ref|XP_008647226.1| PREDICTED: uncharacterized protein LOC100501587 isoform X6 [Zea 
mays]
Length=695

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+ APGV+ILAAWP      +IP+ K    +N+ SGTSM+CPH SGI
Sbjct  398  RGPSSVSPKILKPDVTAPGVNILAAWPPKSSPTVIPLDKRLTEWNMDSGTSMSCPHVSGI  457

Query  179  VA  184
             A
Sbjct  458  AA  459



>ref|XP_008647212.1| PREDICTED: uncharacterized protein LOC100501587 isoform X4 [Zea 
mays]
Length=778

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+ APGV+ILAAWP      +IP+ K    +N+ SGTSM+CPH SGI
Sbjct  481  RGPSSVSPKILKPDVTAPGVNILAAWPPKSSPTVIPLDKRLTEWNMDSGTSMSCPHVSGI  540

Query  179  VA  184
             A
Sbjct  541  AA  542



>ref|XP_010230265.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=802

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S N+LKPD+ APGV+ILAAWP      ++P+ K    +N  +GTSM+CPH SGI
Sbjct  500  RGPSSISPNILKPDVTAPGVNILAAWPPKSPPTVLPLDKRSTHWNFDTGTSMSCPHVSGI  559

Query  179  VA  184
            VA
Sbjct  560  VA  561



>ref|XP_010696462.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=751

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 9/66 (14%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVK-----SYPGYNLISGTSMACPH  166
            RGP+  S+ +LKPD+ APGVDILAAWP    + I P K         YN++SGTSM+CPH
Sbjct  493  RGPNTLSIYVLKPDMIAPGVDILAAWP----NNISPTKLSEDPRRSDYNVLSGTSMSCPH  548

Query  167  TSGIVA  184
             SGI A
Sbjct  549  VSGIAA  554



>tpg|DAA43450.1| TPA: putative subtilase family protein [Zea mays]
Length=818

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+ APGV+ILAAWP      +IP+ K    +N+ SGTSM+CPH SGI
Sbjct  521  RGPSSVSPKILKPDVTAPGVNILAAWPPKSSPTVIPLDKRLTEWNMDSGTSMSCPHVSGI  580

Query  179  VA  184
             A
Sbjct  581  AA  582



>gb|EYU46755.1| hypothetical protein MIMGU_mgv1a001548mg [Erythranthe guttata]
Length=798

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+ S  +LKPDI APGV+ILAAWPD +   EI        +N+ SGTSM+CPH SG+
Sbjct  523  RGPSVESPYVLKPDIIAPGVNILAAWPDGVAPSEIASDTRRTQFNVASGTSMSCPHVSGV  582

Query  179  VA  184
             A
Sbjct  583  AA  584



>ref|XP_008647207.1| PREDICTED: uncharacterized protein LOC100501587 isoform X3 [Zea 
mays]
Length=781

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+ APGV+ILAAWP      +IP+ K    +N+ SGTSM+CPH SGI
Sbjct  484  RGPSSVSPKILKPDVTAPGVNILAAWPPKSSPTVIPLDKRLTEWNMDSGTSMSCPHVSGI  543

Query  179  VA  184
             A
Sbjct  544  AA  545



>tpg|DAA43452.1| TPA: putative subtilase family protein [Zea mays]
Length=796

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+ APGV+ILAAWP      +IP+ K    +N+ SGTSM+CPH SGI
Sbjct  499  RGPSSVSPKILKPDVTAPGVNILAAWPPKSSPTVIPLDKRLTEWNMDSGTSMSCPHVSGI  558

Query  179  VA  184
             A
Sbjct  559  AA  560



>ref|XP_009769237.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
Length=787

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 41/62 (66%), Gaps = 9/62 (15%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + NLLKPDI APGV ILAAWP             P +N++SGTSM+CPH SGI 
Sbjct  529  RGPAGNTPNLLKPDITAPGVTILAAWPG---------NKQPMFNILSGTSMSCPHVSGIA  579

Query  182  AT  187
            AT
Sbjct  580  AT  581



>tpg|DAA43449.1| TPA: putative subtilase family protein [Zea mays]
Length=712

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+ APGV+ILAAWP      +IP+ K    +N+ SGTSM+CPH SGI
Sbjct  415  RGPSSVSPKILKPDVTAPGVNILAAWPPKSSPTVIPLDKRLTEWNMDSGTSMSCPHVSGI  474

Query  179  VA  184
             A
Sbjct  475  AA  476



>ref|XP_009776224.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=742

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSL S  +LKPDI  PG++ILAAWP   G +     S   +N+ISGTSM+CPH +G+ 
Sbjct  487  RGPSLVSQGILKPDIIGPGLNILAAWPTSVGQK---TSSKSTFNIISGTSMSCPHLAGVA  543

Query  182  A  184
            A
Sbjct  544  A  544



>ref|XP_008235585.1| PREDICTED: subtilisin-like protease SDD1 [Prunus mume]
Length=767

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG-YNLISGTSMACPHTSGI  178
            RGPS ++ ++LKPD+ APGV+I+AAWP   G   +P  S  G + ++SGTSMACPH SGI
Sbjct  497  RGPSYSNPSILKPDVIAPGVNIIAAWPQNLGPSGLPEDSRRGNFTIMSGTSMACPHASGI  556

Query  179  VA  184
             A
Sbjct  557  AA  558



>emb|CBI31602.3| unnamed protein product [Vitis vinifera]
Length=1474

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 43/67 (64%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG------YNLISGTSMACP  163
            RGP+ AS +LLKPDI APGV ILAAWP      I PV    G      YN+ISGTSM+CP
Sbjct  489  RGPNPASFDLLKPDIAAPGVRILAAWP-----PIAPVSGVKGDNREVLYNIISGTSMSCP  543

Query  164  HTSGIVA  184
            H SG  A
Sbjct  544  HASGAAA  550


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 11/67 (16%)
 Frame = +2

Query  2     RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG------YNLISGTSMACP  163
             RGP+  + +LLKPD+ APGV ILAAW  I      P+    G      YN++SGTSMACP
Sbjct  1217  RGPNNITHDLLKPDLTAPGVHILAAWSPIS-----PISQMSGDNRVAQYNILSGTSMACP  1271

Query  164   HTSGIVA  184
             H +G  A
Sbjct  1272  HATGAAA  1278



>ref|XP_010552189.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=790

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   +P  K    +N++SGTSMACPH SG+
Sbjct  514  RGPNPESPEILKPDVIAPGLNILAAWPDKIGPSGVPSDKRRTEFNILSGTSMACPHVSGL  573

Query  179  VA  184
             A
Sbjct  574  AA  575



>ref|XP_008381935.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=752

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 43/65 (66%), Gaps = 11/65 (17%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV----KSYPGYNLISGTSMACPHT  169
            RGPSLAS  +LKPDI  PGV ILAAWP        PV    KS   +N++SGTSM+CPH 
Sbjct  493  RGPSLASPGILKPDIIGPGVSILAAWP-------FPVDNTTKSKINFNIMSGTSMSCPHL  545

Query  170  SGIVA  184
            SGI A
Sbjct  546  SGIAA  550



>ref|XP_004141727.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45447.1| hypothetical protein Csa_7G448090 [Cucumis sativus]
Length=777

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  ++KPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  500  RGPNPESPEIVKPDVIAPGLNILAAWPDKIGPSGIPTDKRTTEFNILSGTSMACPHVSGL  559

Query  179  VA  184
             A
Sbjct  560  AA  561



>emb|CDP08910.1| unnamed protein product [Coffea canephora]
Length=727

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS    +++KPD+ APGVDILAAW P+I    +   K    +N ISGTSM+CPH SGI
Sbjct  471  RGPSAVGPDIIKPDVTAPGVDILAAWPPNISPTRLKSDKRSVKFNFISGTSMSCPHVSGI  530

Query  179  VA  184
             A
Sbjct  531  AA  532



>ref|XP_011033844.1| PREDICTED: subtilisin-like protease SDD1 [Populus euphratica]
Length=766

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSLAS  +LKPDI  PGV ILAAWP  +D +      S   +N+ISGTSM+CPH SGI
Sbjct  507  RGPSLASPGILKPDIIGPGVSILAAWPFPLDNN----TNSKSTFNIISGTSMSCPHLSGI  562

Query  179  VA  184
             A
Sbjct  563  AA  564



>ref|XP_009381912.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=1224

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
             RGPS  S  +LKPD+ APG++ILAAWPD  G   IP  +    +N++SGTSMACPH SG+
Sbjct  945   RGPSPQSPEILKPDVIAPGLNILAAWPDNVGPAGIPSDQRKTEFNILSGTSMACPHVSGL  1004

