BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c88323_g1_i1 len=671 path=[1:0-670]

Length=671
                                                                      Score     E

ref|XP_006340936.1|  PREDICTED: probable methyltransferase PMT27-...    135   1e-32   
ref|XP_009590098.1|  PREDICTED: probable methyltransferase PMT27        133   9e-32   
ref|XP_009798747.1|  PREDICTED: probable methyltransferase PMT27        132   3e-31   
ref|XP_004233730.2|  PREDICTED: probable methyltransferase PMT27        130   1e-30   
ref|XP_002533655.1|  ATP binding protein, putative                      125   8e-29   Ricinus communis
ref|XP_010030876.1|  PREDICTED: probable methyltransferase PMT27        122   6e-28   
ref|XP_004170954.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    120   1e-27   
ref|XP_010271514.1|  PREDICTED: probable methyltransferase PMT27        120   2e-27   
ref|XP_008241902.1|  PREDICTED: probable methyltransferase PMT27        119   6e-27   
ref|XP_008440784.1|  PREDICTED: probable methyltransferase PMT27        119   9e-27   
ref|XP_010263954.1|  PREDICTED: probable methyltransferase PMT27        119   1e-26   
ref|XP_007203224.1|  hypothetical protein PRUPE_ppa000863mg             118   1e-26   
ref|XP_004149997.1|  PREDICTED: probable methyltransferase PMT27-...    118   2e-26   
gb|KGN48886.1|  hypothetical protein Csa_6G504660                       118   2e-26   
ref|XP_011028617.1|  PREDICTED: probable methyltransferase PMT27        117   5e-26   
ref|XP_008338020.1|  PREDICTED: probable methyltransferase PMT27        116   6e-26   
emb|CDP01948.1|  unnamed protein product                                116   7e-26   
ref|XP_006383147.1|  dehydration-responsive family protein              115   2e-25   
ref|XP_002310282.2|  hypothetical protein POPTR_0007s13620g             114   4e-25   Populus trichocarpa [western balsam poplar]
gb|EPS60899.1|  hypothetical protein M569_13900                         112   4e-25   
ref|XP_009346291.1|  PREDICTED: probable methyltransferase PMT27        114   4e-25   
ref|XP_008337883.1|  PREDICTED: probable methyltransferase PMT27        114   5e-25   
gb|KHG06183.1|  hypothetical protein F383_31802                         112   1e-24   
ref|XP_011025891.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    112   3e-24   
ref|XP_007046783.1|  S-adenosyl-L-methionine-dependent methyltran...    110   6e-24   
ref|XP_008805853.1|  PREDICTED: probable methyltransferase PMT26        110   6e-24   
ref|XP_004289108.1|  PREDICTED: probable methyltransferase PMT27-...    108   4e-23   
ref|XP_010679826.1|  PREDICTED: probable methyltransferase PMT27        107   9e-23   
emb|CDY72237.1|  BnaC08g48790D                                          102   4e-22   
ref|XP_010908928.1|  PREDICTED: probable methyltransferase PMT26        105   5e-22   
ref|XP_002267515.2|  PREDICTED: probable methyltransferase PMT27        104   9e-22   Vitis vinifera
emb|CBI17424.3|  unnamed protein product                                103   1e-21   
gb|KDP32665.1|  hypothetical protein JCGZ_13663                         103   1e-21   
ref|XP_006403957.1|  hypothetical protein EUTSA_v10010109mg             103   2e-21   
emb|CDY26534.1|  BnaC01g23650D                                          103   2e-21   
ref|NP_190676.1|  putative methyltransferase PMT27                      103   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149307.1|  PREDICTED: probable methyltransferase PMT27        102   3e-21   
gb|KDO71070.1|  hypothetical protein CISIN_1g002884mg                   102   3e-21   
ref|XP_006467154.1|  PREDICTED: probable methyltransferase PMT27-...    102   4e-21   
emb|CDY33299.1|  BnaA01g19660D                                          101   4e-21   
ref|XP_006425567.1|  hypothetical protein CICLE_v10024982mg             102   4e-21   
ref|XP_006290554.1|  hypothetical protein CARUB_v10016641mg             102   6e-21   
ref|XP_009115787.1|  PREDICTED: probable methyltransferase PMT27        102   6e-21   
gb|KDP39437.1|  hypothetical protein JCGZ_03719                         101   6e-21   
ref|XP_010426649.1|  PREDICTED: probable methyltransferase PMT27        101   7e-21   
