BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c88471_g1_i1 len=1284 path=[1:0-1283]

Length=1284
                                                                      Score     E

gb|ADJ66851.1|  O-methyltransferase                                     436   3e-147   
gb|AGN70870.1|  O-methyltransferase OMT2                                436   3e-147   
ref|XP_002277476.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    435   4e-147   Vitis vinifera
gb|AGN70869.1|  O-methyltransferase OMT2                                434   8e-147   
gb|AGN70864.1|  O-methyltransferase OMT2                                434   9e-147   
ref|XP_007043543.1|  O-methyltransferase                                432   3e-146   
ref|XP_010094294.1|  (RS)-norcoclaurine 6-O-methyltransferase           432   3e-146   
gb|AGB06348.1|  o-methyltransferase                                     432   7e-146   
ref|XP_002517957.1|  o-methyltransferase, putative                      426   8e-144   Ricinus communis
gb|AGN70858.1|  O-methyltransferase OMT1                                426   1e-143   
gb|ADJ66850.1|  O-methyltransferase                                     426   3e-143   
emb|CAN64492.1|  hypothetical protein VITISV_006040                     425   7e-143   Vitis vinifera
emb|CAN77813.1|  hypothetical protein VITISV_028341                     424   8e-143   Vitis vinifera
gb|AFZ78576.1|  caffeic acid O-methyltransferase                        421   6e-142   
ref|XP_002277602.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    422   1e-141   Vitis vinifera
ref|XP_006371585.1|  caffeic acid O-methyltransferase family protein    420   2e-141   
gb|ACC63885.1|  caffeic acid 3-O-methyltransferase                      419   7e-141   Populus trichocarpa [western balsam poplar]
ref|XP_010094297.1|  (RS)-norcoclaurine 6-O-methyltransferase           417   3e-140   
ref|XP_007043544.1|  O-methyltransferase                                416   1e-139   
dbj|BAC78828.1|  caffeic acid O-methyltransferase                       412   3e-138   Rosa chinensis var. spontanea
gb|KDP24163.1|  hypothetical protein JCGZ_25820                         411   1e-137   
ref|XP_010035708.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    409   5e-137   
ref|XP_002517958.1|  o-methyltransferase, putative                      404   3e-135   Ricinus communis
ref|XP_010051712.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    402   2e-134   
ref|XP_010036415.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    402   3e-134   
gb|KHN31955.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    401   7e-134   
ref|NP_001243073.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-meth...    401   1e-133   
ref|XP_010052213.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    400   1e-133   
ref|XP_003539906.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    399   3e-133   
ref|XP_008230261.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    399   3e-133   
gb|KHG13565.1|  RS-norcoclaurine 6-O-methyltransferase                  399   4e-133   
ref|XP_004299536.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    398   2e-132   
gb|AFK39321.1|  unknown                                                 398   2e-132   
gb|KEH17409.1|  caffeic acid O-methyltransferase                        397   3e-132   
ref|XP_007215606.1|  hypothetical protein PRUPE_ppa007776mg             397   3e-132   
gb|KHG03500.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    395   9e-132   
ref|XP_008365438.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    394   8e-131   
ref|XP_009357074.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    393   9e-131   
ref|XP_004506552.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    392   2e-130   
ref|XP_010035715.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    391   5e-130   
ref|XP_008357818.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    391   6e-130   
ref|XP_010094290.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-meth...    390   7e-130   
ref|XP_009357073.1|  PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticu...    391   8e-130   
gb|KHG18226.1|  RS-norcoclaurine 6-O-methyltransferase                  390   1e-129   
gb|AFK43640.1|  unknown                                                 390   1e-129   
gb|KDP24165.1|  hypothetical protein JCGZ_25822                         390   1e-129   
ref|XP_010051722.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    389   3e-129   
ref|XP_004304125.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    387   3e-128   
ref|XP_006480224.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    386   3e-128   
ref|XP_006420396.1|  hypothetical protein CICLE_v10005309mg             386   3e-128   
ref|XP_011039887.1|  PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticu...    386   6e-128   
ref|XP_008341892.1|  PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticu...    386   8e-128   
gb|KCW89506.1|  hypothetical protein EUGRSUZ_A01797                     385   3e-127   
ref|XP_010051706.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    384   3e-127   
ref|XP_003605744.1|  Caffeic acid 3-O-methyltransferase                 384   4e-127   
ref|XP_006480221.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    384   4e-127   
gb|KCW89504.1|  hypothetical protein EUGRSUZ_A01795                     382   2e-126   
ref|XP_010088827.1|  (RS)-norcoclaurine 6-O-methyltransferase           381   4e-126   
ref|XP_003605745.1|  Caffeic acid 3-O-methyltransferase                 381   4e-126   
ref|XP_006430285.1|  hypothetical protein CICLE_v10012087mg             380   6e-126   
ref|XP_010035712.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    380   1e-125   
gb|KDO61043.1|  hypothetical protein CISIN_1g018775mg                   379   2e-125   
ref|XP_006481835.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    379   3e-125   
ref|XP_006480222.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    374   2e-123   
ref|XP_006480226.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    374   3e-123   
ref|XP_006420393.1|  hypothetical protein CICLE_v10005297mg             372   1e-122   
ref|XP_010035710.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    372   2e-122   
ref|XP_010036413.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    372   3e-122   
ref|XP_006480225.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    370   7e-122   
ref|XP_008448276.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    368   2e-120   
gb|KEH16872.1|  caffeic acid O-methyltransferase                        365   3e-120   
ref|XP_004139935.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    365   5e-120   
gb|ABZ89566.1|  O-methyltransferase 2                                   365   9e-120   Humulus lupulus [common hop]
ref|XP_011045485.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    364   1e-119   
ref|XP_010035711.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    363   4e-119   
gb|ACO90220.1|  putative O-methyltransferase                            362   2e-118   Eschscholzia californica
ref|XP_010035709.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    359   1e-117   
ref|XP_002319364.2|  hypothetical protein POPTR_0013s13990g             355   4e-116   Populus trichocarpa [western balsam poplar]
ref|XP_011045486.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    354   2e-115   
ref|XP_011045483.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    353   3e-115   
gb|KCW47151.1|  hypothetical protein EUGRSUZ_K00956                     353   3e-115   
ref|XP_002319365.2|  hypothetical protein POPTR_0013s14000g             353   5e-115   Populus trichocarpa [western balsam poplar]
ref|XP_002513062.1|  o-methyltransferase, putative                      353   6e-115   Ricinus communis
gb|ABK94890.1|  unknown                                                 350   4e-114   Populus trichocarpa [western balsam poplar]
ref|XP_011045482.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    348   2e-113   
ref|XP_010932727.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    348   4e-113   
ref|XP_010689116.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    345   5e-112   
gb|AAC49708.1|  caffeic acid O-methyltransferase                        344   4e-111   Pinus taeda
gb|AAD24001.1|AF119225_1  caffeic acid ortho-methyltransferase          343   9e-111   Pinus radiata
ref|XP_010038642.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    341   2e-110   
ref|XP_010066803.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    341   2e-110   
sp|Q6WUC2.1|7OMT_PAPSO  RecName: Full=(R,S)-reticuline 7-O-methyl...    341   2e-110   Papaver somniferum
gb|AAB09044.1|  O-methyltransferase                                     342   3e-110   Pinus radiata
ref|XP_006447892.1|  hypothetical protein CICLE_v10015993mg             339   3e-110   
ref|XP_006841690.1|  hypothetical protein AMTR_s00003p00247710          340   3e-110   
gb|KDP40527.1|  hypothetical protein JCGZ_24526                         339   9e-110   
ref|XP_008230260.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    337   4e-109   
ref|XP_010691168.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    338   6e-109   
dbj|BAE79723.1|  reticuline-7-O-methyltransferase                       337   9e-109   Eschscholzia californica
ref|XP_009343397.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    337   9e-109   
gb|ADE76636.1|  unknown                                                 337   1e-108   
ref|XP_006841695.1|  hypothetical protein AMTR_s00003p00249810          327   1e-104   
gb|KCW47149.1|  hypothetical protein EUGRSUZ_K00954                     323   4e-104   
ref|XP_010691166.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    324   1e-103   
ref|XP_007216765.1|  hypothetical protein PRUPE_ppa024697mg             320   4e-102   
ref|XP_004304126.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    318   4e-102   
gb|ACO90227.1|  reticuline 7-O-methyltransferase-like protein           318   8e-102   Papaver bracteatum [great scarlet poppy]
ref|XP_010094292.1|  (RS)-norcoclaurine 6-O-methyltransferase           313   3e-101   
gb|ABK22503.1|  unknown                                                 311   1e-98    Picea sitchensis
emb|CAQ58423.1|  O-methyltransferase                                    310   2e-98    Humulus lupulus [common hop]
gb|ABZ89565.1|  O-methyltransferase 1                                   310   3e-98    Humulus lupulus [common hop]
ref|XP_010691167.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    309   8e-98    
gb|KHG19442.1|  RS-norcoclaurine 6-O-methyltransferase                  303   8e-97    
ref|XP_011045484.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    300   3e-95    
ref|XP_010690135.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    298   3e-94    
ref|XP_008789296.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    295   1e-92    
ref|XP_010098487.1|  (RS)-norcoclaurine 6-O-methyltransferase           293   9e-92    
dbj|BAN63363.1|  flavonoid O-methyltransferase                          292   1e-91    
dbj|BAO79381.1|  matairesinol O-methyltransferase                       287   2e-89    
gb|ACO90252.1|  reticuline 7-O-methyltransferase-like protein           284   2e-88    Papaver bracteatum [great scarlet poppy]
gb|AJD20228.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    284   2e-88    
ref|XP_004144927.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    283   1e-87    
ref|XP_010932489.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    280   8e-87    
ref|XP_008447906.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    279   3e-86    
ref|XP_006422511.1|  hypothetical protein CICLE_v10028731mg             273   4e-84    
ref|XP_004144871.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    273   4e-84    
gb|KDO68213.1|  hypothetical protein CISIN_1g018565mg                   273   6e-84    
ref|XP_009606162.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    272   9e-84    
ref|XP_006486669.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    271   2e-83    
ref|XP_011092948.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    271   2e-83    
gb|KCW47962.1|  hypothetical protein EUGRSUZ_K01696                     268   3e-83    
ref|XP_011092949.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    270   7e-83    
ref|XP_010690136.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    268   9e-83    
gb|AGN70880.1|  O-methyltransferase OMT4                                270   1e-82    
ref|XP_002281110.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    269   2e-82    Vitis vinifera
gb|AGK93045.1|  VvOMT4 protein                                          269   2e-82    
ref|XP_007041719.1|  RS-norcoclaurine 6-O-methyltransferase             268   3e-82    
ref|XP_006447335.1|  hypothetical protein CICLE_v10017872mg             266   5e-82    
gb|AFK39693.1|  unknown                                                 263   6e-82    
gb|AGN70876.1|  O-methyltransferase OMT4                                267   1e-81    
ref|XP_009793237.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    267   1e-81    
ref|XP_006364535.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    265   9e-81    
ref|XP_003601618.1|  O-methyltransferase                                265   1e-80    
dbj|BAN63362.1|  matairesinol O-methyltransferase                       263   4e-80    
emb|CDP22007.1|  unnamed protein product                                260   6e-80    
ref|XP_004231071.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    262   7e-80    
ref|XP_002529799.1|  o-methyltransferase, putative                      261   2e-79    Ricinus communis
ref|XP_007201351.1|  hypothetical protein PRUPE_ppa007692mg             261   2e-79    
ref|XP_002312933.2|  hypothetical protein POPTR_0009s14170g             260   6e-79    Populus trichocarpa [western balsam poplar]
ref|XP_008447905.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    259   1e-78    
ref|XP_010526871.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    259   2e-78    
ref|XP_010526872.1|  PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticu...    258   2e-78    
ref|XP_002281120.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    258   2e-78    Vitis vinifera
gb|AGK93043.1|  OMT3 protein                                            258   3e-78    
ref|XP_011045540.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    258   3e-78    
ref|XP_009802633.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    257   6e-78    
ref|XP_009602880.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    257   1e-77    
ref|XP_010247901.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    256   2e-77    
ref|XP_010244054.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    256   2e-77    
ref|XP_010526874.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    255   3e-77    
ref|XP_003605746.1|  Caffeic acid 3-O-methyltransferase                 252   5e-77    
ref|XP_008447904.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    254   1e-76    
ref|XP_004144872.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    253   2e-76    
ref|XP_010041506.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    250   3e-76    
gb|AGK93044.1|  OMT3 protein                                            253   3e-76    
gb|AGN70875.1|  O-methyltransferase OMT3                                253   4e-76    
gb|KCW47961.1|  hypothetical protein EUGRSUZ_K01694                     248   4e-76    
ref|XP_007201642.1|  hypothetical protein PRUPE_ppa021776mg             253   4e-76    
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    252   6e-76    Vitis vinifera
ref|XP_010526877.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    252   6e-76    
ref|XP_002312934.1|  hypothetical protein POPTR_0009s14160g             252   9e-76    Populus trichocarpa [western balsam poplar]
ref|XP_008236084.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    253   1e-75    
gb|KDO38340.1|  hypothetical protein CISIN_1g042491mg                   248   1e-75    
ref|XP_008236085.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    251   1e-75    
gb|AGK93042.1|  OMT3 protein                                            251   1e-75    
dbj|BAM37634.1|  O-methyltransferase                                    251   1e-75    
gb|AGN70871.1|  O-methyltransferase OMT3                                251   2e-75    
emb|CBI37808.3|  unnamed protein product                                252   2e-75    
ref|XP_007200810.1|  hypothetical protein PRUPE_ppa025618mg             250   3e-75    
ref|XP_008236091.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    249   6e-75    
ref|XP_004251689.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    249   8e-75    
ref|XP_008236081.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    249   1e-74    
gb|ACJ84935.1|  unknown                                                 243   2e-74    Medicago truncatula
ref|XP_007199647.1|  hypothetical protein PRUPE_ppa015631mg             248   3e-74    
ref|XP_006353588.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    248   3e-74    
gb|KDP24054.1|  hypothetical protein JCGZ_26737                         248   3e-74    
ref|XP_011045555.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    247   4e-74    
gb|KDP27133.1|  hypothetical protein JCGZ_20945                         247   4e-74    
gb|AJD20222.1|  norcoclaurine 6-O-methyltransferase                     247   4e-74    
sp|Q9LEL6.1|6OMT_COPJA  RecName: Full=(RS)-norcoclaurine 6-O-meth...    247   5e-74    Coptis japonica
ref|XP_008236083.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    246   1e-73    
gb|ABY75613.1|  S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclau...    246   1e-73    Coptis chinensis
ref|XP_010066313.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    246   2e-73    
sp|Q9LEL5.1|4OMT_COPJA  RecName: Full=3'-hydroxy-N-methyl-(S)-coc...    245   2e-73    Coptis japonica
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    245   3e-73    
ref|XP_006412140.1|  hypothetical protein EUTSA_v10025519mg             245   5e-73    
ref|XP_006353587.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    246   6e-73    
ref|NP_195242.1|  O-methyltransferase family protein                    244   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526878.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    243   1e-72    
ref|XP_009138346.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    244   1e-72    
ref|XP_007200597.1|  hypothetical protein PRUPE_ppa007742mg             243   1e-72    
ref|XP_010690296.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    243   2e-72    
ref|XP_010548126.1|  PREDICTED: LOW QUALITY PROTEIN: (RS)-norcocl...    243   2e-72    
ref|XP_009113527.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    243   2e-72    
emb|CDP18606.1|  unnamed protein product                                237   2e-72    
ref|XP_006283957.1|  hypothetical protein CARUB_v10005080mg             243   3e-72    
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    242   5e-72    
ref|XP_006446725.1|  hypothetical protein CICLE_v10015630mg             242   7e-72    
ref|XP_010530940.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    241   7e-72    
ref|XP_011092950.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    240   1e-71    
ref|XP_010103289.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-meth...    241   1e-71    
gb|KHG12207.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    241   1e-71    
ref|XP_002525160.1|  o-methyltransferase, putative                      240   2e-71    Ricinus communis
gb|KDO38702.1|  hypothetical protein CISIN_1g0463751mg                  236   2e-71    
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    240   2e-71    
ref|XP_010276063.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    239   3e-71    
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570          240   3e-71    Sorghum bicolor [broomcorn]
ref|XP_010690137.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    236   4e-71    
ref|XP_008236088.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    239   5e-71    
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    239   5e-71    
ref|XP_009108679.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    239   5e-71    
ref|XP_008236089.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    239   6e-71    
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    239   6e-71    
emb|CDP07899.1|  unnamed protein product                                233   6e-71    
ref|XP_006420394.1|  hypothetical protein CICLE_v100067042mg            235   7e-71    
gb|KCW47148.1|  hypothetical protein EUGRSUZ_K00953                     236   9e-71    
emb|CDP15888.1|  unnamed protein product                                239   1e-70    
ref|XP_002517827.1|  o-methyltransferase, putative                      238   1e-70    Ricinus communis
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                     239   1e-70    
gb|AAU20765.1|  (S)-norcoclaurine 6-O-methyltransferase                 238   1e-70    Thalictrum flavum subsp. glaucum
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    239   1e-70    
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    238   1e-70    
gb|KHG19041.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    237   2e-70    
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    238   2e-70    
ref|XP_002867087.1|  O-methyltransferase family 2 protein               238   2e-70    
ref|XP_008382454.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    238   2e-70    
ref|XP_010432319.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    238   2e-70    
gb|AAX82431.1|  3,5-dimethoxyphenol O-methyltransferase                 238   4e-70    Ruta graveolens
ref|XP_009138347.1|  PREDICTED: (R,S)-reticuline 7-O-methyltransf...    237   4e-70    
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    237   4e-70    Vitis vinifera
emb|CAI30878.1|  caffeate O-methyltransferase                           237   4e-70    Picea abies
ref|XP_010437514.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    237   4e-70    
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    237   4e-70    Vitis vinifera
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    237   5e-70    
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    237   5e-70    
ref|XP_010446970.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    237   6e-70    
ref|XP_003615973.1|  O-methyltransferase                                237   6e-70    
emb|CAN61955.1|  hypothetical protein VITISV_020020                     236   1e-69    Vitis vinifera
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    236   1e-69    
gb|ABK22490.1|  unknown                                                 236   2e-69    Picea sitchensis
gb|AFX98069.1|  caffeic acid O-methyltransferase                        236   2e-69    
gb|AAP45314.1|  S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclau...    235   2e-69    Papaver somniferum
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...    236   2e-69    
gb|AAU20768.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    235   2e-69    Thalictrum flavum subsp. glaucum
ref|XP_010526873.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    235   2e-69    
ref|XP_006858228.1|  hypothetical protein AMTR_s00062p00190100          235   2e-69    
ref|XP_010066314.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    235   2e-69    
ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    235   3e-69    
ref|XP_008649876.1|  PREDICTED: O-methyltransferase ZRP4-like           235   3e-69    
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...    235   3e-69    
ref|XP_002441376.1|  hypothetical protein SORBIDRAFT_09g025540          235   3e-69    Sorghum bicolor [broomcorn]
dbj|BAM37633.1|  3'-hydroxy-N-methylcoclaurine-4'-O-methyltransfe...    234   3e-69    
gb|KFK30150.1|  hypothetical protein AALP_AA7G223500                    235   3e-69    
ref|XP_006469063.1|  PREDICTED: trans-resveratrol di-O-methyltran...    235   4e-69    
ref|XP_003615967.1|  O-methyltransferase                                234   5e-69    
gb|AFK49425.1|  unknown                                                 234   5e-69    
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250          234   6e-69    
ref|XP_002529795.1|  o-methyltransferase, putative                      233   7e-69    Ricinus communis
gb|AHA44835.1|  caffeate O-methyltransferase                            234   7e-69    
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             234   8e-69    
emb|CAN75970.1|  hypothetical protein VITISV_009881                     233   8e-69    Vitis vinifera
gb|KHF98068.1|  RS-norcoclaurine 6-O-methyltransferase                  231   1e-68    
ref|XP_010247902.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    233   1e-68    
gb|ACO90250.1|  norcoclaurine 6-O-methyltransferase-like protein        233   1e-68    Thalictrum flavum [yellow meadow-rue]
gb|ADN27527.1|  caffeic acid O-methyltransferase                        233   1e-68    
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    233   2e-68    
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    233   2e-68    
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    233   2e-68    
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                  233   2e-68    Thalictrum tuberosum
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    233   2e-68    
gb|AFW78710.1|  O-methyltransferase ZRP4                                233   2e-68    
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                  233   2e-68    
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    233   2e-68    
ref|XP_007163840.1|  hypothetical protein PHAVU_001G268700g             232   2e-68    
ref|XP_008649874.1|  PREDICTED: O-methyltransferase ZRP4-like           232   3e-68    
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...    232   3e-68    
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...    232   4e-68    
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    232   4e-68    
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    231   5e-68    
ref|XP_002525159.1|  o-methyltransferase, putative                      231   5e-68    
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    231   7e-68    
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    231   7e-68    
gb|ABA98340.1|  O-methyltransferase ZRP4, putative, expressed           231   8e-68    
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    231   8e-68    
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    231   8e-68    
ref|XP_011097031.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    231   9e-68    
gb|AAY86361.1|  caffeic acid O-methyltransferase                        231   1e-67    
emb|CAN73269.1|  hypothetical protein VITISV_021917                     231   1e-67    
gb|AFK40372.1|  unknown                                                 231   1e-67    
ref|XP_003538520.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    231   1e-67    
prf||2119166A  caffeic acid O-methyltransferase                         231   1e-67 
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    231   1e-67    
ref|NP_001148593.1|  O-methyltransferase ZRP4                           231   1e-67    
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    230   1e-67    
ref|XP_004290757.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    231   1e-67    
gb|ABK25932.1|  unknown                                                 230   2e-67    
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase      230   2e-67    
ref|XP_008803442.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    229   2e-67    
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...    231   2e-67    
ref|XP_008358432.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    230   2e-67    
gb|AEF97347.1|  O-methyltransferase                                     230   2e-67    
gb|ACU21493.1|  unknown                                                 230   2e-67    
gb|ABS57468.1|  caffeic acid O-methyl transferase                       230   3e-67    
emb|CAQ76879.1|  resveratrol O-methyltransferase                        229   3e-67    
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                     229   3e-67    
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...    230   3e-67    
gb|ABK21417.1|  unknown                                                 229   3e-67    
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                  229   3e-67    
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    229   4e-67    
gb|KHN44492.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltra...    229   4e-67    
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    229   4e-67    
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...    229   4e-67    
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    229   5e-67    
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase         229   5e-67    
gb|ABR18380.1|  unknown                                                 229   5e-67    
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg             229   6e-67    
gb|KHG11439.1|  RS-norcoclaurine 6-O-methyltransferase                  227   7e-67    
gb|ADO16247.1|  caffeic acid O-methyltransferase                        229   7e-67    
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    229   7e-67    
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g             229   7e-67    
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                     229   7e-67    
ref|XP_008788395.1|  PREDICTED: trans-resveratrol di-O-methyltran...    229   7e-67    
emb|CAA52461.1|  catechol O-methyltransferase                           229   8e-67    
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    228   8e-67    
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    228   9e-67    
gb|KDP21022.1|  hypothetical protein JCGZ_21493                         228   1e-66    
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase      228   1e-66    
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    228   1e-66    
gb|AAD29845.1|AF064697_1  O-methyltransferase                           228   1e-66    
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase      228   1e-66    
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    228   1e-66    
emb|CAA52462.1|  catechol O-methyltransferase                           228   1e-66    
ref|XP_006469136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    228   1e-66    
gb|EMT10452.1|  O-methyltransferase ZRP4                                228   1e-66    
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                      228   1e-66    
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1               228   1e-66    
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    228   1e-66    
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    228   1e-66    
gb|EMS45262.1|  O-methyltransferase ZRP4                                228   2e-66    
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    228   2e-66    
ref|XP_010103004.1|  3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-meth...    228   2e-66    
gb|ACY41220.1|  O-methyltransferase-like protein                        228   2e-66    
gb|AEV93478.1|  caffeic acid O-methyltransferase                        228   2e-66    
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    227   2e-66    
gb|AAP45315.1|  S-adenosyl-L-methionine:norcoclaurine 6-O-methylt...    227   2e-66    
gb|AHY28757.1|  caffeate O-methyltransferase                            227   3e-66    
gb|EAY82987.1|  hypothetical protein OsI_38209                          227   3e-66    
emb|CDY17512.1|  BnaC03g65510D                                          227   3e-66    
gb|ABK23795.1|  unknown                                                 227   3e-66    
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like       227   3e-66    
ref|XP_010918594.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    227   3e-66    
sp|Q43609.1|COMT1_PRUDU  RecName: Full=Caffeic acid 3-O-methyltra...    227   3e-66    
ref|XP_002278208.2|  PREDICTED: trans-resveratrol di-O-methyltran...    227   3e-66    
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1        227   4e-66    
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    226   4e-66    
emb|CBI37807.3|  unnamed protein product                                225   5e-66    
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             226   5e-66    
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    226   5e-66    
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    228   5e-66    
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    227   5e-66    
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    226   5e-66    
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    226   5e-66    
gb|AAF60951.1|  O-methyltransferase                                     226   5e-66    
gb|ACO90232.1|  putative norcoclaurine 6-O-methyltransferase            226   5e-66    
sp|Q6WUC1.1|6OMT_PAPSO  RecName: Full=(RS)-norcoclaurine 6-O-meth...    226   5e-66    
gb|AHY28752.1|  caffeate O-methyltransferase                            226   5e-66    
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    226   5e-66    
gb|AFK39235.1|  unknown                                                 226   5e-66    
ref|XP_011084575.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    226   5e-66    
ref|NP_001140810.1|  uncharacterized protein LOC100272885               226   6e-66    
ref|XP_010677637.1|  PREDICTED: inositol 4-methyltransferase-like       227   6e-66    
ref|XP_007218167.1|  hypothetical protein PRUPE_ppa007511mg             226   6e-66    
gb|AAA80579.1|  3' flavonoid O-methyltransferase                        226   6e-66    
ref|XP_002864309.1|  O-methyltransferase 1                              226   6e-66    
ref|XP_008358438.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    226   6e-66    
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             226   7e-66    
gb|AIJ28474.1|  O-methyltransferase                                     226   7e-66    
gb|AAQ01670.1|  catechol O-methyltransferase                            226   7e-66    
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                      226   7e-66    
ref|XP_008807987.1|  PREDICTED: trans-resveratrol di-O-methyltran...    226   7e-66    
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    226   7e-66    
gb|ABO41845.1|  putative caffeic acid methyltransferase                 226   7e-66    
ref|XP_007218166.1|  hypothetical protein PRUPE_ppa007511mg             226   7e-66    
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    226   7e-66    
ref|NP_001240003.1|  uncharacterized protein LOC100780100               226   8e-66    
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                   226   8e-66    
ref|XP_002317838.1|  Chain A family protein                             226   9e-66    
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...    226   9e-66    
gb|AFD53036.1|  caffeic acid-O-methyltransferase                        226   1e-65    
gb|AFK41218.1|  unknown                                                 226   1e-65    
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...    226   1e-65    
gb|AET00984.2|  caffeic acid O-methyltransferase                        226   1e-65    
ref|XP_003618025.1|  Caffeic acid 3-O-methyltransferase                 226   1e-65    
gb|ABK24146.1|  unknown                                                 226   1e-65    
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like      226   1e-65    
ref|XP_008778275.1|  PREDICTED: trans-resveratrol di-O-methyltran...    225   1e-65    
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...    226   1e-65    
emb|CAN78992.1|  hypothetical protein VITISV_005827                     225   1e-65    
gb|AAD29843.1|AF064695_1  catechol O-methyltransferase                  225   1e-65    
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    225   1e-65    
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg             226   1e-65    
gb|ABS18316.1|  caffeic acid-3-O-methyltransferase                      225   1e-65    
gb|AAS64572.1|  caffeic acid O-methyltransferase                        225   2e-65    
gb|AHY28754.1|  caffeate O-methyltransferase                            225   2e-65    
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    225   2e-65    
dbj|BAO79382.1|  hypothetical plant O-methyltransferase                 225   2e-65    
gb|ABK23414.1|  unknown                                                 225   2e-65    
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    225   2e-65    
ref|XP_004144926.1|  PREDICTED: (RS)-norcoclaurine 6-O-methyltran...    225   2e-65    
gb|AFZ78575.1|  caffeic acid O-methyltransferase                        225   2e-65    
gb|EYU45322.1|  hypothetical protein MIMGU_mgv1a009747mg                224   2e-65    
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    225   2e-65    
gb|ABR18103.1|  unknown                                                 225   2e-65    
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                  225   2e-65    
ref|XP_009387259.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    225   2e-65    
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...    224   2e-65    
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...    224   3e-65    
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...    224   3e-65    
gb|ABO41834.1|  putative caffeic acid methyltransferase                 224   3e-65    
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   224   3e-65    
prf||1906376A  O-methyltransferase                                      224   3e-65 
gb|EPS67212.1|  hypothetical protein M569_07558                         224   3e-65    
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase      224   3e-65    
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             224   3e-65    
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...    224   3e-65    
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...    225   3e-65    
ref|NP_001056039.1|  Os05g0515500                                       224   3e-65    
gb|AAB96879.1|  O-methyltransferase 1                                   224   3e-65    
ref|XP_011091582.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    224   3e-65    
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             224   4e-65    
gb|ABO41840.1|  putative caffeic acid methyltransferase                 224   4e-65    
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             224   4e-65    
gb|AFX68805.1|  O-metyltransferase                                      224   4e-65    
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...    224   5e-65    
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             224   5e-65    
gb|ABO41852.1|  putative caffeic acid methyltransferase                 224   5e-65    
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             224   5e-65    
gb|AEO14870.1|  caffeic acid O-methyltransferase                        224   6e-65    
gb|AEO14871.1|  caffeic acid O-methyltransferase                        224   6e-65    
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    224   7e-65    
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3    224   7e-65    
ref|XP_004242403.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    223   7e-65    
ref|XP_010916033.1|  PREDICTED: trans-resveratrol di-O-methyltran...    223   7e-65    
gb|EMS47465.1|  O-methyltransferase ZRP4                                223   8e-65    
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              223   8e-65    
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    223   9e-65    
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    223   9e-65    
gb|AFQ94040.1|  monolignol 4-O-methyltransferase 4                      223   1e-64    
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    223   1e-64    
ref|XP_010920170.1|  PREDICTED: trans-resveratrol di-O-methyltran...    223   1e-64    
gb|KDP30064.1|  hypothetical protein JCGZ_18389                         223   1e-64    
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    223   1e-64    
gb|AIY62319.1|  caffeic acid O-methyl transferase                       224   1e-64    
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...    223   1e-64    
pdb|3REO|A  Chain A, Monolignol O-Methyltransferase (Momt)              223   1e-64    
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                    223   1e-64    
gb|ABQ02270.2|  O-methyltransferase                                     223   1e-64    
ref|XP_002321948.1|  Chain A family protein                             223   2e-64    
ref|XP_002520291.1|  o-methyltransferase, putative                      223   2e-64    
emb|CDY43839.1|  BnaC03g14720D                                          223   2e-64    
emb|CDY17514.1|  BnaC03g65490D                                          222   2e-64    
emb|CAA11131.1|  O-methyltransferase                                    222   2e-64    
gb|ACT87981.1|  caffeic acid O-methyltransferase                        223   2e-64    
emb|CDY29856.1|  BnaA03g48770D                                          222   2e-64    
gb|AFK45226.1|  unknown                                                 222   2e-64    
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                      222   2e-64    
gb|ABR17930.1|  unknown                                                 223   2e-64    
emb|CDX76316.1|  BnaA08g10840D                                          221   2e-64    
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like       222   3e-64    
ref|XP_002522500.1|  o-methyltransferase, putative                      222   3e-64    
emb|CDY18306.1|  BnaC09g30560D                                          222   3e-64    
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    221   3e-64    
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    222   3e-64    
ref|NP_001267963.1|  O-methyltransferase                                221   3e-64    
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1        222   3e-64    
emb|CAN79968.1|  hypothetical protein VITISV_043678                     221   3e-64    
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...    221   3e-64    
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    222   3e-64    
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    222   4e-64    
ref|XP_010247677.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    221   4e-64    
ref|XP_011091586.1|  PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurin...    221   4e-64    
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    222   4e-64    
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...    223   4e-64    
gb|ACD56610.1|  putative caffeic acid protein                           221   4e-64    
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                    221   4e-64    
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    221   4e-64    
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             221   5e-64    
sp|O04385.2|IEMT_CLABR  RecName: Full=(Iso)eugenol O-methyltransf...    221   5e-64    
emb|CDY09084.1|  BnaC08g10380D                                          220   5e-64    
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           221   6e-64    



>gb|ADJ66851.1| O-methyltransferase [Vitis vinifera]
 gb|AGN70866.1| O-methyltransferase OMT2 [Vitis vinifera]
 gb|AGN70867.1| O-methyltransferase OMT2 [Vitis vinifera]
 gb|AGN70868.1| O-methyltransferase OMT2 [Vitis vinifera]
Length=367

 Score =   436 bits (1120),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 227/347 (65%), Positives = 273/347 (79%), Gaps = 6/347 (2%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA +W++M  F DSMALK AV+LRI DIIHSHA  +PITLSQIA  I DSPSPD  
Sbjct  23    MLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHA--RPITLSQIATCI-DSPSPDIT  79

Query  258   TLSRILRLLVRRKIFTSAVRP-SDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L+RI+R LVR KIFT+A  P SDG  T+YG TP+S+WL+ DAELS+APM+L + HP  M
Sbjct  80    CLARIMRFLVRAKIFTAAPPPQSDGGETLYGLTPSSKWLLHDAELSLAPMVLMENHPSLM  139

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HCF  CVKEGG AFEKAHG  I+++A+  PEFNK FNDGM    +I  KA+++ Y  
Sbjct  140   APWHCFGTCVKEGGIAFEKAHGHQIWDLASEKPEFNKLFNDGMACTAKISIKAVIAAYK-  198

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF S+G+LVDVGGGTG AVAE+VKA+PHIKGINFDLPHVVATAP Y+GVSHVGGDMF S
Sbjct  199   DGFGSIGTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPHVVATAPAYKGVSHVGGDMFES  258

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP A AIF+KW+LHDW DE+CVKILKNCR+A+PEKTGK+IIVD V++ +G   F +   V
Sbjct  259   IPDADAIFMKWILHDWNDEDCVKILKNCRKAIPEKTGKVIIVDGVIREDGYEPFDETRLV  318

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              DL+M+AHSS G+ERTE EWK+LL E GFP Y I++   +  IIEAY
Sbjct  319   LDLVMMAHSSHGQERTEVEWKKLLEEGGFPRYRILKIPTLQMIIEAY  365



>gb|AGN70870.1| O-methyltransferase OMT2 [Vitis vinifera]
Length=367

 Score =   436 bits (1120),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 274/347 (79%), Gaps = 6/347 (2%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA +W++M  F DSMALK AV+LRI DIIHSHA  +PITLSQIA  I DSPSPD  
Sbjct  23    MLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHA--RPITLSQIATCI-DSPSPDIT  79

Query  258   TLSRILRLLVRRKIFTSAVRP-SDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L+RI+R LVR KIFT+A  P SDG  T+YG TP+S+WL+ DAELS+APM+L + HP  M
Sbjct  80    CLARIMRFLVRAKIFTAAPPPQSDGGETLYGLTPSSKWLLHDAELSLAPMVLMENHPSLM  139

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HCF  CVKEGG AFEKAHG  I+++A+  PEFNK FNDGM    +I  KA+++ Y  
Sbjct  140   APWHCFGTCVKEGGIAFEKAHGHQIWDLASEKPEFNKLFNDGMACTAKISIKAVIAAYK-  198

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF S+G+LVDVGGGTG AVAE+VKA+PHIKGINFDLPHVVATAP Y+GVSHVGGDMF S
Sbjct  199   DGFGSIGTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPHVVATAPAYKGVSHVGGDMFES  258

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP+A AIF+KW+LHDW DE+CVKILKNCR+A+PEKTGK+IIVD V++ +G   F +   V
Sbjct  259   IPNADAIFMKWILHDWNDEDCVKILKNCRKAIPEKTGKVIIVDGVIREDGYEPFDETRLV  318

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              DL+M+AH+S G+ERTE EWK+LL E GFP Y I++   +  IIEAY
Sbjct  319   LDLVMMAHTSHGQERTEVEWKKLLEEGGFPRYRILKIPTLQMIIEAY  365



>ref|XP_002277476.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase [Vitis vinifera]
Length=367

 Score =   435 bits (1119),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 273/347 (79%), Gaps = 6/347 (2%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA +W++M  F DSMALK AV+LRI DIIHSHA  +PITLSQIA  I DSPSPD  
Sbjct  23    MLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHA--RPITLSQIATCI-DSPSPDIT  79

Query  258   TLSRILRLLVRRKIFTSAVRP-SDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L+RI+R LVR KIFT+A  P SDG  T+YG TP+S+WL+ DAELS+APM+L + HP  M
Sbjct  80    CLARIMRFLVRAKIFTAAPPPQSDGGETLYGLTPSSKWLLHDAELSLAPMVLMENHPSLM  139

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HCF  CVKEGG AFEKAHG  I+++A+  PEFNK FNDGM    +I  KA+++ Y  
Sbjct  140   APWHCFGTCVKEGGIAFEKAHGHQIWDLASEKPEFNKLFNDGMACTAKISIKAVIAAYK-  198

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF S+G+LVDVGGGTG AVAE+VKA+PHIKGINFDLPHVVATAP Y+GVSHVGGDMF S
Sbjct  199   DGFGSIGTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPHVVATAPAYEGVSHVGGDMFES  258

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP A AIF+KW+LHDW DE+CVKILKNCR+A+PEKTGK+IIVD V++ +G   F +   V
Sbjct  259   IPDADAIFMKWILHDWNDEDCVKILKNCRKAIPEKTGKVIIVDGVIREDGYEPFDETRLV  318

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              DL+M+AH+S G+ERTE EWK+LL E GFP Y I++   +  IIEAY
Sbjct  319   LDLVMMAHTSHGQERTEVEWKKLLEEGGFPRYRILKIPTLQMIIEAY  365



>gb|AGN70869.1| O-methyltransferase OMT2 [Vitis vinifera]
Length=367

 Score =   434 bits (1117),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 272/347 (78%), Gaps = 6/347 (2%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA +W++M  F DSMALK AV+LRI DIIHSHA  +PITLSQIA  I DSPSPD  
Sbjct  23    MLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHA--RPITLSQIATCI-DSPSPDIT  79

Query  258   TLSRILRLLVRRKIFTSAVRP-SDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L+RI+R LVR KIFT+   P SDG  T+YG TP+S+WL+ DAELS+APM+L + HP  M
Sbjct  80    CLARIMRFLVRAKIFTATPPPQSDGGETLYGLTPSSKWLLHDAELSLAPMVLMENHPSLM  139

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HCF  CVKEGG AFEKAHG  I+++A+  PEFNK FNDGM    +I  KA+++ Y  
Sbjct  140   APWHCFGTCVKEGGIAFEKAHGHQIWDLASEKPEFNKLFNDGMACTAKISIKAVIAAYK-  198

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF S+G+LVDVGGGTG AVAE+VKA+PHIKGINFDLPHVVATAP Y+GVSHVGGDMF S
Sbjct  199   DGFGSIGTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPHVVATAPAYKGVSHVGGDMFES  258

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP A AIF+KW+LHDW DE+CVKILKNCR+A+PEKTGK+IIVD V++ +G   F +   V
Sbjct  259   IPDADAIFMKWILHDWNDEDCVKILKNCRKAIPEKTGKVIIVDGVIREDGYEPFDETRLV  318

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              DL+M+AHSS G+ERTE EWK+LL E GFP Y I++   +  IIEAY
Sbjct  319   LDLVMMAHSSHGQERTEVEWKKLLEEGGFPRYRILKIPTLQMIIEAY  365



>gb|AGN70864.1| O-methyltransferase OMT2 [Vitis vinifera]
 gb|AGN70865.1| O-methyltransferase OMT2 [Vitis vinifera]
Length=367

 Score =   434 bits (1117),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 225/347 (65%), Positives = 273/347 (79%), Gaps = 6/347 (2%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA +W++M  F DSMALK AV+LRI DIIHSHA  +PITLSQIA  I DSPSPD  
Sbjct  23    MLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHA--RPITLSQIATCI-DSPSPDIT  79

Query  258   TLSRILRLLVRRKIFTSAVRP-SDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L+RI+R LVR KIFT+   P SDG  T+YG TP+S+WL+ DAELS+APM+L + HP  M
Sbjct  80    CLARIMRFLVRAKIFTATPPPQSDGGETLYGLTPSSKWLLHDAELSLAPMVLMENHPSLM  139

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HCF  CVKEGG AFEKAHG  I+++A+  PEFNK FNDGM    +I  KA+++ Y  
Sbjct  140   APWHCFGTCVKEGGIAFEKAHGHQIWDLASEKPEFNKLFNDGMACTAKISIKAVIAAYK-  198

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF S+G+LVDVGGGTG AVAE+VKA+PHIKGINFDLPHVVATAP Y+GVSHVGGDMF S
Sbjct  199   DGFGSIGTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPHVVATAPAYKGVSHVGGDMFES  258

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP+A AIF+KW+LHDW DE+CVKILKNCR+A+PEKTGK+IIVD V++ +G   F +   V
Sbjct  259   IPNADAIFMKWILHDWNDEDCVKILKNCRKAIPEKTGKVIIVDGVIREDGYEPFDETRLV  318

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              DL+M+AH+S G+ERTE EWK+LL E GFP Y I++   +  IIEAY
Sbjct  319   LDLVMMAHTSHGQERTEVEWKKLLEEGGFPRYRILKIPTLQMIIEAY  365



>ref|XP_007043543.1| O-methyltransferase [Theobroma cacao]
 gb|EOX99374.1| O-methyltransferase [Theobroma cacao]
Length=353

 Score =   432 bits (1112),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 278/357 (78%), Gaps = 5/357 (1%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
             M+ S   ++ L  QA++W+YM  F DSMALK+AV+LRI DIIHSH  A  ITLSQIA+ I
Sbjct  1     METSKFGEATLQGQAEIWQYMFSFADSMALKSAVELRIADIIHSHGGA--ITLSQIASCI  58

Query  231   HDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAELSMAPMLL  407
               SP PD + L+RI+RLLVRRK+F S   PSDG   +YG T +S WL+ D++L++APM+L
Sbjct  59    GGSPPPDNSYLARIMRLLVRRKVF-SVQNPSDGGEPLYGLTLSSTWLIHDSDLTLAPMVL  117

Query  408   FQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
              + HP  MAP+HCFS CVKEGG AF+KAHG+ I++ A+ +PEFN+ FNDGM   ++I+++
Sbjct  118   MENHPWQMAPWHCFSECVKEGGIAFKKAHGREIWDFASENPEFNRLFNDGMACTSKIVTR  177

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
             AI++GY  +GF  +GSLVDVGGG G  ++EIVKA PHIKG+NFDLPHVV+TAP Y GV H
Sbjct  178   AILTGYK-EGFSCIGSLVDVGGGIGGLISEIVKANPHIKGVNFDLPHVVSTAPAYHGVCH  236

Query  768   VGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDP  947
             VGGDMF +IP A A+ +KW+LHDWGDE+C+KIL+NCR+A+P + GK+IIV+ VLKP+G  
Sbjct  237   VGGDMFHAIPDADAVMMKWILHDWGDEDCIKILRNCRKAIPRENGKVIIVECVLKPDGTD  296

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              F D+ ++ DLLM+AHSSGGKERTE EWK++L E GFP Y II   A ASIIEAY +
Sbjct  297   PFDDMGFIFDLLMIAHSSGGKERTELEWKKILEEGGFPRYKIINIPAFASIIEAYPE  353



>ref|XP_010094294.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
 gb|EXB55626.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
Length=356

 Score =   432 bits (1112),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 221/353 (63%), Positives = 282/353 (80%), Gaps = 11/353 (3%)
 Frame = +3

Query  81    LHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTAT  260
             L  + ++WKYML+  DSMA+K AV+LRIPDII+SH    P++L+QIAAAI D+ SPD + 
Sbjct  8     LRDREEIWKYMLNHADSMAIKCAVELRIPDIINSHGG--PMSLAQIAAAIPDTSSPDISC  65

Query  261   LSRILRLLVRRKIFTSAVRPSDGA----TVYGPTPASRWLVRDA---ELSMAPMLLFQTH  419
             L+RI+RLLVRR IFT A + SDG+    T+YG T +SRWL+ D    +L++AP  L +TH
Sbjct  66    LARIMRLLVRRNIFT-AHQSSDGSGDSTTLYGLTHSSRWLLSDTSDDQLTLAPFFLMETH  124

Query  420   PLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
             P  MAP+HCFSRCVKEGG AF+KAHG+ I++ A+ +PEFNK FNDGME   +II KAI+S
Sbjct  125   PWLMAPWHCFSRCVKEGGSAFQKAHGREIWDFASENPEFNKLFNDGMECTARIILKAILS  184

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGD  779
              Y  DGF S+GSLVDVGGGTG A++EIVK+ PHI GINFDLPHVV TAP Y GVSHVGGD
Sbjct  185   EYR-DGFGSLGSLVDVGGGTGRALSEIVKSHPHINGINFDLPHVVGTAPVYPGVSHVGGD  243

Query  780   MFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGD  959
             MF SIP+A A+F+KW++HDWGDE+CVKILKNCR+A+PEK+GK++IVD VL PEG+ +F D
Sbjct  244   MFESIPNADAVFMKWIMHDWGDEDCVKILKNCRKAIPEKSGKVVIVDLVLNPEGNTLFDD  303

Query  960   ISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             +S + DL+M+A +SGGKERTE +WK++L E GFP Y II+  ++ SIIEAY +
Sbjct  304   MSLIWDLVMVADASGGKERTENQWKKILKEGGFPRYKIIKIPSLTSIIEAYPE  356



>gb|AGB06348.1| o-methyltransferase [Camellia sinensis]
Length=354

 Score =   432 bits (1110),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 221/353 (63%), Positives = 271/353 (77%), Gaps = 4/353 (1%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             +FD + ML +QA++WKYM  F DSMALK+AV+LRI DIIHSH +  PITLSQIAA I DS
Sbjct  6     AFDGEGMLQAQAEIWKYMYQFADSMALKSAVELRIADIIHSHGS--PITLSQIAAGIIDS  63

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTH  419
             PSPD   L+RI+RLLVRRKIFT   +   G  +YGPT  SRWL+  AELS+APML+ +  
Sbjct  64    PSPDITCLARIMRLLVRRKIFTVTPQSDGGEALYGPTHMSRWLLHGAELSLAPMLMMEND  123

Query  420   PLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
               ++AP+H  S CV+EGG  F+KAHG+ I++  + +PEFN  FND M    +I  KAI++
Sbjct  124   HRALAPWHYLSNCVREGGIGFQKAHGREIWDYCSMNPEFNNIFNDAMGCTARITMKAIMT  183

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGD  779
             GY  D F  VGS+VDVGGGTGAA+ EIVK  PHIKGINFDLPHV+ATAPEY GVSHVGGD
Sbjct  184   GYK-DAFCGVGSMVDVGGGTGAAMGEIVKVHPHIKGINFDLPHVIATAPEYGGVSHVGGD  242

Query  780   MFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGD  959
             MF +IPSA A+F+K ++HDW DE+CV ILKNCR+A+PEKTGK+II+D VL PEGD +F D
Sbjct  243   MFKAIPSADAVFMKRIMHDWNDEDCVNILKNCRKAIPEKTGKVIIIDVVLNPEGDGMFDD  302

Query  960   ISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
                V DLLM+AH +GGKERTE EWK++L E GFP YNII+  A  SIIEA+ +
Sbjct  303   TGLVLDLLMIAH-TGGKERTELEWKKVLEEGGFPCYNIIKIAAFPSIIEAFPE  354



>ref|XP_002517957.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44475.1| o-methyltransferase, putative [Ricinus communis]
Length=352

 Score =   426 bits (1096),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 220/357 (62%), Positives = 278/357 (78%), Gaps = 6/357 (2%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
             M+G F++++ L  QAQVW+ M  F DSMALK AV+L IPDIIHSH   + ITLSQIA++I
Sbjct  1     MEGVFEDEASLIGQAQVWQLMFAFADSMALKCAVELHIPDIIHSHG--KSITLSQIASSI  58

Query  231   HDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLL  407
              DS SPD   L RI+RLLVRR IFT A  PSDG  T+YG T  S+WLV D++ ++APM+L
Sbjct  59    -DSTSPDIPYLQRIMRLLVRRNIFT-ADHPSDGGETLYGLTHVSKWLVHDSDRTLAPMVL  116

Query  408   FQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
              + HP ++ P+HCFS+CVK+GG AFEKA+G  I++ AA +PEFNK FN GM    ++  +
Sbjct  117   MENHPWTINPWHCFSQCVKKGGIAFEKANGHEIWDFAARNPEFNKMFNGGMSCTARLTIR  176

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
             AI+ GY  DGF S+ SLVDVGGGTG  V EIVK+ PHIKGIN+DL HVV+TAP Y+GV H
Sbjct  177   AILEGYK-DGFCSMKSLVDVGGGTGDLVTEIVKSHPHIKGINYDLAHVVSTAPAYEGVCH  235

Query  768   VGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDP  947
             VGGDMF +IP+A A+ +KW++HDWGDE+CV+ILKNCR+A+PEKTGK++IVD VL+PEG+ 
Sbjct  236   VGGDMFQAIPNADAVIMKWIMHDWGDEDCVRILKNCRKAIPEKTGKVMIVDIVLQPEGNG  295

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             +F D   V DLLM+AHSSGGKERTE EWK++L E GFP Y II+  A+ SIIEAY +
Sbjct  296   LFDDTRLVFDLLMIAHSSGGKERTEAEWKKILEEGGFPRYRIIKIPALTSIIEAYPE  352



>gb|AGN70858.1| O-methyltransferase OMT1 [Vitis vinifera]
 gb|AGN70859.1| O-methyltransferase OMT1 [Vitis vinifera]
Length=369

 Score =   426 bits (1096),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 276/352 (78%), Gaps = 10/352 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA +W++M  F DSMALK AV+LRI DIIHSHA  +PITLSQIA  I DSPSPD  
Sbjct  23    MLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHA--RPITLSQIATCI-DSPSPDIT  79

Query  258   TLSRILRLLVRRKIFTSAVRP-SDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L+RI+R LVR KIFT+   P SDG  T+YG TP+S+WL+ DA+LS+APM+L + HP  M
Sbjct  80    CLARIMRFLVRAKIFTAVPPPQSDGGETLYGLTPSSKWLLHDADLSLAPMVLMENHPFLM  139

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HCF  CVKEGG AFEKAHG+ I++ A+ +PEFNK FNDGM    +++   +V+ Y  
Sbjct  140   APWHCFGTCVKEGGIAFEKAHGRQIWDFASENPEFNKLFNDGMACTAKVVMGEVVAAYK-  198

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF S+ +LVDVGGGTG AVAE+VKA+PHIKGINFDLPHVVA+AP Y+GVSHVGGDMF S
Sbjct  199   DGFGSIRTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPHVVASAPAYEGVSHVGGDMFES  258

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP+A AIF+KW++HDW DE+C+KILKNCR+A+PEKTGK+IIVD V++ + D  F     V
Sbjct  259   IPNADAIFMKWIMHDWSDEDCIKILKNCRKAVPEKTGKIIIVDGVIREDSDDPFDKTRLV  318

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS---IIEAYSQ  1118
              DLLM+AHSS GKER+E EWK++L E GFP Y I++ I++++   IIEAY +
Sbjct  319   FDLLMMAHSSNGKERSEVEWKKVLEEGGFPRYRIME-ISISTLPMIIEAYPE  369



>gb|ADJ66850.1| O-methyltransferase [Vitis vinifera]
 gb|AGN70860.1| O-methyltransferase OMT1 [Vitis vinifera]
 gb|AGN70861.1| O-methyltransferase OMT1 [Vitis vinifera]
 gb|AGN70862.1| O-methyltransferase OMT1 [Vitis vinifera]
 gb|AGN70863.1| O-methyltransferase OMT1 [Vitis vinifera]
Length=369

 Score =   426 bits (1094),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 276/352 (78%), Gaps = 10/352 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA +W++M  F DSMALK AV+LRI DIIHS A  +PITLSQIA  I DSPSPD  
Sbjct  23    MLQGQANIWRHMFAFADSMALKCAVELRIADIIHSQA--RPITLSQIATCI-DSPSPDIT  79

Query  258   TLSRILRLLVRRKIFTSAVRP-SDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L+RI+R LVR KIFT+A  P SDG  T+YG TP+S+WL+ DA+LS+APM+L + HP  M
Sbjct  80    CLARIMRFLVRAKIFTAAPPPQSDGGETLYGLTPSSKWLLHDADLSLAPMVLMENHPFLM  139

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HCF  CVKEGG AFEKAHG+ I++ A+ +PEFNK FNDGM    +++   +V+ Y  
Sbjct  140   APWHCFGTCVKEGGIAFEKAHGRQIWDFASENPEFNKLFNDGMACTAKVVMGEVVAAYK-  198

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF S+ +LVDVGGGTG AVAE+VKA+PHIKGINFDLPHVVA+AP Y+GVSHVGGDMF S
Sbjct  199   DGFGSIRTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPHVVASAPAYEGVSHVGGDMFES  258

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP+A AIF+KW++HDW DE+C+KILKNCR+A+PEKTGK+IIVD V++ + D  F     V
Sbjct  259   IPNADAIFMKWIMHDWSDEDCIKILKNCRKAVPEKTGKIIIVDGVIREDSDDPFDKTRLV  318

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS---IIEAYSQ  1118
              DLLM+AHSS GKER+E EWK++L E GFP Y I++ I++++   IIEAY +
Sbjct  319   FDLLMMAHSSNGKERSEVEWKKVLEEGGFPRYRIME-ISISTLPMIIEAYPE  369



>emb|CAN64492.1| hypothetical protein VITISV_006040 [Vitis vinifera]
Length=375

 Score =   425 bits (1092),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 276/352 (78%), Gaps = 10/352 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA +W++M  F DSMALK AV+LRI DIIHS   A+PITLSQIA  I DSPSPD  
Sbjct  29    MLQGQANIWRHMFAFADSMALKCAVELRIADIIHS--XARPITLSQIATCI-DSPSPDIT  85

Query  258   TLSRILRLLVRRKIFTSAVRP-SDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L+RI+R LVR KIFT+A  P SDG  T+YG TP+S+WL+ DA+LS+APM+L + HP  M
Sbjct  86    CLARIMRFLVRAKIFTAAPPPQSDGGETLYGLTPSSKWLLHDADLSLAPMVLMENHPXLM  145

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HCF  CVKEGG AFEKAHG+ I++ A+ +PEFNK FNDGM    +++   +V+ Y  
Sbjct  146   APWHCFGTCVKEGGIAFEKAHGRQIWDFASENPEFNKLFNDGMACTAKVVMGEVVAAYK-  204

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF S+ +LVDVGGGTG AVAE+VKA+PHIKGINFDLPHVVA+AP Y+GVSHVGGDMF S
Sbjct  205   DGFGSIRTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPHVVASAPAYEGVSHVGGDMFES  264

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP+A AIF+KW++HDW DE+C+KILKNCR+A+PEKTGK+IIVD V++ + D  F     V
Sbjct  265   IPNADAIFMKWIMHDWSDEDCIKILKNCRKAVPEKTGKIIIVDGVIREDSDDPFDKTRLV  324

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS---IIEAYSQ  1118
              DLLM+AHSS GKER+E EWK++L E GFP Y I++ I++++   IIEAY +
Sbjct  325   FDLLMMAHSSNGKERSEVEWKKVLEEGGFPRYRIME-ISISTLPMIIEAYPE  375



>emb|CAN77813.1| hypothetical protein VITISV_028341 [Vitis vinifera]
Length=375

 Score =   424 bits (1091),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 276/352 (78%), Gaps = 10/352 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA +W++M  F DSMALK AV+LRI DIIHSHA  +PITLSQIA  I D PSPD  
Sbjct  29    MLQGQANIWRHMFAFADSMALKCAVELRIADIIHSHA--RPITLSQIATCI-DFPSPDIT  85

Query  258   TLSRILRLLVRRKIFTSAVRP-SDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L+RI+R LVR KIFT+A  P SDG  T+YG TP+S+WL+ DA+LS+APM+L + HP  M
Sbjct  86    CLARIMRFLVRAKIFTAAPPPQSDGGETLYGLTPSSKWLLHDADLSLAPMVLMENHPSLM  145

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HCF  CVKEGG AFEKAHG+ I++ A+ +PEFNK FNDGM    +++   +V+ Y  
Sbjct  146   APWHCFGTCVKEGGIAFEKAHGRQIWDFASENPEFNKLFNDGMACTAKVVMGEVVAAYK-  204

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF S+ +LVDVGGGTG AVAE+VKA+PHIKGINFDLPHVVA+AP Y+GVSHVGGDMF S
Sbjct  205   DGFGSIRTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPHVVASAPAYEGVSHVGGDMFES  264

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP+A AIF+KW++HDW DE+C+KILKNCR+A+PEKTGK+IIVD V++ + D  F     V
Sbjct  265   IPNADAIFMKWIMHDWSDEDCIKILKNCRKAVPEKTGKIIIVDGVIREDSDDPFDKTRLV  324

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS---IIEAYSQ  1118
              DLLM+AHSS GKER+E EWK++L E GFP Y I++ I++++   IIEAY +
Sbjct  325   FDLLMMAHSSNGKERSEVEWKKVLEEGGFPRYRILE-ISISTLPMIIEAYPE  375



>gb|AFZ78576.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=351

 Score =   421 bits (1083),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 213/354 (60%), Positives = 273/354 (77%), Gaps = 4/354 (1%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             GS DE+ +L  Q +VW+ M  F +SMALK A++L IPDII+S     P+TL+QIA+ I D
Sbjct  2     GSLDEEKLLRGQVEVWQLMFGFAESMALKCAIELGIPDIINSLGG--PVTLNQIASGI-D  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQT  416
             SP  D   L+RI+R LVR+++FT  +    G T+YG T +S+WL+RD+E+S+APM+L Q 
Sbjct  59    SPCVDIPYLARIMRFLVRKRVFTQHIPSDGGETLYGLTDSSKWLLRDSEVSLAPMVLMQN  118

Query  417   HPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIV  596
             +P  +AP+H  S+CVKEGG AF+KAHG  I+++A+ +PEFN+ FND +    +II +A+V
Sbjct  119   YPWQLAPWHYLSQCVKEGGIAFKKAHGCEIWDLASQNPEFNRIFNDALACTAKIIMRAVV  178

Query  597   SGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGG  776
             S Y G GF  V +LVDVGGGTG  +AEIVKA+PHIKGINFDLPHVVA AP Y GVSHVGG
Sbjct  179   SHYKG-GFDDVETLVDVGGGTGGNLAEIVKAYPHIKGINFDLPHVVAAAPAYNGVSHVGG  237

Query  777   DMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFG  956
               F +IP+A +IF+KWVLHDWGDE+CVKILKNCR+A+PEKTGKLI+V+ VL+PEG+  FG
Sbjct  238   SFFEAIPNADSIFMKWVLHDWGDEDCVKILKNCRKAMPEKTGKLILVEIVLQPEGNGQFG  297

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             D+  V+DL+M AHS+GGKERTE EWK+LL E GFP Y II   A+ SIIEAY Q
Sbjct  298   DMGMVSDLVMFAHSTGGKERTELEWKKLLEEGGFPRYKIINIPALPSIIEAYLQ  351



>ref|XP_002277602.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase [Vitis vinifera]
Length=375

 Score =   422 bits (1084),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 218/352 (62%), Positives = 274/352 (78%), Gaps = 10/352 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA +W++M  F DSM LK A++LRI DIIHSHA  +PITLSQIA  I DSPSPD  
Sbjct  29    MLQGQANIWRHMFAFADSMVLKCALELRIADIIHSHA--RPITLSQIATCI-DSPSPDIT  85

Query  258   TLSRILRLLVRRKIFTSAVRP-SDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L+RI+R LV  KIFT+A  P SDG  T+YG TP+S+WL+ DAELS+APM+L + HP  M
Sbjct  86    CLARIMRFLVCAKIFTAAPPPQSDGGETLYGLTPSSKWLLHDAELSLAPMVLMENHPFLM  145

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HC   CVKEGG AFEKAHG+ I++ A+ +PEFNK FNDGM    +++   +V+ Y  
Sbjct  146   APWHCLGTCVKEGGIAFEKAHGRQIWDFASENPEFNKLFNDGMACTAKVVMGEVVAAYK-  204

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF S+ +LVDVGGGTG AVAE+VKA+PHIKGINFDLPHVVA+AP Y+GVSHVGGDMF S
Sbjct  205   DGFGSIRTLVDVGGGTGGAVAEVVKAYPHIKGINFDLPHVVASAPAYEGVSHVGGDMFES  264

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP+A AIF+KW++HDW DE+C+KILKNCR+A+PEKTGK+IIVD V++ + D  F     V
Sbjct  265   IPNADAIFMKWIMHDWSDEDCIKILKNCRKAVPEKTGKIIIVDGVIREDSDDPFDKTRLV  324

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS---IIEAYSQ  1118
              DLLM+AHSS GKER+E EWK++L E GFP Y I++ I++++   IIEAY +
Sbjct  325   FDLLMIAHSSNGKERSEVEWKKVLEEGGFPRYRILE-ISISTLPMIIEAYPE  375



>ref|XP_006371585.1| caffeic acid O-methyltransferase family protein [Populus trichocarpa]
 gb|ERP49382.1| caffeic acid O-methyltransferase family protein [Populus trichocarpa]
Length=351

 Score =   420 bits (1080),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 212/354 (60%), Positives = 274/354 (77%), Gaps = 4/354 (1%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             GS DE+++L  Q +VW+ M  F +SMALK A++L I DII+S     P+TL+QIA+ I D
Sbjct  2     GSLDEEALLRGQVEVWQLMFGFAESMALKCAIELGIADIINSLGG--PVTLNQIASGI-D  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQT  416
             SP  D   L+RI+R LVR+++FT  +    G T+YG T +S+WL+RD+E+S+APM+L Q 
Sbjct  59    SPCVDIPYLARIMRFLVRKRVFTQHIPSDGGETLYGLTDSSKWLLRDSEVSLAPMVLMQN  118

Query  417   HPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIV  596
             +P  +AP+H  S+CVKEGG AF+KAHG  I+++A+ +PEFN+ FND +    +II +A+V
Sbjct  119   YPWQLAPWHYLSQCVKEGGIAFKKAHGCEIWDLASQNPEFNRIFNDALACTAKIIMRAVV  178

Query  597   SGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGG  776
             S Y G GF  V +LVDVGGGTG  +AEIVKA+PHIKGINFDLPHVVA AP Y GVSHVGG
Sbjct  179   SHYKG-GFDDVETLVDVGGGTGGNLAEIVKAYPHIKGINFDLPHVVAAAPAYNGVSHVGG  237

Query  777   DMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFG  956
             + F +IP+A +IF+KWVLHDWGDE+CVKILKNCR+A+PEKTGKLI+V+ VL+PEG+  FG
Sbjct  238   NFFEAIPNADSIFMKWVLHDWGDEDCVKILKNCRKAMPEKTGKLILVEIVLQPEGNGQFG  297

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             D+  V+DL+M AHS+GGKERTE EWK+LL E GFP Y II   A+ SIIEAY Q
Sbjct  298   DMGMVSDLVMFAHSTGGKERTELEWKKLLEEGGFPRYKIINIPALPSIIEAYLQ  351



>gb|ACC63885.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
Length=351

 Score =   419 bits (1076),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 215/355 (61%), Positives = 276/355 (78%), Gaps = 6/355 (2%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             GS DE+++L  Q +VW+ M  F +SMALK A++L I DII+S     P+TL+QIA+ I D
Sbjct  2     GSLDEEALLRGQVEVWQLMFGFAESMALKCAIELGIADIINSLGG--PVTLNQIASGI-D  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQ  413
             SP  D   L+RI+R LVR+++FT    PSDG  T+YG T +S+WL+RD+E+S+APM+L Q
Sbjct  59    SPCVDIPYLARIMRFLVRKRVFTQH-NPSDGGETLYGLTDSSKWLLRDSEVSLAPMVLMQ  117

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              +P  +AP+H  S+CVKEGG AF+KAHG  I+++A+ +PEFN+ FND +    +II +A+
Sbjct  118   NYPWQLAPWHYLSQCVKEGGIAFKKAHGCEIWDLASQNPEFNRIFNDALACTAKIIMRAV  177

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             VS Y G GF  V +LVDVGGGTG  +AEIVKA+PHIKGINFDLPHVVA AP Y GVSHVG
Sbjct  178   VSHYKG-GFDDVETLVDVGGGTGGNLAEIVKAYPHIKGINFDLPHVVAAAPAYNGVSHVG  236

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIF  953
             G+ F +IP+A +IF+KWVLHDWGDE+CVKILKNCR+A+PEKTGKLI+V+ VL+PEG+  F
Sbjct  237   GNFFEAIPNADSIFMKWVLHDWGDEDCVKILKNCRKAMPEKTGKLILVEIVLQPEGNGQF  296

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             GD+  V+DL+M AHS+GGKERTE EWK+LL E GFP Y II   A+ SIIEAY Q
Sbjct  297   GDMGMVSDLVMFAHSTGGKERTELEWKKLLDEGGFPRYKIINIPALPSIIEAYLQ  351



>ref|XP_010094297.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
 gb|EXB55629.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
Length=354