Query  179   VA  184
              A
Sbjct  1005  AA  1006



>ref|XP_004155899.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=776

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  ++KPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  499  RGPNPESPEIVKPDVIAPGLNILAAWPDKIGPSGIPTDKRTTEFNILSGTSMACPHVSGL  558

Query  179  VA  184
             A
Sbjct  559  AA  560



>ref|XP_002275429.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=740

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSLAS  +LKPDI  PGV +LAAWP    +      S   +N+ISGTSM+CPH SGI 
Sbjct  479  RGPSLASPGILKPDITGPGVSVLAAWPSSVDNR---TDSKVAFNMISGTSMSCPHLSGIA  535

Query  182  A  184
            A
Sbjct  536  A  536



>ref|XP_008462247.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=777

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  ++KPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  500  RGPNPESPEIVKPDVIAPGLNILAAWPDKIGPSGIPTDKRTTEFNILSGTSMACPHVSGL  559

Query  179  VA  184
             A
Sbjct  560  AA  561



>ref|XP_003603807.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES74058.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            +GPS  + N+LKPDI APGV+ILAAW   D + +   K    YN+ SGTSMACPH SG+ 
Sbjct  500  KGPSYLTKNILKPDIAAPGVNILAAWTGNDTENVPKGKKPSPYNIESGTSMACPHVSGLA  559

Query  182  AT  187
             +
Sbjct  560  GS  561



>ref|XP_009604592.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=742

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS+ S  +LKPDI  PG++ILAAWP   G++     S   +N+ISGTSM+CPH +G+ 
Sbjct  487  RGPSMVSQGILKPDIIGPGLNILAAWPTSVGEK---TSSKSTFNIISGTSMSCPHLAGVA  543

Query  182  A  184
            A
Sbjct  544  A  544



>gb|EYU39034.1| hypothetical protein MIMGU_mgv1a019276mg, partial [Erythranthe 
guttata]
Length=688

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSLAS  +LKPDI  PGV ILAAWP +  D     K+   +N+ISGTSM+CPH SGI 
Sbjct  441  RGPSLASPGILKPDIIGPGVSILAAWP-VSVDNYTNEKAT--FNMISGTSMSCPHLSGIA  497

Query  182  A  184
            A
Sbjct  498  A  498



>ref|XP_008246193.1| PREDICTED: cucumisin-like, partial [Prunus mume]
Length=208

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 9/66 (14%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-----PDIDGDEIIPVKSYPGYNLISGTSMACPH  166
            RGP+  + ++LKPD+ APGVDILAAW     P ID ++   V+    YN+ISGTSM+CPH
Sbjct  62   RGPNPITPDILKPDLTAPGVDILAAWSPVAPPSIDFEDTRSVE----YNIISGTSMSCPH  117

Query  167  TSGIVA  184
             SG  A
Sbjct  118  ASGAAA  123



>ref|XP_009619449.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana tomentosiformis]
Length=786

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 40/62 (65%), Gaps = 9/62 (15%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP   + NLLKPDI APGV ILAAWP             P +N++SGTSM+CPH SGI 
Sbjct  528  RGPVENTPNLLKPDITAPGVTILAAWPG---------NKQPMFNILSGTSMSCPHVSGIA  578

Query  182  AT  187
            AT
Sbjct  579  AT  580



>ref|XP_002303551.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
 gb|EEE78530.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
Length=764

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSLAS  +LKPDI  PGV ILAAWP  +D +      S   +N+ISGTSM+CPH SGI
Sbjct  498  RGPSLASPGILKPDIIGPGVSILAAWPFPLDNN----TNSKSTFNIISGTSMSCPHLSGI  553

Query  179  VA  184
             A
Sbjct  554  AA  555



>emb|CAA07250.1| serine protease [Solanum lycopersicum]
Length=747

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS AS+ +LKPDI  PGV+ILAAWP  +D ++     +   +N+ISGTSM+CPH SG+
Sbjct  486  RGPSGASIGILKPDIIGPGVNILAAWPTSVDDNK----NTKSTFNIISGTSMSCPHLSGV  541

Query  179  VA  184
             A
Sbjct  542  AA  543



>ref|XP_011036534.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  497  RGPNPESPEILKPDVIAPGLNILAAWPDKIGPSGIPSDKRKIEFNILSGTSMACPHVSGL  556

Query  179  VA  184
             A
Sbjct  557  AA  558



>emb|CAA06413.1| P69E protein [Solanum lycopersicum]
Length=754

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+ AS  +LKPDI  PGV+ILAAWP  +DG++     +   +N+ISGTSM+CPH SG+
Sbjct  486  RGPNTASPGILKPDIIGPGVNILAAWPTSVDGNK----NTKSTFNIISGTSMSCPHLSGV  541

Query  179  VA  184
             A
Sbjct  542  AA  543



>ref|XP_007208831.1| hypothetical protein PRUPE_ppa025337mg [Prunus persica]
 gb|EMJ10030.1| hypothetical protein PRUPE_ppa025337mg [Prunus persica]
Length=753

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 41/62 (66%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS AS  +LKPDI  PGV ILA WP  +D       KS   +N+ISGTSMACPH SGI
Sbjct  487  RGPSTASPGILKPDITGPGVSILATWPVSVDN----ATKSKATFNIISGTSMACPHLSGI  542

Query  179  VA  184
             A
Sbjct  543  AA  544



>ref|XP_002303550.2| hypothetical protein POPTR_0003s11860g [Populus trichocarpa]
 gb|EEE78529.2| hypothetical protein POPTR_0003s11860g [Populus trichocarpa]
Length=755

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSLAS  +LKPDI  PGV ILAAWP +  +     KS   +N+ISGTSM+CPH SGI 
Sbjct  495  RGPSLASPGILKPDIIGPGVSILAAWP-VSVENKTDTKST--FNIISGTSMSCPHLSGIA  551

Query  182  A  184
            A
Sbjct  552  A  552



>ref|XP_009619450.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 40/62 (65%), Gaps = 9/62 (15%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP   + NLLKPDI APGV ILAAWP             P +N++SGTSM+CPH SGI 
Sbjct  502  RGPVENTPNLLKPDITAPGVTILAAWPG---------NKQPMFNILSGTSMSCPHVSGIA  552

Query  182  AT  187
            AT
Sbjct  553  AT  554



>ref|XP_002520491.1| peptidase, putative [Ricinus communis]
 gb|EEF41904.1| peptidase, putative [Ricinus communis]
Length=2072

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+L +++LLKPDI APG++ILAA+P +I   E +       +N++SGTSM+CPH +G+
Sbjct  448  RGPNLIALDLLKPDISAPGIEILAAFPTNIPPTESLHDNRQVKFNIVSGTSMSCPHAAGV  507

Query  179  VA  184
             A
Sbjct  508  AA  509



>ref|XP_004300738.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=745

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+LAS  +LKPDI  PGV++LAAWP  +D +     K+   +N+ISGTSM+CPH SGI
Sbjct  487  RGPNLASPGILKPDIIGPGVNVLAAWPFPLDNN----TKAASTFNIISGTSMSCPHLSGI  542

Query  179  VA  184
             A
Sbjct  543  AA  544



>gb|EYU39036.1| hypothetical protein MIMGU_mgv1a026993mg [Erythranthe guttata]
Length=745

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSLAS  +LKPDI  PGV ILAAWP  +D +          +N+ISGTSM+CPH SGI
Sbjct  486  RGPSLASPGILKPDIIGPGVSILAAWPVSVDNN----TNENATFNMISGTSMSCPHLSGI  541

Query  179  VA  184
             A
Sbjct  542  AA  543



>gb|KDP22364.1| hypothetical protein JCGZ_26195 [Jatropha curcas]
Length=778

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+L S+ +LKPD+ APGV+I+AAW    G   +P  +    +N++SGTSM+CPH SGI
Sbjct  509  RGPNLLSLEILKPDVIAPGVNIIAAWTGDTGPSSLPTDRRRVKFNILSGTSMSCPHVSGI  568

Query  179  VA  184
             A
Sbjct  569  AA  570



>ref|XP_011003069.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=760

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 4/61 (7%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  S N+LKPDI APG +ILAAW   DG     V   P + ++SGTSM+CPH SG+ 
Sbjct  496  RGPSSISRNILKPDIAAPGSNILAAWTASDG----KVTDIPKFKIMSGTSMSCPHVSGMA  551

Query  182  A  184
            A
Sbjct  552  A  552



>ref|XP_002509656.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51043.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=741