ref|XP_010503787.1|  PREDICTED: probable methyltransferase PMT27        101   7e-21   
ref|XP_010515490.1|  PREDICTED: probable methyltransferase PMT27        101   8e-21   
dbj|BAD54068.1|  ankyrin-like                                         99.4    8e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CDY66535.1|  BnaA09g54660D                                          100   1e-20   
gb|KHN36073.1|  Putative methyltransferase PMT27                        100   1e-20   
ref|XP_008783335.1|  PREDICTED: probable methyltransferase PMT26        100   1e-20   
ref|NP_001058561.1|  Os06g0712800                                     99.8    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002516311.1|  ATP binding protein, putative                      100   2e-20   Ricinus communis
ref|XP_010412715.1|  PREDICTED: probable methyltransferase PMT27      98.6    2e-20   
gb|KDO51661.1|  hypothetical protein CISIN_1g003776mg                 99.4    2e-20   
ref|XP_011031158.1|  PREDICTED: probable methyltransferase PMT26 ...    100   2e-20   
ref|XP_011031156.1|  PREDICTED: probable methyltransferase PMT26 ...    100   3e-20   
ref|XP_011031160.1|  PREDICTED: probable methyltransferase PMT26 ...    100   3e-20   
ref|XP_011031157.1|  PREDICTED: probable methyltransferase PMT26 ...    100   3e-20   
ref|XP_009410679.1|  PREDICTED: probable methyltransferase PMT26      99.8    3e-20   
ref|XP_011031161.1|  PREDICTED: probable methyltransferase PMT26 ...  99.8    3e-20   
ref|XP_010674444.1|  PREDICTED: probable methyltransferase PMT26      99.8    3e-20   
ref|XP_002306259.2|  dehydration-responsive family protein            99.8    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010557710.1|  PREDICTED: probable methyltransferase PMT27      99.8    3e-20   
ref|XP_003516560.1|  PREDICTED: probable methyltransferase PMT27-...  99.4    4e-20   
ref|XP_002285889.2|  PREDICTED: probable methyltransferase PMT24      99.4    4e-20   Vitis vinifera
ref|XP_010277710.1|  PREDICTED: probable methyltransferase PMT24      99.4    4e-20   
gb|EAZ02339.1|  hypothetical protein OsI_24442                        99.0    6e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_006432154.1|  hypothetical protein CICLE_v10000328mg           99.0    6e-20   
gb|KDO51659.1|  hypothetical protein CISIN_1g003776mg                 98.6    6e-20   
ref|XP_003630288.1|  Ankyrin-like protein                             99.0    6e-20   
ref|XP_003538865.1|  PREDICTED: probable methyltransferase PMT27-...  98.6    7e-20   
gb|KHN41938.1|  Putative methyltransferase PMT27                      98.6    7e-20   
ref|XP_010911089.1|  PREDICTED: probable methyltransferase PMT26      98.6    8e-20   
ref|XP_004143348.1|  PREDICTED: probable methyltransferase PMT26-...  98.6    8e-20   
ref|XP_004166405.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  98.6    8e-20   
ref|XP_008462649.1|  PREDICTED: probable methyltransferase PMT26      98.6    8e-20   
gb|AES95041.2|  methyltransferase PMT16, putative                     98.6    9e-20   
ref|XP_009414876.1|  PREDICTED: probable methyltransferase PMT26      97.8    9e-20   
ref|XP_003612083.1|  Ankyrin-like protein                             98.2    9e-20   
ref|XP_009383568.1|  PREDICTED: probable methyltransferase PMT26      98.2    9e-20   
ref|XP_007158605.1|  hypothetical protein PHAVU_002G166600g           98.2    1e-19   
ref|XP_008781596.1|  PREDICTED: probable methyltransferase PMT26      97.8    1e-19   
ref|XP_011100953.1|  PREDICTED: probable methyltransferase PMT27      97.8    2e-19   
gb|EEE66346.1|  hypothetical protein OsJ_22638                        97.8    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011022921.1|  PREDICTED: probable methyltransferase PMT26      97.4    2e-19   
ref|XP_010270332.1|  PREDICTED: probable methyltransferase PMT26 ...  97.4    2e-19   
ref|XP_010270331.1|  PREDICTED: probable methyltransferase PMT26 ...  97.1    2e-19   
ref|XP_010527657.1|  PREDICTED: probable methyltransferase PMT24      97.1    2e-19   
ref|XP_006295874.1|  hypothetical protein CARUB_v10025004mg           97.1    3e-19   