 Score =   417 bits (1072),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 216/359 (60%), Positives = 282/359 (79%), Gaps = 17/359 (5%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS-  245
             +++ L  QA++WKYM +F DS+AL+ AV+L+IPDII+SH    PITL+QIA++I ++ S 
Sbjct  4     DEASLRGQAEIWKYMFNFADSLALRCAVELKIPDIINSHGG--PITLAQIASSIPNTSSD  61

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGA----TVYGPTPASRWLVRDA----ELSMAPM  401
             PD + L+RI+RLLVRRKIFT A +PSDG+     +YG T +S+WL+RD     + ++AP+
Sbjct  62    PDISCLARIMRLLVRRKIFT-AHQPSDGSGNSTILYGLTHSSKWLLRDTLGDDQHTLAPI  120

Query  402   LLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQII  581
              L +THP  ++P+HCFSRC+KEGG AFEK+HG+ I++ A+ +PEFNK FNDGME   +II
Sbjct  121   FLMETHPWLVSPWHCFSRCIKEGGIAFEKSHGREIWDFASENPEFNKLFNDGMECTAKII  180

Query  582   SKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGV  761
              KAI+S Y  DGF  +GSLVDVGGGTG A++EIVK+ PHIKG NFDLPHVVATAP Y GV
Sbjct  181   LKAILSEYK-DGFDYLGSLVDVGGGTGGALSEIVKSHPHIKGTNFDLPHVVATAPAYPGV  239

Query  762   SHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEG  941
             SHVGGDMF SIP+A A    W++HDWGDE+CVKILKNCR+A+PEK+GK+II+D VL PEG
Sbjct  240   SHVGGDMFESIPNADA----WIMHDWGDEDCVKILKNCRKAIPEKSGKVIIIDVVLNPEG  295

Query  942   DPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             + +F D   + DL+M+AH+SGGKERTE EWK++L E GF  Y I++  A+ SIIEAY Q
Sbjct  296   NGLFDDTGLIFDLVMVAHASGGKERTENEWKKILKEGGFSRYKIVKIPALTSIIEAYPQ  354



>ref|XP_007043544.1| O-methyltransferase [Theobroma cacao]
 gb|EOX99375.1| O-methyltransferase [Theobroma cacao]
Length=365

 Score =   416 bits (1070),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/367 (56%), Positives = 279/367 (76%), Gaps = 5/367 (1%)
 Frame = +3

Query  21    ASKFSPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQP  200
             + K + +E+    S + K+++  QA +W++M  F DSMALK AV+LRI DII+SH   +P
Sbjct  3     SKKQNLLEKKEMDSKEAKALVQGQATIWQFMFGFADSMALKCAVELRIADIINSHH--RP  60

Query  201   ITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRD  377
             ITL+QIA+ I  S SPD   L+RI+R L+RRK+F  A  PSDG   +YG T +SRWL+ D
Sbjct  61    ITLAQIASCIDGSASPDITCLARIMRFLIRRKLFI-AHHPSDGGECLYGLTHSSRWLLHD  119

Query  378   AELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDG  557
             +ELS+AP++L Q HP  MAP+H FSRC +EGG AF+ AHG+ +FE A+ +P FNK FND 
Sbjct  120   SELSLAPLILMQDHPWLMAPWHYFSRCAREGGIAFKVAHGREVFEFASANPTFNKLFNDA  179

Query  558   MESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVA  737
             M   ++++++AI+S Y  DGF S+GSLVDVGGGTG  ++EIV+A+PH+KG NFDLPHV+ 
Sbjct  180   MACTSKVVTRAILSEYK-DGFSSIGSLVDVGGGTGGMISEIVRAYPHVKGTNFDLPHVIE  238

Query  738   TAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIV  917
             TAP Y GV H+GGDMF +IP+A A+ +KW+LHDW  E+C+KIL+NCR+A+P +TGK+I+V
Sbjct  239   TAPTYHGVCHIGGDMFQAIPNADAVIMKWILHDWSSEDCIKILRNCRDAIPSETGKVILV  298

Query  918   DAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS  1097
             + VL+P+G  +F D+S + DL+MLAHSSGGK+RTE EWK+LL EAGFP Y ++   A+  
Sbjct  299   ECVLQPDGSGLFDDVSLILDLVMLAHSSGGKQRTELEWKKLLNEAGFPRYKVLNIPALPC  358

Query  1098  IIEAYSQ  1118
             IIEAY +
Sbjct  359   IIEAYPK  365



>dbj|BAC78828.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=359

 Score =   412 bits (1059),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 223/363 (61%), Positives = 276/363 (76%), Gaps = 11/363 (3%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             ME V +   DE S L  QA VWKYML F DSMALK+AV+LRIPDIIHSH  A  +TLS+I
Sbjct  1     MEAVTE--LDEAS-LRGQADVWKYMLRFADSMALKSAVELRIPDIIHSHDHA--LTLSEI  55

Query  219   AAAIHD-SPSPDTATLSRILRLLVRRKIFTSAVRPSD-GATVYGPTPASRWLVRDAELSM  392
               +    SPSPD   LSRI+RLLVRR IFT+     D G T+YG T +SRWL+ D+E ++
Sbjct  56    TCSFDSASPSPDITCLSRIMRLLVRRNIFTAQPDGGDSGETLYGLTHSSRWLLHDSEFTL  115

Query  393   APMLLFQTHPLSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESV  569
             APM+L +T+   M P+HCFS+CVK+G   AFEKAHG+ I++  +  PEFN+ FNDGM   
Sbjct  116   APMVLMETNSTLMEPWHCFSQCVKQGTPCAFEKAHGRDIWQFFSEKPEFNRLFNDGMSCT  175

Query  570   TQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPE  749
              +I  KA+++GY G GF +V +LVDVGGGTG+AVAEIVK +P IKGINFDLPHVVA APE
Sbjct  176   AKITMKAMLTGYKG-GFDNVATLVDVGGGTGSAVAEIVKLYPSIKGINFDLPHVVAIAPE  234

Query  750   YQGVSHVGGDMFV--SIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDA  923
             Y GVSHVGGDMF   +IP+  AIF+KW++HDW D +CVKILKNCR+A+PE++GK+IIVD 
Sbjct  235   YHGVSHVGGDMFDGGNIPNTDAIFMKWIMHDWSDNDCVKILKNCRKAIPERSGKVIIVDV  294

Query  924   VLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASII  1103
             VL+P GD +F D   V DLLM+AH+SGGKERTE EWK++L  AGFP Y II+  A++SII
Sbjct  295   VLEPNGDGMFDDTGLVFDLLMIAHASGGKERTESEWKKMLELAGFPRYKIIKIPALSSII  354

Query  1104  EAY  1112
             EAY
Sbjct  355   EAY  357



>gb|KDP24163.1| hypothetical protein JCGZ_25820 [Jatropha curcas]
Length=354

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 213/352 (61%), Positives = 270/352 (77%), Gaps = 4/352 (1%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             + +++L  QAQ+W++M  F DSMALK+AV+LRI DIIHSH    P+TLSQ++++I+   +
Sbjct  6     EAQALLKGQAQLWQHMFAFADSMALKSAVELRIADIIHSHGG--PVTLSQLSSSINSPSN  63

Query  246   P-DTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHP  422
               D + L RI+RLLVRR IFT  + P    T+YG T  SRWLV D++L++APML+ + HP
Sbjct  64    NPDISYLKRIMRLLVRRNIFTVDLSPDGKETLYGLTNVSRWLVHDSDLTLAPMLIMENHP  123

Query  423   LSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSG  602
              +M P+H  S CVKEGG AF+KA+G  I+E A+  PEFN  FN GM    +++ +AI+ G
Sbjct  124   SAMNPWHFLSECVKEGGIAFQKANGYEIWEFASRYPEFNVMFNSGMACTARVVIRAILVG  183

Query  603   YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
             Y  DGF  +GSLVDVGGGTG  VAEIVK+ PHIKGINFDLPHVV TAP Y+GVSHVGGDM
Sbjct  184   YK-DGFGCMGSLVDVGGGTGNLVAEIVKSHPHIKGINFDLPHVVDTAPVYEGVSHVGGDM  242

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDI  962
             F +IP+A A+ +KW++HDWGD++CVKILKNCR+A+PEK GK+IIVD VLKPEG+ +F D 
Sbjct  243   FKAIPNADAVIMKWIMHDWGDDDCVKILKNCRKAIPEKKGKVIIVDIVLKPEGNDLFDDT  302

Query  963   SYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
               V DLLM+AHSSGGKERTE EWK LL E GFP YNII+  A+ SIIEA+ Q
Sbjct  303   GLVFDLLMIAHSSGGKERTEAEWKILLEEGGFPRYNIIKIPALTSIIEAFPQ  354



>ref|XP_010035708.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW47147.1| hypothetical protein EUGRSUZ_K00951 [Eucalyptus grandis]
Length=360

 Score =   409 bits (1052),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 212/361 (59%), Positives = 273/361 (76%), Gaps = 10/361 (3%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
             M+   D ++ L  QA +WK+M  F+DSMALK AV+LRIPDIIHS+    P+TL QIA+ I
Sbjct  1     MESLDDTEATLRGQAHIWKHMFAFVDSMALKCAVELRIPDIIHSYGGG-PVTLVQIASRI  59

Query  231   HDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-----VYGPTPASRWLVRD--AELS  389
               SPSP T  L+RI+RLLVR+ IF++  R  DG+      +Y    +SRWL++   +E S
Sbjct  60    -PSPSPGTTYLARIMRLLVRKNIFSAHRRQPDGSQESHEMLYSLNQSSRWLLQGPGSENS  118

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESV  569
             +APM+L + H   M+P+HC   CV+ GG AFE AHG+ I++ A+ +PEFN  FNDGM   
Sbjct  119   LAPMVLMEDHQWLMSPWHCLGDCVRTGGVAFEIAHGRKIWDFASENPEFNHLFNDGMACT  178

Query  570   TQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPE  749
             ++I+ KAIV GY   GF S+GSLVDVGGGTG AVAEI+K++PHI+GINFDLPHVVATAP 
Sbjct  179   SKILVKAIVEGYK-HGFESIGSLVDVGGGTGGAVAEIIKSYPHIQGINFDLPHVVATAPA  237

Query  750   YQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL  929
             + GV+HVGGDMF +IP A A+F+KW++HDWG+E+CVKILKNCREA+PE+ GK+II + VL
Sbjct  238   HAGVTHVGGDMFETIPHADAVFMKWIMHDWGNEDCVKILKNCREAIPERNGKVIIAEVVL  297

Query  930   KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
             KPEGD +F +I  V DLLM+AHSSGGKER E EWK++L E GFP YNII+  ++ SIIEA
Sbjct  298   KPEGDGMFDEIGLVFDLLMIAHSSGGKERDELEWKKILEEGGFPRYNIIKTPSMLSIIEA  357

Query  1110  Y  1112
             Y
Sbjct  358   Y  358



>ref|XP_002517958.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44476.1| o-methyltransferase, putative [Ricinus communis]
Length=351

 Score =   404 bits (1039),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 206/355 (58%), Positives = 273/355 (77%), Gaps = 6/355 (2%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             GS + + ++  Q ++WK M  F DSM LKAAV+LRIPDII+SHA  +PITLSQIA+ I D
Sbjct  2     GSLEPEKLVSGQLEIWKLMFGFADSMVLKAAVELRIPDIINSHA--RPITLSQIASGI-D  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQ  413
             S SPD + L+RI+R LV + IFT A +PSDG  + YG    +RWL+RD++L++ PM++ +
Sbjct  59    SSSPDISYLARIMRYLVCKGIFT-AHQPSDGGESFYGLAENTRWLLRDSDLTLHPMVIME  117

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              HP  + P+H   +CVKEGG AF+KAHG  +++ A+ +PEFN+ FN  +    +I+ KA+
Sbjct  118   NHPWQVTPWHYLGQCVKEGGIAFKKAHGCEMWDFASQNPEFNRIFNQALACTAKIVMKAV  177

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             +SGY  DGF ++ +LVDVGGGTG  +AEIVKA+PHIK +NFDLPHVVATAP + G++HVG
Sbjct  178   LSGYK-DGFDAITTLVDVGGGTGGNLAEIVKAYPHIKTLNFDLPHVVATAPAFDGIAHVG  236

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIF  953
             G+MF SIP+A AIF+KW+LHDWGDE CVKILKNCR+A+PEKTGKL++V+ VL+ +G+  F
Sbjct  237   GNMFESIPNADAIFMKWILHDWGDEYCVKILKNCRKAIPEKTGKLVLVEIVLQEDGNNQF  296

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             GD+  V DLLM AH++GGKER+E EWK+LL E GFP Y II   A+ SIIEAY Q
Sbjct  297   GDMGLVFDLLMFAHTTGGKERSEIEWKKLLEEGGFPRYKIINIPALPSIIEAYPQ  351



>ref|XP_010051712.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89505.1| hypothetical protein EUGRSUZ_A01796 [Eucalyptus grandis]
Length=361

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 219/367 (60%), Positives = 272/367 (74%), Gaps = 13/367 (4%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             ME   +G  D  +ML  QA++W+YML F DSMAL  AV+LRI DIIHSH+  +P+TL+QI
Sbjct  1     MEGAKEG--DAAAMLRGQAEIWRYMLGFADSMALNCAVELRIADIIHSHSG-RPVTLAQI  57

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATV-YGPTPASRWLVRDAELSMA  395
             A +I  SPSPD   LSR++RLLVRR IF S  RPSDG  + Y  T  SRWLVRD+EL++ 
Sbjct  58    ARSIEGSPSPDLPYLSRVMRLLVRRNIF-SVHRPSDGGDLLYSLTDLSRWLVRDSELNLV  116

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             PM++ + HPL +AP+HC  +CV+EGG AF+KAHG  I+E A  +PEFNK FND M    +
Sbjct  117   PMVIMENHPLQLAPWHCLGQCVREGGIAFQKAHGVEIWEFARDNPEFNKIFNDAMACTAK  176

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             II KA    Y G+GF  VGS+VDVGGGTG  +AEIV+A+P I+GINFDLPHVVATAP + 
Sbjct  177   IIMKAAFEAY-GEGFSLVGSVVDVGGGTGGVIAEIVRAYPRIRGINFDLPHVVATAPAHD  235

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP---EKTGKLIIVDAV  926
             GV HVGG+MF +IP A A+F+KWVLHDWGDE+CVKILKNCR+A+    +K GKLIIVD V
Sbjct  236   GVEHVGGNMFEAIPKADAVFLKWVLHDWGDEDCVKILKNCRKAIASSDQKPGKLIIVDLV  295

Query  927   LKPE---GDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS  1097
             L+ +   GDP F D+    DL+M+A  SGGKERTE EWK LL + GFP +NII+  A+ S
Sbjct  296   LRDQEGSGDP-FEDVGVTFDLIMMALQSGGKERTEAEWKVLLEQGGFPRHNIIKIQALPS  354

Query  1098  IIEAYSQ  1118
             IIEA+ Q
Sbjct  355   IIEAFPQ  361



>ref|XP_010036415.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   402 bits (1033),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 204/359 (57%), Positives = 271/359 (75%), Gaps = 11/359 (3%)
 Frame = +3

Query  60    SFDE-KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             S DE ++ L  QA +WK M  + DSMALK AV+LR+PDIIHS+    P+TL+QIA+ I  
Sbjct  3     SLDETEATLRGQAHIWKLMYAYADSMALKCAVELRVPDIIHSYGGG-PVTLAQIASRI-P  60

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-----TVYGPTPASRWLVRD--AELSMA  395
             SPSP TA L+RI+RLLVR+ IF++     DG      T+Y  TP+SRWL++   +ELS+A
Sbjct  61    SPSPGTAYLARIMRLLVRKNIFSANHCEPDGGHESHETLYSLTPSSRWLLQGPGSELSLA  120

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             P++L + HP  M+P+HCF  CVK GG AFE AHG+ I++ A+ +PEFN+ FNDGM  V+ 
Sbjct  121   PLVLMENHPWLMSPWHCFGDCVKTGGIAFEMAHGRKIWDFASENPEFNRLFNDGMACVSG  180

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             ++ + IV  Y  DGF S+GSLVDVGGG G  +AEI K+F HI+GINFDLPHVVATAP + 
Sbjct  181   VVVRGIVEVYK-DGFESIGSLVDVGGGVGKTLAEITKSFSHIQGINFDLPHVVATAPAHD  239

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKP  935
             GV+HVGG+MF +IP A A+F+KW++HDWGD++CVKILKNC++ +PEK GK+II D VLKP
Sbjct  240   GVTHVGGNMFETIPHADAVFMKWIMHDWGDKDCVKILKNCKKEIPEKNGKVIIADVVLKP  299

Query  936   EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             EG+ +F +   V+DL+M+ H SGGKER E EWK++L E GFP++NII+  ++ SIIEAY
Sbjct  300   EGNGMFDETRLVSDLVMMVHRSGGKERDELEWKKILEEGGFPHFNIIKTPSLFSIIEAY  358



>gb|KHN31955.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Glycine 
soja]
Length=369

 Score =   401 bits (1031),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 199/363 (55%), Positives = 268/363 (74%), Gaps = 7/363 (2%)
 Frame = +3

Query  33    SPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLS  212
             SP  E    S +E+  L  Q ++W+YM  F DS+ALK+ ++LRI DII  +   +P++LS
Sbjct  9     SPPLEFKGMSKEEEDSLLGQVEIWRYMTCFTDSVALKSVIELRIADIIDRYG--KPLSLS  66

Query  213   QIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSM  392
             QI   I D+PSPD + L R++R++VRRKIF SA +   G T+YG T AS+W++RD ++++
Sbjct  67    QIVENIDDAPSPDASLLQRVMRVMVRRKIF-SAEQSETGETLYGLTRASKWILRDTKMTL  125

Query  393   APMLLFQTHPLSMAPFHCFSRCVKEG---GFAFEKAHGKGIFEMAAGDPEFNKSFNDGME  563
             APMLL + HP+ + P H  S  ++EG   G AF K HG   FEM   DPE+N+ FN+GM 
Sbjct  126   APMLLLENHPIHLNPAHYISEIIREGTKNGTAFFKCHGHEQFEMTGLDPEYNRLFNEGMV  185

Query  564   SVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATA  743
                +++SKA+++GY  DGF  + SLVDVGGG G +++EIV+A+PHI  INFDLPHVVATA
Sbjct  186   CTARVVSKAVITGYK-DGFNQIKSLVDVGGGIGGSLSEIVRAYPHINAINFDLPHVVATA  244

Query  744   PEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDA  923
             P+Y G++HVGGDMFVSIP A AI++KW+LHDW DE CVKILKNCR+A+PEKTGK+IIVD 
Sbjct  245   PKYDGITHVGGDMFVSIPDADAIYMKWILHDWSDEHCVKILKNCRKAIPEKTGKVIIVDH  304

Query  924   VLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASII  1103
             VL+PEG+ +F D+    D+++LAH++GGKERTEE WK L  E GF  YNII+  A+ SII
Sbjct  305   VLRPEGNELFTDVGIAFDMMLLAHNAGGKERTEENWKWLFKETGFARYNIIKINALPSII  364

Query  1104  EAY  1112
             EA+
Sbjct  365   EAF  367



>ref|NP_001243073.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Glycine max]
 gb|AEV53337.1| inositol methyltransferase [Glycine max]
 gb|KHN41138.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Glycine 
soja]
Length=369

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 199/370 (54%), Positives = 271/370 (73%), Gaps = 13/370 (4%)
 Frame = +3

Query  12    HSPASKFSPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAA  191
             HSP  +F  +      S +E+  L  Q ++W+YM  F DS+ALKA ++LRI DI+  +  
Sbjct  8     HSPPLEFKGL------SKEEEDSLLGQVEIWRYMTCFTDSVALKAVIELRIADILDRYG-  60

Query  192   AQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV  371
              +P++LSQI   I D+PSPD + L R+LR++VRRKIF SA     G T++G T AS+W++
Sbjct  61    -KPLSLSQIVENIEDAPSPDASLLQRVLRVMVRRKIF-SAQESETGETLFGLTRASKWIL  118

Query  372   RDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEG---GFAFEKAHGKGIFEMAAGDPEFNK  542
             RD ++++APMLL + HP+ + P H  S  ++EG   G AF K HG   FEM   DPE+N+
Sbjct  119   RDTKMTLAPMLLLENHPIHLNPAHYISEIIREGTKNGTAFFKCHGHEQFEMTGLDPEYNR  178

Query  543   SFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDL  722
              FN+GM    +++SKA+++GY  DGF  + SLVDVGGG G +++EIV+A+PHI  INFDL
Sbjct  179   LFNEGMVCTARVVSKAVITGYK-DGFNQIKSLVDVGGGIGGSLSEIVRAYPHINAINFDL  237

Query  723   PHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTG  902
             PHVVATAP++ G++HVGGDMFVSIPSA AI++KW+LHDW DE C+KILKNCR+A+PEKTG
Sbjct  238   PHVVATAPKFDGITHVGGDMFVSIPSADAIYMKWILHDWSDEHCIKILKNCRKAIPEKTG  297

Query  903   KLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQN  1082
             K+IIVD VL+PEG+ +F D+    D+++LAH++GGKERTEE WK L  E GF  YNII+ 
Sbjct  298   KVIIVDHVLRPEGNELFTDVGIAFDMMLLAHNAGGKERTEENWKWLFKETGFARYNIIKI  357

Query  1083  IAVASIIEAY  1112
              A+ SIIEA+
Sbjct  358   NALPSIIEAF  367



>ref|XP_010052213.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89562.1| hypothetical protein EUGRSUZ_A01846 [Eucalyptus grandis]
Length=361

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 215/366 (59%), Positives = 270/366 (74%), Gaps = 11/366 (3%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             ME   +G  D  +ML  QA++W+YML F DSM L  AV+LRI DIIHSH   +P+TL+QI
Sbjct  1     MEGAKEG--DAAAMLRGQAEIWRYMLSFADSMVLNCAVELRIADIIHSHGG-RPVTLAQI  57

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSD-GATVYGPTPASRWLVRDAELSMA  395
             A +I  SPSPD   LSR++RLLVRR IF S   PSD G  +YG T +SRWLVRD+EL++ 
Sbjct  58    ARSIEGSPSPDLPYLSRVMRLLVRRNIF-SVHHPSDSGDPLYGLTDSSRWLVRDSELNLV  116

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             PM++ + HPL +AP+HC  +CV+EGG AF+KAHG  ++E A  +PEFNK FN+ M    +
Sbjct  117   PMVIMENHPLQLAPWHCLGQCVREGGIAFQKAHGVKMWEFAGDNPEFNKMFNEAMACTAK  176

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             II KA++  Y GDGF  VGS+VDVGGGTG  +AEIV+A+PHI+GINFDL HVVATAP + 
Sbjct  177   IIMKAVLEAY-GDGFSLVGSVVDVGGGTGGVIAEIVRAYPHIRGINFDLLHVVATAPAHD  235

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP---EKTGKLIIVDAV  926
             GV HVGG MF +IP A A+F+KWVLHDWGDE+CVKILKNCR+A+    +K GKLI+VD V
Sbjct  236   GVEHVGGSMFEAIPKADAVFLKWVLHDWGDEDCVKILKNCRKAIASSDQKPGKLIMVDLV  295

Query  927   L--KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASI  1100
             L  +     +F D+    DLLM+AH SGGKERTE EWK LL + GFP +NII+  A+ SI
Sbjct  296   LLDREGSGGLFEDVGVTFDLLMMAHQSGGKERTESEWKLLLEQGGFPRHNIIKIQALPSI  355

Query  1101  IEAYSQ  1118
             IEA+ Q
Sbjct  356   IEAFPQ  361



>ref|XP_003539906.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Glycine 
max]
Length=363

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/354 (55%), Positives = 265/354 (75%), Gaps = 7/354 (2%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             S +E+  L  Q ++W+YM  F DS+ALK+ ++LRI DII  +   +P++LSQI   I D+
Sbjct  12    SKEEEDSLLGQVEIWRYMTCFTDSVALKSVIELRIADIIDRYG--KPLSLSQIVENIDDA  69

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTH  419
             PSPD + L R++R++VRRKIF SA +   G T+YG T AS+W++RD ++++APMLL + H
Sbjct  70    PSPDASLLQRVMRVMVRRKIF-SAEQSETGETLYGLTRASKWILRDTKMTLAPMLLLENH  128

Query  420   PLSMAPFHCFSRCVKEG---GFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKA  590
             P+ + P H  S  ++EG   G AF K HG   FEM   DPE+N+ FN+GM    +++SKA
Sbjct  129   PIHLNPAHYISEIIREGTKNGTAFFKCHGHEQFEMTGLDPEYNRLFNEGMVCTARVVSKA  188

Query  591   IVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHV  770
             +++GY  DGF  + SLVDVGGG G +++EIV+A+PHI  INFDLPHVVATAP+Y G++HV
Sbjct  189   VITGYK-DGFNQIKSLVDVGGGIGGSLSEIVRAYPHINAINFDLPHVVATAPKYDGITHV  247

Query  771   GGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPI  950
             GGDMFVSIP A AI++KW+LHDW DE CVKILKNCR+A+PEKTGK+IIVD VL+PEG+ +
Sbjct  248   GGDMFVSIPDADAIYMKWILHDWSDEHCVKILKNCRKAIPEKTGKVIIVDHVLRPEGNEL  307

Query  951   FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             F D+    D+++LAH++GGKERTEE WK L  E GF  YNII+  A+ SIIEA+
Sbjct  308   FTDVGIAFDMMLLAHNAGGKERTEENWKWLFKETGFARYNIIKINALPSIIEAF  361



>ref|XP_008230261.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Prunus 
mume]
Length=356

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 213/352 (61%), Positives = 267/352 (76%), Gaps = 5/352 (1%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAA-QPITLSQIAAAIHDSP  242
             + ++ML  QA +WKYM  F DSMALK AV+LRI DIIHSHA     ITLSQIA+ +  +P
Sbjct  5     EAEAMLRGQADIWKYMFGFADSMALKCAVELRIADIIHSHAPTDHMITLSQIASHL-VAP  63

Query  243   SPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHP  422
             SPD   L+RI+RLLVRR IF        G  +YG T +SRWL+ D+E+S+APML+ + HP
Sbjct  64    SPDITCLTRIMRLLVRRNIFAVHHPSEGGEPLYGLTYSSRWLLHDSEMSLAPMLVMENHP  123

Query  423   LSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
               MAP+H FS+CVKEGG  AF+KAHG  I++ A+ +P FNK FNDGM    +I+ KAI++
Sbjct  124   SLMAPWHYFSQCVKEGGPGAFKKAHGLEIWDFASENPGFNKLFNDGMACTARIVMKAILT  183

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGD  779
              YG  GF  VGSLVDVGGGTG+AVAEIV+A+P+IKG NFDLPHVVATAP Y GVSHVGGD
Sbjct  184   EYG-HGFDGVGSLVDVGGGTGSAVAEIVQAYPNIKGFNFDLPHVVATAPAYHGVSHVGGD  242

Query  780   MFVS-IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFG  956
             MF   IP+A A+F+KW++HDW D +C+KILKNCREA+PE+ GK++IVD VL+P GD +  
Sbjct  243   MFEDHIPNADAVFMKWIMHDWNDCDCIKILKNCREAIPERGGKIMIVDIVLEPSGDGVLD  302

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             D   V DL+M+AH+SGG ERTE EW+++L E GFP Y II+  A+ SIIEAY
Sbjct  303   DTRLVFDLVMIAHASGGMERTENEWEKILKEGGFPRYKIIKIPALLSIIEAY  354



>gb|KHG13565.1| RS-norcoclaurine 6-O-methyltransferase [Gossypium arboreum]
Length=365

 Score =   399 bits (1026),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 207/349 (59%), Positives = 269/349 (77%), Gaps = 4/349 (1%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS-PS  245
             +++ L  QA++W+YM  F DSMALK+AV+LRI DIIHSH  A  ITLSQIA+ I+    S
Sbjct  16    DEARLQGQAEIWRYMFSFADSMALKSAVELRIADIIHSHGVA--ITLSQIASCINGCLTS  73

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
             PD  TL+ I+RLLVRRKIFT       G  +Y  T +SRWL+ D+E ++APM+L + HP 
Sbjct  74    PDITTLASIMRLLVRRKIFTVHHPLDGGDPLYDLTHSSRWLLHDSEQTLAPMVLMENHPW  133

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              +AP+HCFS+CVKEGG AF+KAHG+ I+++A+G+PEFNK FNDG+ S +++++ AI+SGY
Sbjct  134   LIAPWHCFSQCVKEGGIAFKKAHGREIWDLASGNPEFNKLFNDGLASTSKVVTSAILSGY  193

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
                G  S+ SLVDVGGG G  ++EIVKA+PHIKG+NFDLPHVV  AP Y  +SHVGGDMF
Sbjct  194   K-QGLSSIESLVDVGGGIGGLISEIVKAYPHIKGVNFDLPHVVLAAPAYNEISHVGGDMF  252

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
               IP+A A+ +KWVLHDWGDE+C+KILKNCR+A+P + GK+IIV+ V+K EG  +F D+ 
Sbjct  253   HVIPNANAVIMKWVLHDWGDEDCIKILKNCRKAIPRENGKVIIVEVVVKAEGSGVFDDMG  312

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             ++ DLLM+AHSSGGKERTE EWK++L E GF  Y II   A+ SIIEAY
Sbjct  313   FIFDLLMIAHSSGGKERTEVEWKKILEEGGFSRYKIIDIPALPSIIEAY  361



>ref|XP_004299536.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=359

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 213/353 (60%), Positives = 265/353 (75%), Gaps = 8/353 (2%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD-SPS  245
             +++ L  QA VWKYML F DSMALK+AV+LRIPDII+SH   Q ++LS I + I   SPS
Sbjct  8     DEATLRGQADVWKYMLGFADSMALKSAVELRIPDIINSHC--QALSLSDIVSNIDSKSPS  65

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSD-GATVYGPTPASRWLVRDAELSMAPMLLFQTHP  422
             PD   LSRI+RLLVRR IF +     D G T+YG TP+SRWL++D+EL++APM+L QT P
Sbjct  66    PDITCLSRIMRLLVRRNIFAAHHDDGDSGETLYGLTPSSRWLLQDSELTLAPMVLLQTDP  125

Query  423   LSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
             + MAP   FS+CVK+GG  AF KAHG+ I++  + + E N+ FND M     II K I++
Sbjct  126   ILMAPMQYFSQCVKQGGTHAFSKAHGRDIWQFFSENLEANQLFNDAMACSANIIMKVILA  185

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGD  779
                G  F  V +LVDVGGGTG A AEIVKA+P IK INFDLP+VVATAP Y GVSHVGGD
Sbjct  186   RCKG-AFDDVTTLVDVGGGTGRAAAEIVKAYPSIKAINFDLPYVVATAPAYHGVSHVGGD  244

Query  780   MFV--SIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIF  953
             MF   +IP+A AIF+KW++HDW D +C+KILKNCR+A+PE++GK+IIVDAVL+P GD +F
Sbjct  245   MFDEGNIPNADAIFMKWIMHDWSDGDCIKILKNCRKAIPERSGKVIIVDAVLEPNGDGLF  304

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              D   V DLLM+ HSSGGKER+E EWK++L +AGFP YNII   AV SIIEAY
Sbjct  305   DDTGLVFDLLMITHSSGGKERSESEWKQMLEQAGFPRYNIINIPAVVSIIEAY  357



>gb|AFK39321.1| unknown [Lotus japonicus]
Length=369

 Score =   398 bits (1022),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 200/366 (55%), Positives = 267/366 (73%), Gaps = 7/366 (2%)
 Frame = +3

Query  24    SKFSPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPI  203
             SK SP       S +E+  L  Q ++W+YM  F DS+ALK+ ++LR+ DII      +P+
Sbjct  6     SKHSPPLAFKGVSKEEEESLLGQVEIWRYMCAFTDSVALKSIIELRVADIIDRFG--KPL  63

Query  204   TLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAE  383
             +LSQIAA I D+PSPD   L R++R++VRRKIF SA +   G T+YG T AS+W++RD +
Sbjct  64    SLSQIAANIEDAPSPDVKLLERLMRVMVRRKIF-SAEKSESGETLYGLTRASKWILRDTK  122

Query  384   LSMAPMLLFQTHPLSMAPFHCFSRCVKEG---GFAFEKAHGKGIFEMAAGDPEFNKSFND  554
             +++APMLL + HP+ + P H  S  V+EG   G  F + HG   FEM   D E+N+ FN+
Sbjct  123   MTLAPMLLLENHPIHLNPAHYISDTVREGKENGTPFLRCHGHDQFEMTGLDEEYNRLFNE  182

Query  555   GMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVV  734
             GM    +I+ +A++SGY  DGF  + SLVDVGGG G +++EIV+A+PHIK INFDLPHVV
Sbjct  183   GMVCTARIVPRAVISGYK-DGFNQIESLVDVGGGIGGSLSEIVRAYPHIKAINFDLPHVV  241

Query  735   ATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLII  914
             ATAP Y G++HVGGDMFVS+P+A AI++KW+LHDW DE C+KILKNCREA+PEKTGK+II
Sbjct  242   ATAPPYDGITHVGGDMFVSVPNADAIYMKWILHDWSDEHCIKILKNCREAIPEKTGKVII  301

Query  915   VDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVA  1094
             VD VL+PEG+  F D  +  D+++LAH+SGGKERTEE W+ L  E GFP YNII+  A+ 
Sbjct  302   VDHVLQPEGNEPFSDTGHAFDMMLLAHNSGGKERTEENWQYLFKETGFPRYNIIKINALP  361

Query  1095  SIIEAY  1112
             SIIEA+
Sbjct  362   SIIEAF  367



>gb|KEH17409.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=369

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 202/370 (55%), Positives = 269/370 (73%), Gaps = 13/370 (4%)
 Frame = +3

Query  12    HSPASKFSPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAA  191
             HSP S F  +      S +E+  L  Q ++WKYM  F DS ALKA V+LRI DII     
Sbjct  8     HSPPSVFKGV------SKEEEESLLGQIEIWKYMTQFTDSFALKAVVELRIADIIDRQC-  60

Query  192   AQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV  371
              +P++L++I   + D+PSPD+  L R++R++VRRKIF SA +   G  +YG T AS+W++
Sbjct  61    -KPLSLTEIVQNLEDAPSPDSTLLLRVMRVMVRRKIF-SAEKSETGEILYGLTRASKWIL  118

Query  372   RDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEG---GFAFEKAHGKGIFEMAAGDPEFNK  542
             +D ++++AP++L +THP+ M PF+  S  VKEG   G AF + HG   FEMA+ DP+FN+
Sbjct  119   QDTKVTLAPLVLLETHPIHMNPFNFMSDIVKEGTKNGTAFFRCHGYDQFEMASVDPKFNE  178

Query  543   SFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDL  722
              FN G    T  + +A+++GY  DGF  + +LVDVGGG G +++EIVKA+PHI+GINFDL
Sbjct  179   LFNKGQACTTGFVFRAVIAGYK-DGFNQIQTLVDVGGGIGGSMSEIVKAYPHIQGINFDL  237

Query  723   PHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTG  902
             PHVV+TAP+Y G++HVGGDMFVSIPSA AI+IKW+LHDW D+ CVKILKNCR+A+PEKTG
Sbjct  238   PHVVSTAPKYDGITHVGGDMFVSIPSADAIYIKWILHDWSDDHCVKILKNCRKAIPEKTG  297

Query  903   KLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQN  1082
             K+II+D VL PEGD  F DI    D+++ AH+SGGKERTEE WK L  E GFP YNII+ 
Sbjct  298   KVIILDHVLDPEGDEPFTDIGIAFDMILFAHNSGGKERTEENWKYLFKETGFPRYNIIKI  357

Query  1083  IAVASIIEAY  1112
              A+ SIIEA+
Sbjct  358   NALLSIIEAF  367



>ref|XP_007215606.1| hypothetical protein PRUPE_ppa007776mg [Prunus persica]
 gb|EMJ16805.1| hypothetical protein PRUPE_ppa007776mg [Prunus persica]
Length=356

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 210/352 (60%), Positives = 267/352 (76%), Gaps = 5/352 (1%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAA-QPITLSQIAAAIHDSP  242
             + ++ML  QA +WKYM  F DSMALK AV+LRI DIIHSHA     ITLSQIA+ +  +P
Sbjct  5     EAEAMLRGQADIWKYMFGFADSMALKCAVELRIADIIHSHAPTDHMITLSQIASHL-IAP  63

Query  243   SPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHP  422
             SPD   L+RI+RLLVRR IF        G  VYG T +SRWL+ D+E+S+APML+ + HP
Sbjct  64    SPDITCLTRIMRLLVRRNIFAVHHPSEGGEPVYGLTYSSRWLLHDSEMSLAPMLVMENHP  123

Query  423   LSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
               MAP+H FS+CV+EGG +AF+KAHG  I++ A+ +P FNK FNDGM    +I+ KAI++
Sbjct  124   SLMAPWHYFSQCVREGGPWAFKKAHGLEIWDFASENPGFNKLFNDGMACTARIVMKAILT  183

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGD  779
              YG   F  VGSLVDVGGGTG+AVA+IV+A+P+IKG NFDLPHVVATAP Y GVSHVGGD
Sbjct  184   EYG-RWFDGVGSLVDVGGGTGSAVADIVQAYPNIKGFNFDLPHVVATAPAYHGVSHVGGD  242

Query  780   MFVS-IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFG  956
             MF   IP+A A+F+KW++HDW D +C+KILKNCR+A+PE+ GK++I D VL+P GD +  
Sbjct  243   MFEDHIPNADAVFMKWIMHDWNDSDCIKILKNCRKAIPERGGKIMIADIVLEPSGDGVLD  302

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             D   V DL+M+AH+SGGKERTE EW+++L E GFP Y II+  A+ SIIEAY
Sbjct  303   DTRLVFDLVMIAHASGGKERTENEWEKILKEGGFPRYKIIKIPALLSIIEAY  354



>gb|KHG03500.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Gossypium 
arboreum]
Length=354

 Score =   395 bits (1016),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 272/350 (78%), Gaps = 7/350 (2%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIH-DSPS  245
             +++ML  QA++W+Y+  F DSMALK AV+LRI DIIHS+    P+TLSQIA+ I+ D  S
Sbjct  7     DEAMLQGQAEIWRYLYSFADSMALKCAVELRIADIIHSNGG--PLTLSQIASCINGDLTS  64

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHP  422
             PD  TL+RI+RLL+RRKIFT    PSDG   +Y  T +SRWL+ D++ ++ PM+L + HP
Sbjct  65    PDITTLARIMRLLIRRKIFTVH-HPSDGGDLLYDLTHSSRWLLHDSKQTLMPMVLMENHP  123

Query  423   LSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSG  602
             L MAP+H FS+CVKEGGFAF+KAHG  I+++A+ +P+FNK FNDG+   ++ ++  I+S 
Sbjct  124   LQMAPWHYFSQCVKEGGFAFKKAHGCEIWDLASRNPDFNKLFNDGLACTSKFLTSVILSS  183

Query  603   YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
             Y   G  S+GSLVDVGGGTG  ++EIVK +PHIKGINFDLPHVV+TAP Y GVSH+GGD+
Sbjct  184   YK-QGLSSIGSLVDVGGGTGGLISEIVKKYPHIKGINFDLPHVVSTAPTYNGVSHIGGDL  242

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDI  962
             F +IP+A A+ +KW+LH WGDE+C+KIL+NC++A+P + GK+IIV+ +LK +G  +F +I
Sbjct  243   FHAIPNADAVILKWILHCWGDEDCIKILRNCKKAIPRENGKVIIVEIILKEDGSGVFDEI  302

Query  963   SYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              ++ DL+M+AH++ GKERTE EWK++L   GF +Y II   A+ASIIEAY
Sbjct  303   GFLLDLVMIAHAN-GKERTEAEWKKILEGGGFSHYKIINIPALASIIEAY  351



>ref|XP_008365438.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Malus 
domestica]
Length=364

 Score =   394 bits (1011),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 214/364 (59%), Positives = 272/364 (75%), Gaps = 14/364 (4%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQP-------ITL  209
             M  + + ++ L  QA +WKYM  F DSMALK AV+LRI DIIHSH+           ITL
Sbjct  3     MQEATEVEASLRGQADIWKYMXGFADSMALKCAVELRIADIIHSHSPTDGASNSXPMITL  62

Query  210   SQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAEL  386
             SQ A++I  +PSPD   L+RI+RLLVRR IF +    SDG   +YG T +SRWL+ + EL
Sbjct  63    SQXASSI--APSPDMTYLTRIMRLLVRRNIF-AIHHSSDGEEPLYGLTHSSRWLLHNXEL  119

Query  387   SMAPMLLFQTHPLSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGME  563
             S+APML+ + HP  MAP+H FS+CVKEGG +AF+ AHG  I++ A+ +PEFNK FNDGM 
Sbjct  120   SLAPMLVMENHPCLMAPWHYFSQCVKEGGPYAFKMAHGLEIWDYASQNPEFNKLFNDGMA  179

Query  564   SVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATA  743
                +++ KAI++GY   GF  VGSLVDVGGGTG+AVAEIVK++P+IKG NFDLPHVVATA
Sbjct  180   CTARVVMKAILTGYE-HGFDGVGSLVDVGGGTGSAVAEIVKSYPNIKGFNFDLPHVVATA  238

Query  744   PEYQGVSHVGGDMFV-SIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVD  920
             P Y GVSHVGGDMF  SIP+A A+F+K ++H+W D +C+KILKNCR+A+PEK+GK+IIVD
Sbjct  239   PVYHGVSHVGGDMFEGSIPNADAVFMKXIMHBWSDXDCIKILKNCRKAIPEKSGKIIIVD  298

Query  921   AVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASI  1100
              VL+P G+ I  D   V DLLM+AH SGG+ERTE EWK +L E GFP Y +I+  A+ASI
Sbjct  299   IVLEPNGEGILDDTRLVFDLLMIAHXSGGRERTETEWKNILEEGGFPRYKVIKIPALASI  358

Query  1101  IEAY  1112
             +EAY
Sbjct  359   VEAY  362



>ref|XP_009357074.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=362

 Score =   393 bits (1010),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 214/357 (60%), Positives = 269/357 (75%), Gaps = 14/357 (4%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQP-------ITLSQIAAAI  230
             ++ L  QA++WKYM  F DSMALK AV+LRI DIIHSH  +         I LSQIA+ I
Sbjct  8     ETSLRGQAEIWKYMFGFADSMALKCAVELRIADIIHSHRPSDGAPNSNPMIALSQIASCI  67

Query  231   HDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLL  407
               +PSP+   L+RI+RLLVRR IF +   PSDG  T+YG T +SRWL+ DAELS+APML+
Sbjct  68    --APSPNITYLTRIMRLLVRRNIF-AVHHPSDGGETLYGLTNSSRWLLHDAELSLAPMLV  124

Query  408   FQTHPLSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIIS  584
              Q HP  MAP+H FSR VKEGG  AF+ AHG  I++ A+ +PE NK FNDGM   +++++
Sbjct  125   LQNHPCLMAPWHYFSRRVKEGGPCAFKMAHGLDIWDYASQNPEINKLFNDGMACSSRVVT  184

Query  585   KAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVS  764
             KAI +GY   GF  VGSLVDVGGGTG+AVAEIVKA+P+IKG NFDLPHVVATAP Y GVS
Sbjct  185   KAIFTGYE-HGFDGVGSLVDVGGGTGSAVAEIVKAYPNIKGFNFDLPHVVATAPVYHGVS  243

Query  765   HVGGDMFV-SIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEG  941
             HV GDMF  +IP+A A+F+K ++HDW D +C+KILKNCR+A+PEK+GK+IIVD VL+P G
Sbjct  244   HVAGDMFEGNIPNADAVFMKHIMHDWSDSDCIKILKNCRKAIPEKSGKIIIVDVVLEPNG  303

Query  942   DPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +    D   + DL+M+AH+SGG+ERTE EWK+LL E GFP Y +I+  A ASI+EAY
Sbjct  304   EGTLNDTRLILDLVMIAHASGGRERTEIEWKKLLEEGGFPRYKVIKIPAFASIVEAY  360



>ref|XP_004506552.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Cicer arietinum]
Length=369

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/370 (53%), Positives = 268/370 (72%), Gaps = 13/370 (4%)
 Frame = +3

Query  12    HSPASKFSPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAA  191
             HSP S F  +      S +E+  L  Q ++WKYM  F DS ALK+ V+LRI DII  +  
Sbjct  8     HSPPSAFKGL------SKEEEESLLGQIEIWKYMTQFTDSFALKSVVELRIADIIDRYG-  60

Query  192   AQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV  371
              +P++L+QI   + D+PSPD+  L RI+R++VRRKIF+S  +   G T+YG T AS+W++
Sbjct  61    -KPLSLTQIVQNLDDAPSPDSTLLLRIMRVMVRRKIFSSE-KSETGETLYGLTRASKWIL  118

Query  372   RDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEG---GFAFEKAHGKGIFEMAAGDPEFNK  542
             +D ++++APMLL + HP  + P +  S  ++EG   G AF + HG   FEM   DP++N+
Sbjct  119   QDTKMTLAPMLLLENHPFHLNPANFISDIIREGTKNGTAFFRCHGHEQFEMTGLDPKYNE  178

Query  543   SFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDL  722
              FN GM    +I+S+A+++GY  DGF  + SLVDVGGG G +++EIV+A+PHI+GINFDL
Sbjct  179   LFNQGMVCTARIVSRAVIAGYK-DGFNQIQSLVDVGGGIGGSLSEIVRAYPHIQGINFDL  237

Query  723   PHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTG  902
             PHVV TAP++ G++HVGGDMFVS+PSA AI++KW+LHDW D+ C+KILKNCR+A+PEKTG
Sbjct  238   PHVVETAPKFDGITHVGGDMFVSVPSADAIYMKWILHDWSDDHCIKILKNCRKAIPEKTG  297

Query  903   KLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQN  1082
             K+IIVD VL PEGD  F D     D+++LAH++GGKERTEE WK L  E GFP YNII+ 
Sbjct  298   KVIIVDHVLDPEGDEPFTDTGIAFDMMLLAHNAGGKERTEENWKYLFKETGFPRYNIIKI  357

Query  1083  IAVASIIEAY  1112
              A+ SIIEA+
Sbjct  358   NALPSIIEAF  367



>ref|XP_010035715.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW47152.1| hypothetical protein EUGRSUZ_K00957 [Eucalyptus grandis]
Length=360

 Score =   391 bits (1005),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 203/359 (57%), Positives = 266/359 (74%), Gaps = 11/359 (3%)
 Frame = +3

Query  60    SFDE-KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             S DE ++    QA +   +  + DSMALK AV+LR+PDIIHS+    P+TL+QIA+ I  
Sbjct  3     SLDETEATRRGQAHILNLLHAYADSMALKCAVELRVPDIIHSYGGG-PVTLAQIASRI-P  60

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-----TVYGPTPASRWLVR--DAELSMA  395
             SPS  TA L+RI+RLLVR  IF++     DG       +Y  TP+SRWL++  ++ELS+A
Sbjct  61    SPSLGTAYLARIMRLLVRENIFSANRCQPDGGHESHEILYSLTPSSRWLLQGPESELSLA  120

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             P++L +THP  M+P+HCF  CVK GG AFE AHG+ I++ A+ +PEFN+ FNDGM  V+ 
Sbjct  121   PLVLLETHPWLMSPWHCFGNCVKTGGIAFEMAHGRKIWDFASENPEFNRLFNDGMVCVSG  180

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             I+ + I+  Y  DGF  +GSLVDVGGG G  +AEI+K+FPHI+GINFDLPHVVATAP + 
Sbjct  181   IMVRGIIEVYK-DGFERIGSLVDVGGGIGKTLAEIIKSFPHIQGINFDLPHVVATAPAHD  239

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKP  935
             GV+HVGG+MF +IP A A+F++ ++HDWGDE+CVKILKNCR+A+PEK GK+II D VLKP
Sbjct  240   GVTHVGGNMFETIPHADAVFMRGIMHDWGDEDCVKILKNCRKAIPEKNGKVIIADIVLKP  299

Query  936   EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             EGD +F     V DL+M+AH SGGKER E EWK++L E GFP YNII+  ++ SIIEAY
Sbjct  300   EGDSMFDKTRLVMDLVMMAHCSGGKERDEPEWKKILEEGGFPCYNIIKTPSLLSIIEAY  358



>ref|XP_008357818.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Malus 
domestica]
Length=364

 Score =   391 bits (1005),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 213/364 (59%), Positives = 270/364 (74%), Gaps = 14/364 (4%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQP-------ITL  209
             M  + + ++ L  QA +WKYM  F DSMALK AV+LRI DIIHSH+           ITL
Sbjct  3     MQEATEVEASLRGQADIWKYMXGFADSMALKCAVELRIADIIHSHSPTDGASNSXPMITL  62

Query  210   SQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAEL  386
             SQ A++I  +PSPD   L+RI+RLLVRR IF +    SDG   +YG T +SRWL+ + EL
Sbjct  63    SQXASSI--APSPDMTYLTRIMRLLVRRNIF-AIHHXSDGXEPLYGLTHSSRWLLHNXEL  119

Query  387   SMAPMLLFQTHPLSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGME  563
             S+APML  + HP  MAP+H F +CVKEGG +AF+ AHG  I++ A+ +PEFNK FNDGM 
Sbjct  120   SLAPMLXMENHPCLMAPWHYFXQCVKEGGPYAFKMAHGLEIWDYASQNPEFNKLFNDGMA  179

Query  564   SVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATA  743
                +++ KAI++GY   GF  VGSLVDVGGGTG+AVAEIVK++P+IKG NFDLPHVVATA
Sbjct  180   CTXRVVMKAILTGYE-HGFDGVGSLVDVGGGTGSAVAEIVKSYPNIKGFNFDLPHVVATA  238

Query  744   PEYQGVSHVGGDMFV-SIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVD  920
             P Y GVSHVGGDMF  SIP+A A+F+K ++H+W D +C+KILKNCR+A+PEK+GK+IIVD
Sbjct  239   PXYHGVSHVGGDMFEGSIPNADAVFMKXIMHBWSDXDCIKILKNCRKAIPEKSGKIIIVD  298

Query  921   AVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASI  1100
              VL+P G+ I  D   V DLLM+AH SGG+ERTE EWK +L E GFP Y +I+  A+ASI
Sbjct  299   IVLEPNGEGILDDTRLVFDLLMIAHXSGGRERTETEWKNILEEGGFPRYKVIKIPALASI  358

Query  1101  IEAY  1112
             +EAY
Sbjct  359   VEAY  362



>ref|XP_010094290.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Morus 
notabilis]
 gb|EXB55622.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Morus 
notabilis]
Length=348

 Score =   390 bits (1003),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 264/360 (73%), Gaps = 22/360 (6%)
 Frame = +3

Query  63    FDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSP  242
              DE S L  QA+VWKYM  F DSMA+K AV+LRIPDII S+    P++L++I AA   + 
Sbjct  3     LDEAS-LRGQAEVWKYMFSFADSMAVKCAVELRIPDIIKSNGG--PMSLAEIVAAFPRAS  59

Query  243   SPDTATLSRILRLLVRRKIFTSAVRPSDG----ATVYGPTPASRWLVRDA---ELSMAPM  401
             SPD + LSRI+RLLVR KIFT A + SDG    AT+YG T +SRWL+RD    +L++APM
Sbjct  60    SPDISCLSRIMRLLVRLKIFT-ARQSSDGSGDSATLYGLTQSSRWLLRDTSDDQLTLAPM  118

Query  402   LLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQII  581
             LL + HPL MAP+HCFS+CVK+GG   EKAHG  I++   G+ EFNK FN GME  ++I+
Sbjct  119   LLLENHPLLMAPWHCFSQCVKDGGLPLEKAHGPEIWDFVTGNGEFNKMFNRGMECASRIV  178

Query  582   SKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHI-KGINFDLPHVVATAPEYQG  758
              +A++S Y  DGF  +GSL+DVGGGTG  VA+IVK+ PHI K INFDLP VVA APE+ G
Sbjct  179   MRAVLSEYYKDGFGCLGSLLDVGGGTGGDVAQIVKSCPHIIKSINFDLPDVVAKAPEHPG  238

Query  759   VSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPE  938
             VSHVGGDMF S          W++H+W DE+CVKILKNCR+A+PEK+GK+IIVD VL+PE
Sbjct  239   VSHVGGDMFKS----------WIMHEWSDEDCVKILKNCRKAIPEKSGKVIIVDIVLEPE  288

Query  939   GDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             G  +F +   V DL+M+AH+SGGKERTE EWK +L E GFP Y + +  A+ SIIEAY Q
Sbjct  289   GTGVFDETGLVFDLVMVAHTSGGKERTENEWKNILKEGGFPRYKVTKIPALTSIIEAYPQ  348



>ref|XP_009357073.1| PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticuline 7-O-methyltransferase-like 
[Pyrus x bretschneideri]
Length=362

 Score =   391 bits (1004),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 213/364 (59%), Positives = 276/364 (76%), Gaps = 14/364 (4%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHA------AAQP-ITL  209
             M  + + ++ L  QA + KYM  F+DSMALK AV+LRI DIIHSH+       ++P ITL
Sbjct  1     MQEATEVEASLRGQANIRKYMFGFVDSMALKCAVELRIADIIHSHSPTDGASNSKPMITL  60

Query  210   SQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAEL  386
             SQ+A++I  +PSPD   L+RI+RLLV R IF +   PSDG   +YG T +SRWL+ +AEL
Sbjct  61    SQLASSI--APSPDMTYLTRIMRLLVHRNIF-AIHHPSDGGEPLYGLTHSSRWLLHNAEL  117

Query  387   SMAPMLLFQTHPLSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGME  563
             S+APML+ + HP  MAP+H F +CVKEGG +AF+ AHG  I++ A+ +PEFNK FNDGM 
Sbjct  118   SLAPMLVMENHPCLMAPWHYFGQCVKEGGPYAFKMAHGLEIWDYASQNPEFNKLFNDGMA  177

Query  564   SVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATA  743
                +++ KAI++GY   GF  VGSLVDVGGGTG+AVAEIVK++P+IKG NFDLPHVVATA
Sbjct  178   CTARVVMKAILTGYE-HGFDGVGSLVDVGGGTGSAVAEIVKSYPNIKGFNFDLPHVVATA  236

Query  744   PEYQGVSHVGGDMFV-SIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVD  920
             P Y GVSHVGGDMF  SIP+A A+F+KW++HDW D +C+KILKNCR+A+PEK+GK+IIVD
Sbjct  237   PVYHGVSHVGGDMFEGSIPNADAVFMKWIMHDWSDSDCIKILKNCRKAIPEKSGKIIIVD  296

Query  921   AVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASI  1100
              VL+P G+ I  D   V DLLM+AH+ GG+ERTE E K +L E GFP + +I+  A+ASI
Sbjct  297   IVLEPNGEGILDDTRLVFDLLMIAHTPGGRERTETEXKNILEEGGFPRHKVIKIPALASI  356

Query  1101  IEAY  1112
             +EAY
Sbjct  357   VEAY  360



>gb|KHG18226.1| RS-norcoclaurine 6-O-methyltransferase [Gossypium arboreum]
Length=355

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 271/350 (77%), Gaps = 7/350 (2%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS-PS  245
             +++ L  QA++W+YM  F DSMALK+AV+LRI DII+S+  A   TLSQIA+ I+D   S
Sbjct  7     DEARLQGQAEIWRYMFSFADSMALKSAVELRIADIIYSYGGAA--TLSQIASCINDGLTS  64

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHP  422
             PD  TL+RI+RLL RRKIFT    PSDG  ++Y  T +SRWL+ D+E S+APM+L + HP
Sbjct  65    PDITTLARIMRLLARRKIFTIH-HPSDGRDSLYNLTHSSRWLLHDSEQSLAPMVLMENHP  123

Query  423   LSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSG  602
               MAP+H FS+CVKEGG AF+KAHG  I+++A+ +P+FNK FNDG+   +++I+ AI+SG
Sbjct  124   WQMAPWHYFSQCVKEGGDAFKKAHGCEIWDLASRNPDFNKLFNDGLACTSKVITSAILSG  183

Query  603   YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
             Y   GF S+GSLVDVGGGTG  ++EI+K +PHIK +NFDLPHVV+TAP Y GVSH+GGDM
Sbjct  184   YK-QGFNSIGSLVDVGGGTGGLISEIIKVYPHIKCVNFDLPHVVSTAPAYNGVSHIGGDM  242

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDI  962
             F +IP+  AI +KW+LHDW DE+C+KILKNC++A+P++ GK+II++ +LK +G  +F +I
Sbjct  243   FHAIPNTDAIIMKWILHDWDDEDCIKILKNCKKAIPKENGKVIIIEIILKEDGSGLFDEI  302

Query  963   SYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              ++ DL M+AH++ GKERTE EWK++L   GF +Y II   ++ SIIEAY
Sbjct  303   GFILDLAMIAHTN-GKERTEVEWKKILEGGGFFHYKIINIPSLLSIIEAY  351



>gb|AFK43640.1| unknown [Medicago truncatula]
Length=369

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 265/370 (72%), Gaps = 13/370 (4%)
 Frame = +3

Query  12    HSPASKFSPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAA  191
             HSP S F  +      S +E+  L  Q ++WKYM  F DS ALKA V+LRI DII     
Sbjct  8     HSPPSVFKGV------SKEEEESLLGQIEIWKYMTQFTDSFALKAVVELRIADIIDRQC-  60

Query  192   AQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV  371
              +P++L++I   + D PSPD+  L R++R++VRRKIF SA +   G  +YG T AS+W++
Sbjct  61    -KPLSLTEIVQNLEDVPSPDSTLLLRVMRVMVRRKIF-SAEKSETGEILYGLTRASKWIL  118

Query  372   RDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEG---GFAFEKAHGKGIFEMAAGDPEFNK  542
             +D ++++AP +L + HP+ M PF+  S  VKEG   G AF + HG   FEMA+ DP+FN+
Sbjct  119   QDTKVTLAPSVLLEIHPIHMNPFNFMSDIVKEGTKNGTAFFRCHGYDQFEMASVDPKFNE  178

Query  543   SFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDL  722
              FN G    T  + +A+++GY  DGF  + +LVDVGGG G +++EIVKA+PHI+GINFDL
Sbjct  179   LFNKGQACTTGFVFRAVIAGYK-DGFNQIQTLVDVGGGIGGSMSEIVKAYPHIQGINFDL  237

Query  723   PHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTG  902
             PHVV+TAP+Y G++HVGGDMFVS+PSA AI+IKW+LHDW D  CVKILKNCR+A+PEKTG
Sbjct  238   PHVVSTAPKYDGITHVGGDMFVSVPSADAIYIKWILHDWSDGHCVKILKNCRKAIPEKTG  297

Query  903   KLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQN  1082
             K+II+D VL PEGD  F DI    D+++ AH+SGGKERTEE WK L  E GFP YNII+ 
Sbjct  298   KVIILDHVLDPEGDEPFTDIGIAFDMILFAHNSGGKERTEENWKYLFRETGFPRYNIIKI  357

Query  1083  IAVASIIEAY  1112
              A+ SIIEA+
Sbjct  358   NALLSIIEAF  367



>gb|KDP24165.1| hypothetical protein JCGZ_25822 [Jatropha curcas]
Length=360

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 199/357 (56%), Positives = 262/357 (73%), Gaps = 11/357 (3%)
 Frame = +3

Query  63    FDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSP  242
              + +++L  Q ++W+ +  F DSM LKAAV+L IPDIIHSHA  +PI+LSQIA+ I DS 
Sbjct  6     LESETLLRGQKEIWQLLFGFADSMVLKAAVELGIPDIIHSHA--RPISLSQIASGI-DSS  62

Query  243   SPDTATLSRILRLLVRRKIFT------SAVRPSDGATVYGPTPASRWLVRDAELSMAPML  404
             SPD A L RI+R LVR+ IFT      S      G  +YG T  SRWL+RD EL++ PM+
Sbjct  63    SPDIACLERIMRYLVRKDIFTAHHDLPSEESDGGGEILYGLTRKSRWLLRDTELTLNPMV  122

Query  405   LFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIIS  584
             + + HP    P+H  S+CVKEGG AF+KAHG  +++ A+ +PEFN+ FN+G+    +I+ 
Sbjct  123   IMENHPWQQKPWHYLSQCVKEGGIAFKKAHGCEMWDFASKNPEFNRVFNEGLACTAKIVM  182

Query  585   KAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVS  764
             +A++SGY  DGF  + +LVDVGGGTG  +AEIVK +PHIKGINFDLPHVVATA  + GVS
Sbjct  183   RAVLSGYK-DGFEGIRTLVDVGGGTGGNLAEIVKVYPHIKGINFDLPHVVATATAFDGVS  241

Query  765   HVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGD  944
             HVGG+MF  IP A  +F+KW+LHDWGDE C KIL+NCR+A+ EK GKL++V+ ++K +G+
Sbjct  242   HVGGNMFEQIPVADVVFMKWILHDWGDEYCAKILRNCRKAISEKNGKLVLVEIIVKEDGN  301

Query  945   PI-FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                FGD+  V DLLMLAH++GGKERTE +WK+LL E GFP YNII   A+ SIIEA+
Sbjct  302   KNEFGDMGMVFDLLMLAHTTGGKERTEIQWKKLLEEGGFPRYNIINIPALPSIIEAF  358



>ref|XP_010051722.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=359

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 216/367 (59%), Positives = 270/367 (74%), Gaps = 15/367 (4%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             ME   +G  D  +ML  QA++W+YM  F D MAL  AV+LRI DIIHSH   +P+TL+QI
Sbjct  1     MEGAKEG--DAAAMLRGQAEIWRYMHGFADPMALNCAVELRIADIIHSHGG-RPVTLAQI  57

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAELSMA  395
             A +I  SPSPD   LS ++RLLVRR IF S  RPSDG   +YG T  SRWLVRD+EL++ 
Sbjct  58    AWSIEGSPSPDLPYLSPVMRLLVRRNIF-SVHRPSDGGDPLYGLTNLSRWLVRDSELNLV  116

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             PM++ Q HP+ +AP+H   +CV+EGG AF+KAHG  ++E A  +PEFNK FND +    +
Sbjct  117   PMVIMQNHPVQLAPWHYLGQCVREGGIAFQKAHGVEMWEFARDNPEFNKIFNDAVVCTAK  176

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             II+KA++  Y GDGF  VGS+VDVGGGTG  +AEIV+A+P I+GINFDLPHVVATAP + 
Sbjct  177   IITKAVLEAY-GDGFSLVGSVVDVGGGTGGMIAEIVRAYPRIRGINFDLPHVVATAPAHD  235

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP---EKTGKLIIVDAV  926
             G  HVGG+MF +IP A A+F+KWVLHDWGDE+CVKILKNCR+A+    +K GKLIIVD V
Sbjct  236   G--HVGGNMFEAIPKADAVFLKWVLHDWGDEDCVKILKNCRKAIASSDQKPGKLIIVDLV  293

Query  927   LKPE---GDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS  1097
             L+ +   GDP F D     DLLM+AH SGGKERTE EWK LL + GFP +NII+  A+ S
Sbjct  294   LRDQEGSGDP-FEDFGVTFDLLMMAHQSGGKERTEAEWKVLLEQGGFPRHNIIKIQALPS  352

Query  1098  IIEAYSQ  1118
             IIEA+ Q
Sbjct  353   IIEAFPQ  359



>ref|XP_004304125.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=353

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 213/356 (60%), Positives = 269/356 (76%), Gaps = 17/356 (5%)
 Frame = +3

Query  63    FDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD-S  239
              DE S L  QA VWKYML F DSMAL++AV+LRIPDIIHSH  A  +TLS+IA++    S
Sbjct  7     LDEAS-LRGQADVWKYMLGFADSMALRSAVELRIPDIIHSHGRA--LTLSEIASSFDSAS  63

Query  240   PSPDTATLSRILRLLVRRKIFTS--AVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQ  413
             PSPD + L+RI+RLLVRR IFT+      S+   +YG T +SRWL+ D+EL++APM+L +
Sbjct  64    PSPDISCLARIMRLLVRRNIFTAHHDGEDSEKTGLYGLTHSSRWLLHDSELTLAPMVLME  123

Query  414   THPLSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKA  590
             T+P  MAP+HCFS+CVK+ G  AF++AHG+ I++  + + +FN+ FNDGM    +I  KA
Sbjct  124   TNPTLMAPWHCFSQCVKQRGPCAFKRAHGRDIWQFFSENLKFNRLFNDGMACTAKITMKA  183

Query  591   IVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHV  770
             I++GY G GF  V +LVDVGGGTG+AVAEIVKA+P IKGINFDLPHVVATAP Y GVSHV
Sbjct  184   ILAGYKG-GFEDVATLVDVGGGTGSAVAEIVKAYPSIKGINFDLPHVVATAPVYHGVSHV  242

Query  771   GGDMF--VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGD  944
             GGDMF   SIP+A AIF+K V+HDW D +CVKILKNCR  +PE+TGK+IIVD +L+P G 
Sbjct  243   GGDMFDEGSIPNADAIFMKRVMHDWSDSDCVKILKNCRNVIPERTGKVIIVDVILEPNGV  302

Query  945   PIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              +F       DLLM+AH+SGGKERTE EW ++L +AGFP   II+  A+  IIEAY
Sbjct  303   GMF-------DLLMIAHTSGGKERTESEWTKMLEQAGFPRLKIIKIPALMLIIEAY  351



>ref|XP_006480224.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
Length=351