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS AS  +LKPDI  PGV+ILAAWP+   + +        +N+ISGTSM+CPH SGI 
Sbjct  482  RGPSQASPGILKPDIIGPGVNILAAWPESTDNSV------NRFNMISGTSMSCPHLSGIA  535

Query  182  A  184
            A
Sbjct  536  A  536



>emb|CDP15554.1| unnamed protein product [Coffea canephora]
Length=797

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+  S+ +LKPDI APGV+ILAAWPD +   E+        +N++SGTSM+CPH SGI
Sbjct  523  RGPNGESIYVLKPDIIAPGVNILAAWPDGVPPTELPTDTRRTNFNIVSGTSMSCPHVSGI  582

Query  179  VA  184
             A
Sbjct  583  AA  584



>ref|XP_003580309.1| PREDICTED: subtilisin-like protease SDD1 [Brachypodium distachyon]
Length=750

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS     +LKPDI  PGV++LAAWP   G    PV   P +N+ISGTSM+ PH SGI 
Sbjct  483  RGPSRQHTGILKPDIAGPGVNVLAAWPFQVGPPSTPVLPGPTFNIISGTSMSTPHLSGIA  542

Query  182  A  184
            A
Sbjct  543  A  543



>ref|XP_006358961.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=745

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS A+  +LKPDI  PGV+ILAAWP    +   P    P +N+ISGTSM+CPH SG+ 
Sbjct  482  RGPSRATPGILKPDIIGPGVNILAAWPTSVENNTEP---KPTFNIISGTSMSCPHLSGVA  538

Query  182  A  184
            A
Sbjct  539  A  539



>gb|EYU39035.1| hypothetical protein MIMGU_mgv1a001882mg [Erythranthe guttata]
Length=745

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 11/65 (17%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG----YNLISGTSMACPHT  169
            RGPS AS  +LKPDI  PGV+ILAAWP+        V +YP     +N+ISGTSM+CPH 
Sbjct  485  RGPSSASPGILKPDIVGPGVNILAAWPE-------SVDNYPNENAIFNIISGTSMSCPHL  537

Query  170  SGIVA  184
            SG+ A
Sbjct  538  SGVAA  542



>ref|XP_007158029.1| hypothetical protein PHAVU_002G118200g [Phaseolus vulgaris]
 gb|ESW30023.1| hypothetical protein PHAVU_002G118200g [Phaseolus vulgaris]
Length=773

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDG-DEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+L    +LKPD+ APGV+ILAAW  + G  E+     +  +N++SGTSM+CPH SGI
Sbjct  496  RGPNLIRPEILKPDLIAPGVNILAAWTGLKGPSELDEDHRHVNFNILSGTSMSCPHVSGI  555

Query  179  VA  184
            +A
Sbjct  556  LA  557



>ref|XP_009398828.1| PREDICTED: subtilisin-like protease SDD1 [Musa acuminata subsp. 
malaccensis]
Length=760

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+  + N+LKPD+ APGV+ILAAWP + G       S P +N+ISGTSMA PH +GIV
Sbjct  495  RGPN--NGNILKPDVLAPGVNILAAWPFMVGPNASATPSNPTFNMISGTSMAAPHVAGIV  552

Query  182  A  184
            A
Sbjct  553  A  553



>ref|XP_004244716.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=767

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSLAS  +LKPDI  PGV+ILAAWP    ++     +   +N+ISGTSM+CPH SG+ 
Sbjct  503  RGPSLASPGILKPDIIGPGVNILAAWPTSVENK---TNTKSTFNIISGTSMSCPHLSGVA  559

Query  182  A  184
            A
Sbjct  560  A  560



>ref|XP_004244591.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=743

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+LAS  +LKPDI  PGV+ILAAWP    +      +   +N+ISGTSM+CPH SG+ 
Sbjct  484  RGPNLASRGILKPDIIGPGVNILAAWPTSMENN---TNTKSTFNIISGTSMSCPHLSGVA  540

Query  182  A  184
            A
Sbjct  541  A  541



>ref|XP_007210332.1| hypothetical protein PRUPE_ppa002068mg [Prunus persica]
 gb|EMJ11531.1| hypothetical protein PRUPE_ppa002068mg [Prunus persica]
Length=721

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 42/65 (65%), Gaps = 11/65 (17%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV----KSYPGYNLISGTSMACPHT  169
            RGPSLAS  +LKPDI  PGV ILAAWP        PV     S   +N+ISGTSM+CPH 
Sbjct  462  RGPSLASPGILKPDIIGPGVSILAAWP-------FPVDNTTNSKVNFNIISGTSMSCPHL  514

Query  170  SGIVA  184
            SGI A
Sbjct  515  SGIAA  519



>ref|NP_001159342.1| putative subtilase family protein precursor [Zea mays]
 gb|ACN25842.1| unknown [Zea mays]
 tpg|DAA63306.1| TPA: putative subtilase family protein [Zea mays]
Length=783

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 7/65 (11%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG----YNLISGTSMACPHT  169
            RGP+L ++ LLKPD+ APGV+ILAAW    GD  +   S  G    YN+ISGTSM+CPH 
Sbjct  504  RGPNLVALELLKPDVVAPGVNILAAW---SGDASVSGYSDDGRRADYNIISGTSMSCPHV  560

Query  170  SGIVA  184
            +GI A
Sbjct  561  AGIAA  565



>ref|XP_009608768.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=745

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS AS  +LKPDI  PGV++LAAWP  +D ++     +   +N+ISGTSM+CPH SGI
Sbjct  484  RGPSEASRGILKPDIIGPGVNVLAAWPTSVDNNK----NTKSTFNIISGTSMSCPHLSGI  539

Query  179  VA  184
             A
Sbjct  540  AA  541



>gb|KDP41714.1| hypothetical protein JCGZ_16121 [Jatropha curcas]
Length=724

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKS-YPGYNLISGTSMACPHTSGI  178
            RGP L+S  ++KPDI APG  ILAAWP+    E I  +  +  +NL SGTSMACPH +GI
Sbjct  443  RGPFLSSPTVMKPDIMAPGSLILAAWPETSAVESINAEGIFSNFNLESGTSMACPHAAGI  502

Query  179  VA  184
             A
Sbjct  503  AA  504



>gb|ABD64827.1| putative subtilisin serine protease of stomatal density and distribution 
[Isatis tinctoria]
Length=778

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSLA+ ++LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSM+CPH SGI
Sbjct  505  RGPSLANPSILKPDMIAPGVNIIAAWPQNLGPTGLPYDSRRVNFTVMSGTSMSCPHVSGI  564

Query  179  VA  184
             A
Sbjct  565  TA  566



>ref|XP_009762965.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana sylvestris]
Length=744

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS AS  +LKPDI  PGV++LAAWP  +D ++     +   +N+ISGTSM+CPH SGI
Sbjct  483  RGPSEASRGILKPDIIGPGVNVLAAWPTSVDNNK----NTKSTFNIISGTSMSCPHLSGI  538

Query  179  VA  184
             A
Sbjct  539  AA  540



>ref|XP_008784364.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=798

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   IP  +    +N++SGTSMACPH SG+
Sbjct  520  RGPNPQSPEILKPDLIAPGLNILAAWPDSVGPAGIPSDRRRTEFNILSGTSMACPHVSGL  579

Query  179  VA  184
             A
Sbjct  580  AA  581



>ref|XP_006358408.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS+AS  +LKPDI  PGV+ILAAWP    +      +   +N+ISGTSM+CPH SG+ 
Sbjct  483  RGPSIASRGILKPDIIGPGVNILAAWPTSMENN---TNTKSTFNIISGTSMSCPHLSGVA  539

Query  182  A  184
            A
Sbjct  540  A  540



>ref|XP_008437181.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=745

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSLAS  +LKPDI  PGV ILAAWP    D     KS   +N+ISGTSM+CPH SGI 
Sbjct  486  RGPSLASPGILKPDITGPGVSILAAWP-FPLDNNTNTKST--FNIISGTSMSCPHLSGIA  542

Query  182  A  184
            A
Sbjct  543  A  543



>ref|NP_001234288.1| SBT2 protein precursor [Solanum lycopersicum]
 emb|CAA67430.1| SBT2 [Solanum lycopersicum]
 emb|CAA07000.1| subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S+ +LKPD+ APGV+ILA W    G   +P+ +    +N++SGTSM+CPH SGI
Sbjct  506  RGPNFLSLEILKPDMVAPGVNILAGWTGALGPSSLPIDQRRTNFNILSGTSMSCPHVSGI  565

Query  179  VA  184
             A
Sbjct  566  AA  567



>ref|XP_006418166.1| hypothetical protein EUTSA_v10006861mg [Eutrema salsugineum]
 gb|ESQ36519.1| hypothetical protein EUTSA_v10006861mg [Eutrema salsugineum]
Length=778