gb|KHN16949.1|  Putative methyltransferase PMT26                      96.3    4e-19   
ref|XP_010930722.1|  PREDICTED: probable methyltransferase PMT26      96.3    5e-19   
ref|XP_002881329.1|  hypothetical protein ARALYDRAFT_482372           96.3    5e-19   
ref|XP_009398710.1|  PREDICTED: probable methyltransferase PMT27      96.3    5e-19   
ref|XP_006584650.1|  PREDICTED: probable methyltransferase PMT26-...  96.3    5e-19   
ref|XP_010027631.1|  PREDICTED: probable methyltransferase PMT26      95.9    6e-19   
ref|XP_003523221.1|  PREDICTED: probable methyltransferase PMT26-...  95.9    6e-19   
ref|XP_002520274.1|  ATP binding protein, putative                    95.5    8e-19   Ricinus communis
ref|XP_009355841.1|  PREDICTED: probable methyltransferase PMT26      95.5    8e-19   
ref|XP_004503920.1|  PREDICTED: probable methyltransferase PMT26-...  95.5    8e-19   
ref|XP_004502956.1|  PREDICTED: probable methyltransferase PMT26-...  95.5    9e-19   
emb|CDX94669.1|  BnaC07g09890D                                        95.1    1e-18   
gb|KHN09623.1|  Putative methyltransferase PMT26                      95.1    1e-18   
ref|XP_003526869.1|  PREDICTED: probable methyltransferase PMT26-...  95.1    1e-18   
ref|XP_009102852.1|  PREDICTED: probable methyltransferase PMT24      95.1    1e-18   
ref|XP_002309924.1|  dehydration-responsive family protein            95.1    1e-18   Populus trichocarpa [western balsam poplar]
emb|CDY44314.1|  BnaA07g07980D                                        94.7    1e-18   
ref|XP_008811930.1|  PREDICTED: probable methyltransferase PMT24      95.1    1e-18   
ref|XP_010501645.1|  PREDICTED: probable methyltransferase PMT24      94.7    1e-18   
ref|XP_010478312.1|  PREDICTED: probable methyltransferase PMT24 ...  94.7    1e-18   
ref|XP_010460728.1|  PREDICTED: probable methyltransferase PMT24      94.7    2e-18   
ref|XP_004288094.1|  PREDICTED: probable methyltransferase PMT26-...  94.7    2e-18   
dbj|BAE99717.1|  hypothetical protein                                 94.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502550.1|  PREDICTED: probable methyltransferase PMT26-...  94.4    2e-18   
ref|NP_180977.1|  putative methyltransferase PMT25                    94.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008394173.1|  PREDICTED: probable methyltransferase PMT26 ...  94.4    2e-18   
ref|XP_008394175.1|  PREDICTED: probable methyltransferase PMT26 ...  94.0    2e-18   
ref|XP_009150474.1|  PREDICTED: probable methyltransferase PMT26      94.0    3e-18   
ref|XP_011006302.1|  PREDICTED: probable methyltransferase PMT24 ...  94.0    3e-18   
ref|XP_006415572.1|  hypothetical protein EUTSA_v10006884mg           93.6    3e-18   
ref|XP_002893569.1|  hypothetical protein ARALYDRAFT_473159           93.6    3e-18   
ref|XP_006303155.1|  hypothetical protein CARUB_v10008372mg           93.6    3e-18   
emb|CDY43782.1|  BnaA06g23180D                                        93.6    3e-18   
ref|XP_011006303.1|  PREDICTED: probable methyltransferase PMT24 ...  93.6    3e-18   
gb|AAG51752.1|AC068667_31  unknown protein; 55790-52851               93.6    3e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDX84478.1|  BnaC03g50220D                                        93.6    3e-18   
dbj|BAE99079.1|  hypothetical protein                                 93.6    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174240.2|  putative methyltransferase PMT24                    93.6    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828886.1|  hypothetical protein AMTR_s00001p00185010        93.6    4e-18   
emb|CDY66721.1|  BnaC03g76010D                                        92.0    6e-18   
ref|XP_006645134.1|  PREDICTED: probable methyltransferase PMT26-...  92.8    6e-18   
ref|XP_010906388.1|  PREDICTED: probable methyltransferase PMT24      93.2    6e-18   
gb|EPS67515.1|  hypothetical protein M569_07258                       91.3    7e-18   
ref|XP_010469377.1|  PREDICTED: probable methyltransferase PMT25      92.8    7e-18   
ref|XP_006410572.1|  hypothetical protein EUTSA_v10016285mg           92.8    7e-18   
ref|XP_003564784.1|  PREDICTED: probable methyltransferase PMT26      92.8    7e-18   