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 265/351 (75%), Gaps = 6/351 (2%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPD  251
             + +L  QA+VW++M  F  SMALK+AV+LR+ DI+HSH    PITLSQ+A+ I DS  PD
Sbjct  5     EELLRGQAEVWQFMFAFTYSMALKSAVELRLADIMHSHGC--PITLSQLASRI-DSSCPD  61

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGA--TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
              + L+RI+R+LV + IF +A  PSDG   T+YG T  S+WL+ D+ELS+APM+L Q +  
Sbjct  62    ISHLARIMRMLVYKGIF-AAHHPSDGGDETMYGTTHISKWLLHDSELSLAPMILVQNNQW  120

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              +AP+H  S+CVK+GG  F KAHG   ++ A+ +P+FN  FN+ M   T+I  KA VS Y
Sbjct  121   LLAPWHYLSQCVKKGGIPFRKAHGSTFWDFASQNPQFNNLFNEAMACTTKITMKAFVSHY  180

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               DGF ++ S+VDVGGGTG A+AEIVK++PHIKG+NFDL HV+ATAP ++GVSH+GGDMF
Sbjct  181   KVDGFNNIRSMVDVGGGTGTALAEIVKSYPHIKGVNFDLQHVIATAPTHEGVSHIGGDMF  240

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
              +IP+A A+F+KW+LHDWGDE C+KILKNCR+A+PEK GK+IIVD VL+P+G  +F +  
Sbjct  241   DAIPNADAVFMKWILHDWGDEACIKILKNCRKAIPEKIGKVIIVDIVLQPDGSGLFDETR  300

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              V DLLM+   SGGKERTE EWK++L + GFP + II+  A+ SIIEAY +
Sbjct  301   LVFDLLMMVDLSGGKERTELEWKKILEKGGFPRHRIIKIPALQSIIEAYPE  351



>ref|XP_006420396.1| hypothetical protein CICLE_v10005309mg [Citrus clementina]
 gb|ESR33636.1| hypothetical protein CICLE_v10005309mg [Citrus clementina]
Length=351

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 199/351 (57%), Positives = 263/351 (75%), Gaps = 6/351 (2%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPD  251
             + +L  QA+VW++M  F  SMALK+AV+LR+ DI+HSH    PITLSQ+A+ I DS  PD
Sbjct  5     EELLRGQAEVWQFMFAFTYSMALKSAVELRLADIMHSHGC--PITLSQLASRI-DSSCPD  61

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGA--TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
              + L+RI+R+LV + IF +A  PSDG   T+YG T  S+WL+ D+ELS+APM+L Q +  
Sbjct  62    ISHLARIMRMLVYKGIF-AAHHPSDGGDETLYGTTHISKWLLHDSELSLAPMILVQNNQW  120

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              +AP+H  S+CVK+GG  F KAHG   ++ A+ +P+FN  FN+ M   T+I  KA VS Y
Sbjct  121   LLAPWHYLSQCVKKGGIPFRKAHGSTFWDFASQNPQFNNLFNEAMACTTKITMKAFVSHY  180

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               DGF ++ S+VDVGGGTG A+AEIVK++PHIKGINFDL HV+ATAP ++GVSHVGGDMF
Sbjct  181   KVDGFNNIRSMVDVGGGTGTALAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMF  240

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
              +IP+A A+F+KW+LHDWGDE C+KILKNCR+A+PEK GK+IIVD VL+P+G  +F +  
Sbjct  241   DAIPNADAVFMKWILHDWGDEACIKILKNCRKAIPEKIGKVIIVDIVLQPDGSGLFDETR  300

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              V DLLM+   SGGKERTE EWK++L   GFP Y II+  A+  I+EAY +
Sbjct  301   LVFDLLMMVDLSGGKERTELEWKKILENGGFPRYRIIKIPALLWIVEAYPE  351



>ref|XP_011039887.1| PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticuline 7-O-methyltransferase-like 
[Populus euphratica]
Length=351

 Score =   386 bits (991),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 200/354 (56%), Positives = 262/354 (74%), Gaps = 4/354 (1%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             GS DE+++L  Q +VW+ +  F++SMALK A+++ I DII+S     P+TL+QIA+ I D
Sbjct  2     GSIDEETLLRGQVEVWQLVFGFVESMALKCAIEIGIVDIINSLDG--PLTLNQIASRI-D  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQT  416
             SPS D   L+R +R LVR+++FT     + G T+Y  T  S+WL+RD+E+S+A M+L Q 
Sbjct  59    SPSVDIPFLARXMRFLVRKRVFTQHNPSNGGETLYRLTDNSKWLLRDSEVSLAAMVLMQN  118

Query  417   HPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIV  596
             +P  +AP+H  S+CVK+GG AF+KAHG   +++A+ +PEFN+ FND +    +II +A+V
Sbjct  119   YPSHLAPWHYLSQCVKDGGIAFKKAHGCETWDLASQNPEFNRIFNDALACTAKIIMRAVV  178

Query  597   SGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGG  776
             S Y G GF  V +L DVGGGTG  +AEIVKA+PHIKGINF+LPHVVA AP Y GVSHVGG
Sbjct  179   SHYKG-GFDDVETLADVGGGTGGNLAEIVKAYPHIKGINFELPHVVAAAPAYNGVSHVGG  237

Query  777   DMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFG  956
             + F +IP A +IF+KWVLHDWGDE CVKILKN R A+ EKTGKLI+V+ VL+PEG+  FG
Sbjct  238   NFFEAIPVADSIFMKWVLHDWGDECCVKILKNYRTAMTEKTGKLILVEIVLQPEGNGQFG  297

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             D+  V+DL+M AHS+GGKE TE EWK+LL E GFP Y I    A  SIIEAY Q
Sbjct  298   DMGMVSDLVMFAHSTGGKESTELEWKKLLEEGGFPRYKIFNIPAXPSIIEAYLQ  351



>ref|XP_008341892.1| PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticuline 7-O-methyltransferase-like 
[Malus domestica]
Length=369

 Score =   386 bits (991),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 212/371 (57%), Positives = 272/371 (73%), Gaps = 21/371 (6%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHA------AAQP-ITL  209
             M  + + ++ L  QA +WKYM  F DSMALK  V+LRI DIIHSH+       ++P ITL
Sbjct  1     MQXATEVEASLRGQADIWKYMFGFADSMALKCVVELRIADIIHSHSPNAGASNSKPMITL  60

Query  210   SQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAEL  386
             SQ+A+ I  +PS +   L+RI+RLLVR+ IFT    PSDG   +YG T +SRWL+ DAEL
Sbjct  61    SQLASCI--APSLEITCLTRIMRLLVRQNIFTVH-HPSDGGEPLYGLTHSSRWLLHDAEL  117

Query  387   SMAPMLLFQTHPLSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGME  563
             S+APML+ + HP  M P+H F++C+K GG  AF+ AHG  I++ A+ +PEFNK FNDGM 
Sbjct  118   SLAPMLMMENHPCLMVPWHYFAQCIKGGGPCAFKMAHGLEIWDYASQNPEFNKLFNDGMA  177

Query  564   SVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPH-----  728
                +++ KAI++GY   GF S+GSLVDVGGGTG AVAEIVKA+P+IKG NFDLPH     
Sbjct  178   CTARVVMKAILTGYE-HGFDSIGSLVDVGGGTGGAVAEIVKAYPNIKGFNFDLPHLRRGS  236

Query  729   --VVATAPEYQGVSHVGGDMFV-SIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKT  899
               VVA AP Y GVSHVGGDMF  +IP+A AIF+KWV+HDW D +C+KILKNCR+ +PEK+
Sbjct  237   KSVVAMAPVYHGVSHVGGDMFEGNIPNADAIFMKWVMHDWSDSDCIKILKNCRKVIPEKS  296

Query  900   GKLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQ  1079
             GK+IIVD VL+P G+ I  D   V DLLM+AH+SGG+ERTE EWK++L   GFP Y +I+
Sbjct  297   GKIIIVDIVLEPNGEGILDDTGLVFDLLMIAHASGGRERTESEWKKILEGGGFPRYKVIK  356

Query  1080  NIAVASIIEAY  1112
               A+ASI+EAY
Sbjct  357   IPAIASIVEAY  367



>gb|KCW89506.1| hypothetical protein EUGRSUZ_A01797 [Eucalyptus grandis]
Length=370

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 215/376 (57%), Positives = 270/376 (72%), Gaps = 22/376 (6%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             ME   +G  D  +ML  QA++W+YM  F D MAL  AV+LRI DIIHSH   +P+TL+QI
Sbjct  1     MEGAKEG--DAAAMLRGQAEIWRYMHGFADPMALNCAVELRIADIIHSHGG-RPVTLAQI  57

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAELSMA  395
             A +I  SPSPD   LS ++RLLVRR IF S  RPSDG   +YG T  SRWLVRD+EL++ 
Sbjct  58    AWSIEGSPSPDLPYLSPVMRLLVRRNIF-SVHRPSDGGDPLYGLTNLSRWLVRDSELNLV  116

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             PM++ Q HP+ +AP+H   +CV+EGG AF+KAHG  ++E A  +PEFNK FND +    +
Sbjct  117   PMVIMQNHPVQLAPWHYLGQCVREGGIAFQKAHGVEMWEFARDNPEFNKIFNDAVVCTAK  176

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             II+KA++  Y GDGF  VGS+VDVGGGTG  +AEIV+A+P I+GINFDLPHVVATAP + 
Sbjct  177   IITKAVLEAY-GDGFSLVGSVVDVGGGTGGMIAEIVRAYPRIRGINFDLPHVVATAPAHD  235

Query  756   ---------GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP---EKT  899
                       + HVGG+MF +IP A A+F+KWVLHDWGDE+CVKILKNCR+A+    +K 
Sbjct  236   VCFLWILISNMEHVGGNMFEAIPKADAVFLKWVLHDWGDEDCVKILKNCRKAIASSDQKP  295

Query  900   GKLIIVDAVLKPE---GDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYN  1070
             GKLIIVD VL+ +   GDP F D     DLLM+AH SGGKERTE EWK LL + GFP +N
Sbjct  296   GKLIIVDLVLRDQEGSGDP-FEDFGVTFDLLMMAHQSGGKERTEAEWKVLLEQGGFPRHN  354

Query  1071  IIQNIAVASIIEAYSQ  1118
             II+  A+ SIIEA+ Q
Sbjct  355   IIKIQALPSIIEAFPQ  370



>ref|XP_010051706.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=364

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 214/369 (58%), Positives = 267/369 (72%), Gaps = 14/369 (4%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             ME   +G  D  +ML  QA++W+YML F DSMAL  AV+LRI DIIHSH   + +TL+QI
Sbjct  1     MEGAKEG--DAAAMLRGQAEIWRYMLGFADSMALNCAVELRIADIIHSHGGRR-VTLAQI  57

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAELSMA  395
             A +I  SPSPD   LSR++RLLVRR IF S  RPSDG   +YG T  SRWLVRD+E+++ 
Sbjct  58    ARSIEGSPSPDLPYLSRVMRLLVRRNIF-SVHRPSDGGDPLYGLTDLSRWLVRDSEMNLV  116

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             PM++ Q HP+ +AP+H   +CV+EGG AF+KAHG  ++E A  +P+ NK FND M    +
Sbjct  117   PMVIMQNHPVQLAPWHFLGQCVREGGIAFQKAHGVEMWEFAGDNPKLNKMFNDAMACTAK  176

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             II KA++  Y GDG   VGS+VDVGGGTG  +AEIV+A+PHI+GINFDLPHVVATAP Y 
Sbjct  177   IIMKAVLEVY-GDGVGLVGSVVDVGGGTGGVIAEIVRAYPHIRGINFDLPHVVATAPAYD  235

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP---EKTGKLIIVDAV  926
              V H+GG MF +IP+A A+F+KWVLHDWGDE+CVKILKNCR+++    +K GKLIIVD V
Sbjct  236   RVEHMGGSMFEAIPTADAVFLKWVLHDWGDEDCVKILKNCRKSIASSDQKPGKLIIVDVV  295

Query  927   L-----KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAV  1091
             L           +F DI    DLLM+AH SGGKERTE EWK LL + GFP YNII+  A+
Sbjct  296   LHDRDDGGGSGDLFEDIGVTFDLLMMAHQSGGKERTEAEWKVLLEQGGFPRYNIIKIQAL  355

Query  1092  ASIIEAYSQ  1118
              SIIEA+ Q
Sbjct  356   PSIIEAFPQ  364



>ref|XP_003605744.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|AES87941.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK48346.1| unknown [Medicago truncatula]
Length=369

 Score =   384 bits (987),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/370 (52%), Positives = 263/370 (71%), Gaps = 13/370 (4%)
 Frame = +3

Query  12    HSPASKFSPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAA  191
             HSP S F  +      S +E+  L  Q ++WKYM  F DS ALKA V+LRI DII  +  
Sbjct  8     HSPPSAFKGV------SKEEEESLLGQIEIWKYMTQFTDSFALKAVVELRIADIIDRYG-  60

Query  192   AQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV  371
              +P++L+QI   + D+PSPD+  L R++R++VRRKIF SA +   G  +YG T AS+W++
Sbjct  61    -KPLSLTQIVQNLEDAPSPDSTLLLRVMRVMVRRKIF-SAEKSETGEILYGLTRASKWIL  118

Query  372   RDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEG---GFAFEKAHGKGIFEMAAGDPEFNK  542
             +D ++++APMLL + HP  + P +  S  +KEG   G AF + HG   FEM   D ++N 
Sbjct  119   QDTKMTLAPMLLLENHPFHLNPANFISEIIKEGTKNGTAFFRCHGHEQFEMTGLDSKYND  178

Query  543   SFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDL  722
              FN GM    +I+S+A+++GY  DGF  + SLVDVGGG G +++EIV+A+PHI+ INFDL
Sbjct  179   LFNQGMVCTARIVSRAVIAGYK-DGFNQIKSLVDVGGGIGGSLSEIVRAYPHIQAINFDL  237

Query  723   PHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTG  902
             PHVV+TAP + G++HVGGDMFVS+PSA AI++KW+LHDW D+ C+KILKNCR+A+PEKTG
Sbjct  238   PHVVSTAPNFDGITHVGGDMFVSVPSADAIYMKWILHDWSDDHCIKILKNCRKAIPEKTG  297

Query  903   KLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQN  1082
             K+IIVD VL PEG+  F D     D+++LAH++GGKERTEE WK L  E GFP YNII+ 
Sbjct  298   KVIIVDHVLDPEGNEPFTDTGIAFDMMLLAHNAGGKERTEENWKYLFNETGFPRYNIIKI  357

Query  1083  IAVASIIEAY  1112
              A+  IIEA+
Sbjct  358   NALPCIIEAF  367



>ref|XP_006480221.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
Length=351

 Score =   384 bits (985),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 261/351 (74%), Gaps = 6/351 (2%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPD  251
             + +L  QA+VW++M  F  SMALK+AV+LR+ DI+HSH    PITLSQ+A+ I DS  PD
Sbjct  5     EELLRGQAEVWQFMFAFTYSMALKSAVELRLADIMHSHGC--PITLSQLASRI-DSSCPD  61

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGA--TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
              + L+R++R+LV + IF +A  PSDG   T+YG T  S+WL+ D+ELS+APM+L Q +  
Sbjct  62    ISHLARVMRMLVYKGIF-AARHPSDGGDETLYGTTHISKWLLHDSELSLAPMILVQNNQW  120

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              +AP+H  S+CVK+GG  F KAHG   ++ A+ +P+FN  FN+ M   T+I  KA VS Y
Sbjct  121   LLAPWHYLSQCVKKGGIPFRKAHGSTFWDFASQNPQFNNLFNEAMACTTKITMKAFVSHY  180

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               DGF ++ S+VDVGGGTG  +AEIVK++PHIKGINFDL HV+ATAP ++GVSHVGGDMF
Sbjct  181   KVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMF  240

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
              +IP+A A+F+KW+LHDWGDE C+KILKNCR+A+PEK  K+IIVD VL+P+G  +F +  
Sbjct  241   DAIPNADAVFMKWILHDWGDEACIKILKNCRKAIPEKIRKVIIVDIVLQPDGSGLFDETR  300

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              V DLLM+   SGGKERTE EWK++L   GFP Y II+  A+  IIEAY +
Sbjct  301   LVFDLLMMVDLSGGKERTELEWKKILENGGFPRYRIIKIPALLWIIEAYPE  351



>gb|KCW89504.1| hypothetical protein EUGRSUZ_A01795 [Eucalyptus grandis]
Length=353

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 210/356 (59%), Positives = 261/356 (73%), Gaps = 12/356 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             ML  QA++W+YML F DSMAL  AV+LRI DIIHSH   + +TL+QIA +I  SPSPD  
Sbjct  1     MLRGQAEIWRYMLGFADSMALNCAVELRIADIIHSHGGRR-VTLAQIARSIEGSPSPDLP  59

Query  258   TLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAELSMAPMLLFQTHPLSMA  434
              LSR++RLLVRR IF S  RPSDG   +YG T  SRWLVRD+E+++ PM++ Q HP+ +A
Sbjct  60    YLSRVMRLLVRRNIF-SVHRPSDGGDPLYGLTDLSRWLVRDSEMNLVPMVIMQNHPVQLA  118

Query  435   PFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGD  614
             P+H   +CV+EGG AF+KAHG  ++E A  +P+ NK FND M    +II KA++  Y GD
Sbjct  119   PWHFLGQCVREGGIAFQKAHGVEMWEFAGDNPKLNKMFNDAMACTAKIIMKAVLEVY-GD  177

Query  615   GFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSI  794
             G   VGS+VDVGGGTG  +AEIV+A+PHI+GINFDLPHVVATAP Y  V H+GG MF +I
Sbjct  178   GVGLVGSVVDVGGGTGGVIAEIVRAYPHIRGINFDLPHVVATAPAYDRVEHMGGSMFEAI  237

Query  795   PSAQAIFIKWVLHDWGDEECVKILKNCREALP---EKTGKLIIVDAVL-----KPEGDPI  950
             P+A A+F+KWVLHDWGDE+CVKILKNCR+++    +K GKLIIVD VL           +
Sbjct  238   PTADAVFLKWVLHDWGDEDCVKILKNCRKSIASSDQKPGKLIIVDVVLHDRDDGGGSGDL  297

Query  951   FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             F DI    DLLM+AH SGGKERTE EWK LL + GFP YNII+  A+ SIIEA+ Q
Sbjct  298   FEDIGVTFDLLMMAHQSGGKERTEAEWKVLLEQGGFPRYNIIKIQALPSIIEAFPQ  353



>ref|XP_010088827.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
 gb|EXB37024.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
Length=351

 Score =   381 bits (978),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 208/361 (58%), Positives = 261/361 (72%), Gaps = 15/361 (4%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
             MD + DE   L  QA++WKYM  F+DSMAL+  V+LRIPDII+SH    PITL+QI ++I
Sbjct  1     MDSADDEN--LRGQAEIWKYMFRFVDSMALRCVVELRIPDIINSHGG--PITLAQIVSSI  56

Query  231   HDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGA---TVYGPTPASRWLVRDAELSMAPM  401
              ++ SPD + L+RI+R LVRR IFT A  PS+G+   T+YG T  SRWL+   E ++APM
Sbjct  57    PEASSPDISCLARIMRFLVRRNIFT-AHHPSNGSEDITLYGLTHLSRWLLT-CEQTLAPM  114

Query  402   LLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQII  581
             LL+QT P  M P H FS CVK GG  FEKAHG+G+F   + + EF K+ ND ME   +II
Sbjct  115   LLWQTDPTLMTPMHYFSGCVKGGGVPFEKAHGRGMFAFMSENEEFGKACNDAMECTARII  174

Query  582   SKAIVSG--YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
              K I+S    G   F  +GSL+DVGGGTG A++EIVK++PHIKGINFDLPHVV+ AP Y 
Sbjct  175   LKEILSDSQCGDHVFGCLGSLIDVGGGTGGALSEIVKSYPHIKGINFDLPHVVSKAPVYA  234

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKP  935
             GVSHV GDMF SIPSA A    W++HDW DE+CVKILKNCR+A+PEK+GK+IIVD VL  
Sbjct  235   GVSHVAGDMFESIPSADA----WIMHDWMDEDCVKILKNCRKAVPEKSGKVIIVDVVLDL  290

Query  936   EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYS  1115
             +G+ +F D+  + DLLM AHS GGKERTE+EWK++L E GF  Y II+     SIIEAY 
Sbjct  291   KGNGLFDDMGLILDLLMAAHSLGGKERTEKEWKKILKEGGFSCYKIIRISTFLSIIEAYP  350

Query  1116  Q  1118
             +
Sbjct  351   E  351



>ref|XP_003605745.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=357

 Score =   381 bits (979),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/354 (53%), Positives = 257/354 (73%), Gaps = 7/354 (2%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             S +E+  L  Q ++WKYM  F DS ALKA V+LRI DII  +   +P++L+QI   + D+
Sbjct  6     SKEEEESLLGQIEIWKYMTQFTDSFALKAVVELRIADIIDRYG--KPLSLTQIVQNLEDA  63

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTH  419
             PSPD+  L R++R++VRRKIF SA +   G  +YG T AS+W+++D ++++APMLL + H
Sbjct  64    PSPDSTLLLRVMRVMVRRKIF-SAEKSETGEILYGLTRASKWILQDTKMTLAPMLLLENH  122

Query  420   PLSMAPFHCFSRCVKEG---GFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKA  590
             P  + P +  S  +KEG   G AF + HG   FEM   D ++N  FN GM    +I+S+A
Sbjct  123   PFHLNPANFISEIIKEGTKNGTAFFRCHGHEQFEMTGLDSKYNDLFNQGMVCTARIVSRA  182

Query  591   IVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHV  770
             +++GY  DGF  + SLVDVGGG G +++EIV+A+PHI+ INFDLPHVV+TAP + G++HV
Sbjct  183   VIAGYK-DGFNQIKSLVDVGGGIGGSLSEIVRAYPHIQAINFDLPHVVSTAPNFDGITHV  241

Query  771   GGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPI  950
             GGDMFVS+PSA AI++KW+LHDW D+ C+KILKNCR+A+PEKTGK+IIVD VL PEG+  
Sbjct  242   GGDMFVSVPSADAIYMKWILHDWSDDHCIKILKNCRKAIPEKTGKVIIVDHVLDPEGNEP  301

Query  951   FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             F D     D+++LAH++GGKERTEE WK L  E GFP YNII+  A+  IIEA+
Sbjct  302   FTDTGIAFDMMLLAHNAGGKERTEENWKYLFNETGFPRYNIIKINALPCIIEAF  355



>ref|XP_006430285.1| hypothetical protein CICLE_v10012087mg [Citrus clementina]
 gb|ESR43525.1| hypothetical protein CICLE_v10012087mg [Citrus clementina]
Length=350

 Score =   380 bits (977),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 264/351 (75%), Gaps = 7/351 (2%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPD  251
             + +L  QA+ W+ M  F DSMALK+AV+LR+ DI+HSH +  PITL Q+A+ I DS  PD
Sbjct  5     EELLRGQAEAWQLMFAFADSMALKSAVELRLADIMHSHGS--PITLPQLASRI-DSSCPD  61

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGA--TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
                L+R++R+LVR+ IF +  + SDG   T+Y  T  S+WL+ D+ELS+APM+L + +  
Sbjct  62    IPYLARLMRMLVRKGIF-AVHQSSDGGDETLYKMTHISKWLLHDSELSLAPMILVENNQW  120

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              + P+H  S+CVKEGG AF+KAHG GI++ A+ +P+FN  FND M    +I+ KA+VS Y
Sbjct  121   LLEPWHYLSQCVKEGGIAFKKAHGCGIWDFASQNPQFNNLFNDAMACTAKIVMKALVSHY  180

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               DGF S+ SLVDVGGGTG A+AEIVK++PHIKGINFDLPHVVATAP  +G+ HVGGDMF
Sbjct  181   K-DGFDSIQSLVDVGGGTGGALAEIVKSYPHIKGINFDLPHVVATAPVCEGIFHVGGDMF  239

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
              +IP A A+F+KW+LHDW DE CVKILKNCR+A+P+K GKL++V+ V++ +G+ IFGD+ 
Sbjct  240   DAIPKADAVFMKWILHDWDDEACVKILKNCRQAIPDKNGKLVLVEIVVQEDGNNIFGDMG  299

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              V DL+M AH++GGKERTE+EW +LL + GF    II   A+ SIIEAY Q
Sbjct  300   LVFDLVMFAHTTGGKERTEQEWMKLLEQGGFHRCKIISMPALYSIIEAYPQ  350



>ref|XP_010035712.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW47150.1| hypothetical protein EUGRSUZ_K00955 [Eucalyptus grandis]
Length=359

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 195/361 (54%), Positives = 268/361 (74%), Gaps = 11/361 (3%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
             M+  ++ ++ L  QA +WK M  + DSMALK AV+LR+PDIIHS+    P+TL+QIA+ I
Sbjct  1     MESLYETEAPLRGQAHIWKLMYAYADSMALKCAVELRVPDIIHSYGGG-PVTLAQIASRI  59

Query  231   HDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-----TVYGPTPASRWLVRD--AELS  389
               SPSP TA L+RI+R LVR+ IF++     DG      T+Y  T +SRWL++   +ELS
Sbjct  60    -PSPSPGTAYLARIMRFLVRKNIFSANRCQPDGGHESHETLYSLTTSSRWLLQGPGSELS  118

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESV  569
             +AP++L + HP  M+P+H F  C+K GG AFE AHG+ +++ A+ +PEFN+ FNDGM  +
Sbjct  119   LAPLVLMENHPWVMSPWHYFGDCIKTGGIAFEMAHGRKVWDFASENPEFNRLFNDGMAGL  178

Query  570   TQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPE  749
             + ++ + IV  Y  DGF S+GSLVDVGGG G  +AEI+K+F HI+GINFDLPHVVATAP 
Sbjct  179   SGVVVRGIVEVYK-DGFESIGSLVDVGGGVGKTLAEIIKSFSHIQGINFDLPHVVATAPA  237

Query  750   YQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL  929
             + GV+HVG +MF +IP A A+F+K ++HDWGDE+C+KILKNCR+A+ +K GK+IIVD VL
Sbjct  238   HDGVTHVGRNMFETIPHADAVFMKGIMHDWGDEDCIKILKNCRKAILKKNGKVIIVDVVL  297

Query  930   KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
             KP+G+ +F +   V D++M+AH SGGKER E EWK +L E GFP YNII+  +++SIIEA
Sbjct  298   KPDGNGMFDENGLVLDMVMMAHCSGGKERDELEWK-ILEEGGFPRYNIIKTPSLSSIIEA  356

Query  1110  Y  1112
             Y
Sbjct  357   Y  357



>gb|KDO61043.1| hypothetical protein CISIN_1g018775mg [Citrus sinensis]
Length=350

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 263/351 (75%), Gaps = 7/351 (2%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPD  251
             + +L  QA+VW+ M  F DSMALK+AV+LR+ DI+HSH +  PITL Q+A+ I DS  PD
Sbjct  5     EELLRGQAEVWQLMFAFADSMALKSAVELRLADIMHSHGS--PITLPQLASRI-DSSCPD  61

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGA--TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
                L+R++R+LVR+ IF +  + SDG   T+Y  T  S+WL+ D+ELS+APM+L + +  
Sbjct  62    IPYLARLMRMLVRKGIF-AVHQSSDGGDETLYKMTHISKWLLHDSELSLAPMILVENNQW  120

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              + P+H  S+CVKEGG AF+KAHG  I++ A+  P+FN  FND M    +I+ KA+VS Y
Sbjct  121   LLEPWHYLSQCVKEGGIAFKKAHGCEIWDFASQSPQFNNLFNDAMACTAKIVMKALVSHY  180

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               DGF S+ SL DVGGGTG A+AEIVK++PHIKGINFDLPHVVATAP  +G+ HVGGDMF
Sbjct  181   K-DGFDSIQSLADVGGGTGGALAEIVKSYPHIKGINFDLPHVVATAPVCEGIFHVGGDMF  239

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
              +IP A A+F+KW+LHDW DE CVKILKNCR+A+P+K+GKL++V+ V++ +G+ IFGD+ 
Sbjct  240   DAIPKADAVFMKWILHDWDDEACVKILKNCRQAIPDKSGKLVLVEIVVQEDGNNIFGDMG  299

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              V DL+M AH++GGKERTE+EW +LL + GF    II   A+ SIIEAY Q
Sbjct  300   LVFDLVMFAHTTGGKERTEQEWMKLLEQGGFHRCKIISMPALYSIIEAYPQ  350



>ref|XP_006481835.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 263/351 (75%), Gaps = 7/351 (2%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPD  251
             + +L  QA+VW+ M  F DSMALK+AV+LR+ DI+HSH +  PITL Q+A+ I DS  PD
Sbjct  8     EELLRGQAEVWQLMFAFADSMALKSAVELRLADIMHSHGS--PITLPQLASRI-DSSCPD  64

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGA--TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
                L+R++R+LVR+ IF +  + SDG   T+Y  T  S+WL+ D+ELS+APM+L + +  
Sbjct  65    IPYLARLMRMLVRKGIF-AVHQSSDGGDETLYKMTHISKWLLHDSELSLAPMILVENNQW  123

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              + P+H  S+CVKEGG AF+KAHG  I++ A+  P+FN  FND M    +I+ KA+VS Y
Sbjct  124   LLEPWHYLSQCVKEGGIAFKKAHGCEIWDFASQSPQFNNLFNDAMACTAKIVMKALVSHY  183

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               DGF S+ SL DVGGGTG A+AEIVK++PHIKGINFDLPHVVATAP  +G+ HVGGDMF
Sbjct  184   K-DGFDSIQSLADVGGGTGGALAEIVKSYPHIKGINFDLPHVVATAPVCEGIFHVGGDMF  242

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
              +IP A A+F+KW+LHDW DE CVKILKNCR+A+P+K+GKL++V+ V++ +G+ IFGD+ 
Sbjct  243   DAIPKADAVFMKWILHDWDDEACVKILKNCRQAIPDKSGKLVLVEIVVQEDGNNIFGDMG  302

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              V DL+M AH++GGKERTE+EW +LL + GF    II   A+ SIIEAY Q
Sbjct  303   LVFDLVMFAHTTGGKERTEQEWMKLLEQGGFHRCKIISMPALYSIIEAYPQ  353



>ref|XP_006480222.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006480223.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X2 [Citrus sinensis]
Length=352

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/355 (55%), Positives = 260/355 (73%), Gaps = 7/355 (2%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             S + ++ L  QA++WK+M  FIDS+ALK A++LRIPDIIHSH    PITLSQIA++I DS
Sbjct  3     SVEGEASLRGQAEIWKHMFAFIDSLALKCAIELRIPDIIHSHGG--PITLSQIASSI-DS  59

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAELS-MAPMLLFQ  413
             PSP+ + L RI+RLL R+ IF +A  PSDG   +YG T +SRWLV  ++ + +  + L +
Sbjct  60    PSPEISYLERIMRLLGRKNIF-AAHHPSDGGEPLYGLTHSSRWLVTGSDSNQLVSVYLVE  118

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              HP  +  +H  S+CVKEGG A EKA G  + ++A+ D +FN  FN+GM   ++ +++ I
Sbjct  119   NHPYIVNSWHFMSQCVKEGGSAIEKAFGGVVIDLASKDQQFNNIFNEGMACNSKFLTREI  178

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             ++ Y   GF S+ SLVDV GG G  ++EIVK++PHIKGINFDLPHV+ TAP Y GV+HV 
Sbjct  179   LASYK-HGFDSLKSLVDVAGGIGGLISEIVKSYPHIKGINFDLPHVITTAPVYDGVTHVS  237

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIF  953
             GDMF +IP+A A+ +KWVLH+W DE CVKILKNCREA+PEKTGK+II+D VL+P+G  +F
Sbjct  238   GDMFHTIPNADALLLKWVLHNWSDEACVKILKNCREAIPEKTGKVIIIDVVLQPDGQGLF  297

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              D  Y  DL+M+ ++ GGKERTE EWK LL E GFP Y II+  A+ SIIEAY +
Sbjct  298   DDAGYAFDLVMMVNTPGGKERTELEWKNLLEEGGFPRYQIIKIPALQSIIEAYPE  352



>ref|XP_006480226.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
 ref|XP_006480227.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 191/355 (54%), Positives = 260/355 (73%), Gaps = 6/355 (2%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             S + ++ L  QA++WK+M  FIDS+ALK A++LRIPDIIHSH    PIT SQIA++I   
Sbjct  3     SVEGEASLRGQAEIWKHMFAFIDSLALKCAIELRIPDIIHSHGG--PITSSQIASSIDSP  60

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAELS-MAPMLLFQ  413
              SP+ + + RI+RLL  + IF +A  PSDG   +YG T +SRWLV  ++ + + P+ L +
Sbjct  61    CSPEISYIERIMRLLGHKNIF-AAQHPSDGGEPLYGLTHSSRWLVTGSDSNQLGPVFLVE  119

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              HP  +  +H  S+CVKEGG A EKA G    ++A+ D +FNK FN+GM   ++I+++ I
Sbjct  120   NHPYIVNSWHFLSQCVKEGGSAIEKAFGDAYIDLASKDQQFNKIFNEGMACNSKILTREI  179

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             ++GY   GF S+ SLVDV GG G  ++EIVK++PHIKGINFDLPHV+ TAP Y GV+HV 
Sbjct  180   LAGYK-HGFDSLKSLVDVAGGIGGLISEIVKSYPHIKGINFDLPHVITTAPVYDGVTHVS  238

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIF  953
             GDMF +IP+A A+ +KWVLH+W DE CVKILKNCR+A+PEKTGK+II+D +L+P+G  +F
Sbjct  239   GDMFHTIPNADALLLKWVLHNWSDEACVKILKNCRKAIPEKTGKVIIIDVILQPDGQGLF  298

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              D  Y  DL+M+ +++GGKERTE EWK+LL E GFP Y II+  A+ SIIEAY +
Sbjct  299   DDAGYAFDLVMMVNTAGGKERTELEWKKLLEEGGFPRYQIIKIPALQSIIEAYPE  353



>ref|XP_006420393.1| hypothetical protein CICLE_v10005297mg [Citrus clementina]
 gb|ESR33633.1| hypothetical protein CICLE_v10005297mg [Citrus clementina]
Length=353

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 190/355 (54%), Positives = 258/355 (73%), Gaps = 6/355 (2%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             S + ++ L  QA++WK+M  FIDS+ALK A++LRIPDIIHSH    PIT SQIA++I   
Sbjct  3     SVEGEASLRGQAEIWKHMFAFIDSLALKCAIELRIPDIIHSHGG--PITSSQIASSIDSP  60

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAELS-MAPMLLFQ  413
              SP+ + + RI+RLL  + IF +A  PSDG   +YG T +SRWLV  ++ + + P+ L +
Sbjct  61    SSPEISYIERIMRLLGHKNIF-AAQHPSDGGEPLYGLTHSSRWLVTGSDSNQLGPVFLVE  119

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              HP  +  +H  S+CVKEGG A EKA G    ++A+ D +FNK FN+GM    + +++ I
Sbjct  120   NHPYMVNSWHFLSQCVKEGGSAIEKAFGGVYIDLASKDQQFNKIFNEGMACNAKFLTREI  179

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             ++GY   GF S+ SLVDV GG G  ++EIVK++PHIKGINFDLPHV+ TAP Y GV+HV 
Sbjct  180   LAGYK-HGFDSLKSLVDVAGGIGGLISEIVKSYPHIKGINFDLPHVITTAPVYDGVTHVS  238

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIF  953
             GDMF +IP+A A+ +KWVLH+W DE CVKILKNCR+A+PEKTGK+I++D VL+P+G  +F
Sbjct  239   GDMFHTIPNADALLLKWVLHNWSDEACVKILKNCRKAIPEKTGKVIVIDVVLQPDGQGLF  298

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              D  Y  DL+M+ +++GGKERTE EWK+LL E GFP Y II+  A+ SIIEAY +
Sbjct  299   DDAGYACDLVMMVNTAGGKERTELEWKKLLEEGGFPRYQIIKIPALQSIIEAYPE  353



>ref|XP_010035710.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 258/361 (71%), Gaps = 10/361 (3%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
             M+   + ++ L  QA +   M  +  SMALK AV+LRIPDIIHS+    P+TL+QIA+ I
Sbjct  1     MESLHEIEATLRGQAHISNLMNAYAGSMALKCAVELRIPDIIHSYGGG-PVTLAQIASRI  59

Query  231   HDSPSPDTATLSRILRLLVRRKIFT-SAVRPSDG----ATVYGPTPASRWLVRDA--ELS  389
               SPS +T  L+RI+RLLVR  IF+ +  +P DG     T+Y   P+SRWL++    ELS
Sbjct  60    -PSPSLETTYLARIMRLLVRENIFSANRCQPDDGHESHETLYSLPPSSRWLLQGPGFELS  118

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESV  569
             +AP++L   HP  M+P+HCF  C+K GG AFE AHG+ I++ A+ +PEFN+ FNDGM  V
Sbjct  119   LAPVVLMLNHPWLMSPWHCFGDCIKTGGVAFEMAHGRKIWDFASENPEFNRLFNDGMACV  178

Query  570   TQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPE  749
             ++I    I+  Y  DGF S+GSLVDVGGG G  + EI+K+FPHI+GIN+DLPHVVATAP 
Sbjct  179   SRITIGGIIEVYK-DGFESIGSLVDVGGGIGKTLVEIIKSFPHIQGINYDLPHVVATAPA  237

Query  750   YQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL  929
             + GV+HVGG+MF +IP A A+ +  ++HDWGDE+CVKILKNCR+A+PEK GK+II + VL
Sbjct  238   HDGVTHVGGNMFETIPHADAVLMMEIMHDWGDEDCVKILKNCRKAIPEKNGKVIIANIVL  297

Query  930   KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
             K EGD +F     V DL+M+A  SGGKER E EWK++L E GFP YNII+   + SIIEA
Sbjct  298   KAEGDGMFDKTGLVMDLVMMALCSGGKERDEPEWKKILEEGGFPRYNIIKTPCLQSIIEA  357

Query  1110  Y  1112
             Y
Sbjct  358   Y  358



>ref|XP_010036413.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/359 (54%), Positives = 262/359 (73%), Gaps = 11/359 (3%)
 Frame = +3

Query  60    SFDE-KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             S DE ++ L  QA VWK +  + DSM LK AV+LR+PDIIHS+    P+TL+QIA+ I  
Sbjct  3     SLDETEATLRGQAHVWKLLYAYADSMVLKCAVELRLPDIIHSYGDG-PVTLAQIASRI-P  60

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-----TVYGPTPASRWLVRD--AELSMA  395
             S S  TA L+RI+RLLVR+ IF++     DG+     T+Y  TP+SRWL++   +ELS+A
Sbjct  61    SSSHGTAYLARIMRLLVRKNIFSANHCLPDGSHESHETLYSLTPSSRWLLQGCGSELSLA  120

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             PM+L + HP  M+ +HC    V+ GG AFE AHG+ +++ A+ +PEFN+ FNDGM S ++
Sbjct  121   PMVLMENHPWLMSSWHCLGDSVRTGGIAFEMAHGRKVWDFASENPEFNRLFNDGMASTSR  180

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             I+ + IV  Y  DGF S+GSLVDVGGG G A+ EI+K++PHI+G NFDLPHV+ATAP + 
Sbjct  181   ILVRGIVEAYK-DGFESIGSLVDVGGGIGGALTEIIKSYPHIQGTNFDLPHVIATAPAHN  239

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKP  935
              ++HVGGDMF +IP A A+F+K ++HDWGDE+C+KILKNCR+A+ EK GK+II D VLKP
Sbjct  240   RITHVGGDMFETIPHADAVFMKGIMHDWGDEDCIKILKNCRKAILEKKGKVIISDIVLKP  299

Query  936   EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +GD +F +   V DL+M+ H SGGKER E EWK++L E GF  YNII+   ++ IIEA+
Sbjct  300   KGDGMFDETGLVMDLVMMTHCSGGKERDELEWKKILEEGGFHRYNIIKTPYLSFIIEAF  358



>ref|XP_006480225.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Citrus 
sinensis]
Length=352

 Score =   370 bits (950),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 193/355 (54%), Positives = 259/355 (73%), Gaps = 7/355 (2%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             S + ++ L  QA++WK+M  FIDS+ALK A++LRIPDIIHSH    PITLSQIA+ I DS
Sbjct  3     SVEGEASLRGQAEIWKHMFAFIDSLALKCAIELRIPDIIHSHGG--PITLSQIASCI-DS  59

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAELS-MAPMLLFQ  413
             PSP+ + L RI+RLL R+ IF +A  PSDG   +YG T +SRWLV  ++ + +  + L +
Sbjct  60    PSPEISYLERIMRLLGRKNIF-AAHHPSDGGEPLYGLTHSSRWLVTGSDSNQLGSVYLVE  118

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              HP  +  +H  S+CVKEGG A EKA G  + ++A+ D +FN  FN+GM   ++ +++ I
Sbjct  119   NHPYIVNSWHFMSQCVKEGGSAIEKAFGGVVIDLASKDQQFNSIFNEGMACNSKFLTREI  178

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             +  Y   GF S+ SLVDV GG G  ++EIVK++P+IKGINFDLPHV+ TAP Y GV+HV 
Sbjct  179   LGSYK-HGFDSLKSLVDVAGGIGGLISEIVKSYPNIKGINFDLPHVITTAPVYDGVTHVS  237

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIF  953
             GDMF +IP+A A+ +KWVLH+W D+ CVKILKNCREA+PEKTGK+II+D VL+P+G  +F
Sbjct  238   GDMFHAIPNADALLLKWVLHNWSDDACVKILKNCREAIPEKTGKVIIIDVVLQPDGQGLF  297

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              D  Y  DL+M+ ++ GGKERTE EWK+LL E GFP Y II+  A+ SIIEAY +
Sbjct  298   DDAGYAFDLVMMVNTPGGKERTELEWKKLLEEGGFPRYQIIKIPALQSIIEAYPE  352



>ref|XP_008448276.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Cucumis 
melo]
Length=392

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/351 (54%), Positives = 258/351 (74%), Gaps = 5/351 (1%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD-SP  242
             + +++L  QA++WKYML F DSMALK AV+L + DII+SH +   ++    + A  + S 
Sbjct  43    EAEALLQGQAEIWKYMLCFADSMALKCAVELHLADIINSHGSPISLSQISSSIAASNPSS  102

Query  243   SPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTH  419
             SP  + L+RI+RLLVRR IF +A  PSDG  T+YG T +S+WL+RD+ L++APM   + H
Sbjct  103   SPQISYLNRIMRLLVRRNIF-AAHHPSDGGDTLYGLTHSSKWLLRDSPLTLAPMAFSELH  161

Query  420   PLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
                ++P+ CF+  VKEGG  F+ AHG  I++ A+ +P+FN  FND M S ++++  AI+S
Sbjct  162   QWMVSPWLCFTEAVKEGGSPFKIAHGLDIWDFASKNPQFNHFFNDAMASTSKVVMNAILS  221

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGD  779
              Y  DGF S+ SL DVGGG G +++EIVKAFPHIKGIN+DLPHV++TAP Y+GV+H+GGD
Sbjct  222   VYQ-DGFNSLDSLADVGGGIGGSISEIVKAFPHIKGINYDLPHVISTAPVYEGVTHIGGD  280

Query  780   MFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGD  959
             MF  IP   AIF+KW+LHDW D+ECVKIL+NC++A+PEK GK+IIV+ VL  EG   F D
Sbjct  281   MFEDIPKVDAIFMKWILHDWNDKECVKILENCKKAIPEKRGKVIIVEVVLNEEGKGAFDD  340

Query  960   ISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
               +  DLLMLAH++ GKERTE+EWK +L EAGF  YN+I   A+ SIIEAY
Sbjct  341   TKFYFDLLMLAHTN-GKERTEKEWKTILEEAGFSRYNLIPLPALVSIIEAY  390



>gb|KEH16872.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   365 bits (938),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/337 (54%), Positives = 246/337 (73%), Gaps = 7/337 (2%)
 Frame = +3

Query  111   MLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILRLLVR  290
             M  F DS ALKA V+LRI DII  +   +P++L+QI   + D+PSPD+  L R++R++VR
Sbjct  1     MTQFTDSFALKAVVELRIADIIDRYG--KPLSLTQIVQNLEDAPSPDSTLLLRVMRVMVR  58

Query  291   RKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEG  470
             RKIF SA +   G  +YG T AS+W+++D ++++APMLL + HP  + P +  S  +KEG
Sbjct  59    RKIF-SAEKSETGEILYGLTRASKWILQDTKMTLAPMLLLENHPFHLNPANFISEIIKEG  117

Query  471   ---GFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLv  641
                G AF + HG   FEM   D ++N  FN GM    +I+S+A+++GY  DGF  + SLV
Sbjct  118   TKNGTAFFRCHGHEQFEMTGLDSKYNDLFNQGMVCTARIVSRAVIAGYK-DGFNQIKSLV  176

Query  642   dvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIK  821
             DVGGG G +++EIV+A+PHI+ INFDLPHVV+TAP + G++HVGGDMFVS+PSA AI++K
Sbjct  177   DVGGGIGGSLSEIVRAYPHIQAINFDLPHVVSTAPNFDGITHVGGDMFVSVPSADAIYMK  236

Query  822   WVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSS  1001
             W+LHDW D+ C+KILKNCR+A+PEKTGK+IIVD VL PEG+  F D     D+++LAH++
Sbjct  237   WILHDWSDDHCIKILKNCRKAIPEKTGKVIIVDHVLDPEGNEPFTDTGIAFDMMLLAHNA  296

Query  1002  GGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             GGKERTEE WK L  E GFP YNII+  A+  IIEA+
Sbjct  297   GGKERTEENWKYLFNETGFPRYNIIKINALPCIIEAF  333



>ref|XP_004139935.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004154552.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN46755.1| hypothetical protein Csa_6G128650 [Cucumis sativus]
Length=357

 Score =   365 bits (938),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 195/349 (56%), Positives = 257/349 (74%), Gaps = 9/349 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI---HDSPSP  248
             +L  QA++WKYML F DSMALK AV+L + DII+SH +  PI+LSQIA++I   + S +P
Sbjct  12    LLQGQAEIWKYMLCFADSMALKCAVELHLADIINSHGS--PISLSQIASSIAASNPSSAP  69

Query  249   DTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
               + L+RI+RLLVRR IF +A  PSDG   +YG T +S+WL+RD+ L++APM   + H  
Sbjct  70    QISYLNRIMRLLVRRNIF-AAHHPSDGGDALYGLTHSSKWLLRDSPLTLAPMAFSELHQW  128

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              + P+ CF+  VKEGG  F+ A+G  I++ A  +P+FN  FN+ M S ++++  A++S Y
Sbjct  129   MVNPWLCFTGAVKEGGSPFKIANGLDIWDFAFKNPQFNHFFNNAMASTSKVVMNAVLSVY  188

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               DGF SV SL DVGGG G +++EIVKA PHIKGIN+DLPHVV+TAP Y+GV H+GGDMF
Sbjct  189   L-DGFNSVHSLADVGGGIGGSISEIVKALPHIKGINYDLPHVVSTAPVYEGVIHIGGDMF  247

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
               IP A AIF+KW+LHDW D+ECVKIL+NC++A+PEK GK+IIVD VL  EG   F D  
Sbjct  248   EDIPKADAIFMKWILHDWNDKECVKILENCKKAIPEKRGKVIIVDVVLNEEGKGAFDDTR  307

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +  DLLMLAH++ GKERTE+EWK +L EAGF  Y +I   A+ SIIEAY
Sbjct  308   FYFDLLMLAHTN-GKERTEKEWKTILEEAGFSRYKLIPLPALVSIIEAY  355



>gb|ABZ89566.1| O-methyltransferase 2 [Humulus lupulus]
Length=360

 Score =   365 bits (937),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 193/355 (54%), Positives = 257/355 (72%), Gaps = 10/355 (3%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPD  251
             ++ L  +A VWK +    D M +K A++LRIPDI+HSH+A  PITL+QIA+++ DSPS +
Sbjct  10    EAALRGEANVWKSINGIADFMVMKCALELRIPDIVHSHSA--PITLAQIASSVPDSPSLN  67

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAEL----SMAPMLLFQTH  419
              + LSRI+RLLVRRKIF+          +YGPT +SR L+    L    ++AP + F TH
Sbjct  68    LSYLSRIMRLLVRRKIFSQHKSLDGEEVLYGPTHSSRLLLSKTTLPDQVTLAPFVAFMTH  127

Query  420   PLSMAPFHCFSRCVKEGGFAFEKAHG-KGIFEMAAGDPEFNKSFNDGMESVTQIISKAIV  596
             P   AP+ C +RCVKEGG  FE  HG + +++++ G+PEFNK FNDGM S  +I + AI+
Sbjct  128   PYLSAPWSCLARCVKEGGNGFEMVHGGRQLWDLSPGNPEFNKVFNDGMASTARITTMAIL  187

Query  597   SGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQG-VSHVG  773
             S Y  D F  + SLVDVGG  G +++ IVK+ PHIKGIN+DLPHVVATAP Y G VSHVG
Sbjct  188   SEYR-DVFCGICSLVDVGGEFGGSISAIVKSHPHIKGINYDLPHVVATAPTYTGLVSHVG  246

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIF  953
             G+MF  IP+A A+F+KW+LHDW DE+CVKILKNCR A+PEK GK+IIVD VL+PEG+ +F
Sbjct  247   GNMFEWIPTAVAVFMKWILHDWADEDCVKILKNCRRAMPEKGGKIIIVDIVLEPEGNGLF  306

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              D + + D+ ++A +  GKERTE+EWKR+L E GFP Y I++  A+ S+IEAY Q
Sbjct  307   DDAAVMLDIALMALTR-GKERTEKEWKRVLEEGGFPRYQILKIPALTSVIEAYPQ  360



>ref|XP_011045485.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Populus 
euphratica]
Length=352

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/356 (54%), Positives = 263/356 (74%), Gaps = 7/356 (2%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
              S + ++ML SQ ++ + +L F DSMALK AV+LR+ DII+SH   +PI+LSQIAA I +
Sbjct  2     ASQEAEAMLKSQVEISQLVLGFADSMALKCAVELRLADIINSHG--RPISLSQIAAGI-N  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQ  413
             SPS   ++L+RI+R LVR++ FT A  PSDG  T++G    SR L+ D+E S+AP+++ Q
Sbjct  59    SPSSGISSLARIMRYLVRKEFFT-AHPPSDGGETLFGLNQKSRLLIHDSEQSLAPVVIMQ  117

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              +P  +AP+HC S+C+KEGG AF KAHG  ++++A+ +PE N+ FN+ M   ++I+ + I
Sbjct  118   LNPWLLAPWHCLSQCIKEGGTAFSKAHGCEVWDLASRNPEVNRIFNEAMACTSKIVMREI  177

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             +S Y  DGF ++ SLVDV GG G  VAEIV+A+PHI+GIN DLPHVVATAP+Y+GVSHV 
Sbjct  178   LSQYK-DGFNNIRSLVDVAGGIGGHVAEIVRAYPHIEGINLDLPHVVATAPKYEGVSHVA  236

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGD-PI  950
             G+MF +IP+A AIFIK +LHDW DE CV+IL+NC+ A+PEKTGKLII D VL+ +     
Sbjct  237   GNMFDAIPNADAIFIKRILHDWTDESCVEILRNCKRAIPEKTGKLIIADIVLQTDDHCDQ  296

Query  951   FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
               DI    DL M A ++GGKERTE+EWK+LL E GFP Y II+  A+ SIIEAY +
Sbjct  297   LDDIRMAMDLAMFAVTTGGKERTEQEWKKLLEEGGFPRYKIIKIPALESIIEAYPE  352



>ref|XP_010035711.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 256/359 (71%), Gaps = 11/359 (3%)
 Frame = +3

Query  60    SFDE-KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             S DE ++ L  QA +   +  +  SMALK AV+LR+PDIIHS+     +TL+QIA+ I  
Sbjct  3     SLDETEANLRGQAHILNLLNAYAGSMALKCAVELRVPDIIHSYGGGL-VTLAQIASRI-P  60

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-----TVYGPTPASRWLVRDA--ELSMA  395
             S S +TA L+RI+RLLVR  IF++     DG      T+Y   P+SRWL++    ELS+A
Sbjct  61    SASLETAYLARIMRLLVRENIFSANRCQPDGGHESHETLYSLPPSSRWLLQGPGFELSLA  120

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             P++L   HP  M+P+HC   C+K GG AFE AHG+ I++ A+ +PEFN+ FND M  V+ 
Sbjct  121   PVVLMLNHPWVMSPWHCLGDCIKTGGIAFEMAHGRKIWDFASENPEFNRLFNDAMACVSG  180

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             I  +AI+     DGF S+GSLVDVGGG G  + EI+K+FPHI+GIN+DLPHVVATAP + 
Sbjct  181   ITIRAILE-VNKDGFESIGSLVDVGGGIGKTLVEIIKSFPHIQGINYDLPHVVATAPAHD  239

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKP  935
             GV+HVGG+MF +IP A A+ + W++HDWGDE+CVKILKNCR+A+ +K GK+II + VLK 
Sbjct  240   GVTHVGGNMFETIPHADAVLMMWIMHDWGDEDCVKILKNCRKAISKKNGKVIIANIVLKA  299

Query  936   EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             EGD +F  I  V DL+M+A  SGGKER E EWK++L + GFP YNII+  +++SIIEAY
Sbjct  300   EGDGMFDKIGLVMDLVMMALCSGGKERDEPEWKKILEDGGFPRYNIIETPSLSSIIEAY  358



>gb|ACO90220.1| putative O-methyltransferase [Eschscholzia californica]
Length=362

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 196/355 (55%), Positives = 251/355 (71%), Gaps = 12/355 (3%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD-SPS  245
             E+  L  QA + K ML FIDSMALK AV+L IPDIIHSH   QPITLS+I   I + SPS
Sbjct  10    EEMELQGQADICKLMLAFIDSMALKCAVELGIPDIIHSHG--QPITLSEIINGIPNLSPS  67

Query  246   PDTATLSRILRLLVRRKIFTSAVRP--SDGA----TVYGPTPASRWLVRDAELSMAPMLL  407
              D   L RI+RLLVR ++F SA  P   DG+    T+YG TP+S+WLV+D+++S+AP++L
Sbjct  68    FDINYLFRIMRLLVRNRVF-SAYEPDLKDGSSGTKTLYGLTPSSKWLVKDSKISLAPLVL  126

Query  408   FQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
              + HP  + P+H   +CV+EGGFAF KAHG  I++  + +PEFNK F+ GM   + ++  
Sbjct  127   AENHPWLLDPWHYLGKCVQEGGFAFAKAHGSEIWKFGSENPEFNKLFSVGMACSSTLVVD  186

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
             AI+  Y  +GF  + S+VDVGG  G  + EIVK +PHI+G NFDLPHVVA A E  GV+H
Sbjct  187   AILDNYH-EGFGDLESIVDVGGAIGTLINEIVKKYPHIRGTNFDLPHVVAEALENPGVAH  245

Query  768   VGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDP  947
             VGGDMFV IPSA A+ +KWVLHDW DE+CVKILKNC +A+  K GKLII++ VLKP+G+ 
Sbjct  246   VGGDMFVEIPSADAVILKWVLHDWNDEDCVKILKNCNKAISNK-GKLIIIECVLKPDGEG  304

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +F  +    DLLM+AHSSGG+ERTE EWK+LL   GF  Y I     + SIIEAY
Sbjct  305   LFDGLGLAFDLLMIAHSSGGRERTEAEWKKLLKAGGFSRYKITPIKGIPSIIEAY  359



>ref|XP_010035709.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 254/361 (70%), Gaps = 10/361 (3%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
             M+   + ++ L  QA +   +  +  SMALK AV+LRIPDIIHS+    P+TL+QIA+ I
Sbjct  1     MESLHETEATLRGQAHILNLLNAYAGSMALKCAVELRIPDIIHSYGGG-PVTLAQIASRI  59

Query  231   HDSPSPDTATLSRILRLLVRRKIFT-SAVRPSDG----ATVYGPTPASRWLVRDA--ELS  389
               SPS +TA L+RI+RLLVR  IF+ +  +P DG     T+Y   P+SRWL++    ELS
Sbjct  60    -PSPSLETAYLARIMRLLVRENIFSANRCQPDDGHESHETLYSLPPSSRWLLQGPGFELS  118

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESV  569
             +AP++L   HP  M+P+  F  C+K GG AFE AHG+ I++ A+ +PEFN+ FNDGM  V
Sbjct  119   LAPVVLMLNHPWMMSPWQFFGDCIKTGGIAFEMAHGRKIWDFASENPEFNRLFNDGMACV  178

Query  570   TQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPE  749
             ++I    I+  Y  DGF S+GSLVDVGGG G  + EI+K+ PHI+GIN+DLPHVVATAP 
Sbjct  179   SRITIGGIIEVYK-DGFESIGSLVDVGGGIGKNLVEIIKSCPHIQGINYDLPHVVATAPA  237

Query  750   YQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL  929
             + GV+HVGG+MF +IP A A+ +  ++HDWGDE+CVKILKNCR+A+PEK GK+II + VL
Sbjct  238   HDGVTHVGGNMFETIPHADAVLLMEIMHDWGDEDCVKILKNCRKAIPEKNGKVIIANIVL  297

Query  930   KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
             K E D +F     V DL M+A  SGGKER E EWK++L E GFP YNII+   + SIIEA
Sbjct  298   KAEDDGMFDKTKLVMDLAMMALCSGGKERDELEWKKILEEGGFPRYNIIKTPCLQSIIEA  357

Query  1110  Y  1112
             Y
Sbjct  358   Y  358



>ref|XP_002319364.2| hypothetical protein POPTR_0013s13990g [Populus trichocarpa]
 gb|EEE95287.2| hypothetical protein POPTR_0013s13990g [Populus trichocarpa]
Length=354

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 194/355 (55%), Positives = 261/355 (74%), Gaps = 9/355 (3%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
              S + ++   SQ ++++  L F+DSMALK AV+LR+P+II+SH   +PI+LSQIA+ I +
Sbjct  2     ASQEAEAFFKSQFEIFQLSLGFVDSMALKCAVELRLPEIINSHG--RPISLSQIASGI-N  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQ  413
             SPS D + L+RI+R LVR++IFT A  PSDG  T++G    SR L+ D+E S+  +++ Q
Sbjct  59    SPSSDISYLARIMRYLVRKEIFT-AHPPSDGGETLFGLNQKSRMLMHDSERSLVSIIIMQ  117

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
                  +A +HC S+C+KEGG AF KAHG  +++ A+ +PE N+ FN+ M   + I  +AI
Sbjct  118   HSSWFLAAWHCLSQCIKEGGTAFSKAHGCELWDFASRNPEVNRIFNEAMACTSNITMRAI  177

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             +S Y  DGF ++ SLVDV GG G  VAEIV+A+PHI+GINFDLPHVVATAP+Y+GVSHV 
Sbjct  178   LSHYK-DGFNNIRSLVDVAGGIGGHVAEIVRAYPHIEGINFDLPHVVATAPKYEGVSHVA  236

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPI-  950
             G+MF +IP+A AIFI+ +LHDW DE CV+IL+NC++A+PEKTGKLIIVD VL P  D   
Sbjct  237   GNMFEAIPNADAIFIQRILHDWTDESCVEILRNCKKAIPEKTGKLIIVDIVL-PTDDHCD  295

Query  951   -FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              F DI  V DL+M A ++GGKERTE+EWK+LL E GF  Y II+  A+ SIIEAY
Sbjct  296   QFDDIRMVMDLVMFALTTGGKERTEQEWKKLLEEGGFSRYKIIKIPALESIIEAY  350



>ref|XP_011045486.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Populus 
euphratica]
Length=352

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 194/356 (54%), Positives = 260/356 (73%), Gaps = 7/356 (2%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
              S + ++ML SQ ++ + +L F DSMALK AV+LR+ DII+SH   +PI+LSQIA+ I +
Sbjct  2     ASQEAEAMLKSQVEISQLVLGFADSMALKCAVELRLADIINSHG--RPISLSQIASGI-N  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQ  413
             SPSPD + L+RI+R +VR+ IF SA  PSDG  T++G    SR L+ D+E S+ P+L  Q
Sbjct  59    SPSPDISYLARIMRYVVRKDIF-SAHPPSDGGETLFGLNQKSRMLMHDSERSLVPILTIQ  117

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
               P   AP+HC S+C+KEGG +F KAHG  +++ ++ +PE ++ FN+ M   ++I   AI
Sbjct  118   HSPWLQAPWHCLSQCIKEGGTSFSKAHGCELWDFSSRNPEASRIFNEAMACTSKITMTAI  177

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             +S Y  DGF ++ SLVDVGGG G  VAE  +A+PHIKGIN DLPHVVATAP+Y+GVSHV 
Sbjct  178   LSHYK-DGFNNIRSLVDVGGGIGGHVAEFARAYPHIKGINLDLPHVVATAPKYEGVSHVA  236

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGD-PI  950
             G+MF +IP+A AIFIK +LHDW DE CV+IL+NC++A+PEKTGKLIIVD VL+ +     
Sbjct  237   GNMFEAIPNADAIFIKRILHDWTDESCVEILRNCKKAIPEKTGKLIIVDIVLQTDDHCDK  296

Query  951   FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             F DI    DL+M A ++GGKERTE+EWK+LL E GF  Y II+  A+ SIIEAY +
Sbjct  297   FDDIRMGMDLVMFAVTTGGKERTEQEWKKLLEEGGFSRYKIIKIPALESIIEAYPE  352



>ref|XP_011045483.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X1 [Populus euphratica]
Length=352

 Score =   353 bits (906),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 192/352 (55%), Positives = 255/352 (72%), Gaps = 8/352 (2%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
             E  +   Q ++ +  L F DSMALK AV+LR+ DII+SH   +PI+LSQIAA I +SPSP
Sbjct  7     EAILFKIQVEISQLALGFADSMALKCAVELRLADIINSHG--RPISLSQIAAGI-NSPSP  63

Query  249   DTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
             D + L+RI+R LVR++IFTS   PSDG  T++G    SR L+ D+E S+  +++ Q  P 
Sbjct  64    DISYLARIMRYLVRKEIFTSH-PPSDGGETLFGLNQKSRLLIHDSEQSLTSLVIMQHSPW  122

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              +AP+HC S+ +KEGG AF KAHG  ++++A+ +PE N+ FN+ M   ++I+ + I+S Y
Sbjct  123   LLAPWHCLSQSIKEGGTAFSKAHGCEMWDLASRNPEVNRIFNEAMACTSKIVMREILSQY  182

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               DGF ++ SLVDV GG G  VAEIV+A+PHIKGIN DLPHVVATAP+Y+GVSHV G+MF
Sbjct  183   K-DGFNNIRSLVDVAGGIGGHVAEIVRAYPHIKGINLDLPHVVATAPKYEGVSHVAGNMF  241

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGD-PIFGDI  962
              +IP+A AIFIK +LHDW DE CV+IL+NC++A+PEKTGKLII D VL+ +     F D 
Sbjct  242   DAIPNADAIFIKRILHDWTDESCVEILRNCKKAIPEKTGKLIIADIVLQTDDQRDQFDDT  301

Query  963   SYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
                 DL M AH +GGKERTE+EWK+LL E GF  Y II+  A+ SIIEAY +
Sbjct  302   RMAMDLAMFAH-TGGKERTEQEWKKLLEEGGFSRYKIIKIPALESIIEAYPE  352



>gb|KCW47151.1| hypothetical protein EUGRSUZ_K00956 [Eucalyptus grandis]
Length=361

 Score =   353 bits (907),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/360 (53%), Positives = 255/360 (71%), Gaps = 12/360 (3%)
 Frame = +3

Query  60    SFDE-KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             S DE ++ L  QA +   +  +  SMALK AV+LR+PDIIHS+     +TL+QIA+ I  
Sbjct  3     SLDETEANLRGQAHILNLLNAYAGSMALKCAVELRVPDIIHSYGGGL-VTLAQIASRI-P  60

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-----TVYGPTPASRWLVRDA--ELSMA  395
             S S +TA L+RI+RLLVR  IF++     DG      T+Y   P+SRWL++    ELS+A
Sbjct  61    SASLETAYLARIMRLLVRENIFSANRCQPDGGHESHETLYSLPPSSRWLLQGPGFELSLA  120

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             P++L   HP  M+P+HC   C+K GG AFE AHG+ I++ A+ +PEFN+ FND M  V+ 
Sbjct  121   PVVLMLNHPWVMSPWHCLGDCIKTGGIAFEMAHGRKIWDFASENPEFNRLFNDAMACVSG  180

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             I  +AI+     DGF S+GSLVDVGGG G  + EI+K+FPHI+GIN+DLPHVVATAP + 
Sbjct  181   ITIRAILE-VNKDGFESIGSLVDVGGGIGKTLVEIIKSFPHIQGINYDLPHVVATAPAHD  239

Query  756   GVSHVGGDMFVSIPSAQAIFIK-WVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK  932
             GV+HVGG+MF +IP A A+ +   ++HDWGDE+CVKILKNCR+A+ +K GK+II + VLK
Sbjct  240   GVTHVGGNMFETIPHADAVLMMVRIMHDWGDEDCVKILKNCRKAISKKNGKVIIANIVLK  299

Query  933   PEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              EGD +F  I  V DL+M+A  SGGKER E EWK++L + GFP YNII+  +++SIIEAY
Sbjct  300   AEGDGMFDKIGLVMDLVMMALCSGGKERDEPEWKKILEDGGFPRYNIIETPSLSSIIEAY  359



>ref|XP_002319365.2| hypothetical protein POPTR_0013s14000g [Populus trichocarpa]
 gb|EEE95288.2| hypothetical protein POPTR_0013s14000g [Populus trichocarpa]
Length=354