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSLA+ ++LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSM+CPH SGI
Sbjct  505  RGPSLANPSILKPDMIAPGVNIIAAWPQNLGPTGLPYDSRRVNFTVMSGTSMSCPHVSGI  564

Query  179  VA  184
             A
Sbjct  565  TA  566



>ref|XP_008810058.1| PREDICTED: subtilisin-like protease SDD1 [Phoenix dactylifera]
Length=771

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSL + ++LKPDI APGV+I+AAWP ++    +   +    ++++SGTSMACPH SGI
Sbjct  502  RGPSLTNPSILKPDIIAPGVNIIAAWPANLGPSALQEDRRRSNFSVLSGTSMACPHVSGI  561

Query  179  VA  184
            VA
Sbjct  562  VA  563



>ref|XP_010271749.1| PREDICTED: subtilisin-like protease SBT5.3 [Nelumbo nucifera]
Length=795

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+  + +++KPDI APGV ILAAWP I  DE     +   YN+ISGTSMACPH SG+
Sbjct  529  RGPNTITPDIIKPDITAPGVQILAAWPSISIDETGGRST--DYNIISGTSMACPHVSGV  585



>ref|XP_010240233.1| PREDICTED: subtilisin-like protease SDD1 [Brachypodium distachyon]
Length=749

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSL    +LKPDI  PGV++LAAWP        PV   P +N+ISGTSM+ PH SGI 
Sbjct  483  RGPSLQHTGILKPDITGPGVNVLAAWPFQVAPPSTPVLPGPTFNIISGTSMSTPHLSGIA  542

Query  182  A  184
            A
Sbjct  543  A  543



>ref|XP_006398246.1| hypothetical protein EUTSA_v10000784mg [Eutrema salsugineum]
 gb|ESQ39699.1| hypothetical protein EUTSA_v10000784mg [Eutrema salsugineum]
Length=792

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPSL   N+LKPDI APG++ILAAW   D    + + +    YN+ +GTSM+CPH SG 
Sbjct  529  RGPSLIDANILKPDITAPGLNILAAWSGADSPSKVSLDQRVAAYNIYTGTSMSCPHVSGA  588

Query  179  VA  184
            +A
Sbjct  589  IA  590



>ref|XP_002892197.1| hypothetical protein ARALYDRAFT_470387 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68456.1| hypothetical protein ARALYDRAFT_470387 [Arabidopsis lyrata subsp. 
lyrata]
Length=778

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSLA+ ++LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSM+CPH SGI
Sbjct  505  RGPSLANPSILKPDMIAPGVNIIAAWPQNLGPTGLPYDSRRVNFTVMSGTSMSCPHVSGI  564

Query  179  VA  184
             A
Sbjct  565  TA  566



>gb|KHN01461.1| Subtilisin-like protease [Glycine soja]
Length=346

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVK-SYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   +P       +N++SGTSMACPH SG+
Sbjct  69   RGPNPESPEILKPDVIAPGLNILAAWPDHVGPSGVPSDGRRTEFNILSGTSMACPHVSGL  128

Query  179  VA  184
             A
Sbjct  129  AA  130



>ref|XP_006606084.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  ++ +LKPD+ APGV+ILAAW +  G   +P       +N++SGTSM+CPH SGI
Sbjct  512  RGPNFLTLEILKPDVVAPGVNILAAWSEAIGPSSLPTDHRRVKFNILSGTSMSCPHVSGI  571

Query  179  VA  184
             A
Sbjct  572  AA  573



>tpg|DAA37770.1| TPA: putative subtilase family protein, partial [Zea mays]
Length=439

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP L S  +LKPDI APGVDILAAW P+ +  E+   K Y  Y L+SGTSM+ PH +G+
Sbjct  250  RGPGLISPTILKPDIVAPGVDILAAWVPNKEIMELGRQKLYTKYALVSGTSMSSPHAAGV  309

Query  179  VA  184
             A
Sbjct  310  AA  311



>ref|XP_004245677.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=749

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS AS  +LKPDI  PGV+ILAAWP  +D D+     +   +N+ISGTSM+CPH SG+
Sbjct  486  RGPSRASPGILKPDIIGPGVNILAAWPTPVDDDK----NTKSTFNIISGTSMSCPHLSGV  541

Query  179  VA  184
             A
Sbjct  542  AA  543



>ref|XP_006304967.1| hypothetical protein CARUB_v10012040mg [Capsella rubella]
 gb|EOA37865.1| hypothetical protein CARUB_v10012040mg [Capsella rubella]
Length=779

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSLA+ ++LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSM+CPH SGI
Sbjct  505  RGPSLANPSILKPDMIAPGVNIIAAWPQNLGPTGLPYDSRRVNFTVMSGTSMSCPHVSGI  564

Query  179  VA  184
             A
Sbjct  565  TA  566



>ref|NP_563701.1| subtilisin-like protease SDD1 [Arabidopsis thaliana]
 sp|O64495.1|SDD1_ARATH RecName: Full=Subtilisin-like protease SDD1; AltName: Full=Cucumisin-like 
serine protease SDD1; AltName: Full=Protein STOMATAL 
DENSITY AND DISTRIBUTION 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC16749.1| Strong similarity to protein SBT1 gb|X98929 from Lycopersicum 
esculentum [Arabidopsis thaliana]
 gb|AEE27657.1| Subtilase-like protein [Arabidopsis thaliana]
Length=775

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSLA+ ++LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSM+CPH SGI
Sbjct  502  RGPSLANPSILKPDMIAPGVNIIAAWPQNLGPTGLPYDSRRVNFTVMSGTSMSCPHVSGI  561

Query  179  VA  184
             A
Sbjct  562  TA  563



>ref|XP_007162604.1| hypothetical protein PHAVU_001G165300g, partial [Phaseolus vulgaris]
 gb|ESW34598.1| hypothetical protein PHAVU_001G165300g, partial [Phaseolus vulgaris]
Length=1214

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
             RGPS  + ++LKPD+ APGV+I+AAWP   G   +P  S    ++++SGTSMACPH SGI
Sbjct  940   RGPSYTNPSILKPDVIAPGVNIIAAWPQNLGPTGLPEDSRRVNFSVMSGTSMACPHVSGI  999

Query  179   VA  184
              A
Sbjct  1000  AA  1001



>ref|XP_007208984.1| hypothetical protein PRUPE_ppb022951mg [Prunus persica]
 gb|EMJ10183.1| hypothetical protein PRUPE_ppb022951mg [Prunus persica]
Length=645

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP++AS  +LKPDI  PG+DILAAWP  +D        S   +N+ISGTSM+CPH SGI
Sbjct  376  RGPNIASPGILKPDIIGPGIDILAAWPYSVDN-----ATSKATFNIISGTSMSCPHLSGI  430

Query  179  VA  184
             A
Sbjct  431  AA  432



>ref|XP_009628999.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=788

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  +  +LKPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  512  RGPNPETPEILKPDVIAPGLNILAAWPDGVGPSGIPSDKRRTEFNILSGTSMACPHVSGL  571

Query  179  VA  184
             A
Sbjct  572  AA  573



>ref|XP_004244590.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=738

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS+AS  +LKPDI  PGV+ILAAWP    +      +   +N+ISGTSM+CPH SG+ 
Sbjct  480  RGPSIASRGILKPDIIGPGVNILAAWPTSMENN---TNTKSTFNIISGTSMSCPHLSGVA  536

Query  182  A  184
            A
Sbjct  537  A  537



>emb|CDX75757.1| BnaC03g38400D [Brassica napus]
Length=403

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   +P       +N++SGTSMACPH SG+
Sbjct  127  RGPNPESPEILKPDVIAPGLNILAAWPDRIGPSGVPSDNRRTEFNILSGTSMACPHVSGL  186

Query  179  VA  184
             A
Sbjct  187  AA  188



>ref|XP_004300734.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=765

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSLAS  +LKPDI  PGV ILAAWP  +D        S   +N+ISGTSM+CPH SGI
Sbjct  500  RGPSLASPAILKPDIIGPGVSILAAWPFSVDN----ATDSKATFNIISGTSMSCPHLSGI  555

Query  179  VA  184
             A
Sbjct  556  AA  557



>ref|XP_003536496.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN02773.1| Subtilisin-like protease [Glycine soja]
Length=782

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  ++ +LKPD+ APGV+ILAAW +  G   +P       +N++SGTSM+CPH SGI
Sbjct  513  RGPNFLTLEILKPDVVAPGVNILAAWSEAIGPSSLPTDHRRVKFNILSGTSMSCPHVSGI  572