ref|XP_008360714.1|  PREDICTED: probable methyltransferase PMT26      92.8    7e-18   
ref|XP_006847154.1|  hypothetical protein AMTR_s00017p00240980        92.4    8e-18   
ref|XP_004967286.1|  PREDICTED: probable methyltransferase PMT27-...  92.4    9e-18   
ref|XP_007137790.1|  hypothetical protein PHAVU_009G155600g           92.4    9e-18   
emb|CDY31339.1|  BnaA02g34020D                                        92.0    1e-17   
ref|XP_009130433.1|  PREDICTED: probable methyltransferase PMT26      92.0    1e-17   
ref|XP_006394213.1|  hypothetical protein EUTSA_v10003654mg           92.4    1e-17   
ref|XP_011099715.1|  PREDICTED: probable methyltransferase PMT26      92.0    1e-17   
gb|AAP72961.1|  putative ankyrin-like protein                         92.0    1e-17   Lactuca sativa [cultivated lettuce]
ref|XP_010413759.1|  PREDICTED: probable methyltransferase PMT25      92.0    1e-17   
ref|XP_010090820.1|  putative methyltransferase PMT26                 92.0    1e-17   
ref|XP_011078779.1|  PREDICTED: probable methyltransferase PMT26      91.7    1e-17   
gb|KHN34092.1|  Putative methyltransferase PMT26                      91.7    2e-17   
ref|XP_006580338.1|  PREDICTED: probable methyltransferase PMT26-...  91.7    2e-17   
emb|CDY39830.1|  BnaC02g42880D                                        91.7    2e-17   
ref|XP_009411900.1|  PREDICTED: probable methyltransferase PMT26      91.3    2e-17   
ref|XP_003527960.1|  PREDICTED: probable methyltransferase PMT26-...  91.3    2e-17   
gb|KDO83500.1|  hypothetical protein CISIN_1g015557mg                 89.4    2e-17   
dbj|BAD82580.1|  ankyrin-like protein                                 91.3    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045015.1|  Os01g0883900                                     91.3    2e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CDX90190.1|  BnaA08g17940D                                        90.9    2e-17   
emb|CDP04655.1|  unnamed protein product                              90.9    2e-17   
ref|XP_010679252.1|  PREDICTED: probable methyltransferase PMT26      90.9    2e-17   
gb|KHN46967.1|  Putative methyltransferase PMT25                      90.9    2e-17   
ref|XP_010546331.1|  PREDICTED: probable methyltransferase PMT26      91.3    3e-17   
ref|XP_002458871.1|  hypothetical protein SORBIDRAFT_03g041910        90.9    3e-17   Sorghum bicolor [broomcorn]
gb|EAY76734.1|  hypothetical protein OsI_04689                        90.9    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_009109665.1|  PREDICTED: probable methyltransferase PMT24      90.5    3e-17   
ref|XP_010484172.1|  PREDICTED: probable methyltransferase PMT26      90.9    3e-17   
ref|XP_007214544.1|  hypothetical protein PRUPE_ppa001471mg           90.9    3e-17   
ref|XP_010444329.1|  PREDICTED: probable methyltransferase PMT26      90.9    3e-17   
ref|XP_002437585.1|  hypothetical protein SORBIDRAFT_10g029820        90.9    3e-17   Sorghum bicolor [broomcorn]
gb|KDP32896.1|  hypothetical protein JCGZ_12188                       90.5    4e-17   
ref|XP_006345748.1|  PREDICTED: probable methyltransferase PMT26-...  90.5    4e-17   
ref|XP_010533385.1|  PREDICTED: probable methyltransferase PMT24      90.5    4e-17   
ref|NP_001140988.1|  uncharacterized protein LOC100273067             87.8    4e-17   Zea mays [maize]
ref|XP_010112029.1|  putative methyltransferase PMT24                 90.1    4e-17   
ref|XP_008227415.1|  PREDICTED: probable methyltransferase PMT26      90.5    4e-17   
ref|XP_010461320.1|  PREDICTED: probable methyltransferase PMT26      90.1    5e-17   
ref|XP_010509773.1|  PREDICTED: probable methyltransferase PMT25      89.7    6e-17   
ref|XP_007019267.1|  S-adenosyl-L-methionine-dependent methyltran...  89.7    8e-17   
gb|EMT17461.1|  hypothetical protein F775_31288                       89.7    8e-17   
ref|XP_009414612.1|  PREDICTED: probable methyltransferase PMT24      89.7    8e-17   
ref|NP_201208.2|  putative methyltransferase PMT26                    89.4    8e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10271.1|  ankyrin-like protein                                 89.4    8e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ACN28572.1|  unknown                                               89.4    9e-17   Zea mays [maize]