 Score =   353 bits (905),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 193/355 (54%), Positives = 259/355 (73%), Gaps = 9/355 (3%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
              S + ++   SQ ++++  L F+DSMALK AV+LR+P+II+SH   +PI+LSQIA+ I +
Sbjct  2     ASQEAEAFFKSQFEIFQLSLGFVDSMALKCAVELRLPEIINSHG--RPISLSQIASGI-N  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQ  413
             SPS D + L+RI+R LVR++ FT A  PSDG  T++G    SR L+ D+E S+  ++  Q
Sbjct  59    SPSSDISYLARIMRYLVRKEFFT-AHPPSDGGETLFGLNQKSRMLMHDSERSLVSIITMQ  117

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
                  +A +HC S+C+KEGG AF KAHG  +++ A+ +PE N+ FN+ M   + I  +AI
Sbjct  118   HSSWFLAAWHCLSQCIKEGGTAFSKAHGCELWDFASRNPEVNRIFNEAMACTSNITMRAI  177

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             +S Y  DGF ++ SLVDV GG G  VAEIV+A+PHI+GINFDLPHVVATAP+Y+GVSHV 
Sbjct  178   LSHYK-DGFNNIRSLVDVAGGIGGHVAEIVRAYPHIEGINFDLPHVVATAPKYEGVSHVA  236

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPI-  950
             G+MF +IP+A AIFI+ +LHDW DE CV+IL+NC++A+PEKTGKLIIVD VL P  D   
Sbjct  237   GNMFEAIPNADAIFIQRILHDWTDESCVEILRNCKKAIPEKTGKLIIVDIVL-PTDDHCD  295

Query  951   -FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              F DI  V DL+M A ++GGKERTE+EWK+LL E GF  Y II+  A+ SIIEAY
Sbjct  296   QFDDIRMVMDLVMFALTTGGKERTEQEWKKLLEEGGFSRYKIIKIPALESIIEAY  350



>ref|XP_002513062.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF49565.1| o-methyltransferase, putative [Ricinus communis]
Length=360

 Score =   353 bits (905),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 189/355 (53%), Positives = 246/355 (69%), Gaps = 11/355 (3%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             DE   L  QA +W  +  +I+ MALK  V L IPDII+SH    P++LS I   I + PS
Sbjct  9     DEAMKLMGQAAIWNCLFGYIEGMALKCIVQLYIPDIINSHGC--PLSLSAIVKTI-NHPS  65

Query  246   PDTATLSRILRLLVRRKIFTS----AVRPSDGAT--VYGPTPASRWLVRDAELSMAPMLL  407
              +T  LSRI+ LLVRR IF++    A    D  T  +YG T +S+WL+RD+++S+APMLL
Sbjct  66    FNTNRLSRIMALLVRRDIFSAKPAVATEAEDNNTTLLYGLTNSSKWLIRDSKMSLAPMLL  125

Query  408   FQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
              Q H   ++ FH  +  VKEGG  F K HG  +++ A  +PEFN  FN+ M + + II +
Sbjct  126   LQNHETFVSTFHQLADIVKEGGTGFAKCHGMEVWDFALANPEFNNLFNEAMAAASMIIVE  185

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
             A+  GY   GF  +GSLVDV GGTGA +AEIVK  PHIKG NFDLPHVVATAP+Y GV+H
Sbjct  186   AVKKGYKA-GFNGIGSLVDVAGGTGAMIAEIVKEHPHIKGTNFDLPHVVATAPKYVGVNH  244

Query  768   VGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDP  947
             V GDMF SIPSA A+ +KW+LHDW DE+C+KILKNCR+A+P+KTGKLI++DAVL P+G+ 
Sbjct  245   VAGDMFTSIPSADALLLKWILHDWKDEDCIKILKNCRKAVPKKTGKLIVIDAVLCPKGNG  304

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +F ++ +V DL ++     GKER E EW+ LL E GF  Y II+  A+ASIIEAY
Sbjct  305   LFDEMGFVLDLALMTQID-GKERDESEWEILLKEGGFGRYKIIKIPALASIIEAY  358



>gb|ABK94890.1| unknown [Populus trichocarpa]
Length=354

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 192/355 (54%), Positives = 259/355 (73%), Gaps = 9/355 (3%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
              S + ++   S  ++++  L F+DSMALK AV+LR+P+II+SH   +PI+LSQIA+ I +
Sbjct  2     ASQEAEAFFKSLFEIFQLSLGFVDSMALKCAVELRLPEIINSHG--RPISLSQIASGI-N  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQ  413
             SPS D + L+RI+R LVR++IFT A  PSDG  T++G    SR L+ D+E S+  ++  Q
Sbjct  59    SPSSDISYLARIMRYLVRKEIFT-AHPPSDGGETLFGLNQKSRMLMHDSERSLVSIITMQ  117

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
                  +A +HC S+C+KEGG AF KAHG  +++ A+ +PE N+ FN+ M   + I  +AI
Sbjct  118   HSSWFLAAWHCLSQCIKEGGTAFSKAHGCELWDFASRNPEVNRIFNEAMACTSNITMRAI  177

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             +S Y  DGF ++ SLVDV GG G  VAEIV+A+PHI+GINFDLPHVVATAP+Y+GVSHV 
Sbjct  178   LSHYK-DGFNNIRSLVDVAGGIGGHVAEIVRAYPHIEGINFDLPHVVATAPKYEGVSHVA  236

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPI-  950
             G+MF +IP+A AIF++ +LHDW DE CV+IL+NC++A+PEKTGKLIIVD VL P  D   
Sbjct  237   GNMFEAIPNADAIFMQRILHDWTDESCVEILRNCKKAIPEKTGKLIIVDIVL-PTDDHCD  295

Query  951   -FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              F DI  V DL+M A ++GGKERTE+EWK+LL E GF  Y II+  A+ SIIEAY
Sbjct  296   QFDDIRMVMDLVMFALTTGGKERTEQEWKKLLEEGGFSRYKIIKIPALESIIEAY  350



>ref|XP_011045482.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Populus 
euphratica]
Length=352

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/356 (52%), Positives = 260/356 (73%), Gaps = 7/356 (2%)
 Frame = +3

Query  57    GSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
              S + +++  S+ ++ + +L F DSMALK A++L + DII+SH   +PI+LSQIA+ I +
Sbjct  2     ASLEVEALFKSEVEISQLLLRFADSMALKCAIELGLADIINSHG--RPISLSQIASGI-N  58

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQ  413
             SP  D + L+RI+R LVR++ FT A  PSDG  T++G    SR L+ D+E S+A +++ Q
Sbjct  59    SPRSDMSYLARIMRYLVRKEFFT-AHPPSDGGETLFGLNQKSRLLMHDSERSLASLIIMQ  117

Query  414   THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              HP  + P+HC S+CVKEGG AF K HG  ++++A+ +PE N+ FN+ M   ++I++ A 
Sbjct  118   NHPWFLEPWHCLSQCVKEGGTAFSKVHGCEVWDLASRNPEVNRIFNEAMACTSKIVTTAS  177

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             +S Y  DGF ++ SLVDV GG G  VAEIV+A+PHI+GIN DLPHVVATAP+Y GVSHV 
Sbjct  178   LSQYK-DGFNNIRSLVDVAGGIGGHVAEIVRAYPHIEGINLDLPHVVATAPKYDGVSHVA  236

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEG-DPI  950
             G+MF +IP+A AI+++ +LH + DE  V+IL+NC++A+PEKTGKLIIVD VL+ +     
Sbjct  237   GNMFEAIPNADAIYMQRILHGFTDESGVEILRNCKKAIPEKTGKLIIVDIVLQTDDYRDQ  296

Query  951   FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             F DI  V DL+M+A +SGGKERTE+EWK+LL E GFP Y II+  A+ SIIEAY +
Sbjct  297   FDDIRMVMDLMMIAQTSGGKERTEQEWKKLLEEGGFPRYKIIKIPALQSIIEAYPE  352



>ref|XP_010932727.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Elaeis 
guineensis]
Length=350

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 185/352 (53%), Positives = 245/352 (70%), Gaps = 5/352 (1%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             +++S+L  Q  VW+ ML F DSM L+ AV+L I DIIH H   +P++L  +A+ I  SP 
Sbjct  3     EDRSVLEGQTWVWQTMLAFADSMVLRCAVELGIADIIHQHG--EPLSLPHLASLI-PSPP  59

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
             P+  +  RI+R L  +KIF++   P  G T+YG TPASR LVR ++ S+ PM+LF+THP 
Sbjct  60    PNPTSFLRIMRFLTHKKIFSTHSHPDTGETLYGLTPASRVLVRSSDFSLVPMVLFETHPF  119

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKG-IFEMAAGDPEFNKSFNDGMESVTQIISKAIVSG  602
              +A +H FS  V++GG  +  AHG   +F  AA +PEFN  FN+ M    +    A++S 
Sbjct  120   PIAAWHSFSASVRQGGAPYIMAHGMDMLFGTAATNPEFNAVFNNAMACTAKGTLDAVISA  179

Query  603   YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
             YG DGF  +GSL DVGGGTGA + EIVK  P IKGINFDLPHV+  APEY GV+HV GDM
Sbjct  180   YG-DGFAGLGSLADVGGGTGATLGEIVKLHPGIKGINFDLPHVIEGAPEYPGVTHVAGDM  238

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDI  962
             F +IP A A+F+K V+H +GDEEC K+L+NCR  +PEKTGK+IIVD VL P+ +   GDI
Sbjct  239   FQTIPPADAVFMKTVMHCFGDEECEKVLRNCRGVIPEKTGKVIIVDVVLYPDDNSPLGDI  298

Query  963   SYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
                 D+LM A++S GKERTEEEWK+LL  +GFP +NII+  A+ SIIEA+ +
Sbjct  299   RAKFDMLMFAYTSTGKERTEEEWKKLLKASGFPRWNIIRIPAIWSIIEAFPE  350



>ref|XP_010689116.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=363

 Score =   345 bits (886),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 190/364 (52%), Positives = 255/364 (70%), Gaps = 9/364 (2%)
 Frame = +3

Query  42    EEVMDGSFDEKS-MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             +E++ G+ +E + +L + A+V+ ++  + D++AL++AV+L I DIIHSH   QP++LSQI
Sbjct  4     KEIVLGNVNEDAELLKAHAEVYNHLFAYTDTLALRSAVELHIADIIHSHG--QPMSLSQI  61

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATV-YGPTPASRWLVRDAELSMA  395
             A+ + +SPSPD   L+R++R+LVR+ IFT     S G  V YG T  SRWL+ D ELS+A
Sbjct  62    ASKL-ESPSPDVTCLARVMRMLVRKNIFTVDCNQSSGEEVLYGLTNISRWLLHDHELSLA  120

Query  396   PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
             PM L  THP  +  ++  S  +KEGG  FEKA+G+  +E A+ DPEFN  FN GM + T+
Sbjct  121   PMFLTFTHPWIINAWYEISSSIKEGGTPFEKAYGQSFWERASKDPEFNNMFNIGMAAATK  180

Query  576   IISKAIVSGYGGDGFRSV-GSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEY  752
                 A+V GY  DGF    G+LVDVGGG G  +A+IVKA+PHIKGINFDLPHVV TAP+Y
Sbjct  181   PTLDAVVKGYK-DGFSGFKGTLVDVGGGIGRMIAKIVKAYPHIKGINFDLPHVVGTAPQY  239

Query  753   QGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK  932
              GV+HVGGDMF  IP+A AI  K VLHDW DEEC+ ILKNC++AL ++ GK+IIVD +L 
Sbjct  240   PGVTHVGGDMFKEIPTADAIIFKSVLHDWADEECLAILKNCKKALSQEKGKVIIVDVILH  299

Query  933   PEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNI--IQNIAVASIIE  1106
              +G  +F D     DL ++A   GGKERTE+EWK+LL+EAGF +  I  +  I   SIIE
Sbjct  300   ADGKGLFDDAVIGCDLWLMADCVGGKERTEDEWKKLLIEAGFTHLKITPLPTIMSLSIIE  359

Query  1107  AYSQ  1118
             A+ Q
Sbjct  360   AFPQ  363



>gb|AAC49708.1| caffeic acid O-methyltransferase [Pinus taeda]
Length=381

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 196/378 (52%), Positives = 255/378 (67%), Gaps = 22/378 (6%)
 Frame = +3

Query  24    SKFSPMEEVMDGSFD-EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQP  200
             +K +  E   DG F+ E+  L  QA+ WK    F +S+A+K  V L IPD+I        
Sbjct  9     AKSNGCEISRDGFFESEEEELQGQAEAWKCTFAFAESLAVKCVVLLGIPDMIAREGPRAT  68

Query  201   ITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIF--TSAVRPSDGATVYGPTPASRWLVR  374
             ++L +I A +  + SPD A L RI+R LV + IF  + + R     T YG TPAS+WLV+
Sbjct  69    LSLCEIVANL-PTESPDAACLFRIMRFLVAKGIFPASKSARRRAFETRYGLTPASKWLVK  127

Query  375   DAELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFND  554
               ELSMAPMLL Q    ++AP+H F+ CV EGG AF+KA+G  I+  A+  P+FN  FN+
Sbjct  128   GRELSMAPMLLMQNDETTLAPWHHFNECVLEGGVAFQKANGAEIWSYASDHPDFNNLFNN  187

Query  555   GMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVV  734
              M    +I+ KAI+S Y   GF S+ SLVDVGGGTG AVAEIV+A+P I+GIN+DLPHVV
Sbjct  188   AMACNARIVMKAILSKY--QGFHSLNSLVDVGGGTGTAVAEIVRAYPFIRGINYDLPHVV  245

Query  735   ATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLII  914
             ATA    GV HVGGDMF ++P+A AIF+KW++HDW DE+C+KILKNCR+A+P+ TGK+II
Sbjct  246   ATASSLSGVQHVGGDMFETVPTADAIFMKWIMHDWNDEDCIKILKNCRKAIPD-TGKVII  304

Query  915   VDAVL------------KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGF  1058
             VD VL            K   DPI G    V DL+M+AHSSGGKERTE+EWKR+L+E GF
Sbjct  305   VDVVLDADQGDNTDKKRKKAVDPIVG---TVFDLVMVAHSSGGKERTEKEWKRILLEGGF  361

Query  1059  PNYNIIQNIAVASIIEAY  1112
               YNII+  A+ S+IEA+
Sbjct  362   SRYNIIEIPALQSVIEAF  379



>gb|AAD24001.1|AF119225_1 caffeic acid ortho-methyltransferase [Pinus radiata]
Length=382

 Score =   343 bits (879),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 255/379 (67%), Gaps = 23/379 (6%)
 Frame = +3

Query  24    SKFSPMEEVMDGSFD-EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQP  200
             +K +  E   DG F+ E+  L  QA+ WK    F +S+A+K  V L IPD+I        
Sbjct  9     AKSNGCEISRDGFFESEEEELQGQAEAWKCTFAFAESLAVKCVVLLGIPDMIAREGPRAT  68

Query  201   ITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGA---TVYGPTPASRWLV  371
             ++L +I A +  + SPD A L RI+R LV + IF ++    +G    T YG TPAS+WLV
Sbjct  69    LSLGEIVAKL-PTESPDAACLFRIMRFLVAKGIFRASKSAREGGAFETRYGLTPASKWLV  127

Query  372   RDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFN  551
             +  ELSMAPMLL Q    ++AP+H F+ CV EGG AF+KA+G  I+  A+  P+FN  FN
Sbjct  128   KGRELSMAPMLLMQNDETTLAPWHHFNECVLEGGVAFQKANGAEIWSYASDHPDFNNLFN  187

Query  552   DGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHV  731
             + M    +I+ KAI+S Y   GF S+ SLVDVGGGTG AVAEIV+A+P I+GIN+DLPHV
Sbjct  188   NAMACNARIVMKAILSKY--QGFHSLNSLVDVGGGTGTAVAEIVRAYPFIRGINYDLPHV  245

Query  732   VATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLI  911
             VATA    GV HVGGDMF ++P+  AIF+KW++HDW DE+C+KILKNCR+A+P+ TGK+I
Sbjct  246   VATASSLSGVQHVGGDMFETVPTGDAIFMKWIMHDWNDEDCIKILKNCRKAIPD-TGKVI  304

Query  912   IVDAVL------------KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAG  1055
             IVD VL            K   DPI G    V DL+M+AHSSGGKER+E+EWKR+L+E G
Sbjct  305   IVDVVLDADQGDNTDKKRKKAVDPIVG---TVFDLVMVAHSSGGKERSEKEWKRILLEGG  361

Query  1056  FPNYNIIQNIAVASIIEAY  1112
             F  YNII+  A+ S+IEA+
Sbjct  362   FSRYNIIEIPALQSVIEAF  380



>ref|XP_010038642.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW47146.1| hypothetical protein EUGRSUZ_K00950 [Eucalyptus grandis]
Length=349

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 249/347 (72%), Gaps = 10/347 (3%)
 Frame = +3

Query  81    LHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTAT  260
             L  Q QVWK M  ++DSMAL  AV+LRIPDIIHS     P+TL+QIA+ I  SPS  T  
Sbjct  8     LSGQVQVWKLMYAYVDSMALNCAVELRIPDIIHSLGGG-PVTLAQIASHI-PSPSVKTCV  65

Query  261   LSRILRLLVRRKIFTSAVRPSDG-ATVYGPTPASRWLVRDA-ELSMAPMLLFQTHPLSMA  434
             L RI+  LVR+ IF++     DG  T+YG TP+SRWL++ A  L+++P++L   H   ++
Sbjct  66    LGRIMTPLVRKNIFSAHC---DGRETLYGLTPSSRWLLQGAGHLNLSPLVLLAGHQYMVS  122

Query  435   PFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             P+H  S  +K+GG F  ++A+G  ++++ + +PEF+++F D M    +++ KAIV  Y  
Sbjct  123   PWHSLSDYIKDGGSFPLKRAYGCEMWDLESQNPEFSRTFRDAMACSNKLMMKAIVDAYK-  181

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             DGF  VGSLVDVGGGTG+AVAEIV+A+PHIKGINFD PH+VA AP + GVSHVGGDMF +
Sbjct  182   DGFERVGSLVDVGGGTGSAVAEIVRAYPHIKGINFDQPHIVAAAPAHGGVSHVGGDMFEA  241

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IPSA A+F+KW+LHDW DE+ V+ILKNCR A+ E  GK+I+ + VL+PEGD +F D    
Sbjct  242   IPSADAVFMKWILHDWNDEDSVRILKNCRRAVAETNGKVILAEVVLRPEGDGLFDDTGIA  301

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +DL M+   +GGKERTE EWK+LL E GFP  NI Q  ++ SIIEA+
Sbjct  302   SDLTMITQ-TGGKERTEPEWKKLLEEGGFPRCNIFQTPSLLSIIEAF  347



>ref|XP_010066803.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW88368.1| hypothetical protein EUGRSUZ_A00759 [Eucalyptus grandis]
Length=349

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/364 (52%), Positives = 254/364 (70%), Gaps = 20/364 (5%)
 Frame = +3

Query  30    FSPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITL  209
              +P++E + G          Q QVWK M  ++DSMAL  AV+LRIPDIIHS     P+TL
Sbjct  1     MAPLDETLSG----------QVQVWKLMYAYVDSMALNCAVELRIPDIIHSLGGG-PVTL  49

Query  210   SQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDG-ATVYGPTPASRWLVRDA-E  383
             +QIA+ I  SPS  T  L RI+  LVR+ IF++     DG  T+YG TP+SRWL++ A  
Sbjct  50    AQIASHI-PSPSVKTCVLGRIMTPLVRKNIFSAHY---DGRETLYGLTPSSRWLLQGAGH  105

Query  384   LSMAPMLLFQTHPLSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGM  560
             L++AP++L   H   ++P+H  S  +K+GG F  ++A+G  ++++ + +PEF+++F D M
Sbjct  106   LNLAPLVLLAGHQYMVSPWHSLSDYIKDGGSFPLKRAYGCEMWDLESQNPEFSRTFRDAM  165

Query  561   ESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVAT  740
                 +++ KAIV  Y  DGF  VGSLVDVGGGTG+AV EIV+A+PHIKGINFD PH+VA 
Sbjct  166   ACSNKLMMKAIVDAYK-DGFERVGSLVDVGGGTGSAVTEIVRAYPHIKGINFDQPHIVAA  224

Query  741   APEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVD  920
             AP +  VSHVGGDMF +IPSA A+F+KW+LHDW DE+ V+ILKNCR A+ EK GK+I+ +
Sbjct  225   APAHGRVSHVGGDMFEAIPSADAVFMKWILHDWNDEDSVRILKNCRRAVAEKNGKVILAE  284

Query  921   AVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASI  1100
              VL+PEGD +F D    +DL M+   +GGKERTE EWK+LL E GFP  NI Q  ++ SI
Sbjct  285   VVLRPEGDGLFDDTGIASDLTMITQ-TGGKERTEPEWKKLLEEGGFPRCNIFQTPSLLSI  343

Query  1101  IEAY  1112
             IEA+
Sbjct  344   IEAF  347



>sp|Q6WUC2.1|7OMT_PAPSO RecName: Full=(R,S)-reticuline 7-O-methyltransferase; Short=7OMT 
[Papaver somniferum]
 gb|AAQ01668.1| (R,S)-reticuline 7-O-methyltransferase [Papaver somniferum]
Length=355

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 248/351 (71%), Gaps = 8/351 (2%)
 Frame = +3

Query  81    LHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD---SPSPD  251
             L  QA++W++M  F+DSMALK AV+L IPDII+SH   +P+T+S+I  ++     S SP+
Sbjct  8     LKGQAEIWEHMFAFVDSMALKCAVELGIPDIINSHG--RPVTISEIVDSLKTNTPSSSPN  65

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
                L+RI+RLLV +++FTS +       +Y  T +S+WL++D++ +++P++L++T+P+ +
Sbjct  66    IDYLTRIMRLLVHKRLFTSELHQESNQLLYNLTRSSKWLLKDSKFNLSPLVLWETNPILL  125

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
              P+    +C +E    FE+AHG  I+++A  DP+FN   N  M+  T  I   ++  Y  
Sbjct  126   KPWQYLGKCAQEKSSPFERAHGCEIWDLALADPKFNNFLNGAMQCSTTTIINEMLLEYK-  184

Query  612   DGFRSV-GSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFV  788
             DGF  + GSLVDVGGGTG+ +AEIVKA PHI+GINFDLPHVVATA E+ GV HVGGDMFV
Sbjct  185   DGFSGIAGSLVDVGGGTGSIIAEIVKAHPHIQGINFDLPHVVATAAEFPGVKHVGGDMFV  244

Query  789   SIPSAQAIFIKWVLHDWGDEECVKILKNCREAL-PEKTGKLIIVDAVLKPEGDPIFGDIS  965
              IP A A+ +KW+LHDW DE+C  ILKNC  A+  +K GK+IIVD VL+P+G+ +F  + 
Sbjct  245   DIPEADAVIMKWILHDWSDEDCTIILKNCYRAIRKKKNGKVIIVDCVLRPDGNDLFDKMG  304

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              + D+LM+AH++ GKERTE EWK LL  AGFP YN+I+  A   IIEA+ +
Sbjct  305   LIFDVLMMAHTTAGKERTEAEWKILLNNAGFPRYNVIRTPAFPCIIEAFPE  355



>gb|AAB09044.1| O-methyltransferase [Pinus radiata]
Length=382

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 193/379 (51%), Positives = 254/379 (67%), Gaps = 23/379 (6%)
 Frame = +3

Query  24    SKFSPMEEVMDGSFD-EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQP  200
             +K +  E   DG F+ E+  L  QA+ WK    F +S+A+K  V L IPD+I    +   
Sbjct  9     AKSNGCEISRDGFFESEEEELQGQAEAWKCTFAFAESLAVKCVVLLGIPDMIAREGSRAT  68

Query  201   ITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGA---TVYGPTPASRWLV  371
             ++L +I A +  + SPD A L RI+R LV + IF ++    +G    T YG TPAS+WLV
Sbjct  69    LSLGEIVAKL-PTESPDAACLFRIMRFLVAKGIFRASKSAREGGAFETRYGLTPASKWLV  127

Query  372   RDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFN  551
             +  ELSMAPMLL Q    ++AP+H F+ CV EGG AF+KA+G  I+  A+  P+FN  FN
Sbjct  128   KGRELSMAPMLLMQNDETTLAPWHHFNECVLEGGVAFQKANGAEIWSYASDHPDFNNLFN  187

Query  552   DGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHV  731
             + M    +I+ K I+S Y   GF S+ SLVDVGGGTG AVAEIV+A+P I GIN+DLPHV
Sbjct  188   NAMACNARIVMKGILSKY--QGFHSLNSLVDVGGGTGTAVAEIVRAYPFITGINYDLPHV  245

Query  732   VATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLI  911
             VATA    GV HVGGDMF ++P+  AIF+KW++HDW DE+C+KILKNCR+A+P+ TGK+I
Sbjct  246   VATASSLSGVQHVGGDMFETVPTGDAIFMKWIMHDWNDEDCIKILKNCRKAIPD-TGKVI  304

Query  912   IVDAVL------------KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAG  1055
             IVD VL            K   DPI G    V DL+M+AHSSGGKER+E+EWKR+L+E G
Sbjct  305   IVDVVLDADQGDNTDKKRKKAVDPIVG---TVFDLVMVAHSSGGKERSEKEWKRILLEGG  361

Query  1056  FPNYNIIQNIAVASIIEAY  1112
             F  YNII+  A+ S+IEA+
Sbjct  362   FSRYNIIEIPALQSVIEAF  380



>ref|XP_006447892.1| hypothetical protein CICLE_v10015993mg [Citrus clementina]
 gb|ESR61132.1| hypothetical protein CICLE_v10015993mg [Citrus clementina]
Length=315

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 175/317 (55%), Positives = 237/317 (75%), Gaps = 8/317 (3%)
 Frame = +3

Query  183   HAAAQPITLSQIAAAIHDSPSPDT---ATLSRILRLLVRRKIFTSAVRPSDGA--TVYGP  347
             H    PITL Q+A+ I +S  PD     +L+RI+R+LVR+ +F +A R SDG+  T+YG 
Sbjct  2     HCHGSPITLPQLASGI-NSSCPDVHIIPSLTRIMRMLVRKGVF-AAHRSSDGSEETMYGL  59

Query  348   TPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGD  527
             T  S+WL+RD+E+S+APM+LFQ   L  AP+H  S+CV+EGG AF+KAHG  +++ A+ +
Sbjct  60    TQISKWLLRDSEMSLAPMILFQNSQLLQAPWHHLSQCVQEGGNAFKKAHGCEMWDFASQN  119

Query  528   PEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKG  707
              +FN SFN  M    +I+   ++S Y  DGF  + SLVDVGGGTG  +AEIV+ +PHIKG
Sbjct  120   SQFNNSFNKAMACTAKIVMSTLLSHYK-DGFDGIRSLVDVGGGTGEELAEIVEFYPHIKG  178

Query  708   INFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREAL  887
             +NFDLPHVVATAP Y+GVSHVGGDM  ++P+A A+F+KW+LHDW DE CV+ILKNCR+A+
Sbjct  179   VNFDLPHVVATAPVYEGVSHVGGDMLNAVPNADAVFMKWILHDWDDEACVRILKNCRKAI  238

Query  888   PEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNY  1067
             PEKTGKL++V+ V+K + + +FGD +Y+ DL M AH+  GKERTE+EWK++L E GF  +
Sbjct  239   PEKTGKLVLVEIVVKEDDNDVFGDTAYLFDLCMFAHTRCGKERTEKEWKQILEEGGFLRH  298

Query  1068  NIIQNIAVASIIEAYSQ  1118
             NII   AV +IIEAY Q
Sbjct  299   NIINLPAVPAIIEAYPQ  315



>ref|XP_006841690.1| hypothetical protein AMTR_s00003p00247710 [Amborella trichopoda]
 gb|ERN03365.1| hypothetical protein AMTR_s00003p00247710 [Amborella trichopoda]
Length=351

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 185/342 (54%), Positives = 238/342 (70%), Gaps = 7/342 (2%)
 Frame = +3

Query  90    QAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSR  269
             QA+ W+  L F DS+ LK AV+L IP +IH  A  QP+TLS+I  ++  +PSPD+  LSR
Sbjct  11    QAEFWQLTLAFADSLTLKCAVELGIPQLIH--AKGQPLTLSEIITSLQ-APSPDSWCLSR  67

Query  270   ILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCF  449
             ++R LV++++F+  V+  +G   YG T AS+WLVR     +APML    HP+ +AP+ C 
Sbjct  68    VMRFLVKKRVFSEEVK--EGEAYYGLTRASKWLVRPGTSGLAPMLTMLNHPIFLAPWQCL  125

Query  450   SRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSV  629
             S+CV EGG AFEKAHG  IF+ A  +P  N+ FN+ M S  +++  A++S Y   GF  +
Sbjct  126   SQCVVEGGNAFEKAHGSKIFKYALNNPGSNEIFNEAMASDARVVLDALLSQYK-SGFAGL  184

Query  630   GSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQA  809
              SLVDVGGGTG AV  IVKA PHI GINFDLPHVV++APE+ GV +V GDMF+SIP A A
Sbjct  185   TSLVDVGGGTGTAVIAIVKAHPHISGINFDLPHVVSSAPEHPGVVNVSGDMFISIPHADA  244

Query  810   IFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDP-IFGDISYVTDLLM  986
             +F+KW+LHDW DE+CVKILK CR+ALP K+GKLIIVD VL  + D   F D     D+LM
Sbjct  245   VFMKWILHDWKDEDCVKILKQCRKALPSKSGKLIIVDVVLHLKEDTSAFADSRLAFDMLM  304

Query  987   LAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              A +SGG ERTEEEW+ LL + GF N NI     + SIIEAY
Sbjct  305   FAVTSGGLERTEEEWRALLSKGGFSNCNIKPLPTLQSIIEAY  346



>gb|KDP40527.1| hypothetical protein JCGZ_24526 [Jatropha curcas]
Length=358

 Score =   339 bits (870),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 182/354 (51%), Positives = 243/354 (69%), Gaps = 10/354 (3%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             DE+ ML  QA++W+Y+  F+D +ALK  V L IPDII+SH   +P++ S I   I + PS
Sbjct  8     DEQEMLLGQAKIWQYIFGFLDGIALKCVVQLGIPDIINSHG--RPLSFSSIVKTI-NQPS  64

Query  246   PDTATLSRILRLLVRRKIFT-SAVRPSDG--ATVYGPTPASRWLVRDAELSMAPMLLFQT  416
              D   LSR++ LLVRR IFT ++    DG  AT+YG T AS+WL+RD+E+S+APMLL Q 
Sbjct  65    LDADRLSRVMTLLVRRGIFTATSSEEEDGVHATLYGLTNASKWLIRDSEMSLAPMLLLQH  124

Query  417   HPLSMAPFHCFSRCVKEG--GFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKA  590
             H    + +      VK G  GF  +   G  +++ A+ + EFN  FN  M   ++++ KA
Sbjct  125   HREWQSAWQNLPDIVKNGDSGFTSKSHGGSSLWDFASANSEFNTIFNQAMAVTSKLVVKA  184

Query  591   IVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHV  770
              +  Y  D    +GSLVDV GGTG  V+EIVKA PHIKGINFDLPHV+A APE+ GV+HV
Sbjct  185   FMKTYK-DELNGIGSLVDVAGGTGTLVSEIVKAHPHIKGINFDLPHVIAEAPEHAGVTHV  243

Query  771   GGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPI  950
              GDMF  IP A AI +KW+LH+W DE+C+KILKNC++ALPEK G+LII+DAVL PEGD +
Sbjct  244   SGDMFTGIPPADAIILKWILHNWSDEDCIKILKNCQKALPEKAGRLIIIDAVLLPEGDNL  303

Query  951   FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             F +++ + D+ M+ H +  +ER E EWK+LL EAGF +Y II+    ASIIEAY
Sbjct  304   FDELALIGDMAMMVHLN-AQERNEAEWKKLLEEAGFTSYKIIKMPDQASIIEAY  356



>ref|XP_008230260.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Prunus 
mume]
Length=353

 Score =   337 bits (865),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 241/351 (69%), Gaps = 3/351 (1%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             +E+++L  Q  + +Y  +F++SMALK AV+L I DII+SH   QPITLSQIA  I  SPS
Sbjct  6     EEEAILQGQVDILRYTYNFVESMALKCAVELGIADIINSHGQGQPITLSQIAPQIA-SPS  64

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
              D   LSR++R LV   +F + + P  G  +YG T +S+WL+ + E S+AP++L    P 
Sbjct  65    TDLDLLSRLMRFLVHMNLFEATIDPKTGDALYGLTSSSKWLLSNEEQSLAPLVLMANQPH  124

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              +A +H  S+C+KEGG  F+KA+G  ++++ +   E    F +GM   ++I+ KAI+S Y
Sbjct  125   HLASWHYLSQCIKEGGCGFQKANGFSLYDIPSEKSELGNYFKEGMACTSRIVMKAILSTY  184

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
                GF  VG +VDVGGG G AVAEIVKA PHI+GINFDL  VVA AP+Y GV HVGGDMF
Sbjct  185   K-QGFDGVGLIVDVGGGLGTAVAEIVKAHPHIRGINFDLEDVVARAPKYPGVIHVGGDMF  243

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
               IP A+AIF+KW+LH+W DE+C+KILKNCR+A+PEK GKL+IVD VL P+ + ++    
Sbjct  244   DVIPKAEAIFMKWILHNWNDEKCIKILKNCRKAIPEKIGKLVIVDGVLLPD-NGLWDSFV  302

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
                DL M+  +  GKER+E EWK+LL E GF  Y II+  +  SIIEAY +
Sbjct  303   QRYDLTMMVQTINGKERSEVEWKKLLREGGFGRYKIIKIPSFLSIIEAYPE  353



>ref|XP_010691168.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score =   338 bits (866),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 250/360 (69%), Gaps = 11/360 (3%)
 Frame = +3

Query  48    VMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAA  227
             V+    D+  +L  QA+V+ ++  + DS+ L++AV+LRI DIIHSH   Q ++LSQIA+ 
Sbjct  11    VLGNVNDDAELLRGQAEVYNHLFAYADSLVLRSAVELRIADIIHSHG--QSMSLSQIASK  68

Query  228   IHDSPSPDTATLSRILRLLVRRKIFTSAVR--PSDGATVYGPTPASRWLVRDAELSMAPM  401
             I  SPS +   L R++R+LVR+KIFT+     PSD  T+YG T  S WL+ D ELS+AP 
Sbjct  69    I-ASPSINIMCLERVMRMLVRKKIFTAHYNEHPSD-ETLYGLTTTSMWLLHDQELSLAPA  126

Query  402   LLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQII  581
              L  T      P++  S  +K+GG  F +AHG+  +EMA+ +PEFN  FNDGM + T+ +
Sbjct  127   FLTLTDHSVTKPWYEISHSIKDGGIPFVRAHGETFWEMASNNPEFNNLFNDGMAAATKPV  186

Query  582   SKAIVSGYGGDGFRSV-GSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQG  758
               A++ GY  DGF  + GSLVDVGGG G  VA+IVKA+PHIKGINFD+PHVVA AP Y G
Sbjct  187   LDAVIKGY--DGFSKLEGSLVDVGGGIGKLVAKIVKAYPHIKGINFDVPHVVANAPLYPG  244

Query  759   VSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPE  938
             V+HVGGD+F  IPS+  + IK VLHDW DE+C++ILKNC++A+ +K GK+IIVD +L PE
Sbjct  245   VTHVGGDIFKEIPSSDNVIIKSVLHDWADEDCLRILKNCQKAVSQKNGKVIIVDIILHPE  304

Query  939   GDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNII--QNIAVASIIEAY  1112
             G+ +F + +   D+ M+ + +GGKERTE EW +LL EAGF + NII    I   SIIEA+
Sbjct  305   GEGMFDNAAVALDMFMMTNCTGGKERTENEWNKLLKEAGFAHINIIPLPTIMSLSIIEAF  364



>dbj|BAE79723.1| reticuline-7-O-methyltransferase [Eschscholzia californica]
Length=353

 Score =   337 bits (863),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 243/357 (68%), Gaps = 11/357 (3%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD-SP  242
             DE+ +L  QA + KYM  F+DSM L+  V+L IPDIIHSH   +PITL++I   I + S 
Sbjct  2     DEEIIL-GQADICKYMYGFVDSMTLRCVVELGIPDIIHSHG--RPITLTEILNGIPNLSS  58

Query  243   SPDTATLSRILRLLVRRKIF-TSAVRPSDGATV----YGPTPASRWLVRDAELSMAPMLL  407
             S D   L  I+ +LVRR++F      P DG  +    YG TP+S+ L++D++ ++AP +L
Sbjct  59    SFDINYLQGIMTILVRRRVFAVHKFDPKDGTNLTEIRYGLTPSSKCLLKDSKFNLAPFVL  118

Query  408   FQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
              +THP    P++   +CV+EGG  F KAHG  +F+  +  PEF K F DGME  T+++ +
Sbjct  119   LETHPWITDPWNYLGKCVQEGGSGFVKAHGSDVFKFGSDHPEFFKLFYDGMECSTKVLVQ  178

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
              ++  Y    F+ V S+VDVGGGTG  ++EIVK  PHIKGINFDLPHVVA AP+Y GV H
Sbjct  179   VVLDKYQ-QVFKDVKSIVDVGGGTGMMISEIVKNHPHIKGINFDLPHVVAEAPDYPGVEH  237

Query  768   VGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDP  947
             VGGDMFV IP A AI +K +LHDW D+ CVKIL+NC++A+P K GK+II+D VL P+GD 
Sbjct  238   VGGDMFVEIPQADAITMKGILHDWNDDACVKILENCKKAIP-KNGKVIIIDCVLNPDGDD  296

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             +F DI  V+DL M  H S GKERTE EW++LL + GFP Y I   + V S+IEAY +
Sbjct  297   LFDDIKVVSDLGMRVHCSDGKERTEAEWEKLLKKGGFPRYKITHVVTVQSMIEAYPE  353



>ref|XP_009343397.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=358

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 177/360 (49%), Positives = 243/360 (68%), Gaps = 4/360 (1%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             M EV +G  + ++M   Q  + +Y  +F++SMALK AV+L I DII+S    QPITLSQI
Sbjct  3     MPEVKEG--EGEAMFQGQVDILRYTYNFVESMALKGAVELGIADIINSEGQGQPITLSQI  60

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAP  398
             AA I  SP+ +   LSR++R L R+K+F +      G T+YG T +S WL+ + E S+AP
Sbjct  61    AAKIA-SPTTNLDHLSRLMRFLARKKVFEATTDAKTGDTLYGLTCSSMWLLSNEEQSLAP  119

Query  399   MLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQI  578
             ++L    P  +A +HC S+C+ EGG  FEKA+G  ++++ +   E    F +GM   ++I
Sbjct  120   LVLLANQPHHIAFWHCISKCIMEGGSGFEKANGFSLYDVPSEMSELGNYFKEGMACTSRI  179

Query  579   ISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQG  758
             + KAI+S Y  D F  VG + DVGGG G AVAEIV A PHI+GINFDLP VVA AP Y+G
Sbjct  180   VMKAILSNYK-DVFEGVGLIADVGGGIGEAVAEIVNAHPHIRGINFDLPVVVARAPRYRG  238

Query  759   VSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPE  938
             V+H+GGDMF +IP+A AIF+KW++H+W DE+C+KILKNC +A+PEKTGK+IIVD VL+P+
Sbjct  239   VTHLGGDMFDAIPNADAIFMKWIMHNWNDEQCIKILKNCCKAIPEKTGKIIIVDGVLEPD  298

Query  939   GDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             G  +        DL M+  +S GKER+E EWK LL   G   Y II+  +V SI+E Y +
Sbjct  299   GGGLQDSFVLRYDLTMMVQTSSGKERSEVEWKELLRAGGLSRYKIIKIPSVLSIMEVYPE  358



>gb|ADE76636.1| unknown [Picea sitchensis]
Length=379

 Score =   337 bits (865),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 194/384 (51%), Positives = 261/384 (68%), Gaps = 19/384 (5%)
 Frame = +3

Query  9     LHSPASKFSPMEEVMDGSFD-EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSH  185
             +  PA K +  E   DG F+ E+  L  QA+ WK    F +S+A+K  V L IPD+I   
Sbjct  1     MSGPAMK-NGSEICRDGFFESEEEELQGQAEAWKSTFAFAESLAVKCVVLLGIPDMIARE  59

Query  186   AAAQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGA----TVYGPTP  353
                  ++L++IAA +  + SPDT+ L RI+R LV + +F ++V  S  A    T YG TP
Sbjct  60    GPRATLSLNEIAARL-PADSPDTSCLFRIMRFLVAKGVFRASVVKSAEAGAFETRYGLTP  118

Query  354   ASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPE  533
             AS+W V++ ELSM PMLL Q    ++AP+H F+ CV +GG AFE+A+G  I+  A+  P+
Sbjct  119   ASKWFVKERELSMVPMLLMQNDERTVAPWHHFNECVVDGGIAFERANGAEIWSYASDHPD  178

Query  534   FNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGIN  713
             FN  FND M    +I+ KA++S +   GF+S+ SLVDVGGGTG AVAEIV+A+P IKGIN
Sbjct  179   FNHLFNDAMACNARIVMKALLSKF--QGFQSLNSLVDVGGGTGTAVAEIVRAYPFIKGIN  236

Query  714   FDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPE  893
             +DLPHVVATA    GV HVGGDMF ++PS  AIF+KW++HDW DE+C+KILKNCR+A+P+
Sbjct  237   YDLPHVVATARRLPGVEHVGGDMFETVPSGDAIFMKWIMHDWSDEDCIKILKNCRKAIPD  296

Query  894   KTGKLIIVDAVLKP-EGDPIFG--------DISYVTDLLMLAHSSGGKERTEEEWKRLLM  1046
              TGK+IIVD VL   +GD I          ++  V DL+M+AHSSGGKERTE+EWK +L+
Sbjct  297   -TGKVIIVDVVLDANQGDDIVKKKKKALDPNLGIVFDLVMVAHSSGGKERTEKEWKTILL  355

Query  1047  EAGFPNYNIIQNIAVASIIEAYSQ  1118
             E GF  YNII   A+ S+IEA+ +
Sbjct  356   EGGFGRYNIIDIPALQSVIEAFPR  379



>ref|XP_006841695.1| hypothetical protein AMTR_s00003p00249810 [Amborella trichopoda]
 gb|ERN03370.1| hypothetical protein AMTR_s00003p00249810 [Amborella trichopoda]
Length=361

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/342 (53%), Positives = 233/342 (68%), Gaps = 7/342 (2%)
 Frame = +3

Query  90    QAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSR  269
             QA+ W+  L F+DS+ LK AV+L IP IIH  A  QP+TLS+I  ++  +PSPD++ LSR
Sbjct  21    QAEFWQITLAFVDSLTLKCAVELGIPQIIH--AKGQPLTLSEIITSLQ-APSPDSSCLSR  77

Query  270   ILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCF  449
             ++R LV++++F+  V+   G   Y  T AS+ LVR     +APML    HP+ +AP+HCF
Sbjct  78    VMRFLVKKQVFSEEVKV--GEAYYRLTRASKLLVRPGASGLAPMLTMLNHPIFLAPWHCF  135

Query  450   SRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSV  629
             SRCV E   AFEKAHG  ++   A +   N  FN+ M S T ++ +A++S Y   GF  +
Sbjct  136   SRCVVERVDAFEKAHGSKLWMYTANNTGANDIFNEAMASDTVVVLEALLSEYKS-GFAGL  194

Query  630   GSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQA  809
              SLVDV GGTG AV+ IVKA PHI  INFDLP VV++APE+ GV HV GDMF+SIP A A
Sbjct  195   TSLVDVAGGTGTAVSAIVKAHPHISRINFDLPQVVSSAPEHPGVVHVSGDMFISIPHADA  254

Query  810   IFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDP-IFGDISYVTDLLM  986
             +F+KW+LHDW DE+CVKILK CR+ALP K+GKLIIVD VL  + D   F D     D+LM
Sbjct  255   VFMKWILHDWNDEDCVKILKQCRKALPSKSGKLIIVDVVLHLKEDTSAFADSRLAFDMLM  314

Query  987   LAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              A +SGG ERTEEEW+ LL + GF N NI     + SIIEAY
Sbjct  315   FAVTSGGLERTEEEWRALLSKGGFSNCNIKPLPTLQSIIEAY  356



>gb|KCW47149.1| hypothetical protein EUGRSUZ_K00954, partial [Eucalyptus grandis]
Length=322

 Score =   323 bits (829),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 231/325 (71%), Gaps = 10/325 (3%)
 Frame = +3

Query  51    MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
             M+   + ++ L  QA +   M  +  SMALK AV+LRIPDIIHS+    P+TL+QIA+ I
Sbjct  1     MESLHEIEATLRGQAHISNLMNAYAGSMALKCAVELRIPDIIHSYGGG-PVTLAQIASRI  59

Query  231   HDSPSPDTATLSRILRLLVRRKIFTSA-VRPSDG----ATVYGPTPASRWLVRDA--ELS  389
               SPS +T  L+RI+RLLVR  IF++   +P DG     T+Y   P+SRWL++    ELS
Sbjct  60    -PSPSLETTYLARIMRLLVRENIFSANRCQPDDGHESHETLYSLPPSSRWLLQGPGFELS  118

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESV  569
             +AP++L   HP  M+P+HCF  C+K GG AFE AHG+ I++ A+ +PEFN+ FNDGM  V
Sbjct  119   LAPVVLMLNHPWLMSPWHCFGDCIKTGGVAFEMAHGRKIWDFASENPEFNRLFNDGMACV  178

Query  570   TQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPE  749
             ++I    I+  Y  DGF S+GSLVDVGGG G  + EI+K+FPHI+GIN+DLPHVVATAP 
Sbjct  179   SRITIGGIIEVYK-DGFESIGSLVDVGGGIGKTLVEIIKSFPHIQGINYDLPHVVATAPA  237

Query  750   YQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL  929
             + GV+HVGG+MF +IP A A+ +  ++HDWGDE+CVKILKNCR+A+PEK GK+II + VL
Sbjct  238   HDGVTHVGGNMFETIPHADAVLMMEIMHDWGDEDCVKILKNCRKAIPEKNGKVIIANIVL  297

Query  930   KPEGDPIFGDISYVTDLLMLAHSSG  1004
             K EGD +F     V DL+M+A  SG
Sbjct  298   KAEGDGMFDKTGLVMDLVMMALCSG  322



>ref|XP_010691166.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=363

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 253/366 (69%), Gaps = 10/366 (3%)
 Frame = +3

Query  36    PMEEVMDG--SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITL  209
             P+ E++ G     +  +L  QA+V K +  +IDS+ L++AV+LRI DII+SH   Q ++L
Sbjct  2     PINELVLGINVTKDAELLQGQAEVHKTIFAYIDSLVLRSAVELRIADIIYSHG--QAMSL  59

Query  210   SQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAV--RPS-DGATVYGPTPASRWLVRDA  380
             SQIA  I DSPS D   L RI+R+LVR KIFT+    +PS +  T+YG T  S+WL+ D 
Sbjct  60    SQIALKI-DSPSLDIMCLERIMRMLVRNKIFTAHCNEQPSGETLTLYGLTTTSKWLLHDQ  118

Query  381   ELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGM  560
             ELS+AP +L  T      P +  SR +KEGG  F KAHG+ I+EMA+  PEFN  FN GM
Sbjct  119   ELSLAPTILTFTDLSITKPAYEISRSIKEGGIPFVKAHGESIWEMASNHPEFNSMFNSGM  178

Query  561   ESVTQIISKAIVSGYGGDGFRSV-GSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVA  737
              ++T+ +  A++ GY  DGF  + GS+VD+GGGTG  VA IVK +PH+KGINFDLPHVV 
Sbjct  179   AAITRTVIDAVIKGYK-DGFSKLEGSVVDIGGGTGKLVANIVKEYPHLKGINFDLPHVVE  237

Query  738   TAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIV  917
              AP + GV+HVGGDMF  IPSA  I +K VLH+W DE+C+KILKNC++ + EK GK+IIV
Sbjct  238   NAPLHYGVTHVGGDMFKEIPSANNIILKNVLHNWTDEDCLKILKNCQKVVSEKKGKVIIV  297

Query  918   DAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS  1097
             + +L+PE   +F D +   D+LM+ ++  GKERTE+EW +LL EA F ++NII   +V S
Sbjct  298   EVILRPERHEMFDDTAIALDILMMTNTIRGKERTEDEWMKLLKEAAFTSFNIIPLQSVFS  357

Query  1098  IIEAYS  1115
             IIEA S
Sbjct  358   IIEATS  363



>ref|XP_007216765.1| hypothetical protein PRUPE_ppa024697mg [Prunus persica]
 gb|EMJ17964.1| hypothetical protein PRUPE_ppa024697mg [Prunus persica]
Length=355

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 240/351 (68%), Gaps = 3/351 (1%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             +E+++L  Q  + +Y  +F++SMALK AV+L I DII+SH   QPITLSQIA  I  SPS
Sbjct  8     EEEAILQGQVDILRYTYNFVESMALKCAVELGIADIINSHGQGQPITLSQIAPQIA-SPS  66

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
              D   LSR+LR LV   +F + + P  G  +YG T +S+WL+ + E S+AP++L    P 
Sbjct  67    TDLDLLSRLLRFLVHMNLFEATIDPKTGDALYGLTSSSKWLLSNEEQSLAPLVLMANQPH  126

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              +A +H  S+C+KEGG  F+KA+G  ++++ +   E    F +GM   ++I+ KAI+S Y
Sbjct  127   HLASWHYLSQCIKEGGCGFQKANGFSLYDIPSEKSELGNYFKEGMACTSRIVMKAILSTY  186

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
                GF  VG +VDVGGG G AVAEIVKA PHI+GINFDL  VVATAP+Y GV HVGGDMF
Sbjct  187   K-QGFDGVGLIVDVGGGLGTAVAEIVKAHPHIRGINFDLADVVATAPKYPGVIHVGGDMF  245

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
               IP A AIF+KW+LH+W DE+C +ILKNCR+A+PEK GKL+IVD VL P+ + ++    
Sbjct  246   DVIPKADAIFMKWILHNWNDEKCTQILKNCRKAIPEKIGKLVIVDGVLLPD-NGLWDSFV  304

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
                DL M+  +  GKER+E EWK+LL E GF  Y II+  +  SIIEAY +
Sbjct  305   QRYDLTMMVQTINGKERSEVEWKKLLREGGFGRYKIIKIPSFLSIIEAYPE  355



>ref|XP_004304126.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=313

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 176/288 (61%), Positives = 222/288 (77%), Gaps = 10/288 (3%)
 Frame = +3

Query  63   FDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD-S  239
             DE S L  QA VWKYML F DSMAL++AV+LRIPDIIHSH  A  +TLS+IA++    S
Sbjct  7    LDEAS-LRGQADVWKYMLGFADSMALRSAVELRIPDIIHSHGRA--LTLSEIASSFDSAS  63

Query  240  PSPDTATLSRILRLLVRRKIFTS--AVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQ  413
            PSPD + L+RI+RLLVRR IFT+      S+   +YG T +SRWL+ D+EL++APM+L +
Sbjct  64   PSPDISCLARIMRLLVRRNIFTAHHDGEDSEKTGLYGLTHSSRWLLHDSELTLAPMVLME  123

Query  414  THPLSMAPFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKA  590
            T+P  MAP+HCFS+CVK+ G  AF++AHG+ I++  + + +FN+ FNDGM    +I  KA
Sbjct  124  TNPTLMAPWHCFSQCVKQRGPCAFKRAHGRDIWQFFSENLKFNRLFNDGMACTAKITMKA  183

Query  591  IVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHV  770
            I++GY G GF  V +LVDVGGGTG+AVAEIVKA+P IKGINFDLPHVVATAP Y GVSHV
Sbjct  184  ILAGYKG-GFEDVATLVDVGGGTGSAVAEIVKAYPSIKGINFDLPHVVATAPVYHGVSHV  242

Query  771  GGDMF--VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKL  908
            GGDMF   SIP+A AIF+K V+HDW D +CVKILKNCR  +PE+TGK+
Sbjct  243  GGDMFDEGSIPNADAIFMKRVMHDWSDSDCVKILKNCRNVIPERTGKV  290



>gb|ACO90227.1| reticuline 7-O-methyltransferase-like protein [Papaver bracteatum]
Length=342

 Score =   318 bits (816),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 233/345 (68%), Gaps = 12/345 (3%)
 Frame = +3

Query  111   MLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS--------PDTATLS  266
             M  F++SMALK AV+L IPDII+S+   +P+T+S+I  ++  + S        P+   L+
Sbjct  1     MFAFVNSMALKCAVELGIPDIINSYG--RPVTMSEIIDSLKTTASSSSSSDSSPNVEYLT  58

Query  267   RILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHC  446
             R++RLLV  ++F S        T+Y  T +S+WL++D+E +++ ++ F+T P+ + P   
Sbjct  59    RVMRLLVHNRVFASQFHQESNETLYDLTRSSKWLLKDSEFNVSTLVSFETDPILLKPCQY  118

Query  447   FSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRS  626
               +CV+EGGF FEKA+G  I+E A  +P+FN+  N  +   T  I   ++  Y  DGF S
Sbjct  119   LGKCVQEGGFPFEKAYGCKIWEFALANPQFNEFLNSALRCTTSTIINEMLVEYK-DGFNS  177

Query  627   VGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQ  806
             + SLVDVGGGTG  +A+IV+A PHI+GINFDLPHVVATAP+Y GV HVGGDMFV IP A 
Sbjct  178   IKSLVDVGGGTGTMMAQIVEANPHIEGINFDLPHVVATAPDYPGVKHVGGDMFVDIPEAD  237

Query  807   AIFIKWVLHDWGDEECVKILKNCREAL-PEKTGKLIIVDAVLKPEGDPIFGDISYVTDLL  983
             AI +K VLHDW DE C  ILKNC +A+  +K GK+I+V+ VL+P  +  F     + D++
Sbjct  238   AIMMKSVLHDWNDEYCAMILKNCYKAISKKKNGKVILVEGVLQPNSNDTFDKTGLMFDMV  297

Query  984   MLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             M+AH+S GKERTEEEWK LL  AGFP YNII+  A   IIEA+ +
Sbjct  298   MIAHTSAGKERTEEEWKILLNNAGFPRYNIIKTSAFHCIIEAFPE  342



>ref|XP_010094292.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
 gb|EXB55624.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
Length=248

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 199/249 (80%), Gaps = 13/249 (5%)
 Frame = +3

Query  408   FQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
              QTHP  MAP+HCFSRCVKEGG AF+KAHG+ I++ A+ +PEFNK FNDGME   +II K
Sbjct  1     MQTHPWLMAPWHCFSRCVKEGGSAFQKAHGREIWDFASENPEFNKLFNDGMECTARIILK  60

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
             AI+S Y  DGF S+GSL+DVGGGTG A++EIVK+ PHI GINFDLPHVVA AP Y GVSH
Sbjct  61    AILSEYR-DGFSSLGSLIDVGGGTGRALSEIVKSHPHINGINFDLPHVVAKAPVYPGVSH  119

Query  768   VGGDMFVSIPSAQAIFIK------------WVLHDWGDEECVKILKNCREALPEKTGKLI  911
             VGGDMF SIP+A A+F+K            W++HDWGDE+CVKILKNCR+A+PEK+GK+I
Sbjct  120   VGGDMFESIPNADAVFMKASLATDLNQLSTWIMHDWGDEDCVKILKNCRKAIPEKSGKVI  179

Query  912   IVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAV  1091
             IVD VL PEG+ +F D+S + DL+M+A++SGGKERTE +WK++L+E GFP Y II+  ++
Sbjct  180   IVDLVLNPEGNTLFDDMSLIWDLVMVAYASGGKERTENQWKKILIEGGFPRYKIIKIPSL  239

Query  1092  ASIIEAYSQ  1118
              SIIEAY +
Sbjct  240   TSIIEAYPE  248



>gb|ABK22503.1| unknown [Picea sitchensis]
Length=377

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 240/369 (65%), Gaps = 16/369 (4%)
 Frame = +3

Query  42    EEVMDGSFDEKSM-LHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             E   DG F+ +   L  Q   W     F++S+A+K A+ L IPD+I        ++L++I
Sbjct  11    EICTDGFFESEEEELLGQIHAWNCTFAFVESLAVKCAILLEIPDMIAREGPRATLSLNEI  70

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPS--DGA---TVYGPTPASRWLVRDAE  383
             AA +    SPD + + RI+R LV + +F ++V  S  DG    T YG TP S+W V++ E
Sbjct  71    AARL-PRESPDVSCVFRIMRFLVAKGVFRASVVKSSEDGGSYETRYGLTPVSKWFVKERE  129

Query  384   LSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGME  563
              SM PMLL Q     +AP+HCF+ CV +GG  F++ +G  ++   +  P+FN  FN+ M 
Sbjct  130   QSMVPMLLLQNDERIVAPWHCFNECVLDGGLPFQRTNGGDMWSYTSAHPDFNHLFNNAMA  189

Query  564   SVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATA  743
               T I+ KA++S Y   GF ++ SLVDVGGGTG A AEIV+ +P IK IN+DL HVVATA
Sbjct  190   CDTGIVMKALLSKY--RGFHALNSLVDVGGGTGTATAEIVRTYPSIKAINYDLAHVVATA  247

Query  744   PEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDA  923
              +  GV HVGGDMF ++PS  AIF+KW++H+W DE+C+KILKNCR+A+PE TGK+IIVD 
Sbjct  248   RQLPGVEHVGGDMFETVPSGDAIFMKWIMHNWSDEDCIKILKNCRKAIPE-TGKVIIVDM  306

Query  924   VL------KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNI  1085
             V+      K E   +  ++  V DLLM  H +GGKERTEEEWK++L E GF +YNII   
Sbjct  307   VVDSQHNNKNERAALDPNLCLVFDLLMATHCTGGKERTEEEWKKILWEGGFGDYNIIAIP  366

Query  1086  AVASIIEAY  1112
             AV S+IEA+
Sbjct  367   AVQSVIEAF  375



>emb|CAQ58423.1| O-methyltransferase [Humulus lupulus]
Length=352

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 168/333 (50%), Positives = 224/333 (67%), Gaps = 11/333 (3%)
 Frame = +3

Query  81    LHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTAT  260
             L  Q Q+W+ M  F+DSMALK A++LRI DIIHSH   +PITLSQIA+ I  + +   + 
Sbjct  4     LRGQEQIWQLMFSFVDSMALKCAIELRIADIIHSHG--KPITLSQIASGIRSNSNSSISP  61

Query  261   ----LSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
                 LSRI+R LVR+ IFT     +D   ++YG + +SRWL+RD + S+APM+L QTHPL
Sbjct  62    NIPYLSRIMRFLVRKNIFTEHQEDNDEVISLYGLSDSSRWLLRDFKSSLAPMVLMQTHPL  121

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
             SMA +H     V+     FEKAHG  I+E ++ +PEFNK FN+ M S+  I   A++S Y
Sbjct  122   SMAVWHFLEDYVRNSSNTFEKAHGCNIWEFSSANPEFNKIFNNAMASIVPIYMGAMLSSY  181

Query  606   GGDGFRSVGSLvdvgggtgaav-aEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
               DG   +   V   GG      +E++K +P+IKGINFDLPHV+ATAP   GV+H+ GD+
Sbjct  182   K-DGLGCIKGTVVDVGGGTGGSISELMKYYPNIKGINFDLPHVIATAPALDGVTHISGDI  240

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPE-KTGKLIIVDAVLKPEGDPIFGD  959
             F SIPSA A+ +K VLH + DE+CVK+L+NCR+A+ + K GK+II++ VL P  + IF +
Sbjct  241   FESIPSADAVLMKGVLHCFSDEKCVKVLRNCRKAITDKKNGKIIILEIVLDPTSNQIFDE  300

Query  960   ISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGF  1058
                V DLL +   SGGKERTE EWKRLL EAGF
Sbjct  301   TRMVYDLL-IPLFSGGKERTELEWKRLLNEAGF  332



>gb|ABZ89565.1| O-methyltransferase 1 [Humulus lupulus]
Length=352

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 224/333 (67%), Gaps = 11/333 (3%)
 Frame = +3

Query  81    LHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTAT  260
             L  Q Q+W+ M  F+DSMALK A++LRI DIIHSH   +PITLSQIA+ I  + +   + 
Sbjct  4     LRGQEQIWQLMFSFVDSMALKCAIELRIADIIHSHG--KPITLSQIASGIRSNSNSSISP  61

Query  261   ----LSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
                 LSRI+R LVR+ IFT     +D   ++YG + +SRWL+RD + S+APM+L QTHPL
Sbjct  62    NIPYLSRIMRFLVRKNIFTEHQEDNDEVISLYGLSDSSRWLLRDFKSSLAPMVLMQTHPL  121

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
             SMA +H     V+     FEKAHG  I+E ++ +P+FNK FN+ M S+  I   A++S Y
Sbjct  122   SMAVWHFLEDYVRNSSNTFEKAHGCNIWEFSSANPDFNKIFNNAMASIVPIYMGAVLSSY  181

Query  606   GGDGFRSVGSLvdvgggtgaav-aEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
               DG   +   V   GG      +E++K +P+IKGINFDLPHV+ATAP   GV+H+ GD+
Sbjct  182   K-DGLGCIKGTVVDVGGGTGGSISELMKYYPNIKGINFDLPHVIATAPALDGVTHISGDI  240

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPE-KTGKLIIVDAVLKPEGDPIFGD  959
             F SIPSA A+ +K VLH + DE+CVK+L+NCR+A+ + K GK+II++ VL P  + IF +
Sbjct  241   FESIPSADAVLMKGVLHCFSDEKCVKVLRNCRKAITDKKNGKIIILEIVLDPTSNQIFDE  300

Query  960   ISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGF  1058
                V DLL +   SGGKERTE EWKRLL EAGF
Sbjct  301   TRMVYDLL-IPXFSGGKERTELEWKRLLNEAGF  332



>ref|XP_010691167.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 186/366 (51%), Positives = 253/366 (69%), Gaps = 14/366 (4%)
 Frame = +3

Query  42    EEVMDGSFDEKS-MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             +E+  G+ +E + +L  QA+V+K++  + DS+ L++AV+LRI DIIHSH   Q ++LSQI
Sbjct  4     KELALGNVNEDAELLQGQAEVYKHLFAYADSLVLRSAVELRIADIIHSHG--QAMSLSQI  61

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAV--RPS-DGATVYGPTPASRWLVRDAELS  389
             A+ I  S S +   L R++R+LVR+KIFT+    +PS +  T+YG T  S+WL+ D ELS
Sbjct  62    ASKI-ASSSLNIMCLERVMRMLVRKKIFTAHCNEQPSGETLTLYGLTTTSKWLLHDQELS  120

Query  390   MAPMLL-FQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMES  566
             +AP  L F  H ++  P++  S  +KEGG  F KAHG+ I+EMA+ + EFN  FN GM  
Sbjct  121   LAPTFLTFTDHSIT-KPWYEISSSIKEGGIPFVKAHGESIWEMASNNLEFNSLFNQGMVG  179

Query  567   VTQIISKAIVSGYGGDGFRSV-GSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATA  743
              T++   AI  GY  DGF  + GSLVDVGGG G  VA IVK +PHI+GINFD+PHVVA A
Sbjct  180   YTKLTLDAITKGYK-DGFSELEGSLVDVGGGMGRLVANIVKTYPHIEGINFDMPHVVANA  238

Query  744   PEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTG-KLIIVD  920
             P + GV+HVGGD+F  IPSA+ I IK VL DW DE+C++ILKNC++A+ +K G K+IIVD
Sbjct  239   PLHPGVTHVGGDIFKEIPSAENIIIKSVLLDWNDEDCIRILKNCQKAISQKKGNKVIIVD  298

Query  921   AVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS-  1097
              VL P+G+ +F D +   D+LM+ +  GGKERTE EW +LL EAGF + NII      S 
Sbjct  299   IVLHPDGEGLFDDAAMAIDMLMMTNCIGGKERTENEWNKLLKEAGFTHLNIIPLPTTVSL  358

Query  1098  -IIEAY  1112
              IIEA+
Sbjct  359   FIIEAF  364



>gb|KHG19442.1| RS-norcoclaurine 6-O-methyltransferase [Gossypium arboreum]
Length=274

 Score =   303 bits (776),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 208/272 (76%), Gaps = 7/272 (3%)
 Frame = +3

Query  69   EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS-PS  245
            +++ML  QA++W+YM  F DSMALK+AV+LRI DIIHS+    P+TLSQIA+ I+    S
Sbjct  7    DEAMLQGQAEIWRYMYSFADSMALKSAVELRIADIIHSNGG--PVTLSQIASCINGGLAS  64

Query  246  PDTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHP  422
            PD  TL+RI+RLL+RRKIFT    PSDG   +YG   +SRWL+ D+E ++APM+L  THP
Sbjct  65   PDITTLARIMRLLIRRKIFT-VHHPSDGGDLLYGLIHSSRWLLHDSEQTLAPMVLMNTHP  123

Query  423  LSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSG  602
              M P+H FS+CVKEGG AF+KA+G  ++++A+ DP+ NK FN+G+   +++I+  I+S 
Sbjct  124  WQMTPWHYFSQCVKEGGIAFKKAYGCELWDLASRDPDLNKLFNNGLACSSKVITSVILSS  183

Query  603  YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
            Y   G  S+ SLVDVGGG G  ++EIVKA+PHIKG+NFDLPHVV+TAP Y  VSH+GGDM
Sbjct  184  Y-KQGLSSIRSLVDVGGGIGGLISEIVKAYPHIKGVNFDLPHVVSTAPTYNAVSHIGGDM  242