Query  179  VA  184
             A
Sbjct  573  AA  574



>ref|XP_003579757.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=775

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPDI APGVDILAAW P+ +  EI   + +  Y L+SGTSM+ PH +G+
Sbjct  501  RGPSQQSPGVLKPDIVAPGVDILAAWVPNKEVMEIGRQRLFAKYMLVSGTSMSSPHIAGV  560

Query  179  VA  184
            VA
Sbjct  561  VA  562



>emb|CDY18206.1| BnaC05g02290D [Brassica napus]
Length=777

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSLA+ ++LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSM+CPH SGI
Sbjct  502  RGPSLANPSVLKPDLIAPGVNIIAAWPQNLGPTGLPYDSRRVNFTVMSGTSMSCPHVSGI  561

Query  179  VA  184
             A
Sbjct  562  TA  563



>ref|XP_009373327.1| PREDICTED: subtilisin-like protease SDD1 [Pyrus x bretschneideri]
Length=637

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSL+S  +LKPDI  PGV+ILAAWP+   +  +P      +N+ISGTSMA PH SGI 
Sbjct  367  RGPSLSSPGILKPDIIGPGVEILAAWPESVDNATLP-NPKATFNIISGTSMATPHLSGIA  425

Query  182  A  184
            A
Sbjct  426  A  426



>ref|NP_001234257.1| subtilisin-like endoprotease precursor [Solanum lycopersicum]
 emb|CAA64566.1| subtilisin-like endoprotease [Solanum lycopersicum]
 emb|CAA76724.1| P69A protein [Solanum lycopersicum]
Length=745

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS AS+ +LKPDI  PGV+ILAAWP  +D ++     +   +N+ISGTSM+CPH SG+
Sbjct  486  RGPSGASIGILKPDIIGPGVNILAAWPTSVDDNK----NTKSTFNIISGTSMSCPHLSGV  541

Query  179  VA  184
             A
Sbjct  542  RA  543



>ref|XP_003570499.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=780

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDG-DEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP++ +  +LKPD+ APGVDILAAW   +   E+   K    +N+ISGTSM+CPH SGI
Sbjct  500  RGPNIHAPEILKPDVTAPGVDILAAWTGANSPTELESDKRRVKFNIISGTSMSCPHVSGI  559

Query  179  VA  184
             A
Sbjct  560  AA  561



>ref|XP_008381959.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=1289

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS+AS  +LKPDI  PGVDILAAWP+   +  +P      +N+ISGTSMA PH SGI 
Sbjct  299  RGPSIASPGILKPDIIGPGVDILAAWPESVDNATLP-NPKATFNIISGTSMATPHLSGIG  357

Query  182  A  184
            A
Sbjct  358  A  358


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  2     RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
             RGP++AS  +LKPD+  PGV ILAAWP  + D +        +N+ISGTSMACPH SGI 
Sbjct  1021  RGPNIASPGILKPDVIGPGVSILAAWP-YNVDNVTHPNPKALFNIISGTSMACPHLSGIA  1079

Query  182   A  184
             A
Sbjct  1080  A  1080



>ref|XP_008238738.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=770

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+AS  +LKPDI  PGV ILAAWP  +D       +    +N++SGTSM+CPH SGI
Sbjct  503  RGPSIASTGILKPDIIGPGVSILAAWPVSVDNG----TEGKATFNMVSGTSMSCPHLSGI  558

Query  179  VA  184
             A
Sbjct  559  AA  560



>ref|XP_008447369.1| PREDICTED: subtilisin-like protease SDD1 [Cucumis melo]
Length=768

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKS-YPGYNLISGTSMACPHTSGI  178
            RGPSL++ + LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSMACPH SGI
Sbjct  497  RGPSLSNPSTLKPDVIAPGVNIIAAWPQNLGPTSLPEDSRRSNFTVMSGTSMACPHVSGI  556

Query  179  VA  184
             A
Sbjct  557  TA  558



>emb|CDX89843.1| BnaA10g02390D [Brassica napus]
Length=778

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSLA+ ++LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSM+CPH SGI
Sbjct  503  RGPSLANPSVLKPDLIAPGVNIIAAWPQNLGPTGLPYDSRRVNFTVMSGTSMSCPHVSGI  562

Query  179  VA  184
             A
Sbjct  563  TA  564



>ref|XP_007208895.1| hypothetical protein PRUPE_ppa026788mg [Prunus persica]
 gb|EMJ10094.1| hypothetical protein PRUPE_ppa026788mg [Prunus persica]
Length=770

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+AS  +LKPDI  PGV ILAAWP  +D       +    +N++SGTSM+CPH SGI
Sbjct  503  RGPSIASTGILKPDIIGPGVSILAAWPVSVDNG----TEGKATFNMVSGTSMSCPHLSGI  558

Query  179  VA  184
             A
Sbjct  559  AA  560



>ref|XP_009762964.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana sylvestris]
Length=744

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+AS  +LKPDI  PGV+ILAAWP  +D ++     +   +N+ISGTSM+CPH SGI
Sbjct  484  RGPSVASPGILKPDIIGPGVNILAAWPTSLDDNK----NTKSTFNIISGTSMSCPHLSGI  539

Query  179  VA  184
             A
Sbjct  540  AA  541



>ref|XP_008378050.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=660

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+L S+++LKPD+ APGV+I+AAW    G   +P  +    +N++SGTSM+CPH SGI
Sbjct  391  RGPNLVSLDILKPDMVAPGVNIIAAWTGGLGPSSLPADRRRVKFNILSGTSMSCPHVSGI  450

Query  179  VA  184
             A
Sbjct  451  AA  452



>ref|XP_011072681.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=792

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  +  +LKPD+ APG++ILAAWPD  G   IP  K    +N++SGTSMACPH SG+
Sbjct  516  RGPNPETPEILKPDLIAPGLNILAAWPDNVGPSGIPSDKRRTEFNILSGTSMACPHVSGL  575

Query  179  VA  184
             A
Sbjct  576  AA  577



>ref|XP_009119332.1| PREDICTED: subtilisin-like protease SDD1 [Brassica rapa]
Length=778

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSLA+ ++LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSM+CPH SGI
Sbjct  503  RGPSLANPSVLKPDLIAPGVNIIAAWPQNLGPTGLPYDSRRVNFTVMSGTSMSCPHVSGI  562

Query  179  VA  184
             A
Sbjct  563  TA  564



>ref|XP_010229422.1| PREDICTED: CO(2)-response secreted protease-like [Brachypodium 
distachyon]
Length=521

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 15/69 (22%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPG-------YNLISGTSMAC  160
            RGPS  + N+LKPD+ APGV+ILAAW        IP  S P        +NLISGTSM+C
Sbjct  254  RGPSSQTGNILKPDVAAPGVNILAAW--------IPTSSLPSGQKQPSQFNLISGTSMSC  305

Query  161  PHTSGIVAT  187
            PH +G  AT
Sbjct  306  PHVAGAAAT  314



>gb|KHN15704.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGP+  ++ +LKPD+ APGV+ILAAW +  G   +P       +N++SGTSM+CPH SGI
Sbjct  472  RGPNFLTLEILKPDVVAPGVNILAAWSEAIGPSSLPTDHRRVKFNILSGTSMSCPHVSGI  531

Query  179  VA  184
             A
Sbjct  532  AA  533



>ref|XP_009776158.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=744

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+AS  +LKPDI  PGV+ILAAWP  ++ +      S   +N+ISGTSM+CPH SG+
Sbjct  485  RGPSMASPGILKPDIIGPGVNILAAWPASVENN----TNSKSTFNIISGTSMSCPHLSGV  540

Query  179  VA  184
             A
Sbjct  541  AA  542



>ref|XP_011079622.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=793

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+ S  +LKPDI APGV+ILAAWPD +   E+        +N+ SGTSM+CPH SG+
Sbjct  520  RGPSIESPYVLKPDIIAPGVNILAAWPDGVAPSELSSDTRRTEFNVASGTSMSCPHVSGV  579

Query  179  VA  184
             A
Sbjct  580  AA  581



>ref|XP_002325705.1| hypothetical protein POPTR_0019s00970g [Populus trichocarpa]
 gb|EEF00087.1| hypothetical protein POPTR_0019s00970g [Populus trichocarpa]
Length=697

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 44/64 (69%), Gaps = 9/64 (14%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP---DIDGDEIIPVKSYPGYNLISGTSMACPHTS  172
            RGPSLAS  +LKPDI  PGVDILAAWP   D +G+      +   +N+ISGTSMA PH +
Sbjct  439  RGPSLASPGILKPDIIGPGVDILAAWPYAVDNNGN------TKSAFNMISGTSMATPHLT  492

Query  173  GIVA  184
            GI A
Sbjct  493  GIAA  496



>ref|XP_004954114.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=782

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 43/67 (64%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW------PDIDGDEIIPVKSYPGYNLISGTSMACP  163
            RGP+L +  +LKPDI APGVDILAAW        +D D     K    YN+ISGTSM+CP
Sbjct  505  RGPNLHAPEILKPDITAPGVDILAAWTGKKSPSSLDSD-----KRRVKYNIISGTSMSCP  559

Query  164  HTSGIVA  184
            H SGI A
Sbjct  560  HVSGIAA  566



>ref|XP_007152373.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
 gb|ESW24367.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
Length=781

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S+ +LKPD+ APGV+ILAAW +  G   + V      +N++SGTSM+CPH SGI
Sbjct  508  RGPNFLSLEILKPDLVAPGVNILAAWSEAIGPSGLKVDNRREKFNILSGTSMSCPHVSGI  567

Query  179  VA  184
             A
Sbjct  568  AA  569



>ref|XP_010652423.1| PREDICTED: subtilisin-like protease SDD1 [Vitis vinifera]
Length=766

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSL +  +LKPDI APGV+I+AAWP   G   +P  S    + ++SGTSMACPH SGI
Sbjct  495  RGPSLTNPTILKPDIIAPGVNIIAAWPQNLGPSGLPEDSRRVNFTVMSGTSMACPHISGI  554

Query  179  VA  184
             A
Sbjct  555  AA  556



>gb|KCW77656.1| hypothetical protein EUGRSUZ_D01954 [Eucalyptus grandis]
Length=679

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSL S  +LKPDI  PGV ILAAWP  +D      V     +N+ISGTSM+CPH SGI
Sbjct  419  RGPSLESPGILKPDIIGPGVSILAAWPFSLDNSSTTEVT----FNIISGTSMSCPHLSGI  474

Query  179  VA  184
             A
Sbjct  475  AA  476



>gb|EMT11726.1| Subtilisin-like protease [Aegilops tauschii]
Length=781

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDG-DEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+  +  +LKPD+ APGVDILAAW   +   E+        YN+ISGTSM+CPH SGI
Sbjct  505  RGPNFRAPEILKPDVTAPGVDILAAWTGANSPSELDFDTRRVKYNIISGTSMSCPHVSGI  564

Query  179  VA  184
            VA
Sbjct  565  VA  566



>ref|XP_008234331.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=841

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S+ +LKPD+ APGV+ILAAW    G   +P       +N++SGTSM+CPH SGI
Sbjct  572  RGPNFVSLEILKPDVVAPGVNILAAWTGALGPSSLPTDHRRVKFNILSGTSMSCPHVSGI  631

Query  179  VA  184
             A
Sbjct  632  AA  633



>ref|XP_007219861.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
 gb|EMJ21060.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
Length=780

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGP+  S+ +LKPD+ APGV+ILAAW    G   +P       +N++SGTSM+CPH SGI
Sbjct  511  RGPNFVSLEILKPDVVAPGVNILAAWTGALGPSSLPTDHRRVKFNILSGTSMSCPHVSGI  570

Query  179  VA  184
             A
Sbjct  571  AA  572



>ref|XP_011091250.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=775

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+   +++KPDI APGV+ILAAW P+I   E+   +    +N++SGTSM+CPH SG+
Sbjct  503  RGPSVIGPDIIKPDITAPGVNILAAWPPNISPSELKSDRRRVRFNIVSGTSMSCPHISGL  562

Query  179  VA  184
             A
Sbjct  563  AA  564



>ref|XP_004229864.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326049.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326050.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=764

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS A  +++KPD+ APGVDILAAW P+I    +   K    +N++SGTSM+CPH SG+
Sbjct  494  RGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVQFNILSGTSMSCPHVSGL  553

Query  179  VA  184
             A
Sbjct  554  AA  555



>ref|XP_004500923.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  S N+LKPDI APGV ILAAW   D  E+   +    + ++SGTSM+CPH SG+ 
Sbjct  502  RGPSYLSKNILKPDIAAPGVGILAAWFGNDTSEVPKGQKPSPFKIVSGTSMSCPHVSGLA  561

Query  182  AT  187
            A+
Sbjct  562  AS  563



>gb|KDP25552.1| hypothetical protein JCGZ_20708 [Jatropha curcas]
Length=758

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSLAS  +LKPDI  PGV ILAAWP +  +     K+   +N+ISGTSM+CPH SGI 
Sbjct  497  RGPSLASPGILKPDIIGPGVSILAAWP-VSVENKTNTKAT--FNMISGTSMSCPHLSGIA  553

Query  182  A  184
            A
Sbjct  554  A  554



>ref|XP_009613725.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  ++ +LKPD+ APGV+ILAAW    G   +P  +    +N++SGTSM+CPH SGI
Sbjct  502  RGPNFLTLEILKPDMVAPGVNILAAWTGALGPSSLPTDQRRTNFNILSGTSMSCPHVSGI  561

Query  179  VA  184
             A
Sbjct  562  AA  563



>emb|CAA76727.1| P69D protein [Solanum lycopersicum]
Length=747

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+AS  +LKPDI  PGV++LAAWP  +D ++     +   +N++SGTSM+CPH SG+
Sbjct  486  RGPSVASPGILKPDIIGPGVNVLAAWPTSVDNNK----NTKSTFNIVSGTSMSCPHLSGV  541

Query  179  VA  184
             A
Sbjct  542  AA  543



>gb|KHG02130.1| Subtilisin-like protease [Gossypium arboreum]
 gb|KHG03377.1| Subtilisin-like protease [Gossypium arboreum]
Length=775

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP+L   +++KPDI APGVDILAAWP +     +   K    +N+ISGTSM+CPH SGI
Sbjct  506  RGPNLVGPDVIKPDITAPGVDILAAWPAETSPSRLKSDKRRVLFNIISGTSMSCPHVSGI  565

Query  179  VA  184
             A
Sbjct  566  AA  567



>ref|XP_006358372.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=734

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS+AS  +LKPDI  PGV+ILAAWP    +      +   +N+ISGTSM+CPH SG+ 
Sbjct  476  RGPSIASRGILKPDIIGPGVNILAAWPTSMENS---TNTKSTFNIISGTSMSCPHLSGVA  532

Query  182  A  184
            A
Sbjct  533  A  533



>ref|XP_004245680.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 emb|CAA06414.1| P69F protein [Solanum lycopersicum]
Length=747

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+AS  +LKPDI  PGV++LAAWP  +D ++     +   +N++SGTSM+CPH SG+
Sbjct  486  RGPSVASPGILKPDIIGPGVNVLAAWPTSVDNNK----NTKSTFNIVSGTSMSCPHLSGV  541

Query  179  VA  184
             A
Sbjct  542  AA  543



>ref|XP_010053378.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=752

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSL S  +LKPDI  PGV ILAAWP  +D      V     +N+ISGTSM+CPH SGI
Sbjct  492  RGPSLESPGILKPDIIGPGVSILAAWPFSLDNSSTTEVT----FNIISGTSMSCPHLSGI  547

Query  179  VA  184
             A
Sbjct  548  AA  549



>ref|XP_002318860.1| hypothetical protein POPTR_0012s14140g [Populus trichocarpa]
 gb|EEE97080.1| hypothetical protein POPTR_0012s14140g [Populus trichocarpa]
Length=778

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+L ++ +LKPDI APGV+ILAAW    G   +P       +N++SGTSM+CPH SGI
Sbjct  508  RGPNLLTLEILKPDIVAPGVNILAAWTGDLGPSSLPTDHRRSKFNILSGTSMSCPHVSGI  567

Query  179  VA  184
             A
Sbjct  568  AA  569



>ref|XP_009611962.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 ref|XP_009611971.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=767

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS A  +++KPD+ APGVDILAAW P+I    +   K    +N++SGTSM+CPH SG+
Sbjct  497  RGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVQFNILSGTSMSCPHVSGL  556

Query  179  VA  184
             A
Sbjct  557  AA  558



>ref|XP_004147596.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
 ref|XP_004164315.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
 gb|KGN50165.1| hypothetical protein Csa_5G157240 [Cucumis sativus]
Length=745

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPSLAS  +LKPDI  PGV ILAAWP    D     KS   +N++SGTSM+CPH SGI 
Sbjct  486  RGPSLASPGILKPDITGPGVSILAAWP-FPLDNNTNTKST--FNIVSGTSMSCPHLSGIA  542