Query  783  F-VSIPSAQAIFIKWVLHDWGDEECVKILKNC  875
            F  +IP+A A+ +KW+LHDW D+EC+KIL+NC
Sbjct  243  FHDAIPNADAVIMKWILHDWTDKECIKILRNC  274



>ref|XP_011045484.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X2 [Populus euphratica]
Length=292

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/288 (56%), Positives = 215/288 (75%), Gaps = 6/288 (2%)
 Frame = +3

Query  69   EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
            E  +   Q ++ +  L F DSMALK AV+LR+ DII+SH   +PI+LSQIAA I +SPSP
Sbjct  7    EAILFKIQVEISQLALGFADSMALKCAVELRLADIINSHG--RPISLSQIAAGI-NSPSP  63

Query  249  DTATLSRILRLLVRRKIFTSAVRPSDGA-TVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
            D + L+RI+R LVR++IFTS   PSDG  T++G    SR L+ D+E S+  +++ Q  P 
Sbjct  64   DISYLARIMRYLVRKEIFTSH-PPSDGGETLFGLNQKSRLLIHDSEQSLTSLVIMQHSPW  122

Query  426  SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
             +AP+HC S+ +KEGG AF KAHG  ++++A+ +PE N+ FN+ M   ++I+ + I+S Y
Sbjct  123  LLAPWHCLSQSIKEGGTAFSKAHGCEMWDLASRNPEVNRIFNEAMACTSKIVMREILSQY  182

Query  606  GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
              DGF ++ SLVDV GG G  VAEIV+A+PHIKGIN DLPHVVATAP+Y+GVSHV G+MF
Sbjct  183  K-DGFNNIRSLVDVAGGIGGHVAEIVRAYPHIKGINLDLPHVVATAPKYEGVSHVAGNMF  241

Query  786  VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL  929
             +IP+A AIFIK +LHDW DE CV+IL+NC++A+PEKTGKLII D VL
Sbjct  242  DAIPNADAIFIKRILHDWTDESCVEILRNCKKAIPEKTGKLIIADIVL  289



>ref|XP_010690135.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 173/335 (52%), Positives = 226/335 (67%), Gaps = 10/335 (3%)
 Frame = +3

Query  132   MALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSA  311
             MALK  V+L + DII+SH    PI++SQIAA    S SPD   L R++++LVRR  FT+ 
Sbjct  1     MALKCIVELGVADIINSHG--HPISVSQIAAHF-GSKSPDLRCLKRVMQVLVRRDFFTTV  57

Query  312   -VRPSDGA---TVYGPTPASRWLVR--DAELSMAPMLLFQTHPLSMAPFHCFSRCVKEGG  473
                P++     T+Y  TPAS  L++  + +LS +PM+L Q HP  +A  H  S  +K GG
Sbjct  58    NANPTEFGEDDTLYWLTPASMLLLQHDNDDLSYSPMVLMQHHPHLLAAMHHLSAAIKGGG  117

Query  474   FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgg  653
              AFEKAHG  I++  + D E N+ F+DG+    +I  + I S Y  D F  V S+VDVGG
Sbjct  118   IAFEKAHGCPIWDFLSADQEVNRLFHDGLACTAKIGFRGIASQYV-DVFADVKSVVDVGG  176

Query  654   gtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLH  833
             GTGAA+ EIVKA+PHIKGINFDLPHV+A AP Y+GV+HV GDMF +IP+A    +K +LH
Sbjct  177   GTGAALNEIVKAYPHIKGINFDLPHVIAIAPNYEGVTHVEGDMFKAIPNADVAILKSILH  236

Query  834   DWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKE  1013
             DW DE+C+KILKNCR+A+PEKTGKLI+ + +L  EG      I   +DLLM+AH+ GGKE
Sbjct  237   DWNDEDCIKILKNCRKAIPEKTGKLILFETLLHQEGAESMEGILLASDLLMIAHTGGGKE  296

Query  1014  RTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             RTE E   LL  AGFP+Y +I    + SIIEAY +
Sbjct  297   RTELECNTLLQNAGFPHYRLITKPGLPSIIEAYVE  331



>ref|XP_008789296.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Phoenix 
dactylifera]
Length=339

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 166/327 (51%), Positives = 221/327 (68%), Gaps = 5/327 (2%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             ++ S+L  Q  VW+ ML F DSM L+ AV+L I DIIH H   +P+++ ++A+ +   P 
Sbjct  5     EDHSVLEGQTWVWQTMLAFADSMVLRCAVELGIADIIHEHG--EPLSVPRLASLLPSPPP  62

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
               T+ L RI+R L  +KIF++      G T+YG TPAS  LVR ++LS+ PM+LF+THPL
Sbjct  63    NPTSLL-RIMRFLAHKKIFSTHSHTETGETLYGLTPASGVLVRSSDLSLVPMVLFETHPL  121

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKG-IFEMAAGDPEFNKSFNDGMESVTQIISKAIVSG  602
              +  +  F+  V++GG  +  AHG   +F  AA +PEFN  FN  M    +    A++S 
Sbjct  122   PVLAWGSFTASVRQGGAPYIVAHGMDMLFGTAATNPEFNAVFNSAMACTAKGTLDAVISA  181

Query  603   YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
             Y  DGF  +GSLVDVGGGTGA +  I+K  P IKGINFDLPHV+  APEY GV+HV GDM
Sbjct  182   YK-DGFAGLGSLVDVGGGTGATLGAILKLHPGIKGINFDLPHVIGGAPEYPGVTHVAGDM  240

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDI  962
             F +IP A A+F+K V+H +GDEEC K+L+NCR  +P+KTGK+IIVD VL P  D   GDI
Sbjct  241   FKTIPPADAVFMKTVMHCFGDEECEKVLRNCRSVIPQKTGKVIIVDVVLYPYDDSPLGDI  300

Query  963   SYVTDLLMLAHSSGGKERTEEEWKRLL  1043
                 D+LM A++S GKERTEEEWK+LL
Sbjct  301   RAKFDMLMFAYTSTGKERTEEEWKKLL  327



>ref|XP_010098487.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
 gb|EXB75147.1| (RS)-norcoclaurine 6-O-methyltransferase [Morus notabilis]
Length=367

 Score =   293 bits (751),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 174/369 (47%), Positives = 232/369 (63%), Gaps = 18/369 (5%)
 Frame = +3

Query  45    EVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAA  224
             E +D   DE  M   QA +W+ M   +DS+ LK AV+LRI DIIHSH    P+TLSQIA+
Sbjct  2     EGIDHHVDE--MQRGQADIWQVMYSHMDSLVLKCAVELRIADIIHSHGC--PVTLSQIAS  57

Query  225   AIHDSPSPDTATLSRILRLLVRRKIFT---------SAVRPSDGATVYGPTPASRWLVRD  377
             +I  S SP+   L RILRLLV +KIFT         S   P    T YG T  SRW++ +
Sbjct  58    SISGSTSPNIHYLERILRLLVCKKIFTAHRDDHDSSSGDHPHHHQTRYGLTEKSRWILWE  117

Query  378   AELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDG  557
             +E S+AP+++ Q   L +  F   S  V+ G   ++ A G      +  DP+  K F DG
Sbjct  118   SEPSLAPVIMMQNRRLVIDAFDHLSDSVRHGVVPYKAAFGHDFVGESTVDPKSKKWFKDG  177

Query  558   MESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVA  737
             M ++  ++   ++S    + F  +GSL+DVGG TG  + EIVKA PHIKG NFDLP ++A
Sbjct  178   MINLANMVMDPVLSALKNE-FSCMGSLIDVGGFTGETIYEIVKAHPHIKGFNFDLPDIIA  236

Query  738   TAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIV  917
              AP Y GV+HV GDMF +IP A AIF+K VL++W DE+C+KIL+NCR+++PEKTGK+IIV
Sbjct  237   MAPSYDGVTHVAGDMFEAIPCADAIFMKKVLNNWTDEQCIKILRNCRQSIPEKTGKVIIV  296

Query  918   DAVLKP--EGDPIF--GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNI  1085
             D VL+     D +F   ++    DL +LA    G+ERTE EWK+LL EAGFP   II+  
Sbjct  297   DIVLESLESNDVVFLYDEMRIRFDLGLLAFRGVGRERTELEWKKLLEEAGFPRNKIIRIP  356

Query  1086  AVASIIEAY  1112
             A+ SIIEAY
Sbjct  357   AMPSIIEAY  365



>dbj|BAN63363.1| flavonoid O-methyltransferase [Carthamus tinctorius]
Length=351

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 226/340 (66%), Gaps = 5/340 (1%)
 Frame = +3

Query  93    AQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRI  272
             A   +++   +D +A++ A+DL+I DII++H    P+TL+QIA  I +SPS +   LSR+
Sbjct  15    ATCLQHIYACLDVVAIRCALDLQIADIINNHDG--PVTLAQIAHGI-NSPSLNVDGLSRL  71

Query  273   LRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS  452
             +   V R+IF    +P     +Y   P S+WLV+D++ ++AP+++  T     +     S
Sbjct  72    MAFFVHRQIFDQVHQPETHEPLYNLNPCSKWLVKDSKTTIAPLVMVVTDVPLRSFLQNLS  131

Query  453   RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVG  632
             + + EGG    K  G   +   + +P  N+ FN+GM   T+I   A++S Y  D  +  G
Sbjct  132   KSIAEGGTTTMKIFGLDFWSFLSVNPRSNEIFNEGMACRTRITMDALMSKYRFDELK--G  189

Query  633   SLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAI  812
             +LVDVGGG GAA+ EIV A+PH+ GINFDLP V++TAP+Y+GV+HVGGDMF SIP A +I
Sbjct  190   TLVDVGGGLGAAINEIVTAYPHLNGINFDLPQVISTAPKYEGVTHVGGDMFESIPPADSI  249

Query  813   FIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLA  992
             FIK ++H+WGD EC+++LKNCR ++P KTGK+IIVD +L   GD +F D     DLLML+
Sbjct  250   FIKSIMHNWGDTECIQLLKNCRNSIPIKTGKIIIVDIILHHGGDNVFEDTRIAHDLLMLS  309

Query  993   HSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                 GKERTEEEWK++L E+GF  YN+IQ  A+ SIIEAY
Sbjct  310   SFGSGKERTEEEWKKILNESGFYRYNVIQIPALESIIEAY  349



>dbj|BAO79381.1| matairesinol O-methyltransferase [Anthriscus sylvestris]
Length=353

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/350 (45%), Positives = 225/350 (64%), Gaps = 5/350 (1%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             D  +M    A+ + ++   +D +A++ A++L IPD+I++H    PITLSQIA  I +S S
Sbjct  8     DISAMFQGLAKCFHHIYASLDIVAIRCALELHIPDVINNHDG--PITLSQIARGI-NSSS  64

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
              +   LS ++  LV+R+IF    +P     +Y   P S+WL+++ + ++AP ++  T+  
Sbjct  65    LNFDGLSHLMMFLVKRQIFDQVHQPEIEEPLYTLNPCSKWLIQNPKTTIAPYVMMVTNSS  124

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
                     S+C+ EGG    KA G   +   + +P  N  FN+GM   T+I   A++S Y
Sbjct  125   LRLLLENLSKCIAEGGTTAMKAFGVDFWSFLSVNPHVNDIFNEGMACGTRITMDALMSKY  184

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               DG +  G+LVDVGGG GAA+ +IV A+PHIKGINFDLP V++TAP Y GV+HVGGDMF
Sbjct  185   RFDGLK--GTLVDVGGGLGAAINDIVTAYPHIKGINFDLPQVISTAPTYVGVTHVGGDMF  242

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
              +IP A +IF+K VLHDW D +CV+ILK CR+++P KTGK+IIVD +L   GD +F    
Sbjct  243   KAIPPADSIFMKSVLHDWSDSDCVQILKKCRDSIPGKTGKIIIVDTILHRGGDDVFEYTR  302

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYS  1115
                DL+M +    GKERTE EWK++L EAGF  YN+IQ  A+ SIIE YS
Sbjct  303   IAHDLMMFSLFENGKERTEVEWKKILNEAGFYRYNVIQIPAIESIIEVYS  352



>gb|ACO90252.1| reticuline 7-O-methyltransferase-like protein [Papaver bracteatum]
Length=354

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 224/345 (65%), Gaps = 8/345 (2%)
 Frame = +3

Query  81    LHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSP-SPDTA  257
             L  Q ++W+     IDSMAL+ AV+L IPDII+SH   +PIT+S+I  ++  +  SP+  
Sbjct  8     LKGQIEIWELTGAVIDSMALRCAVELGIPDIINSHG--RPITISEIINSLKSTKASPNAE  65

Query  258   TLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAP  437
              L+R++RLLV  ++FTS V       VY  T +S+WL++D++ +++P +LF THP+ + P
Sbjct  66    YLTRVMRLLVHNRVFTSQVHQESNQIVYNLTRSSKWLLKDSKFNLSPTVLFDTHPIIVKP  125

Query  438   FHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDG  617
             +    RCV+E GF FE+AHG+ I+++A+ DP+FN   N  M   +  I   ++ GY  DG
Sbjct  126   WQYLGRCVQENGFPFERAHGREIWDLASADPKFNNLLNGAMGCTSTTIINEMLLGY-KDG  184

Query  618   FRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVA--TAPEYQGVSHVGGDMFVS  791
             F  +GSLVDVGGGTG  +AEIV+A PHI G N   P      +A  +Q +S +     ++
Sbjct  185   FSGIGSLVDVGGGTGTIIAEIVEANPHIIGTNLR-PSTCGGYSAWIFQELSMLVVICLLT  243

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALP-EKTGKLIIVDAVLKPEGDPIFGDISY  968
              P A A+ +KW+LHDW DE+C KILK   +A+  +K G++IIV+ VL+P G  +F  I  
Sbjct  244   FPEADAVLMKWILHDWSDEDCTKILKKLYKAITKKKNGEVIIVECVLRPGGSGLFDKIGL  303

Query  969   VTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASII  1103
             + D+ MLA +SGGKERTE+EWK LL  AGFP YNIIQ  + A  I
Sbjct  304   IFDMGMLALTSGGKERTEDEWKMLLNNAGFPRYNIIQTPSCAYCI  348



>gb|AJD20228.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Podophyllum 
peltatum]
Length=352

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 230/345 (67%), Gaps = 12/345 (3%)
 Frame = +3

Query  87    SQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLS  266
             +++ VW+Y+  F++   +K A++LRIPD+I +H   QP+TL++++A +      D+++L 
Sbjct  16    AESDVWRYIFGFVEMAVVKCAIELRIPDVIKAHG--QPMTLTELSATL----GCDSSSLY  69

Query  267   RILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHC  446
             RI+R LV +KIF      S+G   Y  TP S   +R  E SMA ++L ++  + +AP+  
Sbjct  70    RIMRFLVHQKIFKXKC-SSNGTECYALTPISXLXMRQGERSMADLVLLESSQVMLAPWQA  128

Query  447   FSRCV-KEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFR  623
              S CV K G   F+  HG  +++ A G PE ++  N+ M    +  + AI+ G     F 
Sbjct  129   LSTCVQKHGSPPFKAVHGVDVWDYATGHPEHSELINNAMACNARFAAPAIIDGCA-KVFD  187

Query  624   SVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSA  803
              V ++VDVGGG G+ +  +V+AFP +KG+NFDLPHVVA AP+   V HV GDMF+S+P A
Sbjct  188   GVCTVVDVGGGDGSTLRVLVEAFPWLKGLNFDLPHVVAVAPQSNNVQHVAGDMFLSVPRA  247

Query  804   QAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPI-FGDISYVTDL  980
              A+F+KWVLHDWGDEEC+KILKNCR+A+PE  GK+IIV+AVL+ + D + F D+  + D+
Sbjct  248   DAVFLKWVLHDWGDEECMKILKNCRKAIPEDGGKVIIVEAVLEEQCDELHFKDVGLMLDM  307

Query  981   LMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNI-AVASIIEAY  1112
             +M+AH++ GKERT EEWK +L +AGF    I+Q I AV S+I AY
Sbjct  308   VMMAHTNHGKERTLEEWKYVLRQAGFSRV-IMQPIRAVQSLILAY  351



>ref|XP_004144927.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004154248.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004166913.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43289.1| hypothetical protein Csa_7G017720 [Cucumis sativus]
Length=358

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/346 (45%), Positives = 219/346 (63%), Gaps = 11/346 (3%)
 Frame = +3

Query  87    SQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLS  266
             ++ ++WKY+  F++   +K A++LRI D I SH +  P+TLSQ++ A++ S S     L 
Sbjct  19    ARVEIWKYIFGFVEMAIVKCAIELRIGDTIESHGS--PMTLSQLSTALNCSAS----LLY  72

Query  267   RILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHC  446
             RILR LVRR IF   +  ++    Y  TP SR L      SMAP LL ++ P+ +AP+H 
Sbjct  73    RILRFLVRRGIFKQEINEAN-VISYDQTPLSRLLASSNNNSMAPFLLLESSPVMLAPWHR  131

Query  447   FSRCVKEGGFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFR  623
              S  +K  G   FE AHGK ++  AA DP  N   ND M    ++++   +       F 
Sbjct  132   LSARIKGNGETPFEAAHGKDVWSFAAADPIHNIVINDAMSCTARVLTVPAILEECPQIFE  191

Query  624   SVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSA  803
              +GSLVDVGGG G  ++ IVKAFP IKGINFDLPHV++++ +Y GV HVGG+M  SIP A
Sbjct  192   GIGSLVDVGGGNGTCLSMIVKAFPWIKGINFDLPHVISSSQQYIGVEHVGGNMLDSIPKA  251

Query  804   QAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEGDPIFGDISYVT  974
              A FI WVLHDW DE C+KILKNC+ A+ EK GK+IIV+A+++    E +   GD+  + 
Sbjct  252   DAAFIMWVLHDWDDETCIKILKNCKGAISEKRGKVIIVEALIEERSEENNNKLGDVGLML  311

Query  975   DLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             D++M+AH+  GKERT +EW  +L +AGF  Y I    AV S+I+A+
Sbjct  312   DMVMMAHTKNGKERTSKEWGHVLHQAGFTQYTITPIRAVHSVIQAF  357



>ref|XP_010932489.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Elaeis 
guineensis]
Length=347

 Score =   280 bits (716),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 198/287 (69%), Gaps = 2/287 (1%)
 Frame = +3

Query  261   LSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPF  440
             L RI+R L  +KIF++   P  G T+YG TPASR LVR ++LS+ P++L+ THP  +A +
Sbjct  62    LLRIMRFLTHKKIFSTHSHPETGETLYGLTPASRVLVRSSDLSLGPVVLYGTHPFPIAAW  121

Query  441   HCFSRCVKEGGFAFEKAHGKGIFE-MAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDG  617
             H FS  V +GG  +  AHG  +    AA +PEFN  F + M    + I  A +S Y  DG
Sbjct  122   HSFSASVLQGGTPYIMAHGTDMLSGTAATNPEFNAVFQNAMACPAKGILDAGISVYR-DG  180

Query  618   FRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIP  797
             F  + SLVDVGGGTGA + EIVK  P  KGINFDLPHV+  APEY GV+HV GDMF +IP
Sbjct  181   FAGLDSLVDVGGGTGATLGEIVKLHPGTKGINFDLPHVIERAPEYPGVTHVAGDMFKTIP  240

Query  798   SAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTD  977
              A A+F+K V+H +GDEEC K+L+NCR  +PEKTGK+IIVD VL P+ +   GDI    D
Sbjct  241   PADAVFMKRVMHCFGDEECEKVLRNCRSVIPEKTGKVIIVDVVLYPDDNSPLGDIRTKFD  300

Query  978   LLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
             +LM A+ S GKERTEEEWK+LL  +GFP +NII+  A+ SIIEA+ +
Sbjct  301   MLMFAYKSTGKERTEEEWKKLLKASGFPRWNIIRIPAIWSIIEAFPE  347



>ref|XP_008447906.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Cucumis 
melo]
Length=358

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 159/357 (45%), Positives = 220/357 (62%), Gaps = 13/357 (4%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             S  +K    ++ Q+WKY+  F++   +K A++LRI D I SH +  P+TLSQ++ A++ S
Sbjct  8     SISKKEEEEARVQIWKYIFGFVEMAIVKCAIELRIGDTIESHGS--PMTLSQLSTALNCS  65

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTH  419
              S     L RILR LVRR IF   +   +    Y  TP SR L      SMAP+LL ++ 
Sbjct  66    SS----LLYRILRFLVRRGIFKQEI-TEENVISYDHTPLSRLLASSNNNSMAPLLLLESS  120

Query  420   PLSMAPFHCFSRCVKEGGFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIV  596
             P+ +AP+H  S  +K  G   FE AHGK ++  AA DP  N   ND M    ++ +   +
Sbjct  121   PVMLAPWHRLSARIKGNGETPFEAAHGKDVWSFAAADPIHNIVINDAMSCTARVHTVPAI  180

Query  597   SGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGG  776
                    F  +GSLVDVGGG G  ++ IVKAFP IKGINFDLPHV++++ +Y GV HVGG
Sbjct  181   LEDCPQIFEGIGSLVDVGGGNGTCLSMIVKAFPWIKGINFDLPHVISSSQQYIGVEHVGG  240

Query  777   DMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL-----KPEG  941
             +M  SIP A A FI WVLHDW DE C+KILKNC+EA+ EK GK+IIV+A++     +   
Sbjct  241   NMLDSIPKADAAFIMWVLHDWDDETCIKILKNCKEAISEKRGKVIIVEAIIEERSEEENN  300

Query  942   DPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +   GD+  + D++M+AH+  GKERT +EW  +L +AGF  Y I    AV S+I+ +
Sbjct  301   NNNLGDVGLMLDMVMMAHTENGKERTIKEWGNVLRQAGFTRYTITPIRAVHSVIQGF  357



>ref|XP_006422511.1| hypothetical protein CICLE_v10028731mg [Citrus clementina]
 gb|ESR35751.1| hypothetical protein CICLE_v10028731mg [Citrus clementina]
Length=354

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 152/361 (42%), Positives = 223/361 (62%), Gaps = 11/361 (3%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             MEE       +K    ++ ++WKY+  F +   +K AV+L I + +    +  PITL+++
Sbjct  1     MEETKVQVMMKKEEDDAKVEIWKYVFGFTNMAVVKCAVELGIAEAVEEKGS--PITLNEL  58

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAP  398
             A+A+   PS     L RI+R L+  K F   V  S G+  +  TP SR L+R  E +MA 
Sbjct  59    ASALKCDPS----LLQRIMRFLIHLKFFKE-VPTSQGSMAFQQTPLSRRLMRHGENNMAA  113

Query  399   MLLFQTHPLSMAPFHCF-SRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
              +L ++ P+ +AP+H   +R +  G  AF+KAHGK ++  AA D   +K  ND M   T+
Sbjct  114   FILLESSPVMLAPWHSLGTRVLANGTSAFDKAHGKDVWSYAAADAAHSKLINDAMACDTR  173

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             +  +AI+ G   + F  + +LVD+GG  G  +  + KAFP I+GINFDLPHVV  A +  
Sbjct  174   LAMRAIIEGCP-EVFDGIETLVDIGGNDGTTLRTLTKAFPRIRGINFDLPHVVCVAEKCH  232

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKP  935
             GV HVGGDMF  +P A A  IKWVLHDWGD+EC+KILKNC+EA+ +  GK+IIV+A+++ 
Sbjct  233   GVEHVGGDMFDGVPEADAAIIKWVLHDWGDDECIKILKNCKEAITKDKGKVIIVEAIIEE  292

Query  936   --EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
               E D  F  +  + D++M+AH++ GKER+ +EW  +L +AGF  YNI    AV S+IEA
Sbjct  293   DDEVDNKFKSVRLMLDMVMMAHTNKGKERSLKEWDYVLRQAGFSRYNITSIHAVQSLIEA  352

Query  1110  Y  1112
             +
Sbjct  353   F  353



>ref|XP_004144871.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004153164.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004170291.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43290.1| hypothetical protein Csa_7G018720 [Cucumis sativus]
Length=359

 Score =   273 bits (699),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 153/347 (44%), Positives = 215/347 (62%), Gaps = 16/347 (5%)
 Frame = +3

Query  90    QAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSR  269
             + Q+WKY+  F++   +K A++L+I D+I SH  +  +TLSQ++++++ SP      L R
Sbjct  22    KVQIWKYIFGFVEMAVIKCAIELKIGDVIESHGDS--MTLSQLSSSLNCSP----LLLHR  75

Query  270   ILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCF  449
             ILR LV R IF    +       Y  TP SR L      SMAP+ L ++ P+ +AP+H  
Sbjct  76    ILRFLVHRGIF----KEEKTTKCYSHTPMSRLLTTTGPNSMAPLHLLESSPVMIAPWHNL  131

Query  450   SRCVK-----EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGD  614
             S CVK      G   FE AHG  ++  AA +P  +   N+ M    +++    V    G+
Sbjct  132   SACVKASDHENGSQPFEMAHGMDLWTYAAANPSHSSLINESMACFARLVILPAVLERCGE  191

Query  615   GFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSI  794
              F  VG LVDVGGG G  ++ +VKA P IKGINFDLPHVV+ + EY+G+ HVGG+MF S+
Sbjct  192   IFDGVGCLVDVGGGNGTCLSILVKACPWIKGINFDLPHVVSVSKEYEGIQHVGGNMFDSV  251

Query  795   PSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL-KPEGDPIFGDISYV  971
             P A A FI  VLHDW DEEC+KILKNC+EA+PEKTGK+IIV+ V+ + E    + D   +
Sbjct  252   PKADAAFIMEVLHDWDDEECIKILKNCKEAIPEKTGKVIIVEVVIDEKEEISKYSDARLM  311

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              D++M+AH+  GKERT EEW  +L +AGF  Y I     + S+I+A+
Sbjct  312   MDMIMMAHTIKGKERTNEEWANVLQKAGFSYYTITPTSTIQSVIQAF  358



>gb|KDO68213.1| hypothetical protein CISIN_1g018565mg [Citrus sinensis]
Length=354

 Score =   273 bits (698),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 151/361 (42%), Positives = 223/361 (62%), Gaps = 11/361 (3%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             MEE       +K    ++ ++WKY+  F +   +K AV+L I + +    +  PITL+++
Sbjct  1     MEETKVQVMMKKEEDDAKVEIWKYVFGFTNMAVVKCAVELGIAEAVEEKGS--PITLNEL  58

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAP  398
             A+A+   PS     L RI+R L+  K F   V  S G+  +  TP SR L+R  E +MA 
Sbjct  59    ASALKCDPS----LLQRIMRFLIHLKFFKE-VPTSQGSMAFQQTPLSRRLMRHGENNMAA  113

Query  399   MLLFQTHPLSMAPFHCF-SRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
              +L ++ P+ +AP+H   +R +  G  AF+KAHGK ++  AA D   +K  ND M   T+
Sbjct  114   FILLESSPVMLAPWHSLGTRVLANGTSAFDKAHGKDVWSYAAADAAHSKLINDAMACDTR  173

Query  576   IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
             +  +AI+ G   + F  + +LVD+GG  G  +  + KAFP I+GINFDLPHVV  A +  
Sbjct  174   LAMRAIIEGCP-EVFDGIETLVDIGGNDGTTLRTLTKAFPRIRGINFDLPHVVCVAEKCH  232

Query  756   GVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKP  935
             GV HVGGDMF  +P A A  IKWVLHDWGD+EC+KILKNC+EA+ +  GK+IIV+A+++ 
Sbjct  233   GVEHVGGDMFDGVPEADAAIIKWVLHDWGDDECIKILKNCKEAITKDKGKVIIVEAIIEE  292

Query  936   EG--DPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
             +   D  F  +  + D++M+AH++ GKER+ +EW  +L +AGF  YNI    AV S+IEA
Sbjct  293   DDGVDNKFKSVRLMLDMVMMAHTNKGKERSLKEWDYVLRQAGFSRYNITSIHAVQSLIEA  352

Query  1110  Y  1112
             +
Sbjct  353   F  353



>ref|XP_009606162.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=357

 Score =   272 bits (696),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 154/352 (44%), Positives = 222/352 (63%), Gaps = 11/352 (3%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             +E     +QA +WKY+  F +   +K A++L I D + S+   QP++L+Q++AA+    S
Sbjct  13    EENEDSQAQADIWKYVFGFTEMAVVKCAIELGIADFLESNQ--QPVSLNQLSAALGCCSS  70

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
                 +L R+LR L+ R IF       +G   Y  TP SR L ++   SMA  +LF++ P+
Sbjct  71    ----SLYRVLRFLINRGIFEE-TSTGNGEISYVQTPLSRLLRKEGGNSMAAFVLFESSPV  125

Query  426   SMAPFHCFSRCV--KEGGF-AFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIV  596
              +AP+H  S  V  KE    AF+ AHGK ++++A  DP +N   N+ M    ++   AI+
Sbjct  126   MLAPWHNLSARVLSKENTVPAFDAAHGKDVWKLAETDPGYNNLLNNAMACDARVSISAII  185

Query  597   SGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGG  776
             +G   + F+ + SLVDVGGG G A+  +V+AFP IKGINFDLPHV + AP    V HVGG
Sbjct  186   NGCP-EIFKGISSLVDVGGGDGTALRILVEAFPWIKGINFDLPHVASVAPHSNSVQHVGG  244

Query  777   DMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFG  956
             +MF  +P A A F+ WVLHDWGD+EC++IL+ C EA+P+ TGK+IIV+AV+  +GD    
Sbjct  245   NMFDYVPKADAAFLMWVLHDWGDDECIQILRKCGEAIPKDTGKVIIVEAVIGRKGDDKLK  304

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             D+  + DL+M+AH+S GKERT +EW  LL  AGF  + I    AV S+I+AY
Sbjct  305   DVGLMLDLVMMAHTSNGKERTAKEWAYLLSAAGFSRHTINHINAVQSVIQAY  356



>ref|XP_006486669.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Citrus sinensis]
Length=346

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/345 (43%), Positives = 218/345 (63%), Gaps = 11/345 (3%)
 Frame = +3

Query  87    SQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLS  266
             ++ ++WKY+  F +   +K AV+L I + +    +  PITL+++A+A+   PS     L 
Sbjct  9     AKVEIWKYVFGFTNMAVVKCAVELGIAEAVEEKGS--PITLNELASALKCDPS----LLQ  62

Query  267   RILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHC  446
             RI+R L+  K F   V  S G+  +  TP SR L+R  E +MA  +L ++ P+ +AP+H 
Sbjct  63    RIMRFLIHLKFFKE-VPTSQGSMAFQQTPLSRRLMRHGENNMAAFILLESSPVMLAPWHS  121

Query  447   F-SRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFR  623
               +R +  G  AF+KAHGK ++  AA D   +K  ND M   T++  +AI+ G   + F 
Sbjct  122   LGTRVLANGTSAFDKAHGKDVWSYAAADAAHSKLINDAMACDTRLAMRAIIEGCP-EVFD  180

Query  624   SVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSA  803
              + +LVD+GG  G  +  + KAFP I+GINFDLPHVV  A +  GV HVGGDMF  +P A
Sbjct  181   GIETLVDIGGNDGTTLRTLTKAFPRIRGINFDLPHVVCVAEKCHGVEHVGGDMFDGVPEA  240

Query  804   QAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEG--DPIFGDISYVTD  977
              A  IKWVLHDWGD+EC+KILKNC+EA+ +  GK+IIV+A+++ +   D  F  +  + D
Sbjct  241   DAAIIKWVLHDWGDDECIKILKNCKEAITKDKGKVIIVEAIIEEDDGVDNKFKSVRLMLD  300

Query  978   LLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             ++M+AH++ GKER+ +EW  +L +AGF  YNI    AV S+IEA+
Sbjct  301   MVMMAHTNKGKERSLKEWDYVLRQAGFSRYNITSIHAVQSLIEAF  345



>ref|XP_011092948.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Sesamum 
indicum]
Length=349

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 218/351 (62%), Gaps = 7/351 (2%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             SF       +Q  +WKY+  F     +K A++L+I +++ SH     ITLS+++AA+  S
Sbjct  5     SFKVDEEAQAQVDIWKYVFGFTPMAVVKCAIELQIAEVLESHGGG--ITLSELSAALGCS  62

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTH  419
               P    L+RI+R L+ R IF   +   +    Y  TP SR L+R+   SMA  +L ++ 
Sbjct  63    SLP----LNRIMRYLMHRGIFKQELTTQESEICYVQTPLSRLLIRNGGNSMADFILLESS  118

Query  420   PLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
             P+ ++P+H     +  G  +FE AHG+ ++E AA +P  +K  ND M    ++   AI++
Sbjct  119   PVMLSPWHRLKSALTSGASSFEAAHGEDVWEYAAANPSHSKLINDAMACHARLAMSAIIN  178

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGD  779
              Y  + F+ + SLVDVGGG G A+  +VKA P I+GINFDL HVV+ AP+Y G+ HV GD
Sbjct  179   RYP-EAFKGISSLVDVGGGNGTALQILVKACPWIRGINFDLAHVVSVAPQYDGIEHVSGD  237

Query  780   MFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGD  959
             MF  +P+A A F+  VLHDWGD+EC+ ILKNCREA+P+ TGK++IV+AV+    +  + D
Sbjct  238   MFEIVPNADAAFLMSVLHDWGDDECIDILKNCREAIPKDTGKVMIVEAVMDEGEEDEYVD  297

Query  960   ISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +    D++MLAH+  GKER+ +EW+ ++  AGF  + +     V S+IEAY
Sbjct  298   VRLALDMVMLAHTEKGKERSRKEWEYVVKAAGFTRFTVRHIQTVLSVIEAY  348



>gb|KCW47962.1| hypothetical protein EUGRSUZ_K01696 [Eucalyptus grandis]
Length=275

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 192/262 (73%), Gaps = 11/262 (4%)
 Frame = +3

Query  60   SFDE-KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
            S DE ++ L  QA +WK M  + DSMALK AV+LR+PDIIHS+    P+TL+QIA+ I  
Sbjct  3    SLDETEATLRGQAHIWKLMYAYADSMALKCAVELRVPDIIHSYGGG-PVTLAQIASRI-P  60

Query  237  SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-----TVYGPTPASRWLVRD--AELSMA  395
            SPSP TA L+RI+RLLVR+ IF++     DG      T+Y  TP+SRWL++   +ELS+A
Sbjct  61   SPSPGTAYLARIMRLLVRKNIFSANHCEPDGGHESHETLYSLTPSSRWLLQGPGSELSLA  120

Query  396  PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
            P++L + HP  M+P+HCF  CVK GG AFE AHG+ I++ A+ +PEFN+ FNDGM  V+ 
Sbjct  121  PLVLMENHPWLMSPWHCFGDCVKTGGIAFEMAHGRKIWDFASENPEFNRLFNDGMACVSG  180

Query  576  IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
            ++ + IV  Y  DGF S+GSLVDVGGG G  +AEI K+F HI+GINFDLPHVVATAP + 
Sbjct  181  VVVRGIVEVY-KDGFESIGSLVDVGGGVGKTLAEITKSFSHIQGINFDLPHVVATAPAHD  239

Query  756  GVSHVGGDMFVSIPSAQAIFIK  821
            GV+HVGG+MF +IP A A+F+K
Sbjct  240  GVTHVGGNMFETIPHADAVFMK  261



>ref|XP_011092949.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Sesamum 
indicum]
Length=350

 Score =   270 bits (690),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 151/352 (43%), Positives = 222/352 (63%), Gaps = 8/352 (2%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             SF      ++Q  +WKY+L F     +K A++L+I D++ SH  A  +TLS+++AA+  S
Sbjct  5     SFKVDEEANAQLDMWKYVLGFTPMALVKCAIELQIADVLESHGGA--MTLSELSAALGCS  62

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTH  419
              S    TL RI+R L+ R IF   VR  + +  Y  TP SR L+++   SMA ++L ++ 
Sbjct  63    SS----TLHRIMRYLMHRGIFKQVVRGQESSICYAQTPLSRLLIKNGGNSMAALVLLESS  118

Query  420   PLSMAPFHCFSR-CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIV  596
                +AP+H  S+  +  G  AFE AHG+ +++ AA +P  +K  ND M    ++   AIV
Sbjct  119   HAMLAPWHRLSKSALISGASAFEAAHGQDLWQYAAANPVHSKLINDAMACHARVDISAIV  178

Query  597   SGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGG  776
             + Y  + F+ + SLVDVGGG G A+  +VKA+P I GINFDLPHVV+ AP+ QG+ HV G
Sbjct  179   NQYP-EAFKGISSLVDVGGGDGTALQILVKAYPWIHGINFDLPHVVSVAPQCQGIKHVQG  237

Query  777   DMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFG  956
             +MF  +P A A F+  VLHDWGD+EC+ IL+ CREA+P+ TGK+II +AV+    +  + 
Sbjct  238   NMFEIVPKADAAFLMSVLHDWGDDECIDILRKCREAIPKDTGKVIIAEAVIDEGEEDKYT  297

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             D+    D++MLAH+  GKERT EEW+ ++  AGF  + +    A  S+IEAY
Sbjct  298   DVRLALDMVMLAHTEKGKERTIEEWEYVVNAAGFTRFTVKHIQATISVIEAY  349



>ref|XP_010690136.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=290

 Score =   268 bits (684),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 203/329 (62%), Gaps = 39/329 (12%)
 Frame = +3

Query  132   MALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSA  311
             MALK  V+L + DII+SH    PI++SQIAA    S SPD   L R++++LVRR  FT+ 
Sbjct  1     MALKCIVELGVADIINSHG--HPISVSQIAAHF-GSKSPDLRCLKRVMQVLVRRDFFTT-  56

Query  312   VRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKA  491
                                                HP  +A  H  S  +K GG AFEKA
Sbjct  57    ----------------------------------HHPHLLAAMHHLSAAIKGGGIAFEKA  82

Query  492   HGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaav  671
             HG  I++  + D E N+ F+DG+    +I  + I S Y  D F  V S+VDVGGGTGAA+
Sbjct  83    HGCPIWDFLSADQEVNRLFHDGLACTAKIGFRGIASQYV-DVFADVKSVVDVGGGTGAAL  141

Query  672   aEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEE  851
              EIVKA+PHIKGINFDLPHV+A AP Y+GV+HV GDMF +IP+A    +K +LHDW DE+
Sbjct  142   NEIVKAYPHIKGINFDLPHVIAIAPNYEGVTHVEGDMFKAIPNADVAILKSILHDWNDED  201

Query  852   CVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEW  1031
             C+KILKNCR+A+PEKTGKLI+ + +L  EG      I   +DLLM+AH+ GGKERTE E 
Sbjct  202   CIKILKNCRKAIPEKTGKLILFETLLHQEGAESMEGILLASDLLMIAHTGGGKERTELEC  261

Query  1032  KRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
               LL  AGFP+Y +I    + SIIEAY +
Sbjct  262   NTLLQNAGFPHYRLITKPGLPSIIEAYVE  290



>gb|AGN70880.1| O-methyltransferase OMT4 [Vitis vinifera]
Length=359

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 225/346 (65%), Gaps = 16/346 (5%)
 Frame = +3

Query  96    QVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRIL  275
             ++WKY+  F +  A+K  ++L I D++ SH    PITLS +++++   PS     L+RI+
Sbjct  22    EMWKYIYGFAEMAAVKCGIELGIADVMESHGG--PITLSALSSSLGCPPS----GLNRIM  75

Query  276   RLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-  452
             R LV R+IF   V  S G T Y  TP SR L+      MA  +L ++ P+ +AP+H  S 
Sbjct  76    RFLVSRRIFKE-VETSQGDTGYQQTPMSRCLMTSGGDGMAAFVLLESSPVMLAPWHGLSA  134

Query  453   RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVG  632
             R + +G   FE AHG  I+  AA +P+ +K  ND M S  + +  A+V+    + F  V 
Sbjct  135   RVLGKGNSTFEAAHGDDIWGYAAKNPDHSKLINDAMASNARRVVPAMVNDCP-EVFDGVS  193

Query  633   SLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAI  812
             +LVDVGGG G A+  +VKA P I+GINFDLPHVVATAP+   V HVGG+MF S+P A A+
Sbjct  194   TLVDVGGGNGTALRTLVKACPWIRGINFDLPHVVATAPKCNDVEHVGGNMFDSVPKADAV  253

Query  813   FIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEG-DPIFGDISYVTDL  980
             FI  VLHDWGDE+C+KIL+ CREA+PE  GK++IV+AV++   P+G D    D+  + D+
Sbjct  254   FIMKVLHDWGDEKCIKILEKCREAIPEDKGKVVIVEAVIEDGDPQGDDQKLKDVKLMVDM  313

Query  981   LMLAHSSGGKERTEEEWKRLLMEAGFPNYNI--IQNIAVASIIEAY  1112
             +M+AH++ GKERT +EW  +L+ AGF  Y I  I+NI V SIIEAY
Sbjct  314   VMMAHTTTGKERTFKEWDYVLLNAGFSRYTIKPIRNI-VQSIIEAY  358



>ref|XP_002281110.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Vitis 
vinifera]
 gb|AGN70878.1| O-methyltransferase OMT4 [Vitis vinifera]
 gb|AGN70879.1| O-methyltransferase OMT4 [Vitis vinifera]
Length=359

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 225/346 (65%), Gaps = 16/346 (5%)
 Frame = +3

Query  96    QVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRIL  275
             ++WKY+  F +  A+K  ++L I D++ SH    PITLS +++++   PS     L+RI+
Sbjct  22    EMWKYIYGFAEMAAVKCGIELGIADVMESHGG--PITLSALSSSLGCPPS----GLNRIM  75

Query  276   RLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-  452
             R LV R+IF   V  S G T Y  TP SR L+      MA  +L ++ P+ +AP+H  S 
Sbjct  76    RFLVSRRIFKE-VATSQGDTGYQQTPMSRCLMTSGGDGMAAFVLLESSPVMLAPWHGLSA  134

Query  453   RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVG  632
             R + +G   FE AHG  I+  AA +P+ +K  ND M S  + +  A+V+    + F  V 
Sbjct  135   RVLGKGNSTFEAAHGDDIWGYAAKNPDHSKLINDAMASNARRVVPAMVNDCP-EVFDGVS  193

Query  633   SLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAI  812
             +LVDVGGG G A+  +VKA P I+GINFDLPHVVATAP+   V HVGG+MF S+P A A+
Sbjct  194   TLVDVGGGNGTALRTLVKACPWIRGINFDLPHVVATAPKCNDVEHVGGNMFDSVPKADAV  253

Query  813   FIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEG-DPIFGDISYVTDL  980
             FI  VLHDWGDE+C+KIL+ CREA+PE  GK++IV+AV++   P+G D    D+  + D+
Sbjct  254   FIMKVLHDWGDEKCIKILEKCREAIPEDKGKVVIVEAVIEDGDPQGDDQKLKDVKLMVDM  313

Query  981   LMLAHSSGGKERTEEEWKRLLMEAGFPNYNI--IQNIAVASIIEAY  1112
             +M+AH++ GKERT +EW  +L+ AGF  Y I  I+NI V SIIEAY
Sbjct  314   VMMAHTTTGKERTFKEWDYVLLNAGFSRYTIKPIRNI-VQSIIEAY  358



>gb|AGK93045.1| VvOMT4 protein [Vitis vinifera]
Length=352

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 225/346 (65%), Gaps = 16/346 (5%)
 Frame = +3

Query  96    QVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRIL  275
             ++WKY+  F +  A+K  ++L I D++ SH    PITLS +++++   PS     L+RI+
Sbjct  15    EMWKYIYGFAEMAAVKCGIELGIADVMESHGG--PITLSALSSSLGCPPS----GLNRIM  68

Query  276   RLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-  452
             R LV R+IF   V  S G T Y  TP SR L+      MA  +L ++ P+ +AP+H  S 
Sbjct  69    RFLVSRRIFKE-VATSQGDTGYQQTPMSRCLMTSGGDGMAAFVLLESSPVMLAPWHGLSA  127

Query  453   RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVG  632
             R + +G   FE AHG  I+  AA +P+ +K  ND M S  + +  A+V+    + F  V 
Sbjct  128   RVLGKGNSTFEAAHGDDIWGYAAKNPDHSKLINDAMASNARRVVPAMVNDCP-EVFDGVS  186

Query  633   SLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAI  812
             +LVDVGGG G A+  +VKA P I+GINFDLPHVVATAP+   V HVGG+MF S+P A A+
Sbjct  187   TLVDVGGGNGTALRTLVKACPWIRGINFDLPHVVATAPKCNDVEHVGGNMFDSVPKADAV  246

Query  813   FIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEG-DPIFGDISYVTDL  980
             FI  VLHDWGDE+C+KIL+ CREA+PE  GK++IV+AV++   P+G D    D+  + D+
Sbjct  247   FIMKVLHDWGDEKCIKILEKCREAIPEDKGKVVIVEAVIEDGDPQGDDQKLKDVKLMVDM  306

Query  981   LMLAHSSGGKERTEEEWKRLLMEAGFPNYNI--IQNIAVASIIEAY  1112
             +M+AH++ GKERT +EW  +L+ AGF  Y I  I+NI V SIIEAY
Sbjct  307   VMMAHTTTGKERTFKEWDYVLLNAGFSRYTIKPIRNI-VQSIIEAY  351



>ref|XP_007041719.1| RS-norcoclaurine 6-O-methyltransferase [Theobroma cacao]
 gb|EOX97550.1| RS-norcoclaurine 6-O-methyltransferase [Theobroma cacao]
Length=353

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 153/340 (45%), Positives = 215/340 (63%), Gaps = 11/340 (3%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             VW+Y+  F++   +K A++L I D I +H +  P+TLS+++AA+   PS     L RI+R
Sbjct  22    VWRYIFGFVEMAVVKCAIELGIADAIENHGS--PMTLSELSAALGCEPS----RLHRIMR  75

Query  279   LLVRRKIFTSAVRP-SDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCF-S  452
              +V  ++F     P S G+  Y  TP SR L      SMA ++L ++ P+ +AP+H   +
Sbjct  76    FMVHNQVFKE--EPISQGSIGYAQTPLSRRLTSSGVNSMAALVLLESSPVMLAPWHSLRA  133

Query  453   RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVG  632
             R +  G   FE AHGK I+  A  +P  +   N+ M    ++   AI+ G   + F  +G
Sbjct  134   RVLASGDSPFEAAHGKDIWSYAEANPGHSTLINEAMACAARVSVPAIIEGCP-EVFDGLG  192

Query  633   SLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAI  812
             SLVDVGGG G A+  +VKAFP I+GINFDLPHVVA A ++ G+ +VGGDMF SIP A A 
Sbjct  193   SLVDVGGGNGTALTTLVKAFPWIRGINFDLPHVVAAATQFDGIENVGGDMFESIPKADAA  252

Query  813   FIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLA  992
             F  WVLHDW DEEC KILK CREA+PE  GK+IIV+AVL+ + D     +  + D++M+A
Sbjct  253   FFMWVLHDWDDEECTKILKKCREAIPEDKGKVIIVEAVLEDDTDDKLDFLRLMLDMVMMA  312

Query  993   HSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             H++ GKERT +EW+ +L  AGF   N+ +  AV S+IEAY
Sbjct  313   HTNKGKERTLKEWRYVLGHAGFTRINVKRIRAVQSVIEAY  352



>ref|XP_006447335.1| hypothetical protein CICLE_v10017872mg [Citrus clementina]
 gb|ESR60575.1| hypothetical protein CICLE_v10017872mg [Citrus clementina]
Length=297

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 153/314 (49%), Positives = 207/314 (66%), Gaps = 30/314 (10%)
 Frame = +3

Query  90    QAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSR  269
             Q +VW++M  F DSMALK A+ LR+ DI+HSH +  PITL Q+A+   D+   D   L+R
Sbjct  11    QPKVWQFMFAFTDSMALKFALGLRLADIMHSHRS--PITLPQLASKRIDTSCLDIPYLAR  68

Query  270   ILRLLVRRKIFTSAVRPS---DGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPF  440
             ++R+LVR+ IF  AV  S   D  T+Y  T  S+WL+ ++ELS+APM+L          +
Sbjct  69    LMRMLVRKGIF--AVHHSSNDDDETLYKMTHISKWLLHNSELSVAPMIL--------ELW  118

Query  441   HCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
             H  S+CVKE                A+ +P+FN  FN+ +E   +I+ KA VS Y  DGF
Sbjct  119   HYLSQCVKE--------------HFASQNPQFNNLFNEAIECTAKIVMKATVSHYK-DGF  163

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
              S+ SLVDVGGGT  A+A+IVK++PHIK INFDLPHVVAT P  +GV HVGGDMF  IP+
Sbjct  164   DSIRSLVDVGGGTTGALAKIVKSYPHIKVINFDLPHVVATTPMCEGVIHVGGDMFDPIPN  223

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDL  980
               A+F+KW+LHDW DE CVKILK+ R+A+ +K  K + V   ++ + + IFGD+  V DL
Sbjct  224   VDAVFMKWILHDWNDEACVKILKSYRKAISDKNEKFVFVVIFVQEDDNNIFGDMGLVFDL  283

Query  981   LMLAHSSGGKERTE  1022
             LM  H++GGKE+TE
Sbjct  284   LMFTHTTGGKEKTE  297



>gb|AFK39693.1| unknown [Lotus japonicus]
Length=216

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = +3

Query  480   FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggt  659
             F   HG   FEM   D E+N+ FN+GM    +I+S+A++SGY  DGF  + SLVDVGGG 
Sbjct  5     FFGCHGHDQFEMTGLDEEYNRLFNEGMVCTARIVSRAVISGYK-DGFNQIESLVDVGGGI  63

Query  660   gaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDW  839
             G +++EIV+A+PHIK IN DLPHVVATAP Y G++HVGGDMFVS+P+A AI++KW+LHDW
Sbjct  64    GGSLSEIVRAYPHIKAINLDLPHVVATAPPYDGITHVGGDMFVSVPNADAIYMKWILHDW  123

Query  840   GDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERT  1019
              DE C+KILKNCREA+PEKTGK+IIVD VL+PEG+  F D  +  D+++LAH+SGGKERT
Sbjct  124   SDEHCIKILKNCREAIPEKTGKVIIVDHVLQPEGNEPFSDTGHAFDMMLLAHNSGGKERT  183

Query  1020  EEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             EE W+ L  E GFP YNII+  A+ SIIEA+
Sbjct  184   EENWQYLFKETGFPRYNIIKINALPSIIEAF  214



>gb|AGN70876.1| O-methyltransferase OMT4 [Vitis vinifera]
 gb|AGN70877.1| O-methyltransferase OMT4 [Vitis vinifera]
Length=359

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 162/345 (47%), Positives = 224/345 (65%), Gaps = 16/345 (5%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F    A+K  ++L I D++ SH    PITLS +++++   PS     L+RI+R
Sbjct  23    MWKYIYGFAAMAAVKCGIELGIADVMESHGG--PITLSALSSSLGCPPS----GLNRIMR  76

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-R  455
              LV R+IF   V  S G T Y  TP SR L+      MA  +L ++ P+ +AP+H  S R
Sbjct  77    FLVSRRIFRE-VATSQGDTGYQQTPMSRCLMTSRGDGMAAFVLLESSPVMLAPWHGLSAR  135

Query  456   CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGS  635
              + +G   FE AHG  I+  AA +P+ +K  ND M S  + +  A+V+    + F  VG+
Sbjct  136   VLGKGNSTFEAAHGDDIWGYAAKNPDHSKLINDAMASNARRVVPAMVNDCP-EVFDGVGT  194

Query  636   LvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIF  815
             LVDVGGG G A+  +VKA P I+GINFDLPHVVATAP+   V HVGG+MF S+P A A+F
Sbjct  195   LVDVGGGNGTALRTLVKACPWIRGINFDLPHVVATAPKCNDVEHVGGNMFDSVPKADAVF  254

Query  816   IKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEG-DPIFGDISYVTDLL  983
             I  VLHDWGDE+C+KIL+ CREA+PE  GK+IIV+AV++   P+G D    D+  + D++
Sbjct  255   IMKVLHDWGDEKCIKILEKCREAIPEDKGKVIIVEAVIEGDDPQGDDQKLKDVKLMVDMV  314

Query  984   MLAHSSGGKERTEEEWKRLLMEAGFPNYNI--IQNIAVASIIEAY  1112
             M+AH++ GKERT +EW  +L+ AGF  Y I  I++I V SIIEAY
Sbjct  315   MMAHTTTGKERTFKEWDYVLLNAGFSRYTIKPIRSI-VQSIIEAY  358



>ref|XP_009793237.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=361

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 222/356 (62%), Gaps = 15/356 (4%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             +E     +QA +WKY+  F +   +K A++L I D + S+   QP++L+Q++ A+    S
Sbjct  13    EENQDSQAQADIWKYVFGFTEMAVVKCAIELGIADFLESNQ--QPVSLNQLSVALGCCSS  70

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
                 +L R+LR L+ R IF       +G   Y  TP SR L ++ E SMA  +LF++ P+
Sbjct  71    ----SLYRVLRFLINRGIFKE-TSTGNGEISYVQTPLSRLLRKEGENSMAAFVLFESSPV  125

Query  426   SMAPFHCFSRCV--KEGGF-AFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIV  596
              +AP+H  S  V  KE    AF+ AHGK +++ A  DP +N   N+ M    ++   AI+
Sbjct  126   MLAPWHNLSARVLSKENTVPAFDAAHGKDVWKFAETDPGYNNLLNNAMACDARVSVPAII  185

Query  597   SGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGG  776
             +G   + F+ + SLVDVGGG G A+  +V+AFP IKGINFDLPHV + AP   GV HVGG
Sbjct  186   NGCP-EIFKGISSLVDVGGGDGTALRILVEAFPWIKGINFDLPHVASVAPHSNGVQHVGG  244

Query  777   DMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL-KPEG---D  944
             DMF  +P A A FI WVLHDWGD EC++ILK C EA+P+ TGK+IIV+AV+ K +G   D
Sbjct  245   DMFHYVPKADAAFIMWVLHDWGDGECIQILKKCGEAIPKDTGKVIIVEAVIEKGDGRKED  304

Query  945   PIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                 D+  + D++M+AH+S GKERT +EW  +L  AGF  + I    AV S+I+AY
Sbjct  305   DKLKDVGLMLDMVMMAHTSNGKERTAKEWAYVLSAAGFSRHTINHINAVQSVIQAY  360



>ref|XP_006364535.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Solanum tuberosum]
Length=354

 Score =   265 bits (676),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 154/345 (45%), Positives = 214/345 (62%), Gaps = 12/345 (3%)
 Frame = +3

Query  90    QAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSR  269
             QA +W+ +  F +    K A++L I D + +H   +P+ LSQ+++A+  S S    +L R
Sbjct  17    QADIWRCISGFTEMAVAKCAIELGISDFLENHQ--EPVPLSQLSSALGCSAS----SLHR  70

Query  270   ILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCF  449
             ILR L+ R IF   V   +G   Y  TP SR L RD E SMA  +L ++ P+ +AP+H  
Sbjct  71    ILRFLINRGIF-KLVSTGNGEMGYVQTPVSRLLKRDGENSMAAFVLLESSPVMLAPWHYL  129

Query  450   SRCV--KEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFR  623
             S  V   E   AF  AHGK ++E A  +PE +K  ND +    ++   AI++    + F+
Sbjct  130   SARVLSNENSGAFSAAHGKDVWEYAKTNPEHSKLINDALACHARVTMHAIINNCA-EIFK  188

Query  624   SVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSA  803
              + SLVDVGGG G  +  +VKAFP I GINFDLPHVV+ AP   GV HV GDMF S+P A
Sbjct  189   GIESLVDVGGGNGTTLGMLVKAFPWINGINFDLPHVVSVAPPCHGVVHVEGDMFHSVPKA  248

Query  804   QAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPIFGDISYVTD  977
             QA F+ WVLHDW DEEC++ILK C EA+P+ TGK+IIV+A L  K   +    D+  + D
Sbjct  249   QAAFLMWVLHDWSDEECIQILKKCIEAIPKDTGKVIIVEAALDEKIGKEKGLKDVGLMLD  308

Query  978   LLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             ++MLAH++ GKERT +EW  +L  AGF  ++I+Q  A+  +I AY
Sbjct  309   MMMLAHTTNGKERTAKEWAHILSAAGFSRHSILQIPAIQPVIVAY  353



>ref|XP_003601618.1| O-methyltransferase [Medicago truncatula]
 gb|AES71869.1| flavonoid O-methyltransferase-like protein [Medicago truncatula]
Length=361

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 147/342 (43%), Positives = 222/342 (65%), Gaps = 17/342 (5%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F++   +K A++L I + I  H   +P++L ++++ +      D++ ++RI+R
Sbjct  27    IWKYIFGFVELAVVKCAIELGIAEAIEKHK--KPMSLLELSSTL----KCDSSYVNRIMR  80

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-R  455
              LV RKIF +     D    Y  TP SR L+R+ E SM  +LL ++ P+ +AP+   S R
Sbjct  81    FLVHRKIFKTMNTNHDDYPSYVQTPLSRRLIRNGEHSMVAILLLESSPVMVAPWLSLSDR  140

Query  456   CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGS  635
              +  G  +FEK HG+ ++  AA + + +   ND M    +++  AIV G   + F  VGS
Sbjct  141   VLVNGNPSFEKVHGEDVWHYAASNLDHSNLINDAMACDAKVVVPAIVEGCS-EVFDGVGS  199

Query  636   LvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIF  815
             LVDVGGG G  ++ + KAFP I+GINFDLPHV+  AP+Y GV HV GDMF S+P A A  
Sbjct  200   LVDVGGGNGTTMSILAKAFPRIRGINFDLPHVIDVAPKYDGVEHVAGDMFTSVPKADAAI  259

Query  816   IKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGD---PIFGDISYVTDLLM  986
             IKWVLHDWGDEEC++ILKNCREA+P++ GK+IIV+AV++ EG+     + D+  + D++M
Sbjct  260   IKWVLHDWGDEECIQILKNCREAIPKENGKVIIVEAVIE-EGEGKHNKYKDVGLMLDMVM  318

Query  987   LAHSSGGKERTEEEWKRLLMEAGF-----PNYNIIQNIAVAS  1097
             +AH++ GKERT +EW+ ++  AGF      + N +Q++ VAS
Sbjct  319   MAHTNIGKERTLKEWEYVIKMAGFKALIVKSINAVQSVIVAS  360



>dbj|BAN63362.1| matairesinol O-methyltransferase [Carthamus tinctorius]
Length=351

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 147/350 (42%), Positives = 219/350 (63%), Gaps = 7/350 (2%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             D  +M    A+  +++   +D +A++ A++L+IPD++++H    PITL+QIA  I +S S
Sbjct  8     DNNAMSKGLAKCLQHIYASLDVVAIRCALELQIPDVMNNHDG--PITLAQIARGI-NSSS  64

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
              +   LSR++  LV R+IF      S+   +Y     S+WLV++ + ++AP ++  T+  
Sbjct  65    LNLNGLSRLMSFLVHRQIFDQV--ESEEEPLYTLNSCSKWLVQNPKTTIAPYVMMVTNSS  122

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
               +     S+C+ EGG    KA G   +   + +P  N  FN+GM   T+I   A++S Y
Sbjct  123   LRSLLGNLSKCIAEGGTTTMKACGVDFWSYLSMNPRVNDVFNEGMACGTRITMDALMSNY  182

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               D  +  G+LVDVGGG GAA+ +IV  +PH+ GINFDLP V++TAP Y+GV+HVGGDMF
Sbjct  183   RFDELK--GTLVDVGGGLGAAINDIVTKYPHLNGINFDLPQVISTAPAYKGVTHVGGDMF  240

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
              +IP A +IF+K +LHDW D +CV+ILK CR+++  + GK++IVD +L    D       
Sbjct  241   KAIPPADSIFMKSILHDWSDNDCVQILKKCRDSISGRKGKMVIVDTILHRGEDDALEYTR  300

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYS  1115
                DL+M +    GKERTE EWK++L EAGF  YNII+  A+ SIIE YS
Sbjct  301   VAHDLMMFSLFENGKERTEVEWKKILNEAGFYRYNIIEIPAIESIIEVYS  350



>emb|CDP22007.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 196/264 (74%), Gaps = 9/264 (3%)
 Frame = +3

Query  51   MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
            MD + +   + H QA++WK++  F+DSMALK+A++L+I DIIH H   +P++LS+I++ I
Sbjct  1    MDTNDEGSKLHHGQAKIWKHLFGFVDSMALKSALELQIADIIHFHG--RPLSLSEISSNI  58

Query  231  HDSPSPDTATLSRILRLLVRRKIFTSA-VRPSDGA-----TVYGPTPASRWLVRDAE-LS  389
             +S SP+   L+RI+RLLVR KIFTS+ VRP  G       +Y  TPAS WL+ + + LS
Sbjct  59   TNSSSPNIPYLARIMRLLVRNKIFTSSEVRPGHGGDTPSTILYDLTPASNWLLNNNDPLS  118

Query  390  MAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESV  569
            +AP +L + HP  ++P+H  S CV+EGG AF+K+HGK I++ A+ +PEFNK FNDGME  
Sbjct  119  LAPFILMENHPWLLSPWHQLSACVREGGIAFQKSHGKEIWDFASQNPEFNKIFNDGMECT  178

Query  570  TQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPE  749
              I  +A++SG     +  V SLVDVGGG GA +AEIVKA+PHIKGINFDLPHVVATAP+
Sbjct  179  GMITVQAVLSGLKSANWDGVESLVDVGGGIGATIAEIVKAYPHIKGINFDLPHVVATAPK  238

Query  750  YQGVSHVGGDMFVSIPSAQAIFIK  821
            Y GVSHVGGDMF +IPSAQAIF+K
Sbjct  239  YDGVSHVGGDMFDAIPSAQAIFMK  262



>ref|XP_004231071.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Solanum 
lycopersicum]
Length=357

 Score =   262 bits (670),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 152/345 (44%), Positives = 217/345 (63%), Gaps = 11/345 (3%)
 Frame = +3

Query  90    QAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSR  269
             QA +W+ +  F +    K A++L I D + +H   +P+ LSQ+++A+  S S    +L R
Sbjct  19    QADIWRCISGFAEMAVAKCAIELGISDFLENHQ--EPVPLSQLSSALGCSAS----SLHR  72

Query  270   ILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCF  449
             ILR L+ R IF       +G   Y  TP SR L RD E SMA ++L ++ P+ +AP+H  
Sbjct  73    ILRFLINRGIFKLVSITGNGEMGYVQTPVSRLLKRDGENSMAALVLLESSPVMLAPWHYL  132

Query  450   SRCV--KEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFR  623
             S  V  KE G AF  AHGK ++E A  +PE +K  ND +    ++   AI++    + F+
Sbjct  133   SARVLSKENGGAFCAAHGKDLWEYAKINPEHSKLINDALACHARVTMHAIINNCA-EIFK  191

Query  624   SVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSA  803
              + SLVDVGGG G  V  +VKAFP I GINFDLPHVV+ AP   GV HV GDMF S+P A
Sbjct  192   GIESLVDVGGGNGTTVGMLVKAFPWINGINFDLPHVVSVAPPCHGVVHVEGDMFHSVPKA  251

Query  804   QAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPIFGDISYVTD  977
              A+F+  VLHDWGD+EC++ILK C EA+P+ TGK+IIV+AV+  K        D+  + D
Sbjct  252   HAVFLMSVLHDWGDDECIQILKKCIEAIPKDTGKVIIVEAVIDEKIGKGKNLKDVGLMLD  311

Query  978   LLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             ++M+AH++ GKER+ +EW  +L  AGF +++I+Q  A+  +I AY
Sbjct  312   MIMMAHTTNGKERSAKEWDHILSAAGFSSHSILQTSAIEPLILAY  356



>ref|XP_002529799.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF32581.1| o-methyltransferase, putative [Ricinus communis]
Length=353

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 220/343 (64%), Gaps = 11/343 (3%)
 Frame = +3

Query  87    SQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLS  266
             +  ++W Y+L F    A+K A++L + D+I S+ A  P+TL ++++ +  +PS    +L 
Sbjct  18    ADVEIWNYVLGFSKIAAVKCAIELGLADVIESNEA--PLTLFELSSTLGCAPS----SLY  71

Query  267   RILRLLVRRKIFTSAVRP-SDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
             RI+R LV +KIF    +P S G T Y  TP SR L+R  E SMA  +L ++ P  +AP+ 
Sbjct  72    RIMRFLVHQKIFKE--KPTSQGTTGYVQTPLSRRLLRQGENSMADFILMESSPDMLAPWQ  129

Query  444   CFSRCVKEGGF-AFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
             C S CV+     AFE++HG+ +++    +P  +K FND M    +II  +I+     + F
Sbjct  130   CLSNCVRGNVHSAFEESHGQHLWKHTEANPAHSKLFNDAMACDARIIVPSIIE-VCPEVF  188

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
               V S+VDVGGG G  +  +VKA P I+GINFDLPHVV+ A E  GV HVGGDMF S+P 
Sbjct  189   NGVKSVVDVGGGNGTTLGLLVKACPWIQGINFDLPHVVSVALECDGVKHVGGDMFDSVPQ  248

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDL  980
             A A F+ WVLHDW D+EC++ILK C+EA+PE  GK+IIV+AV+    D  F  +  + D+
Sbjct  249   ADAAFLMWVLHDWNDDECIQILKKCKEAVPEDNGKVIIVEAVIGEAKDDKFEYVRLMLDI  308

Query  981   LMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
             +++AH++ GKE T +EW+ ++ +AGF ++ I    AV SIIEA
Sbjct  309   VIMAHTNTGKETTSKEWESVIQKAGFRSHTIKPIGAVQSIIEA  351



>ref|XP_007201351.1| hypothetical protein PRUPE_ppa007692mg [Prunus persica]
 gb|EMJ02550.1| hypothetical protein PRUPE_ppa007692mg [Prunus persica]
Length=359

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 221/347 (64%), Gaps = 11/347 (3%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
             H++  VWKY+  F++   +K A++L I D I SH +  P+TL ++++A+   PSP    L
Sbjct  19    HAKVDVWKYVFGFVEIAVVKCAIELGIADTIESHGS--PMTLLELSSALRCDPSP----L  72

Query  264   SRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
              RI+R+LV  KIF        G  V+  TP S+WL++  E SM+ ++L ++ P+ +AP+H
Sbjct  73    YRIMRVLVHLKIFKEKPATQLGPKVFAQTPLSKWLLKSGETSMSALILLESSPVMLAPWH  132

Query  444   CFS-RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
               S R       AFE  HG+ ++  A  +P+ +K  N+ M    ++   A++     + F
Sbjct  133   GLSARIQGISNPAFEAVHGEDVWSYAKANPDHSKLINEAMACDARVAVPAVIESCL-EVF  191

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
             + + ++VDVGGG G  +  +V+A P ++GINFDLPHVV+ A E   + +VGGDMF S+P 
Sbjct  192   KGIATIVDVGGGDGTTLRLLVEACPWVQGINFDLPHVVSVAQECDHIKNVGGDMFDSVPK  251

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPI-FGDISYV  971
             A A+ +KWVLHDWGD+EC++ILK CREA+PE  GK+IIV+AV+  K E + I   ++  +
Sbjct  252   ADAVIMKWVLHDWGDDECIRILKKCREAIPENKGKVIIVEAVIDEKDEKEDIKLTNVRLM  311

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              D++M+AH++ GKERT +EW  +L EAGF  + I    AV S+I+A+
Sbjct  312   LDMVMMAHTNTGKERTLKEWGYVLGEAGFSRHTITPIHAVQSVIQAF  358



>ref|XP_002312933.2| hypothetical protein POPTR_0009s14170g [Populus trichocarpa]
 gb|EEE86888.2| hypothetical protein POPTR_0009s14170g [Populus trichocarpa]
Length=350

 Score =   260 bits (664),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 147/343 (43%), Positives = 212/343 (62%), Gaps = 8/343 (2%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
              +Q ++WKY+  F +   +K A++L I D I ++    P+TLS++++++  +PS    +L
Sbjct  13    QAQVEIWKYIFGFTNMAVVKCAIELGIADAIENNEG--PMTLSELSSSLGCAPS----SL  66

Query  264   SRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
              RI+R LV   IF        G TVY  T  SR L++  E SM  +LLF++  + MAP+H
Sbjct  67    YRIMRFLVHHNIFKEKPSSQLGTTVYVQTALSRRLLKKGEKSMVDLLLFESSHVMMAPWH  126

Query  444   CFS-RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
               S R + +    FE AHG  I++ A  +P  +K  +D M    +++   IV G+  + F
Sbjct  127   NLSSRVLNDNNSPFEGAHGDDIWKYALANPVHSKLIDDAMACDAKLVVPEIVEGFP-EVF  185

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
               V +LVDVGGG G  +  +VKAFP I+GINFDLPHVV+ A E +GV HVGGD F S+P 
Sbjct  186   DGVKTLVDVGGGNGTTLQMLVKAFPWIQGINFDLPHVVSVASESEGVKHVGGDFFESVPK  245

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDL  980
             A A F+ WVLHDW DEEC++ILKNC+EA+    GK+IIV+AV+  E       +  + D+
Sbjct  246   ADAAFLMWVLHDWNDEECIQILKNCKEAIQSDKGKVIIVEAVVGEEKGDKLEFVRLMLDM  305

Query  981   LMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
             +M++H+  GKERT +EW  +L EAGF +Y I    AV S+I A
Sbjct  306   VMMSHTDAGKERTSKEWGYVLKEAGFSSYTIKPIRAVQSVIVA  348



>ref|XP_008447905.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
melo]
Length=360

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 155/348 (45%), Positives = 208/348 (60%), Gaps = 17/348 (5%)
 Frame = +3

Query  90    QAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSR  269
             + QVWKY+  F++   +K A++L+I D+I SH        S   + +  S S     L R
Sbjct  22    KVQVWKYIFGFVEMAVVKCAIELKIGDVIESHGD------SMTLSQLSSSLSCSPLLLHR  75

Query  270   ILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCF  449
             ILR LV R IF    +    +  Y  TP SR L      SMAP+ L ++ P+ +AP+H  
Sbjct  76    ILRFLVHRGIF----KEEKSSKSYSHTPMSRLLTTTGPNSMAPIHLLESSPVMIAPWHNL  131

Query  450   SRCVKEGGFA-----FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGD  614
             S CVK  G       FE AHG  ++  AA +P  +   N+GM    ++     V    G+
Sbjct  132   SACVKANGHENGSQPFEMAHGMDLWTYAAANPSHSSLLNEGMACFARLFILPAVLERCGE  191

Query  615   GFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSI  794
              F  VG LVDVGGG G  ++ +VKA P IKGINFDLPHVV+ + EY+GV HVGGDMF S+
Sbjct  192   IFDGVGCLVDVGGGNGTCLSILVKACPWIKGINFDLPHVVSVSKEYEGVQHVGGDMFDSV  251

Query  795   PSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPI--FGDISY  968
             P A A FI  VLHDW DEEC+KIL+NC+EA+PEKTGK+IIV+ V+  + D I  + D+  
Sbjct  252   PKADAAFIMEVLHDWDDEECIKILRNCKEAIPEKTGKVIIVEIVIDEKEDQISKYSDVKL  311

Query  969   VTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
               D++M+AH+  GKERT EEW  LL +AGF  Y I     + S+I+A+
Sbjct  312   RMDMIMMAHTIKGKERTNEEWANLLQKAGFSYYTITPTTTIQSVIQAF  359



>ref|XP_010526871.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Tarenaya 
hassleriana]
Length=361

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 218/355 (61%), Gaps = 16/355 (5%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             +E     +  ++W+Y+  F D   +K A+DL+IP+ I +H + QP+TL+ ++ A+  SP 
Sbjct  15    EEDEEAKASTEIWRYVFGFTDMAVVKCAIDLKIPEAIENHTS-QPVTLADLSTAVSSSPP  73

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
             P    L RI+R L  R IF   V   DG   Y  TP SR ++     SMAP +L +T P+
Sbjct  74    P---LLRRIMRFLAHRGIFKE-VLTKDGIVGYLNTPLSRLMMSK---SMAPFILLETTPV  126

Query  426   SMAPFHCFSRCVK----EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              +AP+   S  V     EG   F+ AHGK ++  AA +P  ++  N  M    + +  A 
Sbjct  127   MLAPWLNLSSVVSAVSGEGSPPFDAAHGKDVWAYAAENPGHSEIINQAMACDARRVVPA-  185

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             V+G   D F    ++VDVGGG G A+  +VKAFP +KG+NFDLPHVV  A ++ GV +VG
Sbjct  186   VAGACADVFNGASTVVDVGGGNGEALGILVKAFPWVKGLNFDLPHVVEAAEKFDGVENVG  245

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDP  947
             GDMF S+P+A  +FIKWVLHDWGDEE VKILK CREA+P++ GK++IV+AV+  K +GD 
Sbjct  246   GDMFDSVPNADVVFIKWVLHDWGDEEYVKILKKCREAIPKEEGKVVIVEAVVGEKKKGDR  305

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +      + D++M+AH++ G+ERT EEW  +L  AGF  Y I     V S++ AY
Sbjct  306   L-EYARLMLDMVMMAHTTRGRERTSEEWDHVLTAAGFARYEIRDINDVQSVVVAY  359



>ref|XP_010526872.1| PREDICTED: LOW QUALITY PROTEIN: (R,S)-reticuline 7-O-methyltransferase-like 
[Tarenaya hassleriana]
Length=361

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 151/355 (43%), Positives = 218/355 (61%), Gaps = 16/355 (5%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             +E     +  ++W+Y+  F D   +K A+DL+IP+ I +H + QP+TL+ ++ A+  SP 
Sbjct  15    EEDEEAKASTEIWRYVFGFTDMAVVKCAIDLKIPEAIENHTS-QPVTLADLSTAVSSSPL  73

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
             P    L RI+R L  R IF   V   DG   Y  TP SR ++     SMA  +L +T P+
Sbjct  74    P---LLRRIMRFLAHRGIFKE-VLTKDGIVGYLNTPLSRLMMSK---SMALFILLETTPV  126

Query  426   SMAPFHCFSRCVK----EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              +AP+   S  V     EG   F+ AHGK ++  A  +P  ++  N  M   ++ +  A 
Sbjct  127   MLAPWLNLSSVVSAVSGEGSPPFDAAHGKNVWAYATENPGHSEIINQAMACDSRRMVPA-  185

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             V+G   D F    ++VDVGGG G A+  +VKAFP +KG+NFDLPHVV  A ++ GV +VG
Sbjct  186   VAGACADVFNGASTVVDVGGGNGEALGILVKAFPWVKGLNFDLPHVVEAAEKFDGVENVG  245

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDP  947
             GDMF S+P+A  +FIKWVLHDWGD+ECVKILK CREA+P++ GK++IV+AV+  K +GD 
Sbjct  246   GDMFESVPNADVVFIKWVLHDWGDKECVKILKKCREAIPKEEGKVVIVEAVVGEKKKGD-  304

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +      + D++M+AH++ G+ERT EEW  +L  AGF  Y I     V S++ AY
Sbjct  305   MLEYARLMLDMVMMAHTTRGRERTSEEWDHVLTAAGFARYEIRDINDVQSVVVAY  359



>ref|XP_002281120.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase [Vitis vinifera]
 gb|AGN70873.1| O-methyltransferase OMT3 [Vitis vinifera]
 gb|AGN70874.1| O-methyltransferase OMT3 [Vitis vinifera]
Length=353

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 220/342 (64%), Gaps = 12/342 (4%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F++   +K  ++L I D+I SHA   PITLS +++++  S     + L RI+R
Sbjct  19    MWKYIFGFVEMAVVKCGIELGIADVIESHAG--PITLSSLSSSLGCS----PSGLYRIMR  72

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-R  455
              LV R+IF   V  S G T Y  TP SR L+  +E  MA +LL ++ P+ +AP+H  S R
Sbjct  73    FLVNRRIFKE-VATSQGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVMLAPWHGLSAR  131

Query  456   CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGS  635
              + +G   F+ AHG+ ++  AA  P  +K  ND M    ++   AIV+G   + F  V +
Sbjct  132   LLGKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDARMAVSAIVNGCP-EVFDGVST  190

Query  636   LvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIF  815
             LVDVGGG G A+  ++KA P I+GINFDLPHVV++AP+  GV +  GDMF ++P A A F
Sbjct  191   LVDVGGGDGTALRTLIKARPLIRGINFDLPHVVSSAPKCNGVEYASGDMFDTVPKADAAF  250

Query  816   IKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEGDPIFGDISYVTDLLM  986
             + WVLHDWGDEEC++IL+ CR+A+P   GK+IIV+AV++    EGD    D+  + D++M
Sbjct  251   LMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIVEAVIQENEKEGDNNLKDVGLMLDMVM  310

Query  987   LAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +AH++ GKERT +EW  +L +AGF  Y +    AV S+IEAY
Sbjct  311   MAHTTTGKERTLKEWDYVLKKAGFNRYTVKPIRAVKSVIEAY  352



>gb|AGK93043.1| OMT3 protein [Vitis vinifera]
Length=346

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 220/342 (64%), Gaps = 12/342 (4%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F++   +K  ++L I D+I SHA   PITLS +++++  S     + L RI+R
Sbjct  12    MWKYIFGFVEMAVVKCGIELGIADVIESHAG--PITLSSLSSSLGCS----PSGLYRIMR  65

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-R  455
              LV R+IF   V  S G T Y  TP SR L+  +E  MA +LL ++ P+ +AP+H  S R
Sbjct  66    FLVNRRIFKE-VATSQGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVMLAPWHGLSAR  124

Query  456   CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGS  635
              + +G   F+ AHG+ ++  AA  P  +K  ND M    ++   AIV+G   + F  V +
Sbjct  125   LLGKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDARMAVSAIVNGCP-EVFDGVST  183

Query  636   LvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIF  815
             LVDVGGG G A+  ++KA P I+GINFDLPHVV++AP+  GV +  GDMF ++P A A F
Sbjct  184   LVDVGGGDGTALRTLIKARPLIRGINFDLPHVVSSAPKCNGVEYASGDMFDTVPKADAAF  243

Query  816   IKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEGDPIFGDISYVTDLLM  986
             + WVLHDWGDEEC++IL+ CR+A+P   GK+IIV+AV++    EGD    D+  + D++M
Sbjct  244   LMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIVEAVIQENEKEGDNNLKDVGLMLDMVM  303

Query  987   LAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +AH++ GKERT +EW  +L +AGF  Y +    AV S+IEAY
Sbjct  304   MAHTTTGKERTLKEWDYVLKKAGFNRYTVKPIRAVKSVIEAY  345



>ref|XP_011045540.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 148/344 (43%), Positives = 219/344 (64%), Gaps = 11/344 (3%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
             H++ ++WKY+  F +   +K A++L I D I +  +  P+TLS++++++  +PS    +L
Sbjct  19    HAKVEIWKYIFGFTNMAVVKCAIELGIADAIEN--SEGPMTLSELSSSLGCAPS----SL  72

Query  264   SRILRLLVRRKIFTSAVRPS-DGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPF  440
              RI+R LV   IF    +PS  G TVY  T  SR L++  E SM  +LLF+++ + +AP+
Sbjct  73    YRIMRFLVHHNIFKE--KPSSQGTTVYVQTALSRRLLKKGEKSMVDLLLFESNHVMLAPW  130

Query  441   HCFS-RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDG  617
             H  S R + +    FE AHG  +++ A  +P  +K  +D M    +++   IV G   + 
Sbjct  131   HNLSSRVLNDNNSPFEGAHGDDVWKYALVNPVHSKLIDDAMACDAKLVVPEIVEGCP-EV  189

Query  618   FRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIP  797
             F  V +LVDVGGG G A+  +VKAFP I+G NFDLPHVV+ APE +GV HVGG+ F S+P
Sbjct  190   FDGVKTLVDVGGGNGTALQMLVKAFPWIQGTNFDLPHVVSAAPESEGVKHVGGNFFESVP  249

Query  798   SAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTD  977
              A A F+ WVLHDW DEEC++ILKNC+EA+    GK+IIV+AV+  E D     +  + D
Sbjct  250   KADAAFLMWVLHDWNDEECIQILKNCKEAIQSDEGKVIIVEAVVGEEKDDKLEFVRLMLD  309

Query  978   LLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
             ++M++H+  GKERT +EW+ +L EAGF +Y I    AV S+I A
Sbjct  310   MVMMSHTDAGKERTSKEWEYVLKEAGFSSYTIKPIRAVQSVIVA  353



>ref|XP_009802633.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=361

 Score =   257 bits (657),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 222/353 (63%), Gaps = 12/353 (3%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
             +K+   +Q  +WKY+  F +  A+K A++L IPD + +H   +PITL+Q+++ +  S S 
Sbjct  15    DKAESQAQEDIWKYIFGFTEMAAVKCAIELGIPDFLENHQ--EPITLNQLSSVLGCSCSN  72

Query  249   DTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLS  428
                 L RILR L+ R IF        G   Y  TP SR L +D E SMA ++L +  P+ 
Sbjct  73    ---FLYRILRFLINRGIFKEE-STGHGEIGYVQTPLSRLLRKDGENSMAALVLLEASPVM  128

Query  429   MAPFHCFS-RCVKEGGFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSG  602
             +AP+H  S R + +G  A F   HGK ++E A  +PE +K  ND +   +++   AIV  
Sbjct  129   LAPWHFLSGRALAKGNTASFSAVHGKDVWEYAETNPEHSKLINDALACHSRVTILAIVDN  188

Query  603   YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
                + F+ + +LVDVGGG G  ++ +VK FP I+GINFDLPHVV+ AP   GV HV G+M
Sbjct  189   CP-EIFKGIETLVDVGGGDGTTISLLVKTFPWIRGINFDLPHVVSVAPHCHGVQHVEGNM  247

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL---KPEGDPIF  953
             F SIP A A F+  +LHDW D+EC++ILKNC + +P+ TGK+I+V+ VL   K EG+   
Sbjct  248   FDSIPKADAAFLMSILHDWSDDECIQILKNCIKIIPKDTGKVIMVEVVLEKEKGEGNEKL  307

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              D+ ++ D++M+AH++ GKERT +EW ++L  AGF +++I    A+ S+I AY
Sbjct  308   KDVGFMLDMVMMAHTTNGKERTAKEWAQILTAAGFNSHSIKHINAIESVILAY  360



>ref|XP_009602880.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 152/352 (43%), Positives = 218/352 (62%), Gaps = 11/352 (3%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
             +K+   +Q  +WKY   F +  A+K A++L IPD + +H   +PITL+Q+++A+  S S 
Sbjct  16    DKAESQAQEDIWKYTFGFTEMAAVKCAIELGIPDFLENHQ--KPITLNQLSSALGCSSSN  73

Query  249   DTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLS  428
                 L RILR L+ R IF        G   Y  TP SR L RD   SMA ++L +  P+ 
Sbjct  74    ---FLYRILRFLINRGIFKEE-STGHGEIGYVQTPLSRLLRRDGGNSMAALVLLEASPVM  129

Query  429   MAPFHCFS-RCVKEGGFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSG  602
             +AP+H  S R + +G  A F   HGK ++E A  +PE +K  ND M    ++  +AI+  
Sbjct  130   LAPWHFLSARVLAKGNTAAFSAVHGKDVWEYAETNPEHSKLINDAMACHARVAIRAIIDN  189

Query  603   YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
                + F+ + +LVDVGGG G  ++ +VK FP I+GINFDLPHVV+ AP   GV HV G+M
Sbjct  190   CP-EIFKGIETLVDVGGGDGTTISLLVKTFPWIRGINFDLPHVVSVAPPCHGVRHVEGNM  248

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPE--GDPIFG  956
             F SIP A A F+  VLHDW DEEC++ILKNC + +P+ TGK+IIV+ VL+ E  G+    
Sbjct  249   FDSIPKADAAFLMSVLHDWSDEECIQILKNCIKIIPKDTGKVIIVEVVLEKERGGNEKLK  308

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             D+ ++  ++M+AH++ GKERT +EW  +L  AGF  + I    A+AS+I AY
Sbjct  309   DVGFMLAMVMMAHTTNGKERTAKEWAHILTAAGFNRHCIKHINAIASVILAY  360



>ref|XP_010247901.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nelumbo 
nucifera]
Length=346

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/347 (43%), Positives = 208/347 (60%), Gaps = 7/347 (2%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPD  251
             K +   + ++WK+   F D++ L+ A++  I DIIH     +P+TL ++ A I   P  +
Sbjct  5     KEVQADEVEIWKFGYDFADTLVLRCAIEFGIADIIHKQG--EPLTLFELGAQIPVQPV-N  61

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
             T  L R++R +V  KIFT       G   YG +P  ++LV+  + SMA  +L  T     
Sbjct  62    TDHLHRLMRYMVHMKIFTKETL--GGEEXYGLSPHGKFLVKGWDKSMASAILAITDEDFF  119

Query  432   APFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             AP+HC    +   G AFEKA GK I+   A  PE NK FN+ M   T  I+  ++     
Sbjct  120   APWHCLKDVLAGEGTAFEKALGKSIWAYVADHPEKNKLFNEVMACDTSFITSVLIQDCK-  178

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             D F+ + S+VDVGGGTG A+ +I KAFPH+K   +DLPHV+A +P+Y  V  + GDMF  
Sbjct  179   DVFQGIKSVVDVGGGTGTAMRDIAKAFPHLKCTIYDLPHVIADSPDYPEVDRIAGDMFKH  238

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IPSA AI +KW+LHDW D EC++ILK C+E++P + GK+IIVD VL PE           
Sbjct  239   IPSADAILLKWILHDWDDGECIEILKRCKESVPREGGKVIIVDIVLDPESKDPLTKARLR  298

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              DL M+ + +GGKER+E EWK+LL  AGFP Y I+   AV S+I AY
Sbjct  299   LDLDMMVY-TGGKERSEAEWKKLLNAAGFPGYKILHVAAVQSVIMAY  344



>ref|XP_010244054.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nelumbo 
nucifera]
Length=346

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 210/342 (61%), Gaps = 7/342 (2%)
 Frame = +3

Query  87    SQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLS  266
             + A++WK++  F D + L+ A+DL I DIIH     +P+TLS++ A I   P  +T  L 
Sbjct  10    AAAKIWKFVYGFADCLVLRCAIDLGIADIIHKQG--EPLTLSELGAQIPVQPV-NTDHLH  66

Query  267   RILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHC  446
             R++R LV  KIFT      DG   YG  P ++++V+  + S+  ++L  T    MAP+HC
Sbjct  67    RLMRYLVHMKIFTKETL--DGEARYGLAPPAKFIVKGWDKSIVSIILVVTDKDFMAPWHC  124

Query  447   FSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRS  626
                 +   G AFEKA G+ I+   A  PE NK FN+GM   T+++  A+V     D F+ 
Sbjct  125   LKDSLCGEGTAFEKALGRSIWTYMADHPEKNKLFNEGMACDTKLLISALVQDCK-DLFQG  183

Query  627   VGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQ  806
             + SLVDVGGGTG A+  I KAFPH+K   +DLPHV+A +P+Y  V  + GDMF  IPSA 
Sbjct  184   IMSLVDVGGGTGTAMRAIAKAFPHLKCTIYDLPHVIADSPDYPEVDRIAGDMFKHIPSAD  243

Query  807   AIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLM  986
             AI +K +LHDW D EC++ILK C+E++P + GK+IIVD V+  E            DL M
Sbjct  244   AILLKCILHDWDDGECIEILKRCKESVPREGGKVIIVDIVVDLESKHPLTKTRLSLDLDM  303

Query  987   LAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +  ++GGKERTE EWK+LL  AGFP + I    AV S+I AY
Sbjct  304   MV-TTGGKERTEAEWKKLLNAAGFPVFKITHISAVQSVIVAY  344



>ref|XP_010526874.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X1 [Tarenaya hassleriana]
Length=351

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 149/355 (42%), Positives = 217/355 (61%), Gaps = 14/355 (4%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
             E+    +   +W+Y+  F D   +K A++L+IP+ + SH A QP+TL+ ++AA+  SP  
Sbjct  2     EEEEARASVDIWRYVFGFTDMAVVKCAIELKIPEAVESHPA-QPVTLADLSAAVACSPP-  59

Query  249   DTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAEL--SMAPMLLFQTHP  422
                 L RI+R L  + IF   +   DG   Y  TP SR ++    +  S+AP++L ++ P
Sbjct  60    ---LLGRIMRFLSHQGIFKEVIT-KDGIVGYLSTPLSRLMMGSNRVNKSLAPLILMESSP  115

Query  423   LSMAPFHCFSRCVK-----EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
             + +AP+   S  V      EG   FE  HGK ++   A DP  ++ FN+ M   T+ +  
Sbjct  116   VMLAPWLKLSAVVSNASADEGSQPFEAEHGKDLWGYCAEDPIHSEVFNEAMACDTRRVVP  175

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
             A V+G   D F  V ++VDVGGG G A+  +VKAFP IKG+NFDLPHVV TA ++ GV +
Sbjct  176   A-VAGACADVFEGVSTVVDVGGGKGDALGVMVKAFPWIKGLNFDLPHVVETALKFDGVEN  234

Query  768   VGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDP  947
             VGGDMF  +P+A  +FIKWVLHDW DE C+K+LK C+EA+P++ GK++IV+AVL  +   
Sbjct  235   VGGDMFERVPNADVVFIKWVLHDWDDEACIKLLKKCKEAVPKEKGKVVIVEAVLGNKKGD  294

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                    + D++M+AH++ GKERT EEW  +L EAGF  Y +     V S+I AY
Sbjct  295   KLEYARLMLDMVMIAHTTKGKERTMEEWDYVLTEAGFVRYEVRDINDVQSVIIAY  349



>ref|XP_003605746.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|AES87943.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=271

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/273 (49%), Positives = 188/273 (69%), Gaps = 13/273 (5%)
 Frame = +3

Query  12   HSPASKFSPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAA  191
            HSP S F  +      S +E+  L  Q ++WKYM  F DS ALKA V+LRI DII  +  
Sbjct  8    HSPPSAFKGV------SKEEEESLLGQIEIWKYMTQFTDSFALKAVVELRIADIIDRYG-  60

Query  192  AQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV  371
             +P++L+QI   + D+PSPD+  L R++R++VRRKIF SA +   G  +YG T AS+W++
Sbjct  61   -KPLSLTQIVQNLEDAPSPDSTLLLRVMRVMVRRKIF-SAEKSETGEILYGLTRASKWIL  118

Query  372  RDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEG---GFAFEKAHGKGIFEMAAGDPEFNK  542
            +D ++++APMLL + HP  + P +  S  +KEG   G AF + HG   FEM   D ++N 
Sbjct  119  QDTKMTLAPMLLLENHPFHLNPANFISEIIKEGTKNGTAFFRCHGHEQFEMTGLDSKYND  178

Query  543  SFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDL  722
             FN GM    +I+S+A+++GY  DGF  + SLVDVGGG G +++EIV+A+PHI+ INFDL
Sbjct  179  LFNQGMVCTARIVSRAVIAGYK-DGFNQIKSLVDVGGGIGGSLSEIVRAYPHIQAINFDL  237

Query  723  PHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIK  821
            PHVV+TAP + G++HVGGDMFVS+PSA AI++K
Sbjct  238  PHVVSTAPNFDGITHVGGDMFVSVPSADAIYMK  270



>ref|XP_008447904.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
melo]
Length=358

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/345 (42%), Positives = 212/345 (61%), Gaps = 14/345 (4%)
 Frame = +3

Query  96    QVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRIL  275
             Q+W+Y+  F +  A+K A+DL+I DII S+ +  P+TLSQ+++ ++ S S     L RIL
Sbjct  21    QMWRYIFRFTEMAAIKCAIDLKIADIIESYGS--PVTLSQLSSTLNCSSS----LLYRIL  74

Query  276   RLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFSR  455
             R L+ R IF       +    Y  TP SR L  + E SMAP+LL +T P+ +AP+   S 
Sbjct  75    RFLIHRGIFKRET-IDENQIGYSQTPMSRLLAINVENSMAPLLLLETSPVMLAPWQHLSA  133

Query  456   CVKEGGFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVG  632
              +K    + FE AHGK ++  A  + E N  FN+ M    ++I  AI+ G G D F  VG
Sbjct  134   HLKNSDTSPFEIAHGKDLWNYAEANHEHNLLFNEAMACSAKVIVSAIIEGCG-DVFDGVG  192

Query  633   SLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAI  812
              LVDVGGG G+ +  +VK  P +KGINFDLPHVV  +P+Y+ V HV G+MF  +P A   
Sbjct  193   CLVDVGGGNGSTLNILVKVCPWMKGINFDLPHVVCASPQYENVEHVAGNMFDFVPHADVA  252

Query  813   FIKWVLHDWGDEECVKILKNCREALPEKTGKL--IIVDAVLKPEGDPI---FGDISYVTD  977
             F+KW+LHDW DEEC+KILK C+EA+P+  GK+  I    +   +G+ +     D+  + D
Sbjct  253   FLKWILHDWEDEECIKILKKCKEAIPKSGGKVIIIEAIIIEAEKGEKMKKKLSDVGLMFD  312

Query  978   LLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             L+M+AH++ G+ERT EEW  L+ +AGF  + I    A+ S+I+ +
Sbjct  313   LVMMAHTNKGRERTAEEWAFLIHQAGFTRHTITPLQAIQSLIQCF  357



>ref|XP_004144872.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004152955.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 ref|XP_004170290.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43291.1| hypothetical protein Csa_7G018730 [Cucumis sativus]
Length=357

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 217/344 (63%), Gaps = 13/344 (4%)
 Frame = +3

Query  96    QVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRIL  275
             Q+W+Y+  F +  A+K  VDL+I DII S+ +  P+TLSQ+++ ++ S S     L RIL
Sbjct  21    QMWRYIFRFTEMAAIKCVVDLKIADIIESYGS--PVTLSQLSSTLNCSSS----LLHRIL  74

Query  276   RLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFSR  455
             R L+ R IF       +    Y  TP SR L  + E SMAP+LL +T P+ +AP+   S 
Sbjct  75    RFLIHRGIFKQET-IDENQIGYSQTPMSRLLATNVENSMAPLLLLETSPVMLAPWQHLSG  133

Query  456   CVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVG  632
              +K      FE AHGK ++  A  + E N  FN+ M    ++I  AI+ G G D F  V 
Sbjct  134   HLKNSDTLPFEIAHGKDLWRYAEANHEHNLLFNEAMACGAKMIVSAIIEGCG-DVFDGVR  192

Query  633   SLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAI  812
              LVDVGGG G+ ++ +VKA+P +KGINFDLPHVV  +P+Y+ V HV G+MF  +P+A   
Sbjct  193   CLVDVGGGNGSTLSILVKAYPWMKGINFDLPHVVCASPQYENVEHVAGNMFDFVPNADVA  252

Query  813   FIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK----PEGDPIFGDISYVTDL  980
             F+KW+LHDW DEEC+KILK C+E++P+  GK+II++A+++     + +    D+  + DL
Sbjct  253   FLKWILHDWDDEECIKILKKCKESIPKSGGKVIIIEAIIEAEKGEKKNKKLSDVGLMFDL  312

Query  981   LMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +M+AH++ GKERT +EW  L+ +AGF  + I    A+ S+I+ +
Sbjct  313   VMMAHTNRGKERTAQEWAFLIHQAGFTTHTITPIQAIQSLIQCF  356



>ref|XP_010041506.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like, partial 
[Eucalyptus grandis]
Length=261

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 188/262 (72%), Gaps = 11/262 (4%)
 Frame = +3

Query  60   SFDE-KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
            S DE ++ L  QA VWK +  + DSM LK AV+LR+PDIIHS+    P+TL+QIA+ I  
Sbjct  3    SLDETEATLRGQAHVWKLLYAYADSMVLKCAVELRLPDIIHSYGDG-PVTLAQIASRI-P  60

Query  237  SPSPDTATLSRILRLLVRRKIFTSAVRPSDGA-----TVYGPTPASRWLVRD--AELSMA  395
            S S  TA L+RI+RLLVR+ IF++     DG+     T+Y  TP+SRWL++   +ELS+A
Sbjct  61   SSSHGTAYLARIMRLLVRKNIFSANHCLPDGSHESHETLYSLTPSSRWLLQGCGSELSLA  120

Query  396  PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
            PM+L + HP  M+ +HC    V+ GG AFE AHG+ +++ A+ +PEFN+ FNDGM S ++
Sbjct  121  PMVLMENHPWLMSSWHCLGDSVRTGGIAFEMAHGRKVWDFASENPEFNRLFNDGMASTSR  180

Query  576  IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
            I+ + IV  Y  DGF S+GSLVDVGGG G A+ EI+K++PHI+G NFDLPHV+ATAP + 
Sbjct  181  ILVRGIVEAYK-DGFESIGSLVDVGGGIGGALTEIIKSYPHIQGTNFDLPHVIATAPAHN  239

Query  756  GVSHVGGDMFVSIPSAQAIFIK  821
             ++HVGGDMF +IP A A+F+K
Sbjct  240  RITHVGGDMFETIPHADAVFMK  261



>gb|AGK93044.1| OMT3 protein [Vitis vinifera]
Length=347

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 221/343 (64%), Gaps = 13/343 (4%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F++   +K A++L I D+I SH+   PITLS +++++  S     + L RI+R
Sbjct  12    MWKYIFGFVEMAVVKCAIELGIADVIESHSG--PITLSSLSSSLGCS----PSGLYRIMR  65

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-R  455
              LV R++F   V  S G T Y  TP SR L+  +E  MA +LL ++ P+ +AP+H  S R
Sbjct  66    FLVNRRLFKE-VATSQGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVMLAPWHGLSAR  124

Query  456   CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGS  635
              + +G   F+ AHG+ ++  AA  P  +K  ND M    ++   AIV+G   + F  V +
Sbjct  125   LLGKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDARMAVSAIVNGCP-EVFDGVST  183

Query  636   LvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIF  815
             LVDVGGG G A+  ++KA P I+GINFDLPHVV++AP+  GV +  GDMF ++P A A F
Sbjct  184   LVDVGGGDGTALRTLIKARPLIRGINFDLPHVVSSAPKCNGVEYASGDMFDTVPKADAAF  243

Query  816   IKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEGD-PIFGDISYVTDLL  983
             + WVLHDWGDEEC++IL+ CR+A+P   GK+IIV+AV++    EGD     D+  + D++
Sbjct  244   LMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIVEAVIQENEKEGDHNNLKDVGLMLDMV  303

Query  984   MLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             M+AH++ GKERT +EW  +L +AGF  Y +    AV S+IEAY
Sbjct  304   MMAHTTTGKERTLKEWDYVLKKAGFNRYTVKPIRAVKSVIEAY  346



>gb|AGN70875.1| O-methyltransferase OMT3 [Vitis vinifera]
Length=354

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 220/343 (64%), Gaps = 13/343 (4%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F++   +K  ++L I D+I SHA   PITLS +++++  S     + L RI+R
Sbjct  19    MWKYIFGFVEMAVVKCGIELGIADVIESHAG--PITLSSLSSSLGCS----PSGLYRIMR  72

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-R  455
              LV R+IF   V  S G T Y  TP SR L+  +E  MA +LL ++ P+ +AP+H  S R
Sbjct  73    FLVNRRIFKE-VATSQGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVMLAPWHGLSAR  131

Query  456   CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGS  635
              + +G   F+ AHG+ ++  AA  P  +K  ND M    ++   AIV+G   + F  V +
Sbjct  132   LLGKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDARMAVSAIVNGCP-EVFDGVST  190

Query  636   LvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIF  815
             LVDVGGG G A+  ++KA P I+GINFDLPHVV++AP+  GV +  GDMF ++P A A F
Sbjct  191   LVDVGGGDGTALRTLIKARPLIRGINFDLPHVVSSAPKCNGVEYASGDMFDTVPKADAAF  250

Query  816   IKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEGD-PIFGDISYVTDLL  983
             + WVLHDWGDEEC++IL+ CR+A+P   GK+IIV+AV++    EGD     D+  + D++
Sbjct  251   LMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIVEAVIQENEKEGDHNNLKDVGLMLDMV  310

Query  984   MLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             M+AH++ GKERT +EW  +L +AGF  Y +    AV S+IEAY
Sbjct  311   MMAHTTTGKERTLKEWDYVLKKAGFNRYTMKPIRAVKSVIEAY  353



>gb|KCW47961.1| hypothetical protein EUGRSUZ_K01694 [Eucalyptus grandis]
Length=215

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 161/210 (77%), Gaps = 1/210 (0%)
 Frame = +3

Query  429   MAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYG  608
             M+ +HC    V+ GG AFE AHG+ +++ A+ +PEFN+ FNDGM S ++I+ + IV  Y 
Sbjct  1     MSSWHCLGDSVRTGGIAFEMAHGRKVWDFASENPEFNRLFNDGMASTSRILVRGIVEAYK  60

Query  609   GDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFV  788
              DGF S+GSLVDVGGG G A+ EI+K++PHI+G NFDLPHV+ATAP +  ++HVGGDMF 
Sbjct  61    -DGFESIGSLVDVGGGIGGALTEIIKSYPHIQGTNFDLPHVIATAPAHNRITHVGGDMFE  119

Query  789   SIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISY  968
             +IP A A+F+K ++HDWGDE+C+KILKNCR+A+ EK GK+II D VLKP+GD +F +   
Sbjct  120   TIPHADAVFMKGIMHDWGDEDCIKILKNCRKAILEKKGKVIISDIVLKPKGDGMFDETGL  179

Query  969   VTDLLMLAHSSGGKERTEEEWKRLLMEAGF  1058
             V DL+M+ H SGGKER E EWK++L E G 
Sbjct  180   VMDLVMMTHCSGGKERDELEWKKILEEGGL  209



>ref|XP_007201642.1| hypothetical protein PRUPE_ppa021776mg [Prunus persica]
 gb|EMJ02841.1| hypothetical protein PRUPE_ppa021776mg [Prunus persica]
Length=357

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/342 (41%), Positives = 213/342 (62%), Gaps = 11/342 (3%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F++   +K A+ L I D I SH +  P+TL ++++A+   PSP    L RI+R
Sbjct  22    IWKYVFGFVEIAVVKCAIQLGIADAIESHGS--PMTLLELSSALRCDPSP----LYRIMR  75

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-R  455
             +LV  KIF        G  VY  TP S+WL++  + SMA ++L ++ P+ +AP+H  S R
Sbjct  76    VLVHLKIFKEKPATQLGPKVYAQTPLSKWLLKSGKNSMAALILLESSPVMLAPWHGLSAR  135

Query  456   CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGS  635
                    AFE  HG+ ++  AA +P  +K  N+ M    ++   A++     + F+ + +
Sbjct  136   IQGVNNSAFEAVHGEDVWSYAAANPNHSKLINEAMACDARVAVPAVLESCL-EVFKGLET  194

Query  636   LvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIF  815
             +VDVGGG G  +  +V+A P I+GINFDLPHVV+ A E   + +VGGDMF  +P A A  
Sbjct  195   IVDVGGGDGTTLRLLVEACPWIRGINFDLPHVVSVAQECDRIENVGGDMFDCVPKADAAI  254

Query  816   IKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEG---DPIFGDISYVTDLLM  986
             I WVLHDWGD+EC++ILK CREA+PE  G++IIV+AV++ +    D    ++  + D++M
Sbjct  255   IMWVLHDWGDDECIRILKKCREAVPEDKGQVIIVEAVIEEDNEKQDKKLTNVRLMLDMVM  314

Query  987   LAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +AH++ GKERT +EW  +L EAGF  + I    AV S+I+A+
Sbjct  315   MAHTNTGKERTMKEWGYVLGEAGFSRHTITPIHAVQSVIQAF  356



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score =   252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 150/351 (43%), Positives = 216/351 (62%), Gaps = 11/351 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             +L +QAQV  ++ +F++SMALK A+DL IPD+IHSH   QP+ LSQ+  A+   PS    
Sbjct  12    LLQAQAQVVNHVFNFMNSMALKCAIDLAIPDVIHSHG--QPMLLSQLVTALSVQPS-KAP  68

Query  258   TLSRILRLLVRRKIFTS--AVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L R++RLLV    F+    +  ++    Y  T ASR+L++D  L+  P+ L   +P+  
Sbjct  69    CLHRLMRLLVHSGFFSQQQVIHNNEQEEGYSLTSASRFLLKDEPLTGLPLSLLHLNPVLT  128

Query  432   APFHCFSRCVKEGG-FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYG  608
             AP+H  S   + G    F  AHGK  ++  A +P+FN  FN+ M S ++II+  +++   
Sbjct  129   APWHFLSGWFRNGDPTPFYTAHGKPYWDYTAQEPDFNDLFNEAMASDSRIIASVLITKCK  188

Query  609   GDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFV  788
              + F+ + SLVDVG GTG     I KAFPH+K I FD PHVVA       +  VGGDMF 
Sbjct  189   -EQFKGLFSLVDVGAGTGTMTKAIAKAFPHLKCIVFDQPHVVADLQGGGNLEVVGGDMFE  247

Query  789   SIPSAQAIFIKWVLHDWGDEECVKILKNCREALP--EKTGKLIIVDAVLK-PEGDPIFGD  959
             +IPSA A+ +KW+LH+W DEECVKILK C+EA+P  +K GKL+I+D V++  +GD    +
Sbjct  248   TIPSANAVILKWILHNWSDEECVKILKKCKEAIPTKDKGGKLMIIDMVMENNKGDDQAVE  307

Query  960   ISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                  D+LM+   + GK+R E EWK+L + AGF +Y I   +   S+IE Y
Sbjct  308   TQLFWDMLMMTVLT-GKQRNENEWKKLFVTAGFTHYKISAVLGFRSLIEVY  357



>ref|XP_010526877.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X1 [Tarenaya hassleriana]
Length=354

 Score =   252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 221/358 (62%), Gaps = 18/358 (5%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
             E+    +   +W+Y+  F D   +K A++L+IP+ + SH + QP+TL++++ A+  SP  
Sbjct  2     EEEEARASVDIWRYVFGFTDMAVVKCAIELKIPEAVESHPS-QPVTLAELSTAVACSPP-  59

Query  249   DTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELSMAPMLLFQTH  419
                 L RI+R L  + IF   +        Y  TP SR ++   RD + S AP++L ++ 
Sbjct  60    ---LLGRIMRFLSHQGIFKEVITKDGLVGGYLNTPLSRLMMSSNRD-DKSKAPLILMESS  115

Query  420   PLSMAPFHCFSRCV-----KEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIIS  584
             P+ +AP+   S  V     +EG   FE  HGK ++   A DP  ++ FN+ M   T+ + 
Sbjct  116   PVMLAPWLKLSAVVSNAATEEGSQPFEVVHGKDVWAYCAEDPRHSEMFNEAMACDTRRLV  175

Query  585   KAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVS  764
               +++G   D F  V ++VDVGGG G A+  +VKAFP IKG NFDLPHVV TA ++ GV 
Sbjct  176   -PVIAGACSDVFEGVSTVVDVGGGKGDALGVLVKAFPWIKGFNFDLPHVVETALKFDGVE  234

Query  765   HVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPE  938
             +VGGDMF  +P+A A+FIKWVLHDW DE C+K+L+ CREA+P K GK++IVDAV+  K +
Sbjct  235   NVGGDMFERVPNADAVFIKWVLHDWNDEVCIKLLEKCREAIPRKGGKVVIVDAVVGEKKK  294

Query  939   GDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             GD +      + D++M+AH++ G+ERT EEW  ++ EAGF  Y +     ++S+I AY
Sbjct  295   GDRL-EYARLMLDMVMMAHTTRGRERTLEEWDHVITEAGFARYEVRDIDDISSVIIAY  351



>ref|XP_002312934.1| hypothetical protein POPTR_0009s14160g [Populus trichocarpa]
 gb|EEE86889.1| hypothetical protein POPTR_0009s14160g [Populus trichocarpa]
Length=354

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 150/355 (42%), Positives = 216/355 (61%), Gaps = 10/355 (3%)
 Frame = +3

Query  54    DGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIH  233
             D    E+  + +  ++WKY+L F     +K A++L I + I +H    P+ LS++++ + 
Sbjct  7     DSKMKEEEDVQAGVEIWKYVLGFSGIAVVKCAIELGIAEAIENHEGT-PMALSELSSTLG  65

Query  234   DSPSPDTATLSRILRLLVRRKIFTSAVRPS-DGATVYGPTPASRWLVRDAELSMAPMLLF  410
               P     +L RI+R LV    F     P+  G   Y  TP SR L+R  E SMA  +L 
Sbjct  66    CVP----FSLDRIMRFLVHHHFFKE--EPTIQGTAGYVHTPLSRRLLRQGEDSMADFILL  119

Query  411   QTHPLSMAPFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
             ++ P+ +AP+H  S  V+  G  AFE A+G  I++ AA +P FN+  ND M    ++   
Sbjct  120   ESSPVMLAPWHHLSSRVRINGTAAFEAAYGGDIWKYAAANPAFNRLINDAMACDARLAVS  179

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
             AI+       F  + +LVDVGGG G A+ + VKAFP I+GINFDLPHVV+ A E +GV  
Sbjct  180   AIIESCP-KLFDGLKTLVDVGGGNGTALGKFVKAFPWIEGINFDLPHVVSVAAECEGVKQ  238

Query  768   VGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDP  947
             VGGDMF S+P A A+FI  VL DW +++CV+ILK C+EA+P+  GK+IIV+ V+  E   
Sbjct  239   VGGDMFDSVPKADAVFIMKVLQDWNNDDCVRILKKCKEAIPKDKGKVIIVETVIGEEKQD  298

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              F  + ++ D+ M+A ++ GKERT EEW  +L EAGF +YNII   AV S+IEA+
Sbjct  299   SFEFVRFMKDMAMMAFTNSGKERTSEEWDCVLKEAGFSSYNIIPIRAVQSVIEAF  353



>ref|XP_008236084.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Prunus 
mume]
Length=389

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 145/349 (42%), Positives = 221/349 (63%), Gaps = 11/349 (3%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
             H++  V KY+  F++   +K A++L I D I SH +  P+TL ++++A+    S D ++L
Sbjct  47    HAKVDVLKYVFGFVEIAVVKCAIELGIADTIESHGS--PMTLLELSSAL----SCDPSSL  100

Query  264   SRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
              RI+R+LV  KIF        G  V+  TP S+WL++  E SMA ++L ++ P+ +AP+H
Sbjct  101   YRIMRVLVHLKIFKEKPSTQLGPKVFVQTPLSKWLLKSGENSMAALILLESSPVMLAPWH  160

Query  444   CFS-RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
               S R       AFE  HG+ I+  AA +P+ +K  N+ M    ++   A++     + F
Sbjct  161   GLSARIQGISNPAFEAVHGEDIWSYAAANPDHSKLINEAMACDARVAVPAVIESCL-EVF  219

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
             + + ++VDVGGG G  +   V+A P I+GINFDLPHVV+ A E   + +VGGDMF S+P 
Sbjct  220   KGIETIVDVGGGDGTTLRLWVEACPWIQGINFDLPHVVSVAQECDRIKNVGGDMFDSVPK  279

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPI-FGDISYV  971
             A A+ +KWVLHDWGD+EC++ILK CREA+ E  GK+IIV+AV+  K E + I   ++  +
Sbjct  280   ADAVIMKWVLHDWGDDECIRILKKCREAILENKGKVIIVEAVIDEKDEKEDIKLTNVRLM  339

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              D++M+AH++ GKERT +EW  +L EAGF  + I    AV S+I+A+ Q
Sbjct  340   LDMVMMAHTNTGKERTLKEWGYVLREAGFSRHTITPIHAVQSVIQAFPQ  388



>gb|KDO38340.1| hypothetical protein CISIN_1g042491mg [Citrus sinensis]
Length=266

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 192/265 (72%), Gaps = 10/265 (4%)
 Frame = +3

Query  51   MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
            M+ +   + +L  QAQVW+ M  F DSMALK+AV+LR+ DI+H H +  PITL Q+A+ I
Sbjct  1    MESADVREDVLRGQAQVWQLMFAFADSMALKSAVELRLADIMHCHGS--PITLPQLASGI  58

Query  231  HDSPSPDT---ATLSRILRLLVRRKIFTSAVRPSDGA--TVYGPTPASRWLVRDAELSMA  395
             +S  PD     +L+RI+R+LVR+ +F +A R SDG+  T+YG T  S+WL+RD+E+S+A
Sbjct  59   -NSSCPDVHIIPSLTRIMRMLVRKGVF-AAHRSSDGSEETMYGLTQISKWLLRDSEMSLA  116

Query  396  PMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQ  575
            PM+LFQ   L  AP H  S+CV+EGG AF+KAHG  +++ A+ + +FN SFN  M    +
Sbjct  117  PMILFQNSQLLQAPCHHLSQCVEEGGHAFKKAHGCEMWDFASQNSQFNNSFNKAMACTAK  176

Query  576  IISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ  755
            I+   ++S Y  DGF  + SLVDVGGGTG  +AEIV+ +PHIKG+NFDLPHVVATAP Y+
Sbjct  177  IVMSTLLSHY-KDGFDGIRSLVDVGGGTGEELAEIVEFYPHIKGVNFDLPHVVATAPVYE  235

Query  756  GVSHVGGDMFVSIPSAQAIFIKWVL  830
            GVSHVGGDM  ++P+A A+F+K ++
Sbjct  236  GVSHVGGDMLNAVPNADAVFMKVIV  260



>ref|XP_008236085.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Prunus 
mume]
Length=357

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 140/342 (41%), Positives = 212/342 (62%), Gaps = 11/342 (3%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F +   +K A++L I D I SH +  P+TL ++++A+   PSP    L RI+R
Sbjct  22    IWKYVFGFAEIAVVKCAIELGIADAIESHGS--PMTLLELSSALRCDPSP----LYRIMR  75

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-R  455
             +LV  KIF        G  VY  TP S+ L++  + SMA  +L +  P+ +APFH  S R
Sbjct  76    VLVHLKIFKEKPTTQLGPEVYAQTPLSKRLLKSGQNSMAAFILLENSPVMLAPFHGLSAR  135

Query  456   CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGS  635
                    AFE  HG+ ++  AA +P+ +K FN+ M    ++   A++     + F+ + +
Sbjct  136   IQGISNPAFEAVHGEDVWSYAAANPDHSKLFNEAMACDARVTVPAVIESCS-EVFKGIET  194

Query  636   LvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIF  815
             +VDVGGG G  +  +++A P I+GINFDLPHVV+ A E   + +VGGDMF  +P   A+ 
Sbjct  195   IVDVGGGDGTTLRLLIEACPWIRGINFDLPHVVSLAQECDRIENVGGDMFEFVPKVDAVI  254

Query  816   IKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEG---DPIFGDISYVTDLLM  986
             +KWVLHDWGD+EC++ILK CREA+PE  GK+II++AV+  +    D    ++  + D++M
Sbjct  255   MKWVLHDWGDDECIRILKKCREAIPEDKGKVIIIEAVIDEKDEKEDSKLTNVRLMLDMVM  314

Query  987   LAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +AH+S GKERT +EW  +L EAGF  + I    AV S+I+A+
Sbjct  315   MAHNSTGKERTLKEWGYVLGEAGFSRHTITPIHAVQSVIQAF  356



>gb|AGK93042.1| OMT3 protein [Vitis vinifera]
Length=347

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 221/343 (64%), Gaps = 13/343 (4%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F++   +K A++L I D++ SH+   PITLS +++++  S     + L RI+R
Sbjct  12    MWKYIFGFVEMAVVKCAIELGIADVMESHSG--PITLSSLSSSLGCS----PSGLYRIMR  65

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-R  455
              LV R++F   V  S G T Y  TP SR L+  +E  MA +LL ++ P+ +AP+H  S R
Sbjct  66    FLVNRRLFKE-VATSQGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVMLAPWHGLSAR  124

Query  456   CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGS  635
              + +G   F+ AHG+ ++  AA  P  +K  ND M    ++   AIV+G   + F  V +
Sbjct  125   LLGKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDARMAVSAIVNGCP-EVFDGVST  183

Query  636   LvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIF  815
             LVDVGGG G A+  ++KA P I+GINFDLPHVV++AP+  GV +  GDMF ++P A A F
Sbjct  184   LVDVGGGDGTALRTLIKARPLIRGINFDLPHVVSSAPKCNGVEYASGDMFDTVPKADAAF  243

Query  816   IKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEGD-PIFGDISYVTDLL  983
             + WVLHDWGDEEC++IL+ CR+A+P   GK+IIV+AV++    EGD     D+  + D++
Sbjct  244   LMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIVEAVIQENEKEGDHNNLKDVGLMLDMV  303

Query  984   MLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             M+AH++ GKERT +EW  +L +AGF  Y +    AV S+IEAY
Sbjct  304   MMAHTTTGKERTLKEWDYVLKKAGFNRYTMKPIRAVKSVIEAY  346



>dbj|BAM37634.1| O-methyltransferase [Eschscholzia californica]
Length=351

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/342 (42%), Positives = 219/342 (64%), Gaps = 5/342 (1%)
 Frame = +3

Query  87    SQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLS  266
             +QA++WK++  F +S+ LK+AV+L I D IH+H   +P+TLS++A+ +   P  D   L 
Sbjct  13    TQAKIWKHIYGFAESLILKSAVELEIADTIHNHG--KPMTLSELASKLPVQPV-DLDRLY  69

Query  267   RILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHC  446
             R++R LV  K+F       + +  Y   P +++L++  E SM   +L       M+P+H 
Sbjct  70    RVMRYLVHMKLFKKQEDEDEESIKYSLLPPAKFLIKGWEKSMVSAILLINDKDFMSPWHH  129

Query  447   FSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRS  626
                 +     AF+KA GK I++  + +P+ NK FN+GM   ++++S A+V+   G+ F+ 
Sbjct  130   LKEGLVNNSNAFDKALGKSIWDYMSANPDKNKVFNEGMACDSRLVSSALVNE-CGNIFQG  188

Query  627   VGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQ  806
             + +LVDVGGGTG AV  + KAFPHIK   +DLPHV++ +P+   +  + G+MF SIPSA 
Sbjct  189   IQTLVDVGGGTGTAVKAVSKAFPHIKCSIYDLPHVISDSPDIPNIVKIEGEMFKSIPSAD  248

Query  807   AIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLM  986
             AI +K +LHDW D+EC++ILK C+EA+P++ GK+IIVD VL  E    +  +    DL M
Sbjct  249   AILMKCILHDWNDDECIEILKKCKEAVPKEGGKVIIVDIVLDMESKHPYSKVRLTLDLDM  308

Query  987   LAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             + ++  GKERTEEEWK+L+  AGF +Y I Q  A+ S+IEA+
Sbjct  309   MLNTE-GKERTEEEWKKLIDGAGFASYKITQISALQSVIEAF  349



>gb|AGN70871.1| O-methyltransferase OMT3 [Vitis vinifera]
 gb|AGN70872.1| O-methyltransferase OMT3 [Vitis vinifera]
Length=354

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 221/343 (64%), Gaps = 13/343 (4%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F++   +K A++L I D++ SH+   PITLS +++++  S     + L RI+R
Sbjct  19    MWKYIFGFVEMAVVKCAIELGIADVMESHSG--PITLSSLSSSLGCS----PSGLYRIMR  72

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-R  455
              LV R++F   V  S G T Y  TP SR L+  +E  MA +LL ++ P+ +AP+H  S R
Sbjct  73    FLVNRRLFKE-VATSQGDTGYQQTPLSRRLMTRSENGMAALLLLESSPVMLAPWHGLSAR  131

Query  456   CVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGS  635
              + +G   F+ AHG+ ++  AA  P  +K  ND M    ++   AIV+G   + F  V +
Sbjct  132   LLGKGNATFDAAHGQDVWGYAASHPAHSKLINDAMACDARMAVSAIVNGCP-EVFDGVST  190

Query  636   LvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIF  815
             LVDVGGG G A+  ++KA P I+GINFDLPHVV++AP+  GV +  GDMF ++P A A F
Sbjct  191   LVDVGGGDGTALRTLIKARPLIRGINFDLPHVVSSAPKCNGVEYASGDMFDTVPKADAAF  250

Query  816   IKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEGD-PIFGDISYVTDLL  983
             + WVLHDWGDEEC++IL+ CR+A+P   GK+IIV+AV++    EGD     D+  + D++
Sbjct  251   LMWVLHDWGDEECIQILEKCRQAIPGDKGKVIIVEAVIQENEKEGDHNNLKDVGLMLDMV  310

Query  984   MLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             M+AH++ GKERT +EW  +L +AGF  Y +    AV S+IEAY
Sbjct  311   MMAHTTTGKERTLKEWDYVLKKAGFNRYTMKPIRAVKSVIEAY  353



>emb|CBI37808.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 160/380 (42%), Positives = 223/380 (59%), Gaps = 50/380 (13%)
 Frame = +3

Query  96    QVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRIL  275
             ++WKY+  F +  A+K  ++L I D++ SH    PITLS +++++   PS     L+RI+
Sbjct  29    EMWKYIYGFAEMAAVKCGIELGIADVMESHGG--PITLSALSSSLGCPPS----GLNRIM  82

Query  276   RLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-  452
             R LV R+IF   V  S G T Y  TP SR L+      MA  +L ++ P+ +AP+H  S 
Sbjct  83    RFLVSRRIFKE-VATSQGDTGYQQTPMSRCLMTSGGDGMAAFVLLESSPVMLAPWHGLSA  141

Query  453   RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVG  632
             R + +G   FE AHG  I+  AA +P+ +K  ND M S  + +  A+V+    + F  V 
Sbjct  142   RVLGKGNSTFEAAHGDDIWGYAAKNPDHSKLINDAMASNARRVVPAMVNDCP-EVFDGVS  200

Query  633   SLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAI  812
             +LVDVGGG G A+  +VKA P I+GINFDLPHVVATAP+   V HVGG+MF S+P A A+
Sbjct  201   TLVDVGGGNGTALRTLVKACPWIRGINFDLPHVVATAPKCNDVEHVGGNMFDSVPKADAV  260

Query  813   FIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL---------------------  929
             FI  VLHDWGDE+C+KIL+ CREA+PE  GK++IV+A +                     
Sbjct  261   FIMKVLHDWGDEKCIKILEKCREAIPEDKGKVVIVEAKVLHDWGDEKCIKILEKCREAIP  320

Query  930   ----------------KPEG-DPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGF  1058
                              P+G D    D+  + D++M+AH++ GKERT +EW  +L+ AGF
Sbjct  321   EDKGKVVIVEAVIEDGDPQGDDQKLKDVKLMVDMVMMAHTTTGKERTFKEWDYVLLNAGF  380

Query  1059  PNYNI--IQNIAVASIIEAY  1112
               Y I  I+NI V SIIEAY
Sbjct  381   SRYTIKPIRNI-VQSIIEAY  399



>ref|XP_007200810.1| hypothetical protein PRUPE_ppa025618mg [Prunus persica]
 gb|EMJ02009.1| hypothetical protein PRUPE_ppa025618mg [Prunus persica]
Length=358

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/348 (41%), Positives = 218/348 (63%), Gaps = 12/348 (3%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
             H++ Q+WKY+  F +   +K A+ L I D I SH +  P+TL ++++A+   PSP    L
Sbjct  17    HAKVQIWKYVFGFAEIAVVKCAIQLGIADAIESHGS--PMTLLELSSALRCDPSP----L  70

Query  264   SRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
              RI+R+LV  KIF        G  VY  TP S+ L++  + SMA ++L ++ P+ +AP+H
Sbjct  71    YRIMRVLVHLKIFKEKPATQLGPEVYTQTPLSKRLLKSGQNSMAALILLESSPVMLAPWH  130

Query  444   CFSRCVKEG--GFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDG  617
               S  ++       FE+ HG+ ++   A +P+ NK FN+ M    ++   A++     + 
Sbjct  131   GLSARIQGNIRNPVFEEVHGEDLWSFGAANPDHNKLFNEAMACDARVHVPAVIESRL-EV  189

Query  618   FRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIP  797
             F+ + ++VDVGGG G+ +  +V+A P I+GINFDLPHVV+ A E   + +VGGDMF  +P
Sbjct  190   FKGIETIVDVGGGDGSTMRLLVEACPWIQGINFDLPHVVSVAQECDRIENVGGDMFDCVP  249

Query  798   SAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL---KPEGDPIFGDISY  968
              A A+ IK VLHDWGD+EC++ILK CREA+PE  GK+IIV+AV+     + D    ++  
Sbjct  250   KADAVIIKGVLHDWGDDECIRILKKCREAIPEDKGKVIIVEAVIDEKDEKADIKLTNVRL  309

Query  969   VTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             + D++M+AH++ GKERT +EW  +L EAGF  + I    AV S+I+A+
Sbjct  310   MLDMVMMAHTNTGKERTLKEWGYVLGEAGFSRHTITPIHAVPSVIQAF  357



>ref|XP_008236091.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X3 [Prunus mume]
 ref|XP_008236092.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X4 [Prunus mume]
Length=357

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 140/347 (40%), Positives = 216/347 (62%), Gaps = 11/347 (3%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
             H++ ++WKY+  FI+   +K A++L I D I SH +  P+TL ++++A+   PSP    L
Sbjct  17    HAKLEIWKYVYGFIEIAVVKCAIELGIADAIESHGS--PMTLLELSSALRCDPSP----L  70

Query  264   SRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
              RI+R+LV  KIF        G  VY  TP S+ L++  E SMA ++L ++ P+ +A +H
Sbjct  71    YRIMRVLVHLKIFKEKPTTQLGPKVYAQTPLSKLLLKSGENSMAALILLESSPVMLATWH  130

Query  444   CFS-RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
               S R       AFE  HG+ ++  AA +P+ +K FN+ M    ++   A++     + F
Sbjct  131   GLSARIQGITNSAFESVHGEDVWSHAAANPDHSKLFNEAMACDARVAVPAVIESCL-EVF  189

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
             + + ++VDVGGG G  +  +V+A P I+GINFDLPHVV+ A E   + +VGGDMF  +P 
Sbjct  190   KGIETIVDVGGGDGTTLRLLVEACPWIQGINFDLPHVVSVAQECDRIENVGGDMFDCVPK  249

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK---PEGDPIFGDISYV  971
             A A+ +KWVLHDWGD+EC++ILK CREA+PE   K+II++AV+     + D    ++  +
Sbjct  250   ADAVIMKWVLHDWGDDECIRILKKCREAIPEDKRKVIIIEAVIDEKYEKEDSKLTNVRLM  309

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              D++M+AH+S   ERT +EW  +L EAGF  + I    AV S+I+A+
Sbjct  310   LDMVMMAHNSTENERTLKEWGYVLGEAGFSRHTITLIHAVQSVIQAF  356



>ref|XP_004251689.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Solanum lycopersicum]
Length=369

 Score =   249 bits (637),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 145/354 (41%), Positives = 212/354 (60%), Gaps = 20/354 (6%)
 Frame = +3

Query  87    SQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLS  266
             +QA +WK++  F +   +K A++L I D +  +   +PI+L+Q++ A+       + +L 
Sbjct  22    AQANMWKFVFGFTEMAVIKCAIELGIADFLEKNQ--EPISLNQLSIAL----GCCSTSLY  75

Query  267   RILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHC  446
             RILR L+ R IF      S G   Y  TP SR L+++ E SMA  LLF++ P+ +AP+H 
Sbjct  76    RILRFLINRGIFKETSTKS-GKNGYVQTPLSRLLIKEGENSMAAFLLFESSPVMLAPWHN  134

Query  447   FSRCVKEGGFA---FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDG  617
              S  +     +   F+ AHGK I++ A  D   +   N+ M    ++   AI+ G   + 
Sbjct  135   LSARISSKDNSTPSFDAAHGKDIWKYAEADSGLSNLLNNAMACDAKVAVSAIIDGCP-EI  193

Query  618   FRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIP  797
             F  V ++VDVGGG G  +  +V+AFP I GIN DLPHV + AP   GV H GGDMF  +P
Sbjct  194   FEGVNTMVDVGGGDGTTLRLLVEAFPWINGINLDLPHVASVAPHAIGVVHFGGDMFNYVP  253

Query  798   SAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPIFG-----  956
              A A F+ WVLHDWGDEEC++IL  CREA+P+  GK+II++A++  K E + I G     
Sbjct  254   KADAAFLMWVLHDWGDEECIQILTKCREAIPKDKGKVIILEAIIGEKEENNIIRGSNNEK  313

Query  957   --DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
               D+  + D++M+AH+S GKERT +EW  +L EAGF  + I    AV S+I+AY
Sbjct  314   LKDVGLMLDMVMMAHTSNGKERTSKEWAYVLNEAGFGRHTISHINAVQSVIQAY  367



>ref|XP_008236081.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Prunus 
mume]
Length=357

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/347 (40%), Positives = 215/347 (62%), Gaps = 11/347 (3%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
             H++ ++WKY+  F++   +K +++L I D I SH +  P+TL ++++A+   PSP    L
Sbjct  17    HAKVEIWKYVFGFVEIAVVKCSIELGIADAIESHGS--PMTLLELSSALRCDPSP----L  70

Query  264   SRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
              RI+R+LV  KIF        G  VY  TP S+ L++  + SMA  +L ++ P+ +AP+H
Sbjct  71    YRIMRVLVHLKIFKEKPATQLGPKVYAQTPLSKRLLKSGKNSMAAFILLESSPVMLAPWH  130

Query  444   CFS-RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
               S R       +FE  HG+ ++  AA +P  +K  N+ M    ++   A++     + F
Sbjct  131   GLSARIQGVSNPSFEAVHGEDVWSYAAANPNHSKLINEAMACDARVAVPAVLESCL-EVF  189

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
             + + ++VDVGGG G  +  +V+  P I+G+NFDLPHVV+ A E   + +VGGDMF  +P 
Sbjct  190   KGLETIVDVGGGDGTTLRLLVEECPWIRGVNFDLPHVVSVAQECDRIENVGGDMFDCVPK  249

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEG---DPIFGDISYV  971
             A A  I WVLHDWGD+EC++ILK CREA+PE  GK+IIV+AV++ +    D    D+  +
Sbjct  250   ADAAIIMWVLHDWGDDECIRILKKCREAIPEDKGKVIIVEAVIEEDNEKQDKKLTDVRLM  309

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              D++M+AH++ GKERT +EW  +L EAGF  + I    AV S+I+A+
Sbjct  310   LDMVMMAHTNTGKERTLKEWGYVLGEAGFSRHTITPIHAVQSVIQAF  356



>gb|ACJ84935.1| unknown [Medicago truncatula]
Length=201

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 155/200 (78%), Gaps = 1/200 (1%)
 Frame = +3

Query  513   MAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAF  692
             M   D ++N  FN GM    +I+S+A+++GY  DGF  + SLVDVGGG G +++EIV+A+
Sbjct  1     MTGLDSKYNDLFNQGMVCTARIVSRAVIAGYK-DGFNQIKSLVDVGGGIGGSLSEIVRAY  59