Query  182  A  184
            A
Sbjct  543  A  543



>ref|XP_002962719.1| hypothetical protein SELMODRAFT_61337, partial [Selaginella moellendorffii]
 gb|EFJ36182.1| hypothetical protein SELMODRAFT_61337, partial [Selaginella moellendorffii]
Length=718

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 8/67 (12%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDI------DGDEIIPVKSYPGYNLISGTSMACP  163
            RGP+  S +++KPDI APGV+ILAAWPDI      + D   PV  +  YN  SGTSMACP
Sbjct  454  RGPNSISEDIIKPDITAPGVNILAAWPDIVPAYYENYDTNKPV--FVKYNFASGTSMACP  511

Query  164  HTSGIVA  184
            H +G +A
Sbjct  512  HVAGALA  518



>ref|XP_002991821.1| hypothetical protein SELMODRAFT_134229 [Selaginella moellendorffii]
 gb|EFJ07083.1| hypothetical protein SELMODRAFT_134229 [Selaginella moellendorffii]
Length=784

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 8/67 (12%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDI------DGDEIIPVKSYPGYNLISGTSMACP  163
            RGP+  S +++KPD+ APGV+ILAAW DI      + D   PV  Y  YN+ISGTSM+CP
Sbjct  529  RGPNSISQDIIKPDVTAPGVNILAAWSDIAPAYYENYDTAKPV--YVKYNIISGTSMSCP  586

Query  164  HTSGIVA  184
            H +G +A
Sbjct  587  HVTGALA  593



>ref|XP_008802988.1| PREDICTED: subtilisin-like protease SDD1 [Phoenix dactylifera]
Length=762

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP++A  N+LKPDI  PGV++LAAWP     E+ P  +   +N+ISGTSMA PH SGI 
Sbjct  501  RGPNMADRNILKPDIVGPGVNVLAAWP----IEVGPPGATSMFNIISGTSMATPHLSGIA  556

Query  182  A  184
            A
Sbjct  557  A  557



>ref|XP_004510560.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=789

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKS-YPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   +P  +    +N++SGTSMACPH SG+
Sbjct  512  RGPNPESPEILKPDVIAPGLNILAAWPDRVGPSSVPSDTRRTEFNILSGTSMACPHVSGL  571

Query  179  VA  184
             A
Sbjct  572  AA  573



>ref|XP_009397604.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=776

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS  +  +LKPD+ APGV+ILAAW P  D  ++ P +    + L+SGTSM+CPH +G+
Sbjct  508  RGPSTEASGILKPDVAAPGVNILAAWIPGEDSSDVPPGQKPSPFKLVSGTSMSCPHVAGV  567

Query  179  VAT  187
             AT
Sbjct  568  AAT  570



>ref|XP_006358145.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=647

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP   S  +LKPDI  PGV+ILAAWP   G+ II   S   +N+ISGTSMACPH +G+ 
Sbjct  386  RGPFSPSPGILKPDISGPGVNILAAWPTSVGEMIISATS-STFNIISGTSMACPHLAGVA  444

Query  182  A  184
            A
Sbjct  445  A  445



>gb|KDP26457.1| hypothetical protein JCGZ_17615 [Jatropha curcas]
Length=693

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSL + ++LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSMACPH SGI
Sbjct  421  RGPSLTNPSILKPDVIAPGVNIIAAWPQNLGPTGLPEDSRRVNFTVMSGTSMACPHVSGI  480

Query  179  VA  184
             A
Sbjct  481  AA  482



>ref|XP_009789180.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=779

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  ++ +LKPD+ APGV+ILAAW    G   +P  +    +N++SGTSM+CPH SGI
Sbjct  510  RGPNFLTLEILKPDMVAPGVNILAAWTGALGPSSLPTDQRRTNFNILSGTSMSCPHVSGI  569

Query  179  VA  184
             A
Sbjct  570  AA  571



>ref|XP_009781099.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=932

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGP+ AS  +LKPDI  PGV+ILAAW  I  +  I   SY  +N+ISGTSM+CPH SG+ 
Sbjct  669  RGPNFASPGILKPDIIGPGVNILAAW-HISLENNINTNSY--FNMISGTSMSCPHLSGVA  725

Query  182  A  184
            A
Sbjct  726  A  726



>ref|XP_006369092.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65661.1| subtilase family protein [Populus trichocarpa]
Length=773

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   IP       +N++SGTSMACPH SG+
Sbjct  497  RGPNPESPEILKPDVIAPGLNILAAWPDKVGPSGIPSDQRKIEFNILSGTSMACPHVSGL  556

Query  179  VA  184
             A
Sbjct  557  AA  558



>ref|XP_006339499.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS A  +++KPD+ APGVDILAAW P+I    +   K    +N++SGTSM+CPH SG+
Sbjct  495  RGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVQFNILSGTSMSCPHVSGL  554

Query  179  VA  184
             A
Sbjct  555  AA  556



>ref|XP_006363698.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=747

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS+AS  +LKPDI  PGV++LAAWP  +D ++     +   +N+ISGTSM+CPH SG+
Sbjct  486  RGPSVASPGILKPDIIGPGVNVLAAWPTSVDDNK----NTKSTFNIISGTSMSCPHLSGV  541

Query  179  VA  184
             A
Sbjct  542  AA  543



>ref|XP_002980373.1| hypothetical protein SELMODRAFT_112475, partial [Selaginella 
moellendorffii]
 gb|EFJ18633.1| hypothetical protein SELMODRAFT_112475, partial [Selaginella 
moellendorffii]
Length=678

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 8/67 (12%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDI------DGDEIIPVKSYPGYNLISGTSMACP  163
            RGP+  S +++KPDI APGV+ILAAWPDI      + D   PV  +  YN  SGTSMACP
Sbjct  416  RGPNSISEDIIKPDITAPGVNILAAWPDIVPAYYENYDTNKPV--FVKYNFASGTSMACP  473

Query  164  HTSGIVA  184
            H +G +A
Sbjct  474  HVAGALA  480



>ref|XP_008797372.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=796

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   IP  +    +N++SGTSMACPH SG+
Sbjct  516  RGPNPQSPEILKPDLIAPGLNILAAWPDGVGPAGIPSDRRRTEFNILSGTSMACPHVSGL  575

Query  179  VA  184
             A
Sbjct  576  AA  577



>ref|XP_011048615.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   IP       +N++SGTSMACPH SG+
Sbjct  497  RGPNPESPEILKPDVIAPGLNILAAWPDKVGPSGIPSDQRKIEFNILSGTSMACPHVSGL  556

Query  179  VA  184
             A
Sbjct  557  AA  558



>ref|XP_009351462.1| PREDICTED: cucumisin-like, partial [Pyrus x bretschneideri]
Length=460

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 11/67 (16%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDI------DGDEIIPVKSYPGYNLISGTSMACP  163
            RGP+  + N+LKPDI +PGV ILAAWP I      +GD+ +       YN+ISGTSMACP
Sbjct  203  RGPNPNTPNILKPDIASPGVSILAAWPPITPVSGVEGDDRV-----ASYNIISGTSMACP  257

Query  164  HTSGIVA  184
            H +G+ A
Sbjct  258  HAAGVAA  264



>ref|XP_006826300.1| hypothetical protein AMTR_s00004p00071240 [Amborella trichopoda]
 gb|ERM93537.1| hypothetical protein AMTR_s00004p00071240 [Amborella trichopoda]
Length=796

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S  +LKPD+  PGV+ILAAWP I     +P+ +    +NL+SGTSMACPH +GI
Sbjct  492  RGPSSLSPAILKPDLSGPGVNILAAWPPILPPSSVPIDRRIVNWNLLSGTSMACPHVAGI  551

Query  179  VA  184
            VA
Sbjct  552  VA  553



>ref|XP_002303548.2| hypothetical protein POPTR_0003s11840g [Populus trichocarpa]
 gb|EEE78527.2| hypothetical protein POPTR_0003s11840g [Populus trichocarpa]
Length=749

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPD-IDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPSLAS  +LKPDI  PGV ILAAW   +D      + + PG+N+ISGTSMA PH SGI
Sbjct  491  RGPSLASPGILKPDILGPGVRILAAWLHPVDNR----LNTTPGFNVISGTSMATPHLSGI  546

Query  179  VA  184
             A
Sbjct  547  AA  548



>ref|XP_010050438.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79388.1| hypothetical protein EUGRSUZ_C00800 [Eucalyptus grandis]
Length=759

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP   SV +LKPD+  PGV+ILA+WP       +P  K    +N+ISGTSM+CPH SG+
Sbjct  490  RGPYFQSVQILKPDVIGPGVNILASWPAYVSPTELPTDKRSVQFNIISGTSMSCPHVSGV  549