Query  693   PHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKN  872
             PHI+ INFDLPHVV+TAP + G++HVGGDMFVS+PSA AI++KW+LHDW D+ C+KILKN
Sbjct  60    PHIQAINFDLPHVVSTAPNFDGITHVGGDMFVSVPSADAIYMKWILHDWSDDHCIKILKN  119

Query  873   CREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEA  1052
             CR+A+PEKTGK+IIVD VL PEG+  F D     D+++LAH++GGKERTEE WK L  E 
Sbjct  120   CRKAIPEKTGKVIIVDHVLDPEGNEPFTDTGIAFDMMLLAHNAGGKERTEENWKYLFNET  179

Query  1053  GFPNYNIIQNIAVASIIEAY  1112
             GFP YNI +  A+  IIEA+
Sbjct  180   GFPRYNITKINALPCIIEAF  199



>ref|XP_007199647.1| hypothetical protein PRUPE_ppa015631mg, partial [Prunus persica]
 gb|EMJ00846.1| hypothetical protein PRUPE_ppa015631mg, partial [Prunus persica]
Length=351

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 143/354 (40%), Positives = 216/354 (61%), Gaps = 12/354 (3%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             +EK   H++ Q+WKY+  F +   +K A+ L I D I SH    P+TL ++++A+   PS
Sbjct  4     EEKEEEHAKVQIWKYVFGFAEIAVVKCAIQLGIADAIESHGG--PMTLLELSSALRCDPS  61

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
             P      RI+R+LV  KIF +      G  VY  TP S+ L++  + SMA  +L +  P+
Sbjct  62    PPY----RIMRVLVHLKIFKNKPATQLGPKVYAQTPLSKRLLKSGQNSMAAFILLENSPV  117

Query  426   SMAPFHCFSRCVKEG--GFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
              +AP+H  S  +K       FE+ HG+ I+   A +P+ NK FN+ M    +++  A+  
Sbjct  118   MLAPWHVLSTRIKGNIRNSVFEEVHGEDIWSFGAANPDHNKLFNEAMACDARVVVSAMTE  177

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGD  779
                 + F  + ++VDVGGG G  +  +V+A P I+GINFDLPHVV  A E   + +VGGD
Sbjct  178   SCI-EVFEGIETIVDVGGGDGTTLRLLVEACPWIQGINFDLPHVVPVAQECDRIENVGGD  236

Query  780   MFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPI-  950
             MF  +P A A+ IK VL DWGD+EC++ILK CREA+ E  GK+IIV+AV+  K E + I 
Sbjct  237   MFDCVPKADAVIIKSVLQDWGDDECIRILKKCREAIAEDKGKVIIVEAVIDEKDEKEDIK  296

Query  951   FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
               ++  + D++M+A+++ GKERT +EW+ +L EAGF  + I    AV S+I+A+
Sbjct  297   LTNVRLMLDMVMMAYTNTGKERTLKEWEYVLEEAGFSRHTITPIHAVCSVIQAF  350



>ref|XP_006353588.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Solanum 
tuberosum]
Length=366

 Score =   248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 143/353 (41%), Positives = 214/353 (61%), Gaps = 22/353 (6%)
 Frame = +3

Query  87    SQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLS  266
             +QA +WK++  F +   +K A++L I D +  +   +PI+L+Q++ A+    S    +L 
Sbjct  23    AQANMWKFVFGFTEMAVIKCAIELGIADFLEKNQ--EPISLNQLSIALGCCSS----SLY  76

Query  267   RILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHC  446
             RILR L+ R IF    + +   + Y  TP SR L+++ E SMA  LLF++ P+ +A +H 
Sbjct  77    RILRFLINRGIF----KETSTKSGYVQTPLSRLLIKEGENSMAAFLLFESSPVMLASWHN  132

Query  447   FSRCV--KEGGFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDG  617
              S  +  K+   + FE AHGK +++ A  DP+ +   N+ M    +I   AI+     + 
Sbjct  133   LSARISSKDNSLSSFEAAHGKDVWKYAEADPKHSNLLNNAMACDARIAVSAIIDDCP-EI  191

Query  618   FRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIP  797
             F  V ++VDVGGG G  +  +V+AFP I GINFDLPHV + AP   GV HVGGDMF  +P
Sbjct  192   FEGVNTMVDVGGGDGTTLRLLVEAFPWINGINFDLPHVASVAPHAIGVVHVGGDMFNYVP  251

Query  798   SAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPI--------F  953
              A A F+ WVLHDW DEEC++IL  CREA+P+  GK+II++A++  + + I         
Sbjct  252   KADAAFLMWVLHDWSDEECIQILTKCREAIPQDNGKVIILEAIIGGKEESIIRGSNNEKL  311

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              D+  + D++M+AH+S GKERT +EW  +L EAGF  + I    AV S+I+AY
Sbjct  312   KDVGLMLDMVMMAHTSNGKERTSKEWAYVLNEAGFGRHTISHINAVQSVIQAY  364



>gb|KDP24054.1| hypothetical protein JCGZ_26737 [Jatropha curcas]
Length=347

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 149/340 (44%), Positives = 204/340 (60%), Gaps = 11/340 (3%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             VWKYM  F +   +K A++L I + I +H    PITL+ +++ I  +PS     L RI+R
Sbjct  16    VWKYMFGFSNIAVVKCALELGIANAIENHQG--PITLTDLSSTIECNPS----YLHRIMR  69

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFSRC  458
              LV   IF   +  +DG   Y  TP SR L+   E +M  + L +  P+ +AP+H F RC
Sbjct  70    FLVHHNIFKEQL-TADGTKGYIQTPLSRRLLGPGENNMTALFLLENSPVMLAPWH-FLRC  127

Query  459   -VK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVG  632
              V+  G  AFE AHG  I++ AA +P  +   ND +    + +   IV G   + F  V 
Sbjct  128   RVRLNGSAAFEAAHGDDIWKYAAENPGHSNLINDALACNARKMVSGIVEGCV-EVFDGVK  186

Query  633   SLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAI  812
             +LVDVGGG G A+  +VK  P I+GINFDLPHVV  A E  GV HVGGDMF S+P A A 
Sbjct  187   TLVDVGGGNGTALRTLVKLCPWIQGINFDLPHVVDVAEECDGVRHVGGDMFQSVPKADAA  246

Query  813   FIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLA  992
              + WVLHDW D+EC+ ILK C+EA+P + GK+IIV+AV+    D     +    D++M+A
Sbjct  247   LLMWVLHDWNDDECINILKKCKEAIPNEIGKVIIVEAVVDEAKDDKLEFVRLALDMVMMA  306

Query  993   HSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             H+  GKERT EEW+ +L +AGF  + I    AV S+IEA+
Sbjct  307   HTDTGKERTSEEWEYVLKQAGFSRHTIKSIAAVLSVIEAF  346



>ref|XP_011045555.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Populus 
euphratica]
Length=353

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 147/355 (41%), Positives = 214/355 (60%), Gaps = 11/355 (3%)
 Frame = +3

Query  54    DGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIH  233
             D    E+    +  ++WKY+L F     +K A++L I + I +H    P+ LS++++ + 
Sbjct  7     DSKMKEEEDAQAGVEIWKYVLGFSGIAVVKCAIELGIAEAIENHEG--PMALSELSSNLG  64

Query  234   DSPSPDTATLSRILRLLVRRKIFTSAVRPS-DGATVYGPTPASRWLVRDAELSMAPMLLF  410
               P     +L RI+R LV    F     P+  G   Y  TP SR L+R  E SMA  +L 
Sbjct  65    CVP----CSLDRIMRFLVHHHFFKE--EPTIQGTAGYVHTPLSRRLLRQGEDSMADFILL  118

Query  411   QTHPLSMAPFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
             ++ P+ +AP+H  S  V+  G  AFE A+G  I++ AA +P FN+  ND M    ++   
Sbjct  119   ESSPVMLAPWHHLSSRVRINGTAAFEAAYGGDIWKYAAANPAFNRLINDAMACDARLAVS  178

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
             AI+       F  + +LVDVGGG G A+ + VKAFP I+GINFDLPHVV+ A E +GV  
Sbjct  179   AIIESCP-KLFDGLKTLVDVGGGNGTALGKFVKAFPWIEGINFDLPHVVSVAAECEGVKQ  237

Query  768   VGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDP  947
             VGGDMF S+P A A+FI  VL DW +++CV+IL+ C+EA+P+  GK++IV+ V+  E   
Sbjct  238   VGGDMFDSVPKADAVFIMKVLQDWNNDDCVRILRKCKEAIPQDKGKVVIVETVIGEEKQD  297

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              F  + ++ D+ M+A ++ GKERT EEW  +L EAGF +YNI    AV S+IEA+
Sbjct  298   SFEFVRFMKDMAMMAFTNSGKERTSEEWDCVLKEAGFSSYNINPIRAVQSVIEAF  352



>gb|KDP27133.1| hypothetical protein JCGZ_20945 [Jatropha curcas]
Length=347

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 147/338 (43%), Positives = 200/338 (59%), Gaps = 9/338 (3%)
 Frame = +3

Query  102   WKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILRL  281
             WKYM  F +   +K A +L I + I +H    PITL+ +++ I  +PS     L RI+R 
Sbjct  17    WKYMFGFSNIAVVKCAFELGIANAIENHQG--PITLTDLSSTIECNPS----YLHRIMRF  70

Query  282   LVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-RC  458
             LV   IF   +  +DG   Y  TP SR L+   E +MA + L ++ P+ +AP+H  S R 
Sbjct  71    LVHHNIFKEQL-TADGTKGYIQTPLSRRLLGPGENNMAALFLLESSPVMLAPWHFLSCRV  129

Query  459   VKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSL  638
                G  AFE AHG  +++ AA  P  +   ND M    + +   IV G   + F  V +L
Sbjct  130   TLNGSAAFEAAHGDDVWKYAAEYPGHSNLINDAMACNARKMVSGIVEGCV-EVFDGVKTL  188

Query  639   vdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFI  818
             VDVGGG G A+  +VK  P I+GINFDLPHVV  A E  GV HVGGDMF S+P A A  +
Sbjct  189   VDVGGGNGTALRTLVKLCPWIQGINFDLPHVVDVAEECDGVRHVGGDMFQSVPKADAALL  248

Query  819   KWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLAHS  998
              WVLHDW D+EC+ ILK C+EA+P + GK+IIV+AV+    D     +    D++M+AH+
Sbjct  249   MWVLHDWNDDECINILKKCKEAIPNEIGKVIIVEAVVDEAKDDKLEFVRLALDMVMMAHT  308

Query  999   SGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
               GKERT EEW+ +L +AGF  + I    AV S+IEA+
Sbjct  309   DTGKERTSEEWEYVLKQAGFSRHTIKSIAAVQSVIEAF  346



>gb|AJD20222.1| norcoclaurine 6-O-methyltransferase [Sinopodophyllum hexandrum]
Length=350

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 145/349 (42%), Positives = 216/349 (62%), Gaps = 5/349 (1%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
             +K  + SQA++W ++  F +S+ LK AV+L   +IIH+H   +P+TLS++A+ +      
Sbjct  4     QKENISSQAKLWNFIYGFAESLVLKCAVELDFANIIHNHG--KPMTLSELASQLPVMQPV  61

Query  249   DTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLS  428
             +T +L R++R LV   IFT  +  +DG T YG    +++LV+  +  M   +L  T  + 
Sbjct  62    NTNSLYRVMRYLVHINIFTKTLDENDGETKYGLAAPAKFLVKGWDNCMVGSILGITDKVF  121

Query  429   MAPFHCFSRCVKEG-GFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
             M P++     +  G G AFE A GK I+E    +PE NK FN  M   T +I  A++S  
Sbjct  122   MEPWYYIKDELAPGTGTAFELALGKDIWEYMGENPEKNKLFNAAMACDTSMIMSALISE-  180

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               D F  + +LVDVGGGTG A   I +AFP+IK   +DLPHV+A +P Y  ++ V GDMF
Sbjct  181   CKDKFNGIRTLVDVGGGTGTAARNIARAFPNIKCTVYDLPHVIADSPVYPEINRVSGDMF  240

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
               IP+A AI +K +LHDW D+EC++ILK C+EA+P   GK+II+D VL  E +  +  + 
Sbjct  241   KCIPNADAILMKCILHDWEDKECIEILKRCKEAVPVDGGKVIIIDVVLDGESEHPYTKVR  300

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
               +DL M+ ++  GKERT+E WK+L   AG+ +YNI Q  A+ S+IEA+
Sbjct  301   LNSDLDMMLNTE-GKERTKEGWKKLFKAAGYRDYNITQISALQSVIEAF  348



>sp|Q9LEL6.1|6OMT_COPJA RecName: Full=(RS)-norcoclaurine 6-O-methyltransferase; AltName: 
Full=S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase; 
Short=6-OMT [Coptis japonica]
 dbj|BAB08004.1| S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase [Coptis 
japonica]
Length=347

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 152/349 (44%), Positives = 216/349 (62%), Gaps = 8/349 (2%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
             +K  L SQA++W ++  F +S+ LK AV L + +IIH+   +  +TLS++++ +   P  
Sbjct  4     KKDNLSSQAKLWNFIYGFAESLVLKCAVQLDLANIIHNSGTS--MTLSELSSRLPSQPVN  61

Query  249   DTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLS  428
             + A L R++R LV  K+FT A    DG   YG  P +++LV+  +  M   +L  T    
Sbjct  62    EDA-LYRVMRYLVHMKLFTKA--SIDGELRYGLAPPAKYLVKGWDKCMVGSILAITDKDF  118

Query  429   MAPFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
             MAP+H     +  E G AFEKA G  I+   A  PE N+ FN+ M + +++I  A+V   
Sbjct  119   MAPWHYLKDGLSGESGTAFEKALGTNIWGYMAEHPEKNQLFNEAMANDSRLIMSALVKE-  177

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
              G+ F  + +LVDVGGGTG AV  I  AFPHIK   +DLPHV+A +P Y  V  V GDMF
Sbjct  178   CGNIFNGITTLVDVGGGTGTAVRNIANAFPHIKCTVYDLPHVIADSPGYSEVHCVAGDMF  237

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
               IP A AI +K +LHDW D+EC++ILK C+EA+P K GK+IIVD VL  + +  +  + 
Sbjct  238   KFIPKADAIMMKCILHDWDDKECIEILKRCKEAVPVKGGKVIIVDIVLNVQSEHPYTKMR  297

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                DL M+  ++GGKERTEEEWK+L+ +AG+  + I Q  AV S+IEAY
Sbjct  298   LTLDLDMML-NTGGKERTEEEWKKLIHDAGYKGHKITQITAVQSVIEAY  345



>ref|XP_008236083.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Prunus 
mume]
Length=358

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/343 (41%), Positives = 217/343 (63%), Gaps = 12/343 (3%)
 Frame = +3

Query  99    VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILR  278
             +WKY+  F +   +K A++L I D I SH +  P+TL ++++A+   PSP    L RI+R
Sbjct  22    IWKYVFGFAEIAVVKCAIELGIADAIESHGS--PMTLLELSSALRCDPSP----LYRIMR  75

Query  279   LLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFSRC  458
             +LV  KIF        G  VY  TP S+ L++  + SMA ++L ++ P+ +AP+H  S  
Sbjct  76    VLVHLKIFKEKPATQLGPKVYAQTPLSKRLLKSGQNSMAALILLESSPVMLAPWHGLSAR  135

Query  459   VKEG--GFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVG  632
             ++       FE+ HG+ ++   A +P+ NK FN+ M    ++   A++     + F+ + 
Sbjct  136   IQGNIRNPVFEEVHGEDLWSFGAANPDHNKLFNEAMACDARVNVPAVIESCL-EMFKGIE  194

Query  633   SLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAI  812
             ++VDVGGG G+ +  +V+A P I+GINFDLPHVV+ A E   + +VGGDMF  +P A A+
Sbjct  195   TIVDVGGGDGSTMCLLVEACPWIQGINFDLPHVVSVAQECDRIENVGGDMFDCVPKADAV  254

Query  813   FIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPI-FGDISYVTDLL  983
              IK VLHDWGD+EC++ILK CREA+PE  GK+IIV+AV+  K E + I   ++  + D++
Sbjct  255   IIKGVLHDWGDDECIRILKKCREAIPEDKGKVIIVEAVIDEKDEKEDIKLTNVRLMLDMV  314

Query  984   MLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             M+AH++ GKERT +EW  +L EAGF  + I    AV S+I+A+
Sbjct  315   MMAHTNTGKERTLKEWGYVLGEAGFSRHTITPIHAVPSVIQAF  357



>gb|ABY75613.1| S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclaurine 4'-O-methyltransferase 
[Coptis chinensis]
Length=350

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 211/349 (60%), Gaps = 6/349 (2%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             D+   + +QA VWK +  F DS+ L+ AV+L I DI+ ++   QP+ L+ +A+ +  S +
Sbjct  7     DDALDIKAQAHVWKIIYGFADSLVLRCAVELGIVDIVDNNN--QPMALADLASKLPVS-N  63

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
              +   L RILR LV+ +I     +  DG   Y   P +  L R+A+ SM PM+L  T   
Sbjct  64    VNCDNLYRILRYLVKMEIL-RVEKSDDGEKKYALEPIATLLSRNAKRSMVPMILGMTQKD  122

Query  426   SMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
              M P+H     + + G AFEKA G  I+E   G P+ ++ FN+GM   T++++ +++SG 
Sbjct  123   FMTPWHSMKDGLSDNGTAFEKAMGMTIWEYLEGHPDQSQLFNEGMAGETRLLTSSLISG-  181

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               D F+ + SLVDVGGG G  V  I  AFPHIK   FDLPHV+A + ++  +  +GGDMF
Sbjct  182   SRDMFQGIDSLVDVGGGNGTTVKAISDAFPHIKCTLFDLPHVIANSYDHPNIERIGGDMF  241

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDIS  965
              S+PSAQAI +K +LHDW DE+ +KILK CR A+P+  GK+IIVD  L  E D       
Sbjct  242   KSVPSAQAILLKLILHDWNDEDSIKILKQCRNAVPKDGGKVIIVDVALDEESDHELSSTR  301

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              + D+ ML + +GGKERT+E W++++  AGF    I    A+ S+IE +
Sbjct  302   LILDIDMLVN-TGGKERTKEVWEKIVKSAGFSGCKIRHIAAIQSVIEVF  349



>ref|XP_010066313.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Eucalyptus 
grandis]
Length=365

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 218/374 (58%), Gaps = 18/374 (5%)
 Frame = +3

Query  9     LHSPASKFSPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHA  188
             L  P ++ +P  +V     DE++   +   +WKY+L F +   +K A+DL I D I SH 
Sbjct  3     LEKPVAEPTPTAQVAGDEDDEEA--KAGVDIWKYILGFTEMAVVKCAIDLGIADAIESHP  60

Query  189   AAQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWL  368
                 I+LSQ+++ +   PS    +L RILR LV RKIF    R       Y  TP SR L
Sbjct  61    DPS-ISLSQLSSKLGCCPS----SLRRILRFLVHRKIF----RHLADTNTYSQTPLSRLL  111

Query  369   VRDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFA----FEKAHGKGIFEMAAGDPEF  536
             +   E SMA ++L +T P+ +AP+   S  V          F  AHG  I+  +  +P  
Sbjct  112   LARGEKSMAALILLETTPVMLAPWLKLSSHVSATAATAPPPFMVAHGDDIWVYSEANPGH  171

Query  537   NKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINF  716
             ++  ++ M    ++   A+      + F  V ++VDVGGG G  +  + KAFP I+GINF
Sbjct  172   SRLIDEAMACDARVAVPALAEDCP-EVFEGVLTMVDVGGGNGTTLRLLRKAFPWIRGINF  230

Query  717   DLPHVVATA-PEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPE  893
             DLPHVV+ A P  +GV H GGDMF  +P A A F+K VLHDW D EC++ILKNCREA+ E
Sbjct  231   DLPHVVSVALPPCEGVEHAGGDMFEGVPKADAAFLKSVLHDWSDSECIQILKNCREAISE  290

Query  894   -KTGKLIIVDAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYN  1070
              K+GK+IIV+AV+  E D  + D+    D++M+AH+ GGKERTE+EW  +L +AGF  Y 
Sbjct  291   SKSGKVIIVEAVIDEEKDGKWTDVRLTLDMVMMAHTGGGKERTEKEWAHVLRQAGFAKYT  350

Query  1071  IIQNIAVASIIEAY  1112
             I    AV S+IEA+
Sbjct  351   IKPVRAVQSVIEAF  364



>sp|Q9LEL5.1|4OMT_COPJA RecName: Full=3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase; 
AltName: Full=S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclaurine 
4'-O-methyltransferase; Short=4'-OMT [Coptis 
japonica]
 dbj|BAB08005.1| S-adenosyl-L-methionine:3'-hydroxy-N-methylcocla urine 4'-O-methyltransferase 
[Coptis japonica]
Length=350

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 145/346 (42%), Positives = 207/346 (60%), Gaps = 10/346 (3%)
 Frame = +3

Query  81    LHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA-  257
             + +QA VWK +  F DS+ L+ AV+L I DII ++   QP+ L+ +A+ +   P  D   
Sbjct  12    IKAQAHVWKIIYGFADSLVLRCAVELGIVDIIDNNN--QPMALADLASKL---PVSDVNC  66

Query  258   -TLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMA  434
               L RILR LV+ +I     +  DG   Y   P +  L R+A+ SM PM+L  T    M 
Sbjct  67    DNLYRILRYLVKMEIL-RVEKSDDGQKKYALEPIATLLSRNAKRSMVPMILGMTQKDFMT  125

Query  435   PFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGD  614
             P+H     + + G AFEKA G  I+E   G P+ ++ FN+GM   T++++ +++SG   D
Sbjct  126   PWHSMKDGLSDNGTAFEKAMGMTIWEYLEGHPDQSQLFNEGMAGETRLLTSSLISG-SRD  184

Query  615   GFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSI  794
              F+ + SLVDVGGG G  V  I  AFPHIK   FDLPHV+A + +   +  +GGDMF S+
Sbjct  185   MFQGIDSLVDVGGGNGTTVKAISDAFPHIKCTLFDLPHVIANSYDLPNIERIGGDMFKSV  244

Query  795   PSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYVT  974
             PSAQAI +K +LHDW DE+ +KILK CR A+P+  GK+IIVD  L  E D        + 
Sbjct  245   PSAQAIILKLILHDWNDEDSIKILKQCRNAVPKDGGKVIIVDVALDEESDHELSSTRLIL  304

Query  975   DLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             D+ ML + +GGKERT+E W++++  AGF    I    A+ S+IE +
Sbjct  305   DIDMLVN-TGGKERTKEVWEKIVKSAGFSGCKIRHIAAIQSVIEVF  349



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 144/355 (41%), Positives = 214/355 (60%), Gaps = 11/355 (3%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             + + +L +QA +  ++ ++++SM+LK A+ L IPDIIH+H   +P+TLS +  A+  + +
Sbjct  10    ETREILAAQAHIANHVFNYLNSMSLKCAIQLEIPDIIHNHG--KPMTLSNLVNALPINKA  67

Query  246   PDTATLSRILRLLVRRKIF-TSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHP  422
                  + R++R+L+    F  + +  ++    Y  TP SR L+++  LS+ P +L Q  P
Sbjct  68    KGQDCIYRLMRILIHSGFFIQTKINETEEEEGYLLTPNSRLLLKNEPLSLVPFVLAQLDP  127

Query  423   LSMAPFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQI-ISKAIV  596
             + M PF   S+ ++ +    F  AHGK +FE A  +P  N  FN+ M S  ++ IS  I 
Sbjct  128   ILMDPFQSLSKWLQNDDSTPFATAHGKPLFEYAGEEPRLNYLFNEAMASDARLMISVVIK  187

Query  597   SGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGG  776
             +G G   F  + SLVDVGGG G     I  AFP +K   FDLPHVV      + +S+VGG
Sbjct  188   TGSGI--FDGLKSLVDVGGGIGTVAKAISNAFPEVKCTVFDLPHVVEGLEGSKNLSYVGG  245

Query  777   DMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP--EKTGKLIIVDAVLKPE-GDP  947
             DMF S+PSA AI +KW+LHDW DE+CVKILK C+EA+P  E  GK+II+D V+  + GD 
Sbjct  246   DMFKSVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENRGKVIIIDIVVDSQKGDN  305

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                +    +D+LM+ H S GKER  EEW +L  +AGF +Y I   + + S+IE Y
Sbjct  306   KSFETQLFSDILMMVHVS-GKERNREEWAKLFCDAGFSDYKINPILGLRSVIEVY  359



>ref|XP_006412140.1| hypothetical protein EUTSA_v10025519mg [Eutrema salsugineum]
 gb|ESQ53593.1| hypothetical protein EUTSA_v10025519mg [Eutrema salsugineum]
Length=367

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 152/374 (41%), Positives = 221/374 (59%), Gaps = 24/374 (6%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             MEE      DE++   +   +W+Y+  F D  A K A+DL+IP+ I +H ++QP+TL+++
Sbjct  1     MEESKRNILDEEA--KASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSQPVTLAEL  58

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELS  389
             ++A+  SPS     L RI+R LV + IF         AT Y  TP SR ++   RD + S
Sbjct  59    SSAVSASPS----HLLRIMRFLVHQGIFKEVPTKDGLATGYTNTPLSRRMMITKRDGK-S  113

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVK---EGGFA--FEKAHGKGIFEMAAGDPEFNKSFND  554
             +AP +LF+T P  +AP+   S  V     G     F+  HGK ++  A  +P  +   ++
Sbjct  114   LAPFVLFETSPEMLAPWLRLSSVVSSPVNGSHPPPFDAVHGKDVWAFAEDNPCLSVMISE  173

Query  555   GMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVV  734
              M   ++ +    V+G   D F  VG++VDVGG TG  +  +VK FP IKG NFDLPHV 
Sbjct  174   AMACDSRRVVPR-VAGACHDLFDGVGTVVDVGGATGETMGILVKEFPWIKGFNFDLPHVT  232

Query  735   ATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLII  914
               A    GV H+GGDMFVSIP   A+FIKWVLHDWGD++C+KILKNC+EA+P   GK++I
Sbjct  233   EVAQVMDGVEHIGGDMFVSIPKCDAVFIKWVLHDWGDKDCIKILKNCKEAIPPNIGKVLI  292

Query  915   VDAVLK--------PEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYN  1070
             V++V++         E D     +  + D++M+AH+S GKERT +EW  +L ++GF  Y 
Sbjct  293   VESVIREKKETMIVEERDEKLEHVRLMLDMVMMAHTSTGKERTLKEWDFVLNQSGFARYE  352

Query  1071  IIQNIAVASIIEAY  1112
             +     V S+I AY
Sbjct  353   VRDIDDVQSVIIAY  366



>ref|XP_006353587.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Solanum tuberosum]
Length=394

 Score =   246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 149/380 (39%), Positives = 223/380 (59%), Gaps = 25/380 (7%)
 Frame = +3

Query  39    MEEVMDG---SFDEKSMLHS---QAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQP  200
             ME+  +G   + DE+ +  S   QA +WK++  F +   +K A++L I D +  +   +P
Sbjct  1     MEKQTNGKARTNDEEKIQESHEAQANMWKFVFGFTELAVIKCAIELGIADFLEKNQ--EP  58

Query  201   ITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDA  380
             I+L+Q++ A+    S    +L RILR L+ R IF      S G + Y  TP SR L+++ 
Sbjct  59    ISLNQLSVALGCCSS----SLYRILRFLINRGIFKETSTKS-GKSGYVQTPLSRLLIKEG  113

Query  381   ELSMAPMLLFQTHPLSMAPFHCFSRCV--KEGGFA-FEKAHGKGIFEMAAGDPEFNKSFN  551
             E SMA  LLF++ P+ +A +H  S  +  K+   + FE AHGK +++ A  DP+ +   N
Sbjct  114   ENSMAAFLLFESSPVMLASWHNLSARISSKDNSLSSFEAAHGKDVWKYAEADPKHSNLLN  173

Query  552   DGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHV  731
             + M    +I   AI+     + F+ V ++VDVGGG G  +  +V+AFP I GINFDLPHV
Sbjct  174   NAMACDARIAISAIIDDCP-EIFKGVNTIVDVGGGDGTTLRLLVEAFPWINGINFDLPHV  232

Query  732   VATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLI  911
              + AP   GV HVG DMF  +P A A F+ WVLHDW DEEC++IL  CREA+P+  GK+ 
Sbjct  233   ASVAPHAIGVVHVGDDMFNYVPKADAAFLMWVLHDWSDEECIQILTKCREAIPQDNGKVK  292

Query  912   IVDAVLKPEGDPI--------FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNY  1067
             I++A++  + + I          D+  + D++M+AH+S GKERT +EW  +L EAGF  +
Sbjct  293   ILEAIIGEKEENIIRGSNNKKLKDVGLMLDMVMMAHTSNGKERTTKEWAYVLNEAGFNRH  352

Query  1068  NIIQNIAVASIIEAYSQ*FF  1127
              I     V S+I+AY   F 
Sbjct  353   TISHINVVQSVIQAYPSRFL  372



>ref|NP_195242.1| O-methyltransferase family protein [Arabidopsis thaliana]
 emb|CAB36723.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 emb|CAB80233.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM20654.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAN15621.1| O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AEE86474.1| O-methyltransferase family protein [Arabidopsis thaliana]
Length=382

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 221/382 (58%), Gaps = 27/382 (7%)
 Frame = +3

Query  24    SKF---SPMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAA  194
             SKF   + ME+      DE++   +   +WKY+  F D  A K A+DL+IP+ I +H ++
Sbjct  7     SKFLDRNKMEDNKRKVLDEEA--KASLDIWKYVFGFADIAAAKCAIDLKIPEAIENHPSS  64

Query  195   QPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV-  371
             QP+TL+++++A+  SPS     L RI+R LV + IF         AT Y  TP SR L+ 
Sbjct  65    QPVTLAELSSAVSASPS----HLRRIMRFLVHQGIFKEIPTKDGLATGYVNTPLSRRLMI  120

Query  372   --RDAELSMAPMLLFQTHPLSMAPFHCFSRCVKE--GGFA---FEKAHGKGIFEMAAGDP  530
               RD + S+AP +LF+T P  +AP+   S  V     G     F+  HGK ++  A  +P
Sbjct  121   TRRDGK-SLAPFVLFETTPEMLAPWLRLSSVVSSPVNGSTPPPFDAVHGKDVWSFAQDNP  179

Query  531   EFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGI  710
               +   N+ M    + +   +     G  F  V ++VDVGGGTG  +  +VK FP IKG 
Sbjct  180   FLSDMINEAMACDARRVVPRVAGACHG-LFDGVTTMVDVGGGTGETMGMLVKEFPWIKGF  238

Query  711   NFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP  890
             NFDLPHV+  A    GV +V GDMF SIP+  AIFIKWVLHDWGD++C+KILKNC+EA+P
Sbjct  239   NFDLPHVIEVAEVLDGVENVEGDMFDSIPACDAIFIKWVLHDWGDKDCIKILKNCKEAVP  298

Query  891   EKTGKLIIVDAVLKP--------EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLM  1046
                GK++IV++V+          E D     +  + D++M+AH+S GKERT +EW  +L 
Sbjct  299   PNIGKVLIVESVIGENKKTMIVDERDEKLEHVRLMLDMVMMAHTSTGKERTLKEWDFVLK  358

Query  1047  EAGFPNYNIIQNIAVASIIEAY  1112
             EAGF  Y +     V S+I AY
Sbjct  359   EAGFARYEVRDIDDVQSLIIAY  380



>ref|XP_010526878.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X2 [Tarenaya hassleriana]
Length=342

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/340 (42%), Positives = 212/340 (62%), Gaps = 18/340 (5%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
             E+    +   +W+Y+  F D   +K A++L+IP+ + SH + QP+TL++++ A+  SP  
Sbjct  2     EEEEARASVDIWRYVFGFTDMAVVKCAIELKIPEAVESHPS-QPVTLAELSTAVACSPP-  59

Query  249   DTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELSMAPMLLFQTH  419
                 L RI+R L  + IF   +        Y  TP SR ++   RD + S AP++L ++ 
Sbjct  60    ---LLGRIMRFLSHQGIFKEVITKDGLVGGYLNTPLSRLMMSSNRD-DKSKAPLILMESS  115

Query  420   PLSMAPFHCFSRCV-----KEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIIS  584
             P+ +AP+   S  V     +EG   FE  HGK ++   A DP  ++ FN+ M   T+ + 
Sbjct  116   PVMLAPWLKLSAVVSNAATEEGSQPFEVVHGKDVWAYCAEDPRHSEMFNEAMACDTRRLV  175

Query  585   KAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVS  764
               +++G   D F  V ++VDVGGG G A+  +VKAFP IKG NFDLPHVV TA ++ GV 
Sbjct  176   -PVIAGACSDVFEGVSTVVDVGGGKGDALGVLVKAFPWIKGFNFDLPHVVETALKFDGVE  234

Query  765   HVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPE  938
             +VGGDMF  +P+A A+FIKWVLHDW DE C+K+L+ CREA+P K GK++IVDAV+  K +
Sbjct  235   NVGGDMFERVPNADAVFIKWVLHDWNDEVCIKLLEKCREAIPRKGGKVVIVDAVVGEKKK  294

Query  939   GDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGF  1058
             GD +      + D++M+AH++ G+ERT EEW  ++ EAGF
Sbjct  295   GDRL-EYARLMLDMVMMAHTTRGRERTLEEWDHVITEAGF  333



>ref|XP_009138346.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Brassica 
rapa]
Length=366

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 147/374 (39%), Positives = 217/374 (58%), Gaps = 25/374 (7%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             MEE      DE++   +   +W+Y+  F D  A K A+DL+IP+ I +H + QP+TL+++
Sbjct  1     MEESKRNLLDEEA--KASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPS-QPVTLAEL  57

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELS  389
             + A+  SPS     L RI++ LV + +F         AT Y  TP SR ++   RD + S
Sbjct  58    SGAVSASPS----HLHRIMKFLVHQGVFKEVPTKDGLATGYTNTPLSRRMMITKRDGK-S  112

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVKEGGFA-----FEKAHGKGIFEMAAGDPEFNKSFND  554
             +AP +LF+T P  +AP+   S  V           F+  HGK ++ +A  +P FN   N+
Sbjct  113   LAPFVLFETSPELLAPWLRLSSVVSSPANGSHPPPFDTVHGKDLWALAEDNPCFNDVINE  172

Query  555   GMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVV  734
              M   T+++   + +    D F  V ++VDVGG TG  +A +VK FP IKG NFDLPHV+
Sbjct  173   AMACHTRLVVPRVAAACH-DLFEGVATVVDVGGCTGETLAILVKEFPWIKGFNFDLPHVI  231

Query  735   ATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLII  914
               A    GV +VGGDMF S+P    +FIKWVLHDWGD++C++ILKNC+EA+P   GK++I
Sbjct  232   EVAQVLDGVENVGGDMFDSVPKCDNVFIKWVLHDWGDKDCIRILKNCKEAVPSNIGKVLI  291

Query  915   VDAVLKPEG--------DPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYN  1070
             V++V++ +         D     +  + D+ M+AH+S GKERT +EW  +L EAGF  Y 
Sbjct  292   VESVIRDQKKTMIVEDRDEKLEQVRLMLDMGMMAHTSTGKERTLKEWDFVLNEAGFARYE  351

Query  1071  IIQNIAVASIIEAY  1112
             +     V  +I AY
Sbjct  352   VRDIDDVQCVIIAY  365



>ref|XP_007200597.1| hypothetical protein PRUPE_ppa007742mg [Prunus persica]
 gb|EMJ01796.1| hypothetical protein PRUPE_ppa007742mg [Prunus persica]
Length=357

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/347 (40%), Positives = 214/347 (62%), Gaps = 11/347 (3%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
             H++ ++WKY+  F++   +K A++L I D I SH +  P+TL ++++A+   PSP    L
Sbjct  17    HAKVEIWKYVFGFVEIGVVKCAIELGIADAIESHGS--PMTLLELSSALRCDPSP----L  70

Query  264   SRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
              RI+R+LV  KIF        G  VY  TP S+ L++  E SMA ++L    P+ +AP+H
Sbjct  71    YRIMRVLVHLKIFKEKPATQLGPKVYAQTPLSKQLLKSGENSMAALILLGNSPVVLAPWH  130

Query  444   CFS-RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
               S R       AFE   G+ I+  AA +P+ +K FN+ M    ++   A++     + F
Sbjct  131   GLSARIQGISNPAFEAERGEDIWSYAAANPDHSKLFNEAMACDARVAVPAVIESCS-EVF  189

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
             + +  +VDVGGG G  +  +++A P I+GINFDLPHVV+ A E   + +VGGDMF  +P 
Sbjct  190   KGIEKIVDVGGGDGTTLRLLIEACPWIRGINFDLPHVVSVAQECDRIENVGGDMFDFVPK  249

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPI-FGDISYV  971
             A A+ +KWVLH+WGD+EC++ILK CREA+P   GK+IIV+AV+  K E + I   ++  +
Sbjct  250   ADAVIMKWVLHNWGDDECIRILKKCREAIPADKGKVIIVEAVIDEKDEKEDIKLTNVRLM  309

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              D+ M+A +  GKERT +EW  +L +AGF  + I    AV S+I+A+
Sbjct  310   LDMAMMAATQIGKERTLKEWGYVLADAGFSQHTITPIHAVQSVIQAF  356



>ref|XP_010690296.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=364

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 224/361 (62%), Gaps = 14/361 (4%)
 Frame = +3

Query  48    VMDGSFDEKSMLHSQAQ----VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQ  215
             V DG  +++     +AQ    +WKY+  F +   +K A+DL + +IIH++  +  ++L +
Sbjct  11    VADGEHEKEIEDQEEAQADIEIWKYVFGFTEMAIVKCAIDLGLANIIHTNGGS--MSLIE  68

Query  216   IAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMA  395
             +A+ +  SPS    +L R++R L  R+IF  + R S G  +Y  TP SR L+   E +MA
Sbjct  69    LASTLKCSPS----SLYRVMRFLNHRRIFRQS-RTSQGTLIYSQTPLSRRLLSHEENNMA  123

Query  396   PMLLFQTHPLSMAPFHCFS-RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVT  572
               +L ++ P+ ++P+   S R +++ G AF+ A+G+ ++  ++ +   +K  ND M    
Sbjct  124   AFILLESTPVMLSPWLGLSNRVLEKSGSAFDAANGEDVWSYSSKNVAHSKLINDAMACDA  183

Query  573   QIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEY  752
             +++   I+ G   + F  V S VDVGGG G   + +V++ P I+GINFD PHVV+     
Sbjct  184   RVVVPQIIKGCA-NLFDGVCSFVDVGGGDGTTSSMLVRSIPSIQGINFDFPHVVSNGVLC  242

Query  753   QGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK  932
             +GV HVGG+MF S+P A   FI WVLHDWGD+EC++ILK C+EA+ +  GK+IIV+AV++
Sbjct  243   EGVQHVGGNMFDSVPKADVAFIMWVLHDWGDDECIQILKKCKEAISKDKGKVIIVEAVIE  302

Query  933   PEGDPI-FGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
              E     F +   + D++MLAH++ GKERT +EW  LL +AGF ++N+    AV S+IEA
Sbjct  303   AEDTKDEFENARLLLDMVMLAHTTNGKERTLKEWSCLLNKAGFGHFNVHPIQAVQSVIEA  362

Query  1110  Y  1112
             +
Sbjct  363   F  363



>ref|XP_010548126.1| PREDICTED: LOW QUALITY PROTEIN: (RS)-norcoclaurine 6-O-methyltransferase-like 
[Tarenaya hassleriana]
Length=351

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 148/348 (43%), Positives = 207/348 (59%), Gaps = 20/348 (6%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
               +A++W+Y     D   +K A+DL+IPD + +H + QP+TL+ ++AA+  SP    A L
Sbjct  14    EEEAKIWRYAFGLADVAVVKCAIDLKIPDAVENHTS-QPVTLADLSAAVSCSP----ALL  68

Query  264   SRILRLLVRRKIFTSAVRPS-DGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPF  440
              RI+R LV + IF     P+ DG   Y  TP S    R     MA  +L    P+ MAP+
Sbjct  69    RRIMRFLVHQGIFRE--EPTKDGGAGYTNTPLS---RRRPPPPMALPILLACSPVMMAPW  123

Query  441   HCFSRCVKEGG---FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
                +  V   G     FE AHGK  +   A DP FN+ F+    S T+++  A+V G   
Sbjct  124   LKLTDVVSGNGPRKQPFEAAHGKDAWAYTAEDPRFNEMFSQARVSDTRMVVPAVV-GSCA  182

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             D F  V ++VDVGG  G A+  +VKAFP IKG+NFDLPHVV  A + +GV +VGGDMF S
Sbjct  183   DVFDGVSTVVDVGGRDGEAIGILVKAFPWIKGVNFDLPHVVEAANKVEGVENVGGDMFDS  242

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGDISYV  971
             IP A A+FIKW+LH+W DE+C+KIL+ C+EA+PE+ GK+IIV+AV+  + D        +
Sbjct  243   IPHADAVFIKWILHNWNDEDCIKILRKCKEAMPEEKGKVIIVEAVVGQKKDDKLEYARLL  302

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNY-----NIIQNIAVASI  1100
              D+ M+     GKERT  EW  +L EAGF  +     N +Q++ VAS+
Sbjct  303   FDMTMMTQMYEGKERTLGEWAYVLREAGFARHEIRDINCVQSVIVASV  350



>ref|XP_009113527.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Brassica 
rapa]
Length=367

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 219/372 (59%), Gaps = 21/372 (6%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             MEE      DE++   +  ++W+Y+  F D  A K A+DL+IP+ + ++ ++QP+TL+++
Sbjct  1     MEENNKNLVDEEA--KASVEIWRYLFGFADIAAAKCAIDLKIPEALENNPSSQPMTLTEL  58

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV--RDAELSM  392
             ++A   SPS       RI+R LV + +F         AT Y  TP SR ++  +    S+
Sbjct  59    SSATSASPS----HFHRIMRFLVHQGVFKKVPTKDGLATGYTNTPLSRRMMITKSDGKSL  114

Query  393   APMLLFQTHPLSMAPFHCFSRCVKEGGFA----FEKAHGKGIFEMAAGDPEFNKSFNDGM  560
             AP+LL +T P  +AP+   S  V     A    F+  HGK ++  A  +P  ++ FN+ M
Sbjct  115   APLLLLETSPEMLAPWLKLSLVVSSPVNASVPPFDAVHGKELWSFAKDNPRHSELFNEAM  174

Query  561   ESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVAT  740
                 + +   I     G  F  V ++VDVGGGTG  +  +VK FP +KGINFDLPHVV  
Sbjct  175   ACDARRVVPRIAGACHG-LFDGVATVVDVGGGTGETMGILVKEFPWVKGINFDLPHVVEV  233

Query  741   APEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVD  920
             A   + V +VGGDMF SIP+  A+FIKWVLHDWGDEEC+KILKNC+E LP K GK++IV+
Sbjct  234   AQAMESVENVGGDMFDSIPACDAVFIKWVLHDWGDEECIKILKNCKEVLPPKIGKVLIVE  293

Query  921   AVLKPEGDPIF-----GDISYVT---DLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNII  1076
             +++  + + +        + YV    D++M+ H+S GKERT +EW  ++ EAGF  Y + 
Sbjct  294   SIVGEKKNTMIMKDKDDKLEYVRLALDMVMMVHTSTGKERTLKEWDFVIKEAGFARYEVR  353

Query  1077  QNIAVASIIEAY  1112
                 V S+I AY
Sbjct  354   DIDDVQSVIIAY  365



>emb|CDP18606.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +3

Query  558   MESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVA  737
             ME   +I  +AI+S + G  +  V +LVDVGGGTGA +AEIVK +PHIKGINFDLPHVVA
Sbjct  1     MECTGKITMQAILSVFKGTYWDGVETLVDVGGGTGATIAEIVKVYPHIKGINFDLPHVVA  60

Query  738   TAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIV  917
             TAP+Y GVSHVGGDMF +IPSAQA+F+KW++HDW DE+CVKILKNCR A+PEKTGK+ IV
Sbjct  61    TAPKYDGVSHVGGDMFDAIPSAQAVFMKWIMHDWCDEDCVKILKNCRRAIPEKTGKVFIV  120

Query  918   DAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS  1097
             + VLKP+GD +F  I  + DLLM+AHSSGGKERTE EWK+LL + GFP Y I +  A  S
Sbjct  121   EVVLKPDGDGLFDSIGMILDLLMIAHSSGGKERTEPEWKKLLDKGGFPRYKITEIPACFS  180

Query  1098  IIEAYSQ  1118
             IIEAY +
Sbjct  181   IIEAYPE  187



>ref|XP_006283957.1| hypothetical protein CARUB_v10005080mg [Capsella rubella]
 gb|EOA16855.1| hypothetical protein CARUB_v10005080mg [Capsella rubella]
Length=369

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 149/375 (40%), Positives = 216/375 (58%), Gaps = 25/375 (7%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             MEEV     DE+    +   +WKY+  F D  A K A+DL+IP+ I +H ++QP+TL ++
Sbjct  1     MEEVKRKILDEEE--KASVDIWKYVFGFADIAAAKCAIDLKIPEAIENHPSSQPVTLDEL  58

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELS  389
             ++A+  SPS     L RI+R L  + +F         AT Y  TP SR ++   RD + S
Sbjct  59    SSAVSASPS----HLRRIMRFLAHQGLFKEVPIKDGLATGYTNTPLSRRMMITKRDGK-S  113

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVK---EGGFA--FEKAHGKGIFEMAAGDPEFNKSFND  554
             +AP +LF+T P  +AP+   S  V     G     F+  HGK ++  A  +P  ++  N+
Sbjct  114   LAPFVLFETRPEMLAPWLRLSSVVSAPVNGSTPPPFDAVHGKDVWSFAQDNPGLSELINE  173

Query  555   GMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVV  734
              M   T+ +   +     G     V ++VDVGG TG  +  +VK FP IKGINFDLPHV+
Sbjct  174   AMACDTRRVVPRVAEACHG-LLNGVDTVVDVGGSTGETLGILVKEFPWIKGINFDLPHVI  232

Query  735   ATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLII  914
               A    GV +V GDMF S+P+  A+ IKWVLHDWGD++C+KILKNC+EA+P+  GK++I
Sbjct  233   EVAQVLDGVLNVEGDMFDSVPACDAVIIKWVLHDWGDKDCIKILKNCKEAVPQNVGKVLI  292

Query  915   VDAVLKP---------EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNY  1067
             V++V+           E D     +  + D++M+AH+S GKERT +EW  +L EAGF  Y
Sbjct  293   VESVIGENTKKTMIVDERDEKLEHVRLMLDMVMMAHTSTGKERTLKEWDFVLTEAGFARY  352

Query  1068  NIIQNIAVASIIEAY  1112
              +     V S+I AY
Sbjct  353   EVRDIDDVQSLIIAY  367



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 144/352 (41%), Positives = 206/352 (59%), Gaps = 10/352 (3%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPD  251
             + +L +QA +  ++ ++I+ ++LK A+ L IPDIIH+H   +P+TLS +  A+  + +  
Sbjct  12    REILAAQAHIANHVFNYINFVSLKCAIQLEIPDIIHNHG--KPMTLSNLVNALPINKAKG  69

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
                + R++R+L+    F       +    Y  TP S  L+++  LS+AP +L Q  P+ M
Sbjct  70    QDCIYRLMRILIHSGFFIQTKINENEEEGYLLTPNSHLLLKNEPLSLAPFVLAQLDPILM  129

Query  432   APFHCFSRCVKEGGFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQI-ISKAIVSGY  605
              PF   S+ ++      F  AHGK +FE A  +P  N  FN+ M S  ++ IS  I +G 
Sbjct  130   DPFQSLSKWLQNSDSTPFATAHGKPLFEYAGDEPRLNYLFNEAMASDARLMISVVIKNGR  189

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
             G   F  + SL DVGGG G     I  AFP IK   FDLPHVV        +S+VGGDMF
Sbjct  190   GI--FEGLKSLADVGGGIGTVAKAISNAFPEIKCTVFDLPHVVEGLEGSNKLSYVGGDMF  247

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP--EKTGKLIIVDAVLKPE-GDPIFG  956
              S+PSA AI +KW+LHDW DE+CVKILK C+EA+P  E  GK+II+D V+  + GD    
Sbjct  248   KSVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENGGKVIIIDIVVDSQKGDNKSF  307

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +    +D LM+ H S GKER  EEW +L  +AGF +Y II  + + S+IE Y
Sbjct  308   ETQLFSDTLMMVHVS-GKERNREEWVKLFCDAGFSDYKIIPILGLRSLIEVY  358



>ref|XP_006446725.1| hypothetical protein CICLE_v10015630mg [Citrus clementina]
 gb|ESR59965.1| hypothetical protein CICLE_v10015630mg [Citrus clementina]
Length=377

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 145/360 (40%), Positives = 209/360 (58%), Gaps = 19/360 (5%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             +L +QAQVW     +I+SM+LK AV+L IPD+IH H   QP+TLSQIA+A+ D       
Sbjct  21    LLKAQAQVWNCAFSYINSMSLKCAVELGIPDVIHKHG--QPMTLSQIASAL-DIQKNKAH  77

Query  258   TLSRILRLLVRRKIFT--SAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              + R++R+LV    F   + +   +    Y  TPASR L++D  L  AP +   THP+  
Sbjct  78    CIQRLMRILVHSGFFAQQNKIDKDESEVYYSLTPASRLLLKDEPLRAAPFMFLITHPIIT  137

Query  432   APFHCFSRCVKEGG----FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
              PF+  S   K         FE  HGK I+   A + +F   F D M + +Q IS  ++ 
Sbjct  138   TPFNFLSSWFKNDDPSTPTVFESTHGKDIWGCLAQEAKFKNVFYDAMMTDSQFISSVLIK  197

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQ-----GVS  764
                   F+ +  LVD+GGGTG     I +AFP +K I FDLPHVV    + Q      + 
Sbjct  198   DCKV-VFKGLKCLVDLGGGTGTMAKAIAEAFPEMKCIVFDLPHVVDNNLQQQQGTNKNLE  256

Query  765   HVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREAL---PEKTGKLIIVDAVLKP  935
              +GGDMF +IP A A+ +KWVLH+WGDEE VKILK C+EA+    +K GK+I++D V++ 
Sbjct  257   FLGGDMFEAIPPADAVLLKWVLHNWGDEESVKILKKCKEAIDGSKDKGGKVIVIDMVIED  316

Query  936   EG-DPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +  D    +    +D+LM++  S  KER+ +EWK+L +EAGF +YN+   + + S+IE Y
Sbjct  317   QSIDKDSTETQLCSDMLMMSLFSVAKERSIKEWKKLFLEAGFSHYNVNSTLGLRSLIELY  376



>ref|XP_010530940.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Tarenaya 
hassleriana]
Length=353

 Score =   241 bits (616),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 150/351 (43%), Positives = 219/351 (62%), Gaps = 17/351 (5%)
 Frame = +3

Query  87    SQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLS  266
             +  ++W+Y L F +  A+K A++L+IP+ + +  + QP+TL+ +++A+   P      L 
Sbjct  9     ASVEIWRYALGFAEMAAVKCAIELKIPEAVENQTS-QPVTLADLSSAVGFPPP----LLR  63

Query  267   RILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELSMAPMLLFQTHPLSMAP  437
             RI+R L  + IF  AV   DGAT Y  TP SR ++   RD + SMA M+L  ++P+++A 
Sbjct  64    RIMRFLAHQGIF-KAVPTKDGATGYTNTPLSRRMMITNRD-DKSMAHMILLSSNPVAVAS  121

Query  438   FHCFSRCVKEG-GFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             +   S  V  G GF  FE AHGK  +  AA DP + ++FN+ M   T+ +  A V+    
Sbjct  122   YLKLSSAVVSGKGFQPFEAAHGKDAWAYAAEDPGYRETFNEAMACDTRRVVPA-VTNTCA  180

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
             D F  V ++VDVG GTG A+  +VKAFP IK  NFDLPHV+A A E++GV +V GDMF  
Sbjct  181   DIFDGVSTVVDVGCGTGEAMGMVVKAFPWIKAFNFDLPHVMAGASEFEGVENVAGDMFGL  240

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGD-PIFGDISY  968
             IP A A+FIKW+LHDW DE+CVKILK  REA+P++ GK+IIV+AV++ + +      + Y
Sbjct  241   IPRADAVFIKWILHDWSDEDCVKILKRSREAVPKEKGKVIIVEAVVEQKKEDDDDDKLEY  300

Query  969   ---VTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                + D++M+A    G+ER  EEW  LL EAGF  + +     + S+I AY
Sbjct  301   ARLLLDVVMMAQMKNGRERNMEEWDHLLTEAGFVRHEVRDINDLQSVIIAY  351



>ref|XP_011092950.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Sesamum 
indicum]
Length=326

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/329 (42%), Positives = 201/329 (61%), Gaps = 11/329 (3%)
 Frame = +3

Query  138   LKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVR  317
             +K A++L I D++ SH    P++LSQ++AA+  S S     L RI+R L  R+IF     
Sbjct  4     MKCAIELGIADVLESHGG--PMSLSQLSAALGCSSS----VLHRIMRYLTHRRIFKRMST  57

Query  318   PSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS-RCVKEGGFAFEKAH  494
               +    Y  TP SR L+ +   SMA  +L ++ P+ +AP+H  S   + +G  AFE AH
Sbjct  58    SQESEISYVQTPLSRLLISNGGNSMAAFVLMESSPVMLAPWHKLSASALMKGTSAFEAAH  117

Query  495   GKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaava  674
             G  +++ AA +P  +K FNDGM    ++    IV  Y  + F+ + SLV+VGGG G A+ 
Sbjct  118   GDHVWKYAAENPGHSKLFNDGMACHARLAMSTIVDQYP-EAFKGIMSLVNVGGGDGTALH  176

Query  675   EIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEEC  854
              +VKA P I+GIN DLPHVV+ AP+  G+ HVGGDMF  +P A A F+ WVLHDW D+EC
Sbjct  177   VLVKACPWIRGINLDLPHVVSVAPKCHGIEHVGGDMFELVPKADAAFLMWVLHDWSDDEC  236

Query  855   VKILKNCREALPEKTGKLIIVDAVLKP---EGDPIFGDISYVTDLLMLAHSSGGKERTEE  1025
             + IL+ CREA+PE  GK+II +AV+     E +  + D+    D+++L H+  GKER+  
Sbjct  237   IDILRKCREAIPEDRGKVIIAEAVIDDELGEDEDKYRDVRLALDMVILTHTQRGKERSMR  296

Query  1026  EWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             EW+ ++  AGF  + +     + S+IEAY
Sbjct  297   EWEYVVNGAGFTRFTVKPIEDIISVIEAY  325



>ref|XP_010103289.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Morus 
notabilis]
 gb|EXB95356.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Morus 
notabilis]
Length=366

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/346 (42%), Positives = 213/346 (62%), Gaps = 17/346 (5%)
 Frame = +3

Query  105   KYMLHFIDSMAL-KAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILRL  281
             KY    +  MA+ K A++L + D I +H   +P+TL ++++A+      D   L R++R 
Sbjct  26    KYYFGGVVEMAVVKCAIELGMADAIANHG--RPMTLLELSSAL----DCDLQNLHRVMRF  79

Query  282   LVRRKIFTSAV-RPSDG--ATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFS  452
             LV   IF   + R  D      Y  TP+SR L+R  E SMA ++L Q+ P +MA +HC S
Sbjct  80    LVNHGIFKEIIIRNEDTVPTAYYAQTPSSRRLMRTGENSMAALILMQSSPPAMATWHCLS  139

Query  453   RCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSV  629
              CVK +   AFE  HG+ +++ A  +P   +  N+ M    ++++ AI+ G   D F  V
Sbjct  140   ACVKGKATSAFEVVHGEDVWKYAEANPAHGQLINEAMACKARVMASAIIDGCL-DVFEGV  198

Query  630   GSLvdvgggtgaavaEIVKAFPHI-KGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQ  806
              +LVDVGGGTG  +  +VKA P I KGI FDLPHVV+ A + +G+ +VGGDMF  IP A 
Sbjct  199   ETLVDVGGGTGTIMRRLVKACPWISKGITFDLPHVVSLAEQCEGIEYVGGDMFEFIPKAD  258

Query  807   AIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL----KPEGDPIFGDISYVT  974
             A+ +  VLHDWGD+EC++ILK CREA+P+  GK+IIV+AV+    + + D    D+  V 
Sbjct  259   AVLLVTVLHDWGDDECIRILKKCREAIPKDKGKVIIVEAVIGNKEQQKEDNKLNDVGLVL  318

Query  975   DLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             D++M+AH+  GKERT +EW  +L EAGF  + +    A+ S+IEA+
Sbjct  319   DMVMMAHTYKGKERTLDEWAYVLREAGFSRHTVRSIAAIQSVIEAF  364



>gb|KHG12207.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Gossypium 
arboreum]
Length=356

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 147/352 (42%), Positives = 214/352 (61%), Gaps = 16/352 (5%)
 Frame = +3

Query  72    KSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPD  251
             K    ++ ++W Y+  +    A+K A++L I D+I ++ +  P+ LS++A A+   PS  
Sbjct  9     KEEARAEIKIWNYVFGYAKIAAVKCAIELGIADVIENYGS--PMPLSELATALRCDPS--  64

Query  252   TATLSRILRLLVRRKIFTSAVRPSDGATV-YGPTPASRWLVRDAELSMAPMLLFQTHPLS  428
                L RI+RL+V  +IF     P +  TV +  TP SR L++  E SMA  +L  + P  
Sbjct  65    --RLHRIMRLMVHDQIFKQ--EPINQHTVGFSSTPLSRCLIKGGEKSMAAFILLMSGPTC  120

Query  429   MAPFHCFSRCVKEGGFA---FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
             +AP+H  S  V E G     FE A+GK ++     +P+F +  N+ M    ++  +A + 
Sbjct  121   LAPWHSLSARVLETGNNISPFEVANGKDLWSYTEANPDFRELLNNSMGCKARLTVQATIE  180

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGD  779
             G   + F  V SLVDVGGG G A++  VKAFP I+GINFDLPHVVA A +  G+ +VGGD
Sbjct  181   GCP-EVFDGVESLVDVGGGNGTALSLFVKAFPWIRGINFDLPHVVAVAEKSDGIENVGGD  239

Query  780   MFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK--PEGDPIF  953
             MF+ IP A A F+ WVLHDW DEEC+KILK CREA+PE  GK+IIV+AVL+   EGD + 
Sbjct  240   MFMFIPKADAAFLMWVLHDWDDEECIKILKKCREAIPEDKGKVIIVEAVLEEDKEGDEL-  298

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEA  1109
             G    + D  M+  ++ G+ERT +EW  +L ++GF  +N+    AV ++IE 
Sbjct  299   GVARLMLDTAMMVITNKGRERTLKEWSYVLRQSGFTRFNVKPIRAVETVIET  350



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/358 (40%), Positives = 214/358 (60%), Gaps = 10/358 (3%)
 Frame = +3

Query  54    DGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIH  233
             DG +D   +L +QA +W ++  FI+SM+LK+AV L IPD IHSH   +PI+LSQ+ AA+ 
Sbjct  3     DGKYDANELLQAQAHIWNHIFSFINSMSLKSAVQLGIPDAIHSHG--RPISLSQLIAALP  60

Query  234   DSPSPDTATLSRILRLLVRRKIFTSA-VRPSDGATVYGPTPASRWLVRDAELSMAPMLLF  410
               P+     + R++R+L+    F  A +   D    Y  T AS+ L++D  LS+AP LL 
Sbjct  61    IHPAKARG-IPRLMRILIHSGFFAKAKIEEKDEEEGYVLTNASKLLLKDNPLSIAPFLLA  119

Query  411   QTHPLSMAPFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
                P+ + P+H  S   + +   AF+ AHG G +E  A DP  N  FN+ M S  +++ K
Sbjct  120   MLDPILIKPWHYLSTWFQNDDATAFDTAHGMGFWEYTASDPNLNNFFNEAMASDARLVMK  179

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
              ++  + G  F  + SLVDVGGGTG   A I KAFP ++   FDLPHVV      + + +
Sbjct  180   VLIDEHKG-LFEGLKSLVDVGGGTGTMAAAIAKAFPQLECTVFDLPHVVVGLQGTENLKY  238

Query  768   VGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP-EKTGKLIIVDAVLKPEGD  944
             V GDMF +IP A A+ +KW++H W  E CVK+LK C+EA+  +K GKLIIVD VL+ +  
Sbjct  239   VAGDMFEAIPPADAVLLKWIMHGWTHEGCVKLLKLCKEAIKGKKGGKLIIVDLVLESQHV  298

Query  945   PIFGDI--SYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                 D+   +  D+L++   + GKE+  ++W +L M+AGF +Y I   + + S+IE Y
Sbjct  299   TDHQDVETQFFFDILLMTLQT-GKEKNNKDWGKLFMDAGFSDYKINPILGLRSVIEVY  355



>gb|KDO38702.1| hypothetical protein CISIN_1g0463751mg, partial [Citrus sinensis]
Length=240

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 172/244 (70%), Gaps = 6/244 (2%)
 Frame = +3

Query  129  SMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTS  308
            S+ALK A++LRIPDIIHSH    PIT SQIA++I    SP+ + + RI+RLL  + IF +
Sbjct  1    SLALKCAIELRIPDIIHSHGG--PITSSQIASSIDSPSSPEISYIERIMRLLGHKNIF-A  57

Query  309  AVRPSDGAT-VYGPTPASRWLVRDAELS-MAPMLLFQTHPLSMAPFHCFSRCVKEGGFAF  482
            A  PSDG   +YG T +SRWLV  ++ + + P+ L + HP  +  +H  S+CVKEGG A 
Sbjct  58   AQHPSDGGEPLYGLTHSSRWLVTGSDSNQLGPVFLVENHPYMVNSWHFLSQCVKEGGSAI  117

Query  483  EKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtg  662
            EKA G    ++A+ D +FNK FN+GM    + +++ I++GY   GF S+ SLVDV GG G
Sbjct  118  EKAFGDAYIDLASKDQQFNKIFNEGMACNAKFLTREILAGYK-HGFDSLKSLVDVAGGIG  176

Query  663  aavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWG  842
              ++EIVK++PHIKGINFDLPHV+ TAP Y GV+HV GDMF +IP+A A+ +KWVLH+W 
Sbjct  177  GLISEIVKSYPHIKGINFDLPHVITTAPVYDGVTHVSGDMFHTIPNADALLLKWVLHNWS  236

Query  843  DEEC  854
            DE C
Sbjct  237  DEAC  240



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/349 (42%), Positives = 207/349 (59%), Gaps = 9/349 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             +L +Q   WK+  +F++SM LK A+ L IPD+IHSH   QP+ LSQ+  A+   P+    
Sbjct  13    LLQAQVHTWKHTTNFVNSMVLKCAIQLGIPDVIHSHG--QPMALSQLITALSLEPT-KAP  69

Query  258   TLSRILRLLVRRKIFTSA--VRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
              L R++R+LV    F     +  S+    Y  T AS++L++D  +S  P LL Q  P+  
Sbjct  70    CLYRLMRVLVHSGFFAQQKLLHNSEEEEGYSLTFASQFLLKDEPVSGVPFLLLQLDPILT  129

Query  432   APFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYG  608
             AP+H      + E    F  AH K  ++ A  +P+ N  FN+ M S +++I+  IV  Y 
Sbjct  130   APWHFLGDWFQNEDPTPFHTAHRKSFWDYAVHEPKLNDIFNETMVSDSRLIANMIVRQYK  189

Query  609   GDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFV  788
              + F  + SLVDVGGGTG  V  I KAFP +K I FD PHVVA     + +  VGG++F 
Sbjct  190   -EVFEGLASLVDVGGGTGTMVKAIAKAFPQLKCIVFDQPHVVANLEVGENLEIVGGNIFE  248

Query  789   SIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKP-EGDPIFGDIS  965
             +IP A AI +KW+LHDW DEECVKILK C+ A+P K GK+II+D V++  +GD    +  
Sbjct  249   AIPPADAILLKWILHDWSDEECVKILKKCKGAIPNKGGKVIIIDMVVESNKGDNKAVETQ  308

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                D+LM+     GKER E+EW++L + AGF +Y I   + + S+IE Y
Sbjct  309   LFIDMLMMV-VVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVY  356



>ref|XP_010276063.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Nelumbo 
nucifera]
Length=345

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 154/348 (44%), Positives = 210/348 (60%), Gaps = 12/348 (3%)
 Frame = +3

Query  81    LHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTAT  260
             + +QAQVWK++  F++S  LK A++L I DI++ H   QP+TLS++A++I   PS     
Sbjct  5     MKAQAQVWKHIYGFVESFTLKCAIELGIADILYEHG--QPMTLSELASSI-PLPSVSQDG  61

Query  261   LSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPF  440
             L R+LR LV  K+F   V  SDG   Y  TPAS+ LV++ E ++A  +L Q + +    +
Sbjct  62    LYRVLRYLVHMKLFDLQV-DSDGLKKYRLTPASKLLVKNQEKNLASFVLLQLYEID--TW  118

Query  441   HCFSRCVKEGGFAFEKAHGKGI--FEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYG-G  611
             +  S  V+     +EK HG G+   E    D   N+  +D M S T +++ A+V G    
Sbjct  119   NHLSAAVEGTVTPWEKCHG-GVDYIEYFKKDSVANQLLSDAMTSHTSMVTDALVKGCKKA  177

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
                  VGSL+DVGG TG A   I K FP IK   FDLPHVVA APE   V+ +GGDMFVS
Sbjct  178   HILDGVGSLIDVGGCTGVAARAIAKWFPSIKCAVFDLPHVVANAPECPEVTRIGGDMFVS  237

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPI-FGDISY  968
             IP    +F+K VLHDWGDE+CVKILK C+EA+ EK GK +IVD V+  E  P  F     
Sbjct  238   IPKTDVVFMKSVLHDWGDEDCVKILKKCKEAISEKGGKAVIVDIVMDVESSPNEFTGARL  297

Query  969   VTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
               ++ ML  + GGKER+E+EW +L  EAG+  Y I   +A+ SIIE +
Sbjct  298   GMEMDMLV-AVGGKERSEKEWHKLFKEAGYSGYKITPIVAIESIIEVF  344



>ref|XP_002441380.1| hypothetical protein SORBIDRAFT_09g025570 [Sorghum bicolor]
 gb|EES19810.1| hypothetical protein SORBIDRAFT_09g025570 [Sorghum bicolor]
Length=359

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 207/356 (58%), Gaps = 12/356 (3%)
 Frame = +3

Query  60    SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
             S D++++L +Q  +W + + ++ SMALKAA+DLRIPD +H H  +   TL QI   +   
Sbjct  10    STDQQAVLDAQLLLWHHTIGYVKSMALKAALDLRIPDAVHQHGGSA--TLPQIVTKVTLH  67

Query  240   PSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTH  419
             PS     L R++R+L    +F+     +    VYG TPASR LV    L++ P L     
Sbjct  68    PSK-IPCLRRLMRVLTLTGVFSVVHDGAGDEPVYGLTPASRLLVSSGRLNVTPFLTLMLG  126

Query  420   PLSMAPF----HCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISK  587
              + ++ F      F   + +    F+ AHG+ I+++A  D  F K F+DGM + +  I  
Sbjct  127   TVFVSSFFDLGEWFGHELPDPS-PFKLAHGRHIWDLADHDASFGKLFDDGMVADSSFIMD  185

Query  588   AIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSH  767
              +V     D F+ + SLVDV GG G A   I KAFPH++    DLPHVVA AP    V +
Sbjct  186   VVVKECS-DVFQGISSLVDVAGGLGGATQTIAKAFPHVECSVLDLPHVVANAPTDTNVKY  244

Query  768   VGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKP-EGD  944
             + GDMF SIPSA A+F+KW+LHDWGD ECVKILKNC++A+  + GK++I+D V+     D
Sbjct  245   IAGDMFESIPSANAVFLKWILHDWGDAECVKILKNCKKAIASQGGKVVILDMVVGAGSSD  304

Query  945   PIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                 +   + DL M+     G ER E EWK+++ EAGF +Y II  + V SIIE Y
Sbjct  305   EKHVETQILFDLFMMF--INGAERDELEWKKIIFEAGFSSYKIIPVLGVRSIIEVY  358



>ref|XP_010690137.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=241

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 163/234 (70%), Gaps = 1/234 (0%)
 Frame = +3

Query  417   HPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIV  596
             HP  +A  H  S  +K GG AFEKAHG  I++  + D E N+ F+DG+    +I  + I 
Sbjct  9     HPHLLAAMHHLSAAIKGGGIAFEKAHGCPIWDFLSADQEVNRLFHDGLACTAKIGFRGIA  68

Query  597   SGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGG  776
             S Y  D F  V S+VDVGGGTGAA+ EIVKA+PHIKGINFDLPHV+A AP Y+GV+HV G
Sbjct  69    SQYV-DVFADVKSVVDVGGGTGAALNEIVKAYPHIKGINFDLPHVIAIAPNYEGVTHVEG  127

Query  777   DMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFG  956
             DMF +IP+A    +K +LHDW DE+C+KILKNCR+A+PEKTGKLI+ + +L  EG     
Sbjct  128   DMFKAIPNADVAILKSILHDWNDEDCIKILKNCRKAIPEKTGKLILFETLLHQEGAESME  187

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYSQ  1118
              I   +DLLM+AH+ GGKERTE E   LL  AGFP+Y +I    + SIIEAY +
Sbjct  188   GILLASDLLMIAHTGGGKERTELECNTLLQNAGFPHYRLITKPGLPSIIEAYVE  241



>ref|XP_008236088.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Prunus 
mume]
Length=357

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 138/347 (40%), Positives = 216/347 (62%), Gaps = 11/347 (3%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
             H++ ++WKY+  FI+   +K A++L I D I SH +  P+TL ++++A+   PSP    L
Sbjct  17    HAKLEIWKYVYGFIEIAVVKCAIELGIADAIESHGS--PMTLLELSSALRCDPSP----L  70

Query  264   SRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
              RI+R+LV  KIF           VY  TP S+ L++  E SMA ++L  + P+ +AP+H
Sbjct  71    YRIMRVLVHLKIFKEKPTTQLCPKVYAQTPLSKLLLKSGENSMAALILLGSSPVMLAPWH  130

Query  444   CFSRCVKE-GGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
               +  ++     AFE  HG+ ++  AA +P+ +K FN+ M    ++   A++     + F
Sbjct  131   GLTAQIQGISNQAFEAVHGEDLWSHAAANPDHSKLFNEAMACDARVAVPAVIESCL-EVF  189

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
             + + ++VDVGGG G  +  +V+A P I+GINFDLPHVV+ A E   + +VGGDMF  +P 
Sbjct  190   KGIETIVDVGGGDGTTLRLLVEACPWIQGINFDLPHVVSVAQECDRIENVGGDMFDCVPK  249

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPI-FGDISYV  971
             A A+ +K VLHDWGD+EC++ILK CREA+P   G++II++AV+  K E + I   ++  +
Sbjct  250   ADAVIMKSVLHDWGDDECIRILKKCREAIPADKGEVIIIEAVIDEKDEKEDIKLTNVRLM  309

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              D+ M+A +  GKERT +EW  +L EAGF  + I    AV S+I+A+
Sbjct  310   LDMAMMAATETGKERTLKEWGYVLAEAGFSRHAITPIHAVQSVIQAF  356



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 145/363 (40%), Positives = 211/363 (58%), Gaps = 14/363 (4%)
 Frame = +3

Query  36    PMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQ  215
             P   V + + DE + L++   V   +L     M LKAA++L + +II        ++ +Q
Sbjct  10    PAPSVENQAGDEAACLYALQLVSSSIL----PMTLKAAIELDVLEIIAKAGPEGKLSPAQ  65

Query  216   IAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVR-PSDGATV--YGPTPASRWLVRDAE-  383
             +AA +    S     L R+LRLL    I T +V   +DG  +  YGP P  +WL ++ + 
Sbjct  66    VAAQLPTENSMAATMLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNEDG  125

Query  384   LSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGME  563
             +SMAP+ L     + M  ++     V +GG  F KA+G   FE    DP FN  FN+GM+
Sbjct  126   VSMAPLTLMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNNVFNEGMK  185

Query  564   SVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATA  743
             + + +I+K ++  Y   GF  +  LVDVGGG GA +  I   +PHIKGINFDLPHV++ A
Sbjct  186   NHSIVITKKLLESY--KGFEDINVLVDVGGGIGATLHMITSKYPHIKGINFDLPHVISEA  243

Query  744   PEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDA  923
             P   GV HVGGDMF SIPS  AI +KW++HDW DE C KIL+NC +ALP   G++I+ + 
Sbjct  244   PPLPGVEHVGGDMFASIPSGDAILMKWIMHDWSDEHCAKILENCYKALP-NNGRVILCEC  302

Query  924   VL--KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS  1097
             +L   PE  P    + ++ D++MLAH+ GGKERTE+E++ L   AGF  +      + A 
Sbjct  303   ILPVAPEPVPSAQGVFHL-DMIMLAHNPGGKERTEKEYQDLAKGAGFTGFKAQYCFSTAW  361

Query  1098  IIE  1106
             ++E
Sbjct  362   VLE  364



>ref|XP_009108679.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Brassica 
rapa]
Length=368

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 153/375 (41%), Positives = 219/375 (58%), Gaps = 26/375 (7%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             MEE      DE++   +   +W+Y+  F D  A K A+DL+IP+ I +H ++QP+TL+++
Sbjct  1     MEECKRNLVDEEA--KASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSQPMTLAEL  58

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATV-YGPTPASRWLV---RDAEL  386
             ++ +  SPS     L RI+R LV + IF   V   DG T  Y  TP SR ++   RD + 
Sbjct  59    SSTVSASPS----HLRRIMRFLVHQGIFKE-VPIKDGLTTGYTNTPLSRRMMITKRDGK-  112

Query  387   SMAPMLLFQTHPLSMAPFHCFSRCVK---EGGFA--FEKAHGKGIFEMAAGDPEFNKSFN  551
             S+AP +LF+T    +AP+   S  V     G     F+  H K ++ +A  +P F++  N
Sbjct  113   SLAPFVLFETSHEMLAPWLRLSSVVSSPVNGSHPPPFDAVHNKDVWALAEDNPCFSEMIN  172

Query  552   DGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHV  731
             + M   T+ +   +      D F  V ++VDVGGG G AV  +VK FP IKG NFDLPHV
Sbjct  173   EAMACDTRRVVPRVARACH-DLFDGVATVVDVGGGNGEAVGILVKEFPWIKGFNFDLPHV  231

Query  732   VATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLI  911
             +  A    GV +VGGDMF SIP   A+FIKWVLHDWGD++C+KILKNC+EA+P   GK+ 
Sbjct  232   IDVAQVLDGVENVGGDMFDSIPKCDAVFIKWVLHDWGDKDCIKILKNCKEAVPANIGKVF  291

Query  912   IVDAVLK--------PEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNY  1067
             IV++V++         E D     +  + D++M+AH+S GKERT +EW  +L EAGF  Y
Sbjct  292   IVESVIRENKKTMIVEERDEKLEHVRLMLDMVMMAHTSTGKERTLKEWDFVLNEAGFARY  351

Query  1068  NIIQNIAVASIIEAY  1112
              +     V  +I AY
Sbjct  352   EVRDIDDVQCVIIAY  366



>ref|XP_008236089.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X1 [Prunus mume]
 ref|XP_008236090.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like isoform 
X2 [Prunus mume]
Length=357

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 216/347 (62%), Gaps = 11/347 (3%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
             H++ ++WKY+  FI+   +K A++L I D I SH +  P+TL ++++A+   PSP    L
Sbjct  17    HAKLEIWKYVYGFIEIAVVKCAIELGIADAIESHGS--PMTLLELSSALRCDPSP----L  70

Query  264   SRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
              RI+R+LV  KIF        G  VY  TP S+ L++  E SMA ++L ++ P+ +A +H
Sbjct  71    YRIMRVLVHLKIFKEKPTTQLGPKVYAQTPLSKLLLKSGENSMAALILLESSPVMLATWH  130

Query  444   CFS-RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
               S R       AFE  HG+ ++  AA +P+ +K FN+ M    ++   A++     + F
Sbjct  131   GLSARIQGITNSAFESVHGEDVWSHAAANPDHSKLFNEAMACDARVAVPAVIESCL-EVF  189

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
             + + ++VDVGGG G  +  +V+A P I+GINFDLPHVV+ A E   + +VGGDMF  +P 
Sbjct  190   KGIETIVDVGGGDGTTLRLLVEACPWIQGINFDLPHVVSVAQECDRIENVGGDMFDCVPK  249

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPI-FGDISYV  971
             A A+ +K VLH  GD+EC++ILK CREA+P+  GK+II++ V+  K E + I   ++  +
Sbjct  250   ADAVIMKSVLHGCGDDECIRILKKCREAIPDHKGKVIIIEVVIDEKDEKEDIKLTNVRLM  309

Query  972   TDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              D +M+AH++ GKERT +EW  +L EAGF  + I    AV S+I+A+
Sbjct  310   LDTVMMAHTNTGKERTLKEWGYVLGEAGFSQHTITPIHAVYSVIQAF  356



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 210/356 (59%), Gaps = 13/356 (4%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
             E  +LH+Q  +W ++  FI+SM+LK+A+ L IPDIIH H   +P+TL Q+A A+  + + 
Sbjct  10    ETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHG--KPMTLDQLANALSINKA-  66

Query  249   DTATLSRILRLLVRRKIFTSA----VRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQT  416
              T  L R++R+L+R   F  +             Y   P SR L++D  LS+ P LL   
Sbjct  67    KTTHLRRLMRILIRSGFFVKSRIQENEGESEGEGYSLAPPSRLLLKDEPLSVTPFLLAML  126

Query  417   HPLSMAPFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
              P+ + P+H  S   + +    F+ AHG+  ++ A  +P  N  FND M S  +++   +
Sbjct  127   DPILVKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMNVV  186

Query  594   VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
             +  Y  D F  + S+VDVGGGTG     I  AFP ++   FDLPHVV    E + +++VG
Sbjct  187   IK-YSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEESKNLNYVG  245

Query  774   GDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP--EKTGKLIIVDAVLKPE-GD  944
             GD FVSIP A A+ +KW+LHDW DEE VKILK C+EA+P  EK GK+II+D ++  + GD
Sbjct  246   GDFFVSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIIIDMMVDNKIGD  305

Query  945   PIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                 +     D+LM+   + G+ER+E+ W +L ++AGF +Y +   + + S+IE Y
Sbjct  306   DESIETQIFFDMLMMVLVT-GRERSEKGWAKLFLDAGFSDYKVTPILGLRSLIEVY  360



>emb|CDP07899.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  558   MESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVA  737
             ME    I  +A++SG     +  V SLVDVGGG GA +AEIVKA+PHIKGINFDLPHVVA
Sbjct  1     MECTGMITVQAVLSGLKSANWDGVESLVDVGGGIGATIAEIVKAYPHIKGINFDLPHVVA  60

Query  738   TAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIV  917
             TAP+Y GVSHVGGDMF +IPSAQAIF+KW++HDW D++CVKILKNCR A+PE+TGK+ IV
Sbjct  61    TAPKYDGVSHVGGDMFDAIPSAQAIFMKWIMHDWDDDDCVKILKNCRRAIPEQTGKIFIV  120

Query  918   DAVLKPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVAS  1097
             D VLKP+GD +F  +    DL+M+AH+SGGKERTE EWK LL + GFP YNI    A  S
Sbjct  121   DVVLKPDGDGLFDSVRMKLDLVMIAHASGGKERTEPEWKILLQKGGFPRYNISAIPACLS  180

Query  1098  IIEAYSQ  1118
             +IEAY +
Sbjct  181   VIEAYPE  187



>ref|XP_006420394.1| hypothetical protein CICLE_v100067042mg, partial [Citrus clementina]
 gb|ESR33634.1| hypothetical protein CICLE_v100067042mg, partial [Citrus clementina]
Length=253

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 182/256 (71%), Gaps = 7/256 (3%)
 Frame = +3

Query  60   SFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDS  239
            S + ++ L  QA++WK+M  FIDS+ALK A++LRIPDIIHSH    PITLSQIA+ I DS
Sbjct  3    SVEGEASLRGQAEIWKHMFAFIDSLALKCAIELRIPDIIHSHGG--PITLSQIASCI-DS  59

Query  240  PSPDTATLSRILRLLVRRKIFTSAVRPSDGAT-VYGPTPASRWLVRDAELS-MAPMLLFQ  413
            PSP+ + L RI+RLL R+ IF +A  PSDG   +YG T +SRWLV  ++ + +  + L +
Sbjct  60   PSPEISYLERIIRLLGRKNIF-AAHHPSDGGEPLYGLTHSSRWLVTGSDSNQLGSVYLVE  118

Query  414  THPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAI  593
             HP  +  +H  S+CVKEGG A EKA G  + ++A+ D +FN+ FN+GM   ++ +++ I
Sbjct  119  NHPYIVNSWHFMSQCVKEGGSAIEKAFGGVVIDLASKDQQFNRIFNEGMACNSKFLTREI  178

Query  594  VSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVG  773
            +  Y   GF S+ SLVDV GG G  ++EIVK++P+IKGINFDLPHV+ TAP Y GV+HV 
Sbjct  179  LGSYK-HGFDSLKSLVDVAGGIGGLISEIVKSYPNIKGINFDLPHVITTAPVYDGVTHVS  237

Query  774  GDMFVSIPSAQAIFIK  821
            GDMF +IP+A A+ +K
Sbjct  238  GDMFHAIPNADALLLK  253



>gb|KCW47148.1| hypothetical protein EUGRSUZ_K00953 [Eucalyptus grandis]
Length=273

 Score =   236 bits (602),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 182/263 (69%), Gaps = 10/263 (4%)
 Frame = +3

Query  51   MDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAI  230
            M+   + ++ L  QA +   +  +  SMALK AV+LRIPDIIHS+    P+TL+QIA+ I
Sbjct  1    MESLHETEATLRGQAHILNLLNAYAGSMALKCAVELRIPDIIHSYGGG-PVTLAQIASRI  59

Query  231  HDSPSPDTATLSRILRLLVRRKIFTSA-VRPSDG----ATVYGPTPASRWLVRDA--ELS  389
              SPS +TA L+RI+RLLVR  IF++   +P DG     T+Y   P+SRWL++    ELS
Sbjct  60   -PSPSLETAYLARIMRLLVRENIFSANRCQPDDGHESHETLYSLPPSSRWLLQGPGFELS  118

Query  390  MAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESV  569
            +AP++L   HP  M+P+  F  C+K GG AFE AHG+ I++ A+ +PEFN+ FNDGM  V
Sbjct  119  LAPVVLMLNHPWMMSPWQFFGDCIKTGGIAFEMAHGRKIWDFASENPEFNRLFNDGMACV  178

Query  570  TQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPE  749
            ++I    I+  Y  DGF S+GSLVDVGGG G  + EI+K+ PHI+GIN+DLPHVVATAP 
Sbjct  179  SRITIGGIIEVYK-DGFESIGSLVDVGGGIGKNLVEIIKSCPHIQGINYDLPHVVATAPA  237

Query  750  YQGVSHVGGDMFVSIPSAQAIFI  818
            + GV+HVGG+MF +IP A A+ +
Sbjct  238  HDGVTHVGGNMFETIPHADAVLL  260



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/355 (39%), Positives = 212/355 (60%), Gaps = 17/355 (5%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI--AAAIHDSPSPD  251
             +  +QA +W ++ +FI+SM+LK A+ L IPDIIH H   QP+ L+Q+  A  I+++ +P 
Sbjct  13    LFQAQAHIWNHIFNFINSMSLKCAIQLGIPDIIHKHG--QPMALAQLIDALPINNAKAP-  69

Query  252   TATLSRILRLLVRRKIFTSAVRP-SDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLS  428
                + R++R+L+    F  A  P ++G   Y  T AS+ L+ +   S+ P LL    P+ 
Sbjct  70    --FVYRLMRILIHSGFFIKAKIPDNEGQEGYALTSASKLLLANDPFSVTPFLLAMLDPIL  127

Query  429   MAPFHCFSRCVKEGGFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGY  605
               P+H FS+  +      F   HG  ++E+A   P+ N+ FN+GM S  +++S  ++   
Sbjct  128   TDPWHHFSQWFQNSEETPFHTCHGTSLWELAGRQPQLNQFFNEGMASDARLVSTMVIENC  187

Query  606   GGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMF  785
               D F  + SL+DVGGGTG     I  AFPH++    DLPHVV      + +++VGGDMF
Sbjct  188   K-DVFMGLNSLIDVGGGTGTVAKAIADAFPHLQCSVLDLPHVVDGWESSKNLAYVGGDMF  246

Query  786   VSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP--EKTGKLIIVDAVLKPE----GDP  947
              +IP A A+ +KW+LHDW DEECV+IL+ C+EA+P  EK GK+II+D +LK +     D 
Sbjct  247   EAIPPADAVLLKWILHDWSDEECVQILRKCKEAIPSMEKGGKVIIIDMLLKSQQNGDDDA  306

Query  948   IFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                +     D+LM+ H   G+ER E++W++L +EAGF  Y I   + + SIIE Y
Sbjct  307   EAIETQLFFDMLMMVHVK-GRERNEKDWEKLFLEAGFNGYKITPVLGLRSIIEVY  360



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 213/350 (61%), Gaps = 10/350 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             +L +QA +W ++ +FI+SM+LK+A+ L IPD IHSH   +PI+LSQ+ AA+   P+    
Sbjct  11    LLQAQAHIWNHIFNFINSMSLKSAIQLGIPDAIHSHG--RPISLSQLIAALPVLPA-KAR  67

Query  258   TLSRILRLLVRRKIFTSA-VRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMA  434
              + R++R+LV    F +A ++ +D    +  T AS+ L++D  LS+ P LL    P+   
Sbjct  68    CIPRLMRILVHSGFFANAKIKGNDEEEGFVLTSASKLLLKDNPLSVTPFLLAMLDPILTE  127

Query  435   PFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             P+H  S   + +    F+  HG   +E A  +P+FN  FN+ M S  +++ + ++  Y G
Sbjct  128   PWHYVSTWFQNDDATPFDTVHGMPFWEYAGNEPKFNNFFNEAMASDARLVMRVLIDEYKG  187

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
               F  + SLVDVGGGTG   A I KAFP +  I FDLPHVVA       + +VGG+MF  
Sbjct  188   -VFEGLNSLVDVGGGTGTMAAAIAKAFPQLDCIVFDLPHVVAGLQSSANLKYVGGNMFEG  246

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALP-EKTGKLIIVDAVLKPEG--DPIFGDI  962
             +P A AI +KW++HDW DEEC+KIL+  +EA+  +K GKLII+D V + +   D  + + 
Sbjct  247   VPPADAILLKWIIHDWSDEECLKILQRSKEAIKGKKGGKLIIIDMVSENQQVIDDQYVET  306

Query  963   SYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                 D+LM+A  + GKER  +EW +L ++AGF NY I   + + S+IE Y
Sbjct  307   QLFYDMLMMALQT-GKERNNKEWGKLFLDAGFSNYKITPILGLRSVIEVY  355



>emb|CCC55423.1| caffeic acid O-3-methyltransferase [Pinus pinaster]
Length=364

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 196/316 (62%), Gaps = 12/316 (4%)
 Frame = +3

Query  132   MALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA-TLSRILRLLVRRKIFTS  308
             MA+KAA++L +  II +      ++  QI A I  + +PD A TL RILR L    + + 
Sbjct  34    MAMKAAIELDVLQIIANAGNGVQLSPRQIVAHI-PTTNPDAAITLDRILRALASHSVLSC  92

Query  309   AVRPSDGAT---VYGPTPASRWLVRDAE-LSMAPMLLFQTHPLSMAPFHCFSRCVKEGGF  476
             +V   +      +YG TP  ++LV++ + +S+AP++L     + M  ++     V +G  
Sbjct  93    SVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYLKDAVLDGSQ  152

Query  477   AFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvggg  656
              F KAHG   FE  A D  FN+ FN GM   + ++   I+  Y  +GF+ V  LVDVGGG
Sbjct  153   PFTKAHGMNAFEYPAMDQRFNRVFNRGMSEHSTLLMNKILDTY--EGFKEVQELVDVGGG  210

Query  657   tgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHD  836
              G+ +  IV  +PHI GINFD+PHVVA AP Y  V HVGGDMF S+PS QAIF+KW+LHD
Sbjct  211   VGSTLNLIVSKYPHISGINFDMPHVVADAPHYPAVKHVGGDMFDSVPSGQAIFMKWILHD  270

Query  837   WGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPIFGDISYVTDLLMLAHSSGGK  1010
             W D+ C+++LKNC +ALPEK GK+I+VD +L    E  P +    +  DLLMLA++ GGK
Sbjct  271   WSDDHCLRLLKNCHKALPEK-GKVIVVDTILPVAAETSP-YARQGFHIDLLMLAYNPGGK  328

Query  1011  ERTEEEWKRLLMEAGF  1058
             ERTE+E++ L  E GF
Sbjct  329   ERTEQEFRDLAKEVGF  344



>gb|AAU20765.1| (S)-norcoclaurine 6-O-methyltransferase [Thalictrum flavum subsp. 
glaucum]
Length=350

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 149/351 (42%), Positives = 216/351 (62%), Gaps = 10/351 (3%)
 Frame = +3

Query  69    EKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSP  248
              K  L SQA++W ++  F DS+ LK+AV L + +IIH+H +  P+TLS+++  +   P  
Sbjct  5     NKENLSSQAKLWNFIYGFADSLVLKSAVQLDLANIIHNHGS--PMTLSELSLHLPSQPVN  62

Query  249   DTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLS  428
               A L R+LR LV  K+FT +    DG   YG  P +++LV+  +  M   +L  T    
Sbjct  63    QDA-LYRVLRYLVHMKLFTKS--SIDGELRYGLAPPAKFLVKGWDKCMLGAILTITDKDF  119

Query  429   MAPFHCFSRCVKEGG---FAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVS  599
             MAP+H     +   G    AFEKA G  I++  A  PE N+ FN+GM + T++I  A+V 
Sbjct  120   MAPWHYLKEGILNDGSTSTAFEKALGTNIWDYMAEHPEKNQLFNEGMANDTRLIMSALVK  179

Query  600   GYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGD  779
                   F  + ++VDVGGGTG AV  I KAFPHIK   +DLPHV+A +P Y  ++ + GD
Sbjct  180   ECSS-MFDGITTIVDVGGGTGTAVRNIAKAFPHIKCTVYDLPHVIADSPGYTEINSIQGD  238

Query  780   MFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEGDPIFGD  959
             MF  IP+A AI +K +LHDW D+EC++ILK C++A+P   GK+II+D +L  + +  +  
Sbjct  239   MFKYIPNADAIMMKCILHDWDDKECIEILKRCKDAVPRDGGKVIIIDIILDVKSEHPYTK  298

Query  960   ISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             +    DL M+  ++GGKERTEEEWK+L+ +AG+  Y I    AV S+IEAY
Sbjct  299   MRLTLDLDMML-NTGGKERTEEEWKKLIHDAGYKGYKITHISAVQSVIEAY  348



>ref|XP_010934914.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=367

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 216/364 (59%), Gaps = 16/364 (4%)
 Frame = +3

Query  36    PMEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQ  215
             P   V + + DE S +++       +L     M LKAA++L + +II    +   ++ +Q
Sbjct  10    PAPSVENQAGDEASCMYALQLASSSIL----PMTLKAAIELGVLEIIAKAGSVGKLSPAQ  65

Query  216   IAAAIHDSPSPDTAT-LSRILRLLVRRKIFTSAVR-PSDGATV--YGPTPASRWLVRDAE  383
             +AA +  + +P  AT L R+LRLL    I T +V   +DG  +  YGP P  +WL ++ +
Sbjct  66    VAAQL-PTENPMAATMLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNED  124

Query  384   -LSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGM  560
              +SMA + L     + M  ++     V +GG  F KA+G   FE    DP FNK FN+GM
Sbjct  125   GVSMAALTLMNQDKVLMESWYYLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNEGM  184

Query  561   ESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVAT  740
             ++ + II+K ++  Y   GF  V  LVDVGGG GA +  I   +PHIKGINFDLPHV++ 
Sbjct  185   KNHSIIITKKLLEFY--KGFEDVNVLVDVGGGIGATLHMITSKYPHIKGINFDLPHVISE  242

Query  741   APEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVD  920
             AP + GV H+GGDMF S+PS  AI +KW++HDW DE C KIL+NC +ALP   GK+I+ +
Sbjct  243   APPFPGVEHIGGDMFASVPSGDAILMKWIMHDWSDEHCAKILENCHKALP-NNGKVILCE  301

Query  921   AVL--KPEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVA  1094
              +L   PE  P    + +V D++MLAH+ GGKERTE+E++ L   AGF  +      + A
Sbjct  302   CILPVAPEPIPSAQGVFHV-DMIMLAHNPGGKERTEKEYQDLAKGAGFTGFKAQYCFSTA  360

Query  1095  SIIE  1106
              ++E
Sbjct  361   WVLE  364



>ref|XP_004975403.1| PREDICTED: 5-pentadecatrienyl resorcinol O-methyltransferase-like 
[Setaria italica]
Length=366

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 155/366 (42%), Positives = 207/366 (57%), Gaps = 23/366 (6%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             D K +L +Q ++W +   ++ SMAL  A+DL I D IH H  A   TLSQI A    SP 
Sbjct  6     DSKELLQAQLELWHHAFGYVKSMALAVALDLGIADAIHRHGGAA--TLSQILAEAKLSPC  63

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGAT---VYGPTPASRWLVRD------AELSMAP  398
                  L R++R L     FT A     G     +Y  TPASR L+ D       E S++P
Sbjct  64    K-LHGLRRLMRALTVAGTFTIATSSGHGGDDEDIYELTPASRLLISDDVAGDDGEPSLSP  122

Query  399   MLL-----FQTHPLSMAPFHCFSRCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGME  563
             +L      F+  PL M     F +  + G   F  AHGK ++EMAA  P FN   ND M 
Sbjct  123   VLSLVLNPFRVSPLGMGIGAWFRQGDQPGVAPFAVAHGKNMWEMAARKPAFNALVNDAMA  182

Query  564   SVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATA  743
             + ++ + + IV     + F  V SLVDV GG G A   I KAFP ++    DLPHVVA A
Sbjct  183   ADSRFLMR-IVLRECAEVFHGVSSLVDVAGGLGGAATSIAKAFPELRCSVLDLPHVVANA  241

Query  744   PEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP--EKTGKLIIV  917
             P    V  V GDMF SIP A A+F+KW+LHDWGD+EC+KILKNC++A+P  +K GK+II+
Sbjct  242   PSGGNVQFVAGDMFQSIPQADAVFLKWILHDWGDDECIKILKNCKQAIPSRDKGGKVIII  301

Query  918   DAVLKPE-GDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVA  1094
             D V+  E  D    +   + DLL++  +  G ER E+EWK++ +EAGF +Y I+  + V 
Sbjct  302   DMVVGSESSDTRHLETQVLYDLLIMGIN--GVERDEQEWKKIFLEAGFNDYKIMSILGVR  359

Query  1095  SIIEAY  1112
             SIIE Y
Sbjct  360   SIIELY  365



>gb|KHG19041.1| 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase [Gossypium 
arboreum]
Length=328

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 146/328 (45%), Positives = 209/328 (64%), Gaps = 16/328 (5%)
 Frame = +3

Query  147   AVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSD  326
             +++L I D+I ++ +  P+ LS++A A+   PS     L RI+RL+V  +IF     P +
Sbjct  10    SIELGIADVIENYGS--PMPLSELATALRCDPS----RLHRIMRLMVHDQIFKQ--EPIN  61

Query  327   GATV-YGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFA---FEKAH  494
               TV +  TP SR L++  E SMA  +L  + P  +AP+H  S  V E G     FE A+
Sbjct  62    QHTVGFSSTPLSRCLIKGGEKSMAAFILLMSGPTCLAPWHSLSARVLETGNNISPFEVAN  121

Query  495   GKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaava  674
             GK I+  A  +P+F++ FN+ M    ++  +A + G   + F  V +LVD+GGG   A++
Sbjct  122   GKDIWSYAEANPDFSELFNNAMGCKARLTVQATIEGCP-EVFDGVENLVDIGGGNATALS  180

Query  675   EIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEEC  854
              +VKAFP I+GINFDLPHVVA AP+   + +VGGDMF+SIP+A A F+  VLHDW DEEC
Sbjct  181   ILVKAFPWIRGINFDLPHVVAVAPKSDSIENVGGDMFMSIPNADAAFLMTVLHDWDDEEC  240

Query  855   VKILKNCREALPEKTGKLIIVDAVLK--PEGDPIFGDISYVTDLLMLAHSSGGKERTEEE  1028
             VKILK CREA+PE  GK+IIV+AVL+   E D + G +  + D  M+A ++ GKERT +E
Sbjct  241   VKILKKCREAIPEDKGKVIIVEAVLEEDKEVDEV-GVVGLMLDTAMMAITNKGKERTLKE  299

Query  1029  WKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             W  +L ++GF  +N+    AV S+IEAY
Sbjct  300   WSYVLRQSGFTRFNVKPIRAVQSVIEAY  327



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/353 (40%), Positives = 205/353 (58%), Gaps = 14/353 (4%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             +   +L +QA +  ++L++++SM+LK A+ L IPDIIHSH  A  +T S +  A+  + S
Sbjct  10    ETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRA--MTRSDLVNALPINKS  67

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
                  + R++R+L+    F       +G   Y  TP SR L+++  LS+AP +  Q  P+
Sbjct  68    KGHECIYRLMRILIHASFFI------EGEDGYLLTPTSRLLLKNEPLSLAPFVQAQLDPI  121

Query  426   SMAPFHCFSRCVKEGGFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSG  602
              M P+H        G    F  AHGK +F+ A  DP  N+ FN+ MES  ++I  A++  
Sbjct  122   LMDPWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSALIKN  181

Query  603   YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
              G   F  + SLVDVGGG G     I  AFP +K   FDLPHVV        +S++ GDM
Sbjct  182   -GKRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNNLSYITGDM  240

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP--EKTGKLIIVDAVL-KPEGDPIF  953
             F S+PSA AI +KW+LHDW D++C KILK C+EA+P  E  GK+I++D V+   +GD   
Sbjct  241   FKSVPSADAILLKWILHDWSDKDCAKILKKCKEAIPSKENGGKVIVIDTVIDNQKGDDKS  300

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              +     D+LM+ H S GKER E+EW +L  +AGF +Y I   + + S+IE Y
Sbjct  301   FESQLFLDVLMMVHVS-GKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVY  352



>ref|XP_002867087.1| O-methyltransferase family 2 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43346.1| O-methyltransferase family 2 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 149/374 (40%), Positives = 216/374 (58%), Gaps = 24/374 (6%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             MEE      DE++   +   +W+Y+  F D  A K A+DL+IP+ I +H ++QP+TL+++
Sbjct  1     MEETKRRVLDEEA--KASLDIWRYIFGFADIAAAKCAIDLKIPEAIENHPSSQPVTLAEL  58

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELS  389
             ++A+  SPS     L RI+R LV + IF         AT Y  TP S  ++   RD + S
Sbjct  59    SSAVSASPS----HLRRIMRFLVHQGIFKEIPTKDGLATGYANTPLSHRMMITKRDGK-S  113

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVKE--GGFA---FEKAHGKGIFEMAAGDPEFNKSFND  554
             +AP +LF+T P  +AP+   S  V     G A   F+  HGK ++  A  +P  +   N+
Sbjct  114   LAPFVLFETTPEMLAPWLRLSSVVSSPFNGSAPPPFDAVHGKDVWSFAQDNPFLSDMINE  173

Query  555   GMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVV  734
              M    + +   +     G  F  V +++DVGGGTG  +  +VK FP IKG NFDLPHV+
Sbjct  174   AMACDARRVVPRVAGACHG-LFDGVVTVIDVGGGTGETMGILVKEFPWIKGFNFDLPHVI  232

Query  735   ATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLII  914
               A    GV +V GDMF SIP+  A+ IKWVLHDWGD++C+KILKNC+EA+P   GK++I
Sbjct  233   EVAQVLDGVENVEGDMFDSIPACDAVIIKWVLHDWGDKDCIKILKNCKEAVPPNNGKVLI  292

Query  915   VDAVLKP--------EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYN  1070
             V++V+          E D     +  + D++M+AH+S GKERT +EW  +L EAGF  Y 
Sbjct  293   VESVIGENKKTMIVDERDDKLEHVRLMLDMVMMAHTSTGKERTLKEWDFVLKEAGFARYE  352

Query  1071  IIQNIAVASIIEAY  1112
             +     V S+I AY
Sbjct  353   VRDIDDVQSLIIAY  366



>ref|XP_008382454.1| PREDICTED: 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase-like 
[Malus domestica]
Length=360

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/346 (39%), Positives = 211/346 (61%), Gaps = 11/346 (3%)
 Frame = +3

Query  84    HSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATL  263
              ++  +WKY+  F++   +K A++L I D I  H +  P+TL ++++A+    S D + L
Sbjct  22    RAKVDMWKYVFGFVEIAVVKCAIELGIADAIEIHGS--PMTLLELSSAL----SCDPSHL  75

Query  264   SRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAPFH  443
              R++R+LV  KIF        G   Y  TP S+ L++  E SMA ++L ++ P+ +AP+H
Sbjct  76    YRVMRVLVHLKIFKEKTTEL-GPKGYAQTPLSKRLLKSGENSMAALILLESSPVMLAPWH  134

Query  444   CFS-RCVKEGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGF  620
               S R       +FE  HG+ ++  AA +P+ +K  ND M    ++   A++     + F
Sbjct  135   GLSARLRGNSNPSFEAVHGEDLWSFAAANPDHSKLINDAMACDARVAVPAVIESCL-EVF  193

Query  621   RSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPS  800
             + + ++VDVGGG G  +  +V+  P I+GINFD PHVV+ A E   + +VGGD F  +P 
Sbjct  194   KGLETIVDVGGGDGTTLRLLVETCPWIRGINFDRPHVVSVAHECDRIENVGGDFFYCVPK  253

Query  801   AQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLKPEG--DPIFGDISYVT  974
             A A  I WVLHDWGD++C++ILK CREA+P   GK+II++AV++ +G  D    D+  + 
Sbjct  254   ADAAIIMWVLHDWGDDDCIRILKKCREAIPNDKGKVIIIEAVIEEDGKEDNKLADVRLML  313

Query  975   DLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             D++MLAH++ GKERT +EW  +L EAGF  Y I    AV S+I+A+
Sbjct  314   DMVMLAHTNTGKERTFKEWGYVLGEAGFSRYTITPIHAVQSVIQAF  359



>ref|XP_010432319.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Camelina 
sativa]
Length=368

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 148/374 (40%), Positives = 216/374 (58%), Gaps = 24/374 (6%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             ME+      DE++   +   +W+Y+  F D  A K A+DL IP+ I +H ++ P+TL+++
Sbjct  1     MEDTKKQLVDEEA--KASLDIWRYVFGFADIAAAKCAIDLNIPEAIENHPSSHPVTLAEL  58

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELS  389
             ++A+  SPS     L RI+R LV + +F         AT Y  TP SR ++   RD + S
Sbjct  59    SSAVSASPS----HLRRIMRFLVHQGLFKEVATKDGLATGYTNTPLSRRMMITKRDGK-S  113

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVKE--GGFA---FEKAHGKGIFEMAAGDPEFNKSFND  554
             +AP +LF+T P  +AP+   S  V     G     F+  HGK ++  A G+P  +   N+
Sbjct  114   LAPFVLFETRPEMLAPWLRLSSVVPSPVNGSTPPPFDAVHGKDVWSFAQGNPGLSDLINE  173

Query  555   GMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVV  734
              M   T+ +   +     G     V ++VDVGGGTG  +  +VK FP IKG NFDLPHV+
Sbjct  174   AMACDTRRVVPRVAGACHG-LLDDVDTVVDVGGGTGETLGILVKEFPWIKGFNFDLPHVI  232

Query  735   ATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLII  914
               A    GV++V GDMF S+P+  A+FIKWVLHDWGD++C+KILKNC+EA+P   GK++I
Sbjct  233   GVAQNLDGVTNVEGDMFDSVPACDAVFIKWVLHDWGDKDCIKILKNCKEAVPPIVGKVLI  292

Query  915   VDAVLKP--------EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYN  1070
             V+AV+          E D     +  + D++M+AH+S GKERT +EW  +L EAGF  Y 
Sbjct  293   VEAVIGENKKTMIVNERDEKLEHVRLMLDMVMMAHTSTGKERTLKEWDFVLTEAGFARYE  352

Query  1071  IIQNIAVASIIEAY  1112
             +     V  +I AY
Sbjct  353   VRDIDDVQCLIIAY  366



>gb|AAX82431.1| 3,5-dimethoxyphenol O-methyltransferase [Ruta graveolens]
Length=374

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 150/360 (42%), Positives = 208/360 (58%), Gaps = 21/360 (6%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             +  +Q QVW   L+ ++S++LK AV+L IPDIIHSH   QP+TLSQI +A++  P+  T 
Sbjct  20    LFKAQGQVWNCALNCVNSLSLKCAVELGIPDIIHSHG--QPMTLSQICSALNIQPNK-TQ  76

Query  258   TLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAP  437
              + R++R+LV    F S  R  D    YG TPASR L++D     A  LLF THP     
Sbjct  77    AMERVMRILVHSGFF-SLSRDDDPQGYYGLTPASRLLLKDEPFGAAKFLLFMTHPHMTDS  135

Query  438   FHCFSRCVKEG-GFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGD  614
              +  S   +     +FE  HGKG +E  AG+ +F+K F D ME+ +++I   ++  Y  +
Sbjct  136   LNSLSSWFQNDVPTSFETTHGKGYWEFVAGEDKFSKIFYDCMEADSELIVSVLIKDYK-E  194

Query  615   GFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSI  794
              F  +GSLVDVGGGTGA    + KAFP I    FD PHVV      Q +   GGDMF +I
Sbjct  195   VFEGIGSLVDVGGGTGATALALAKAFPEINFTVFDQPHVVHNLQGTQNLRFQGGDMFDAI  254

Query  795   PSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVL------KPEGDPIFG  956
             P A A  +KW  HDWGDE+CVKILK C+EA+P K GK+II++  +      + E +    
Sbjct  255   PPADAFLLKWTSHDWGDEDCVKILKKCKEAIPSK-GKVIIIEIAIKENSKEEAEEEKEKD  313

Query  957   DISYVT--------DLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
             D S  T        D++ +   + GK+RT  EW+++L  AGF +Y I   +   S+IEAY
Sbjct  314   DCSSKTETETQLCFDMMCMQAYNFGKQRTVREWEKVLEGAGFSHYKITPCLGARSLIEAY  373



>ref|XP_009138347.1| PREDICTED: (R,S)-reticuline 7-O-methyltransferase-like [Brassica 
rapa]
Length=367

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 140/368 (38%), Positives = 215/368 (58%), Gaps = 26/368 (7%)
 Frame = +3

Query  69    EKSMLHSQAQ----VWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHD  236
             ++++L+ +A+    +W+Y+  F D  A K A+DL+IP+ I +H ++ P+TL++++ A+  
Sbjct  5     KRNLLYEEAKASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSLPVTLAELSVAVSA  64

Query  237   SPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELSMAPMLL  407
             SPS     L RI+R LV + IF         AT Y  TP SR ++   RD + S+AP +L
Sbjct  65    SPS----HLHRIMRFLVHQGIFKQVPIKDGLATGYTNTPLSRLMMITKRDGK-SLAPFVL  119

Query  408   FQTHPLSMAPFHCFSRCVKEGGFA-----FEKAHGKGIFEMAAGDPEFNKSFNDGMESVT  572
             F+T P  +AP+   S  V           F+  HGK ++ +A  +P  +   N+ M   T
Sbjct  120   FETSPEMLAPWLRLSSVVASPANGSHPPPFDAVHGKDVWALAEDNPCLSHMINEAMACDT  179

Query  573   QIISKAIVSGYGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEY  752
             + +   +      D F  V ++VDVGG TG  +  +VK FP IKG NFD+PHV+  A   
Sbjct  180   RRVVPRVARACH-DLFEGVATVVDVGGCTGETMGILVKEFPWIKGFNFDVPHVIQVAQVL  238

Query  753   QGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKLIIVDAVLK  932
              GV +VGGDMF S+P   A+ IKWVLHDWGD++C++ILKNC+EA+P   GK++IV++V++
Sbjct  239   DGVENVGGDMFDSVPKCDAVLIKWVLHDWGDKDCIRILKNCKEAVPPNIGKVLIVESVIR  298

Query  933   --------PEGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIA  1088
                      + D     +  + D++M+AH++ GKERT +EW  +L EAGF  Y +     
Sbjct  299   EKKKAMIVEDRDEKLEHVRLMLDMVMMAHTTTGKERTLKEWDFVLNEAGFARYEVRDIDD  358

Query  1089  VASIIEAY  1112
             V  +I AY
Sbjct  359   VQCVIIAY  366



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 210/350 (60%), Gaps = 10/350 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             +LH+QA VW ++ +FI+SM+LK A+ L IPDIIH+H   +P+TL ++ A +   P     
Sbjct  12    LLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHG--KPMTLPELVAKLPIHPK-KVW  68

Query  258   TLSRILRLLVRRKIFT-SAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMA  434
              + R++R+LV+   F    V  S+    Y  T ASR L+ D  LS+ P LL    P+   
Sbjct  69    CVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLDPILTK  128

Query  435   PFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             P+H  S   + +    F+ AHG+  ++    +P+ N  FN+ M S  ++++  ++    G
Sbjct  129   PWHYVSAWFQNDDPTPFDTAHGRTFWDYGGHEPKINNFFNEAMASDARLVTSVLIKDCKG  188

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
               F  + SLVDVGGGTG     I  AFPH+    FDLPHVVA     + ++++GGDMF  
Sbjct  189   -VFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGDMFKG  247

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALP--EKTGKLIIVDAVLKPE-GDPIFGDI  962
             IP A AI +KW+LHDW DEECVKIL+ CR+A+P  EK GK+II+D +++ + GD    + 
Sbjct  248   IPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQKGDDESMET  307

Query  963   SYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                 D+LM+   + G+ER E+EW++L ++AGF  Y I   + + S+IE Y
Sbjct  308   QLFFDMLMMILVT-GQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVY  356



>emb|CAI30878.1| caffeate O-methyltransferase [Picea abies]
 gb|ABK23738.1| unknown [Picea sitchensis]
Length=364

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 194/316 (61%), Gaps = 12/316 (4%)
 Frame = +3

Query  132   MALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA-TLSRILRLLVRRKIFTS  308
             M +KAA++L +  II +      ++  QI A I  + +PD A TL RILR+L    + + 
Sbjct  34    MGMKAAIELDVLQIIANAGNGVQLSPRQIVAHI-PTTNPDAAITLDRILRVLASHSVLSC  92

Query  309   AVRPSDGAT---VYGPTPASRWLVRDAE-LSMAPMLLFQTHPLSMAPFHCFSRCVKEGGF  476
             +V   +      +YG TP  ++LV++ + +S+AP++L     + M  ++     V EG  
Sbjct  93    SVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMDSWYYLKDAVLEGSQ  152

Query  477   AFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvggg  656
              F KAHG   FE  A D  FN+ FN GM   + ++   I+  Y   GF+ V  LVDVGGG
Sbjct  153   PFTKAHGMNAFEYPAKDQRFNRVFNRGMSEHSTMLMNKILDTY--QGFKEVQELVDVGGG  210

Query  657   tgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHD  836
              G+ +  IV  +PHI GINFD+PHVV  AP Y  V HVGGDMF S+P+ QAIF+KW+LHD
Sbjct  211   VGSTLNLIVSRYPHISGINFDMPHVVTDAPHYPAVKHVGGDMFDSVPTGQAIFMKWILHD  270

Query  837   WGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPIFGDISYVTDLLMLAHSSGGK  1010
             W D+ C K+LKNC +ALPEK GK+I+VD +L    E  P +    +  DLLMLA++ GGK
Sbjct  271   WSDDHCRKLLKNCHKALPEK-GKVIVVDTILPVAAETSP-YARQGFHIDLLMLAYNPGGK  328

Query  1011  ERTEEEWKRLLMEAGF  1058
             ERTE+E++ L  EAGF
Sbjct  329   ERTEQEFQDLAKEAGF  344



>ref|XP_010437514.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Camelina 
sativa]
Length=368

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 142/376 (38%), Positives = 213/376 (57%), Gaps = 28/376 (7%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             ME++     DE++   +   +W+Y+  F D  A K A+DL+IP+ I +H ++ P+TL+++
Sbjct  1     MEDIKKKIVDEEA--KASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSHPVTLAEL  58

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELS  389
             ++A+  SPS     L RI+R LV + +F         AT Y  TP SR ++   RD + S
Sbjct  59    SSAVSASPS----HLRRIMRFLVHQGLFKEVPIKDGLATGYTNTPLSRRMMITKRDGK-S  113

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVKE--GGFA---FEKAHGKGIFEMAAGDPEFNKSFND  554
             +AP +LF+T P  +AP+   S  V     G     F+  HGK ++  A  +P  ++  N+
Sbjct  114   LAPFVLFETRPEMLAPWLRLSSVVSSPVNGSTPPPFDAVHGKDVWSFAQDNPGLSELINE  173

Query  555   GMESVTQIISKAIVSGYGG--DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPH  728
              M   T+ +   +     G  DG  +V  +    G T      +VK FP IKG NFDLPH
Sbjct  174   AMACDTRRVVPRVAGACHGLLDGVDTVVDVGGGTGETLGI---LVKEFPWIKGYNFDLPH  230

Query  729   VVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKL  908
             V+  A    GV+++ GDMF SIP+  A+FIKWVLHDWGD++C+KILKNC+EA+P   GK+
Sbjct  231   VIEVAQFLDGVTNIEGDMFDSIPACDAVFIKWVLHDWGDKDCIKILKNCKEAVPPIVGKV  290

Query  909   IIVDAVLKP--------EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPN  1064
             +IV++V+          E D     +  + D++M+AH+S GKERT +EW  +L EAGF  
Sbjct  291   LIVESVIGENKKTMIVDERDEKLEHVRLMLDMVMMAHTSTGKERTLKEWDFVLTEAGFAR  350

Query  1065  YNIIQNIAVASIIEAY  1112
             Y +     V  +I AY
Sbjct  351   YEVKDIDDVQCLIIAY  366



>ref|XP_002278127.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=354

 Score =   237 bits (604),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 148/349 (42%), Positives = 209/349 (60%), Gaps = 11/349 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             +  +Q+ ++K++  F+DSM+LK AV L IPD IH+H   QPITL ++A+AI   P   T+
Sbjct  12    LFEAQSFIYKHVFSFMDSMSLKCAVQLGIPDAIHNHN--QPITLPELASAIQ-VPPEKTS  68

Query  258   TLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMAP  437
              L +++RLLV    F +  +  +    Y  TP SR LV+    S+AP++L    P+ + P
Sbjct  69    RLHQLMRLLVHSGFF-AMQKVDENQEGYVLTPPSRLLVKGNATSLAPIVLGMLDPVLVTP  127

Query  438   FHCFSRCVKEGGF-AFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGD  614
             +H     ++     AFE AHG  ++     +PEF     + M + ++++S AI      +
Sbjct  128   WHFLGSWLQGSSLTAFEAAHGMDLWNYGNQNPEFFSLIGEIMATDSRMMSLAIREC--KE  185

Query  615   GFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSI  794
              F  + SLVDVGGGTG     I +AFPH+K    DLP VVA  P+ + + +VGGDMF SI
Sbjct  186   IFEGLSSLVDVGGGTGTMARGICEAFPHLKCTVLDLPQVVANLPKSENLDYVGGDMFQSI  245

Query  795   PSAQAIFIKWVLHDWGDEECVKILKNCREALPEKT--GKLIIVDAVLKPEGDP-IFGDIS  965
             PSA AIFIK VLH+WGDE+CVKILK CREA+P     GK+II+D VL  + D        
Sbjct  246   PSADAIFIKSVLHNWGDEDCVKILKRCREAIPSSAEGGKVIIIDLVLSNKKDEHELAKTK  305

Query  966   YVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                D++M+   + GKER EEEW++L +EAGF +Y I     V S+IE Y
Sbjct  306   LFNDMMMMVLVA-GKERCEEEWEKLFLEAGFSHYKITPRFGVLSLIEVY  353



>ref|XP_008788729.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase [Phoenix 
dactylifera]
Length=367

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 138/331 (42%), Positives = 201/331 (61%), Gaps = 10/331 (3%)
 Frame = +3

Query  132   MALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTATLSRILRLLVRRKIFTSA  311
             M LK A++L + +II    +A  ++ +++AA +        A L R+LRLL    + T +
Sbjct  38    MTLKNAIELDVLEIIAKAGSAAKLSPAEVAAQLPTKNPMAAAMLDRMLRLLASYNVLTCS  97

Query  312   VR-PSDGATV--YGPTPASRWLVRDAE-LSMAPMLLFQTHPLSMAPFHCFSRCVKEGGFA  479
             V   +DG  +  YGP P  +WL ++ + +SMA + L     + M  ++     V +GG  
Sbjct  98    VEVDADGKPLRRYGPAPVCKWLTKNEDGVSMAALTLMNQDKILMESWYYLKDAVLDGGIP  157

Query  480   FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvgggt  659
             F KA+G   FE    DP FN+ FN+GM++ + II+K ++  Y   GF  V  LVDVGGG 
Sbjct  158   FNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSIIITKKLLEFY--KGFEDVNVLVDVGGGI  215

Query  660   gaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDW  839
             GA +  I   +PHI+GINFDLPHV++ AP +  V HVGGDMF S+PS  +I +KW++HDW
Sbjct  216   GATLQMITAKYPHIRGINFDLPHVISEAPPFPDVEHVGGDMFASVPSGDSILMKWIMHDW  275

Query  840   GDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPIFGDISYVTDLLMLAHSSGGKE  1013
              DE C KIL+NC +ALP+  GK+I+V+ +L   PE  P    + +V D++MLAH+ GGKE
Sbjct  276   SDEHCAKILENCYKALPD-NGKVILVECILPVAPEPTPSAQGVFHV-DMIMLAHNPGGKE  333

Query  1014  RTEEEWKRLLMEAGFPNYNIIQNIAVASIIE  1106
             RTE+E++ L   AGF  +      + A IIE
Sbjct  334   RTEKEYQALAKGAGFTGFKAQYCFSTAWIIE  364



>ref|XP_008775842.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Phoenix 
dactylifera]
Length=367

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 199/332 (60%), Gaps = 12/332 (4%)
 Frame = +3

Query  132   MALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTAT-LSRILRLLVRRKIFTS  308
             M LKAA++L I +II        ++ +++A  +  + +P  AT L R+LRLL    I T 
Sbjct  38    MTLKAAIELDILEIIVKAGPGAKLSPAEVATQL-PTENPMAATMLDRMLRLLASYNILTC  96

Query  309   AVR-PSDGATV--YGPTPASRWLVRDAE-LSMAPMLLFQTHPLSMAPFHCFSRCVKEGGF  476
             +V   +DG     YG  P  +WL ++ E  SM+ + L     + M  ++     V +GG 
Sbjct  97    SVEIDADGKPFRRYGAAPVCKWLTKNKEGASMSALTLMNQDKILMGSWYYLKDAVLDGGI  156

Query  477   AFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvggg  656
              F KA+G   FE    DP FN+ FN+ M+  + I +  ++  Y  +GF  V  LVDVGGG
Sbjct  157   PFNKAYGTTAFEYYGTDPRFNRVFNEAMKDHSTITTMKLLEFY--NGFEDVKVLVDVGGG  214

Query  657   tgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHD  836
              GA +  I   +PHIKGINFDLPHV++ AP +QGV HVGGDMF S+PS  AIF+KW++HD
Sbjct  215   IGATINMITSKYPHIKGINFDLPHVISEAPAFQGVEHVGGDMFASVPSGDAIFMKWIMHD  274

Query  837   WGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPIFGDISYVTDLLMLAHSSGGK  1010
             W DE CVKILKNC +ALP+  GK+I+V+ +L   PE  P    + ++ D++MLAH+ GGK
Sbjct  275   WSDELCVKILKNCYKALPD-NGKVILVECILPVAPEPTPSAQGVFHL-DMIMLAHNPGGK  332

Query  1011  ERTEEEWKRLLMEAGFPNYNIIQNIAVASIIE  1106
             ERTEEE+K L   AGF         A   +IE
Sbjct  333   ERTEEEYKDLAEGAGFTGLKAQYCFATTWVIE  364



>ref|XP_010446970.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase-like [Camelina 
sativa]
Length=368

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 142/376 (38%), Positives = 212/376 (56%), Gaps = 28/376 (7%)
 Frame = +3

Query  39    MEEVMDGSFDEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQI  218
             ME++     DE++   +   +W+Y+  F D  A K A+DL+IP+ I +H ++ P+TL+++
Sbjct  1     MEDIKKKLVDEEA--KASLDIWRYVFGFADIAAAKCAIDLKIPEAIENHPSSHPVTLAEL  58

Query  219   AAAIHDSPSPDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLV---RDAELS  389
             ++A+  SPS     L RI+R LV + +F         AT Y  TP SR ++   RD + S
Sbjct  59    SSAVSASPS----HLRRIMRFLVHQGLFKEVPIKDGLATGYTNTPLSRCMMITKRDGK-S  113

Query  390   MAPMLLFQTHPLSMAPFHCFSRCVKE--GGFA---FEKAHGKGIFEMAAGDPEFNKSFND  554
             +AP +LF+T P  +AP+   S  V     G     F+  HGK ++  A  +P  +   N+
Sbjct  114   LAPFVLFETRPEMLAPWLRLSSVVSSPVNGSTPPPFDAVHGKDVWSFAQDNPGLSDLINE  173

Query  555   GMESVTQIISKAIVSGYGG--DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPH  728
              M   T+ +   +     G  DG  +V  +    G T      +VK FP IKG NFDLPH
Sbjct  174   AMACDTRRVVPRVAGACHGLLDGVDTVVDVGGGTGETLGI---LVKEFPWIKGYNFDLPH  230

Query  729   VVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALPEKTGKL  908
             V+  A    GV+++ GDMF SIP+  A+FIKWVLHDWGD++C+KILKNC+EA+P   GK+
Sbjct  231   VIEVAQILDGVTNIEGDMFDSIPACDAVFIKWVLHDWGDKDCIKILKNCKEAVPPIVGKV  290

Query  909   IIVDAVLKP--------EGDPIFGDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPN  1064
             +IV++V+          E D     +  + D++M+AH+S GKERT +EW  +L EAGF  
Sbjct  291   LIVESVIGENKKTMIVDERDEKLEHVRLMLDMVMMAHTSTGKERTLKEWDFVLTEAGFAR  350

Query  1065  YNIIQNIAVASIIEAY  1112
             Y +     V  +I AY
Sbjct  351   YEVRDIDDVQCLIIAY  366



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 142/353 (40%), Positives = 210/353 (59%), Gaps = 11/353 (3%)
 Frame = +3

Query  75    SMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDT  254
             ++L +Q+ VW ++ +FI+SM+LK  VDL IPDIIH+H    PI+    +  IH S  P  
Sbjct  13    NLLKAQSHVWNHIFNFINSMSLKCVVDLGIPDIIHNHGKPMPISKLISSLPIHPSKKP--  70

Query  255   ATLSRILRLLVRRKIFTSA-VRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSM  431
               + R++R++     F+   +  ++    Y  T ASR L++D  +S+ P +     P+ M
Sbjct  71    -CIHRLMRIMTHSGFFSQQNIAANEPEIEYMLTDASRLLLKDNPMSVTPFVYAMLDPVMM  129

Query  432   APFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYG  608
              P+H FS  +K +   +FE  HG  ++E AA D +FN  FN+ M +  Q++S  +V    
Sbjct  130   NPWHQFSMWLKNDDTTSFETTHGMLLWEYAACDSKFNNLFNESMANDAQLVSNLLVEKCK  189

Query  609   GDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFV  788
             G  F    SLVDVGGGTG       K+FP ++ I FDLPHVV      + +S+VGGDMF 
Sbjct  190   G-VFNEFESLVDVGGGTGTMAKTFAKSFPQMECIVFDLPHVVDGLQGSENLSYVGGDMFK  248

Query  789   SIPSAQAIFIKWVLHDWGDEECVKILKNCREALPE--KTGKLIIVDAVLKPE-GDPIFG-  956
              IP   AI +KW+LHDW DEECVKILKNC++A+ +  K GK++I+D VL  E GD     
Sbjct  249   EIPPTDAILLKWILHDWNDEECVKILKNCKDAISKKGKEGKVVIIDMVLDCEKGDNNESV  308

Query  957   DISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAYS  1115
             +     D+LM+  +  GKERT++EW +L+  AGF +Y I   + + ++IE Y+
Sbjct  309   ETKLFFDMLMMV-TLTGKERTKKEWVKLISSAGFCDYKITPILGLRAVIEIYT  360



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 209/350 (60%), Gaps = 10/350 (3%)
 Frame = +3

Query  78    MLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA  257
             +LH+QA VW ++ +FI+SM+LK A+ L IPDIIH+H   +P+TL ++ A +   P     
Sbjct  12    LLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHG--KPMTLPELVAKLPIHPK-KVW  68

Query  258   TLSRILRLLVRRKIFT-SAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPLSMA  434
              + R++R+LV+   F    V  S+    Y  T ASR L+ D  LS+ P LL    P+   
Sbjct  69    CVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLDPILTK  128

Query  435   PFHCFSRCVK-EGGFAFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGG  611
             P+H  S   + +    F+ AHG   ++    +P+ N  FN+ M S  ++++  ++    G
Sbjct  129   PWHYVSAWFQNDDPTPFDTAHGXTFWDYGGHEPKJNNFFNEAMASDARLVTSXLIKDCKG  188

Query  612   DGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVS  791
               F  + SLVDVGGGTG     I  AFPH+    FDLPHVVA     + ++++GGDMF  
Sbjct  189   -VFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGDMFKG  247

Query  792   IPSAQAIFIKWVLHDWGDEECVKILKNCREALP--EKTGKLIIVDAVLKPE-GDPIFGDI  962
             IP A AI +KW+LHDW DEECVKIL+ CR+A+P  EK GK+II+D +++ + GD    + 
Sbjct  248   IPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQKGDDESMET  307

Query  963   SYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
                 D+LM+   + G+ER E+EW++L ++AGF  Y I   + + S+IE Y
Sbjct  308   QLFFDMLMMILVT-GQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVY  356



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 139/353 (39%), Positives = 203/353 (58%), Gaps = 14/353 (4%)
 Frame = +3

Query  66    DEKSMLHSQAQVWKYMLHFIDSMALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPS  245
             +   +L +QA +  ++L++++SM+LK A+ L IPDIIHSH  A  +T S +  A+  + S
Sbjct  10    ETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRA--MTRSDLVNALPINKS  67

Query  246   PDTATLSRILRLLVRRKIFTSAVRPSDGATVYGPTPASRWLVRDAELSMAPMLLFQTHPL  425
                  + R++R+L+    F       +G   Y  TP SR L+++  L++AP +     P+
Sbjct  68    KGHECIYRLMRILIHTGFFI------EGEEGYLLTPTSRLLLKNEPLNLAPFVQAHLDPI  121

Query  426   SMAPFHCFSRCVKEGGFA-FEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSG  602
              M P+H        G    F  AHGK +F+ A  DP  N+ FN+ MES  ++I   ++  
Sbjct  122   LMDPWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSVLIKN  181

Query  603   YGGDGFRSVGSLvdvgggtgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDM  782
              G   F  + SLVDVGGG G     I  AFP +K   FDLPHVV        +S++ GDM
Sbjct  182   -GKRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNNLSYITGDM  240

Query  783   FVSIPSAQAIFIKWVLHDWGDEECVKILKNCREALP--EKTGKLIIVDAVL-KPEGDPIF  953
             F S+PSA AI +KW+LHDW DE+C KILK C+EA+P  E  GK+I++D V+   +GD   
Sbjct  241   FKSVPSADAILLKWILHDWSDEDCAKILKKCKEAIPSKENGGKVIVIDTVIDNQKGDDKS  300

Query  954   GDISYVTDLLMLAHSSGGKERTEEEWKRLLMEAGFPNYNIIQNIAVASIIEAY  1112
              +     D+LM+ H S GKER E+EW +L  +AGF +Y I   + + S+IE Y
Sbjct  301   FETQLFLDVLMMVHVS-GKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVY  352



>gb|ABK22490.1| unknown [Picea sitchensis]
Length=364

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 193/316 (61%), Gaps = 12/316 (4%)
 Frame = +3

Query  132   MALKAAVDLRIPDIIHSHAAAQPITLSQIAAAIHDSPSPDTA-TLSRILRLLVRRKIFTS  308
             M +KAA++L +  II +      ++  QI A I  + +PD A TL RILR+L    + + 
Sbjct  34    MGMKAAIELDVLQIIANAGNGVQLSPRQIVAHI-PTTNPDAAITLDRILRVLASHSVLSC  92

Query  309   AVRPSDGAT---VYGPTPASRWLVRDAE-LSMAPMLLFQTHPLSMAPFHCFSRCVKEGGF  476
             +V   +      +YG TP  ++LV + + +S+AP++L     + M  ++     V EG  
Sbjct  93    SVTTDENGKAERLYGLTPLCKYLVMNQDGVSLAPLVLMNQDKVLMDSWYYLKDAVLEGSQ  152

Query  477   AFEKAHGKGIFEMAAGDPEFNKSFNDGMESVTQIISKAIVSGYGGDGFRSVGSLvdvggg  656
              F KAHG   FE  A D  FN+ FN GM   + ++   I+  Y   GF+ V  LVDVGGG
Sbjct  153   PFTKAHGMNAFEYPAKDQRFNRVFNRGMSEHSTMLMNKILDTY--QGFKEVQELVDVGGG  210

Query  657   tgaavaEIVKAFPHIKGINFDLPHVVATAPEYQGVSHVGGDMFVSIPSAQAIFIKWVLHD  836
              G+ +  IV  +PHI GINFD+PHVV  AP Y  V HVGGDMF S+P+ QAIF+KW+LHD
Sbjct  211   VGSTLNLIVSRYPHISGINFDMPHVVTDAPHYPAVKHVGGDMFDSVPTGQAIFMKWILHD  270

Query  837   WGDEECVKILKNCREALPEKTGKLIIVDAVL--KPEGDPIFGDISYVTDLLMLAHSSGGK  1010
             W D+ C K+LKNC +ALPEK GK+I+VD +L    E  P +    +  DLLMLA++ GGK
Sbjct  271   WSDDHCRKLLKNCHKALPEK-GKVIVVDTILPVAAETSP-YARQGFHIDLLMLAYNPGGK  328

Query  1011  ERTEEEWKRLLMEAGF  1058
             ERTE+E++ L  EAGF
Sbjct  329   ERTEQEFQDLAKEAGF  344



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3297274815984