Query  179  VA  184
             A
Sbjct  550  AA  551



>ref|XP_006363699.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=742

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  S  +LKPDI  PGV+ILAAWP    D      +   +N+ISGTSMACPH SG+ 
Sbjct  483  RGPSRVSPGILKPDIIGPGVNILAAWPTFVDDN---KNTKSTFNIISGTSMACPHLSGVA  539

Query  182  A  184
            A
Sbjct  540  A  540



>ref|XP_002509668.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51055.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=758

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS AS  +LKPDI  PGV ILAAWP I  +     K+   +N+ISGTSM+CPH SGI 
Sbjct  496  RGPSFASPGILKPDIIGPGVSILAAWP-ISVENKTNTKAT--FNMISGTSMSCPHLSGIA  552

Query  182  A  184
            A
Sbjct  553  A  553



>gb|KEH42928.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS +   +LKPDI APG  ILAAWP ++   E    K +  +NLISGTSMACPH +G+
Sbjct  489  RGPSYSCPFVLKPDITAPGTSILAAWPTNVPVMEFESHKIFSKFNLISGTSMACPHVAGV  548

Query  179  VA  184
             A
Sbjct  549  AA  550



>ref|XP_008238728.1| PREDICTED: subtilisin-like protease SDD1 [Prunus mume]
Length=763

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 5/62 (8%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWP-DIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS AS  +LKPDI  PGV ILA WP  +D       KS   +N+ISGTSM+CPH SGI
Sbjct  497  RGPSTASPGILKPDITGPGVSILATWPVSVDN----ATKSKATFNIISGTSMSCPHLSGI  552

Query  179  VA  184
             A
Sbjct  553  AA  554



>ref|XP_008669405.1| PREDICTED: subtilisin-like protease [Zea mays]
 tpg|DAA37771.1| TPA: putative subtilase family protein [Zea mays]
Length=771

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAW-PDIDGDEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGP L S  +LKPDI APGVDILAAW P+ +  E+   K Y  Y L+SGTSM+ PH +G+
Sbjct  499  RGPGLISPTILKPDIVAPGVDILAAWVPNKEIMELGRQKLYTKYALVSGTSMSSPHAAGV  558

Query  179  VA  184
             A
Sbjct  559  AA  560



>ref|XP_004171629.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=769

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDG-DEIIPVKSYPGYNLISGTSMACPHTSGI  178
            RGPS  +  ++KPDI APGV+ILAAWP I    E+   K    +N+ISGTSM+CPH SG+
Sbjct  498  RGPSFLNHXVIKPDITAPGVNILAAWPPIVSPSELESDKRRVLFNIISGTSMSCPHVSGL  557

Query  179  VA  184
             A
Sbjct  558  AA  559



>ref|XP_010091819.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXB46027.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=771

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPS ++ ++LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSMACPH SGI
Sbjct  499  RGPSFSNPSILKPDVVAPGVNIIAAWPQNLGPSGLPEDSRRVNFTVMSGTSMACPHVSGI  558

Query  179  VA  184
             A
Sbjct  559  AA  560



>ref|XP_004492670.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=785

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS+   +++KPD+ APGV+ILAAWP      ++   K    +N++SGTSM+CPH SGI
Sbjct  514  RGPSIVGQDVIKPDVTAPGVNILAAWPSKTSPSLVKSDKRRVLFNIVSGTSMSCPHVSGI  573

Query  179  VA  184
             A
Sbjct  574  AA  575



>ref|XP_010917391.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=797

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGP+  S  +LKPD+ APG++ILAAWPD  G   IP  +    +N++SGTSMACPH SG+
Sbjct  516  RGPNPQSPEILKPDLIAPGLNILAAWPDGVGPAGIPSDRRRTEFNILSGTSMACPHVSGL  575

Query  179  VA  184
             A
Sbjct  576  AA  577



>emb|CBI37197.3| unnamed protein product [Vitis vinifera]
Length=1318

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
             RGPSL +  +LKPDI APGV+I+AAWP   G   +P  S    + ++SGTSMACPH SGI
Sbjct  1047  RGPSLTNPTILKPDIIAPGVNIIAAWPQNLGPSGLPEDSRRVNFTVMSGTSMACPHISGI  1106

Query  179   VA  184
              A
Sbjct  1107  AA  1108



>gb|KGN58306.1| hypothetical protein Csa_3G610820 [Cucumis sativus]
Length=768

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKS-YPGYNLISGTSMACPHTSGI  178
            RGPSL++ + LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSMACPH SGI
Sbjct  497  RGPSLSNPSTLKPDVIAPGVNIIAAWPQNLGPTGLPEDSRRSNFTVMSGTSMACPHVSGI  556

Query  179  VA  184
             A
Sbjct  557  TA  558



>ref|XP_004166310.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
Length=768

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKS-YPGYNLISGTSMACPHTSGI  178
            RGPSL++ + LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSMACPH SGI
Sbjct  497  RGPSLSNPSTLKPDVIAPGVNIIAAWPQNLGPTGLPEDSRRSNFTVMSGTSMACPHVSGI  556

Query  179  VA  184
             A
Sbjct  557  TA  558



>ref|XP_004985628.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=700

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPV-KSYPGYNLISGTSMACPHTSGI  178
            RGPS  S ++LKPD+ APGV+ILAAWP      ++P+ K    +N  SGTSM+CPH SGI
Sbjct  398  RGPSSISPHILKPDVTAPGVNILAAWPPKSSPTVLPLDKRSTDWNFDSGTSMSCPHVSGI  457

Query  179  VA  184
             A
Sbjct  458  AA  459



>ref|XP_009767059.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=752

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS+AS  +LKPDI  PGV+ILAAWP    ++     +   +N+ISGTSM+CPH SG+ 
Sbjct  486  RGPSIASPGILKPDIIGPGVNILAAWPTSVENK---TNTKSTFNIISGTSMSCPHLSGVA  542

Query  182  A  184
            A
Sbjct  543  A  543



>ref|XP_004500924.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=776

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS  S N+LKPDI APGVDILAAW   D   +   K    Y + SGTSM+CPH SG+ 
Sbjct  509  RGPSALSKNILKPDIAAPGVDILAAWIGNDSSRVPKGKKPSPYYIASGTSMSCPHVSGLA  568

Query  182  AT  187
             +
Sbjct  569  GS  570



>gb|EMS46826.1| Subtilisin-like protease [Triticum urartu]
Length=458

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGP+  +  + KPDI APGVDILAAW   +    +P  +    YN+ISGTSM+CPH SGI
Sbjct  183  RGPNSRTPEIFKPDITAPGVDILAAWTGANSPSELPSDTRRVKYNIISGTSMSCPHVSGI  242

Query  179  VA  184
             A
Sbjct  243  AA  244



>ref|XP_010483084.1| PREDICTED: subtilisin-like protease SDD1 [Camelina sativa]
Length=775

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYP-GYNLISGTSMACPHTSGI  178
            RGPSLA+ ++LKPD+ APGV+I+AAWP   G   +P  +    + ++SGTSM+CPH SGI
Sbjct  503  RGPSLANPSILKPDMIAPGVNIIAAWPQNLGPTGLPYDTRRVNFTVMSGTSMSCPHVSGI  562

Query  179  VA  184
             A
Sbjct  563  TA  564



>gb|ABZ89187.1| putative protein [Coffea canephora]
Length=763

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS+AS  +LKPDI  PGV+ILAAWP    +      +   +N++SGTSM+CPH SG+ 
Sbjct  499  RGPSMASPGILKPDIIGPGVNILAAWPQSVENN---TNTKSTFNMLSGTSMSCPHLSGVA  555

Query  182  A  184
            A
Sbjct  556  A  556



>emb|CDO99977.1| unnamed protein product [Coffea canephora]
Length=733

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKSYPGYNLISGTSMACPHTSGIV  181
            RGPS+AS  +LKPDI  PGV+ILAAWP    +      +   +N++SGTSM+CPH SG+ 
Sbjct  469  RGPSMASPGILKPDIIGPGVNILAAWPQSVENN---TNTKSTFNMLSGTSMSCPHLSGVA  525

Query  182  A  184
            A
Sbjct  526  A  526



>ref|XP_004152066.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
Length=770

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    RGPSLASVNLLKPDICAPGVDILAAWPDIDGDEIIPVKS-YPGYNLISGTSMACPHTSGI  178
            RGPSL++ + LKPD+ APGV+I+AAWP   G   +P  S    + ++SGTSMACPH SGI
Sbjct  499  RGPSLSNPSTLKPDVIAPGVNIIAAWPQNLGPTGLPEDSRRSNFTVMSGTSMACPHVSGI  558

Query  179  VA  184
             A
Sbjct  559  TA  560



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525646009952