ref|XP_002307464.2|  hypothetical protein POPTR_0005s20670g           89.4    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006434319.1|  hypothetical protein CICLE_v10000311mg           88.6    1e-16   
gb|EMT26126.1|  hypothetical protein F775_52504                       88.6    1e-16   
ref|XP_007159858.1|  hypothetical protein PHAVU_002G273700g           89.0    1e-16   
ref|XP_006281931.1|  hypothetical protein CARUB_v10028139mg           89.0    1e-16   
ref|XP_007048444.1|  S-adenosyl-L-methionine-dependent methyltran...  89.0    1e-16   
gb|EMS51988.1|  putative methyltransferase PMT27                      88.6    1e-16   
ref|XP_004970814.1|  PREDICTED: probable methyltransferase PMT26-...  88.2    2e-16   
ref|XP_010063906.1|  PREDICTED: probable methyltransferase PMT25 ...  88.2    2e-16   
gb|ABA96619.1|  dehydration-responsive protein, putative              88.2    3e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19833.1|  hypothetical protein OsJ_35417                        88.2    3e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CDX99828.1|  BnaC05g22500D                                        87.8    3e-16   
gb|KHG15143.1|  hypothetical protein F383_09666                       87.8    3e-16   
gb|KHN44285.1|  Putative methyltransferase PMT25                      87.8    3e-16   
ref|XP_003602639.1|  Ankyrin-like protein                             87.0    3e-16   
gb|EYU23728.1|  hypothetical protein MIMGU_mgv1a001484mg              87.8    3e-16   
ref|XP_003602638.1|  Ankyrin-like protein                             87.0    3e-16   
gb|EAY82457.1|  hypothetical protein OsI_37674                        87.8    3e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006578949.1|  PREDICTED: probable methyltransferase PMT26-...  87.8    3e-16   
ref|XP_002864883.1|  hypothetical protein ARALYDRAFT_496597           87.8    4e-16   
gb|AFW75800.1|  hypothetical protein ZEAMMB73_544570                  87.8    4e-16   
ref|XP_008648870.1|  PREDICTED: probable methyltransferase PMT24      87.8    4e-16   
ref|XP_006434317.1|  hypothetical protein CICLE_v10000311mg           87.4    4e-16   
ref|XP_006578951.1|  PREDICTED: probable methyltransferase PMT26-...  87.0    4e-16   
gb|KHG22120.1|  hypothetical protein F383_28461                       87.4    4e-16   
ref|XP_006472883.1|  PREDICTED: probable methyltransferase PMT25-...  87.4    4e-16   
ref|XP_003580900.1|  PREDICTED: probable methyltransferase PMT26      87.0    5e-16   
emb|CDM85080.1|  unnamed protein product                              87.0    5e-16   
ref|XP_009590749.1|  PREDICTED: probable methyltransferase PMT26      86.3    1e-15   
ref|XP_011027424.1|  PREDICTED: probable methyltransferase PMT24      85.9    1e-15   
ref|XP_004289881.1|  PREDICTED: probable methyltransferase PMT25-...  85.9    1e-15   
ref|XP_002266357.1|  PREDICTED: probable methyltransferase PMT26      85.9    1e-15   Vitis vinifera
gb|EYU24085.1|  hypothetical protein MIMGU_mgv1a001214mg              85.9    1e-15   
ref|XP_003602637.1|  Ankyrin-like protein                             85.5    2e-15   
ref|XP_002300957.2|  hypothetical protein POPTR_0002s07640g           85.5    2e-15   Populus trichocarpa [western balsam poplar]
emb|CBI37509.3|  unnamed protein product                              85.5    2e-15   
ref|XP_007137499.1|  hypothetical protein PHAVU_009G132000g           85.1    2e-15   
dbj|BAK05773.1|  predicted protein                                    85.1    3e-15   
gb|EMS53293.1|  putative methyltransferase PMT26                      85.1    3e-15   
ref|XP_010521110.1|  PREDICTED: probable methyltransferase PMT26      84.7    4e-15   
gb|EPS72708.1|  hypothetical protein M569_02045                       84.0    4e-15   
emb|CDY48339.1|  BnaA09g26820D                                        84.3    4e-15   
gb|EMS56319.1|  putative methyltransferase PMT26                      84.3    4e-15   
ref|XP_009771172.1|  PREDICTED: probable methyltransferase PMT26      84.3    4e-15   
ref|NP_001151565.1|  ankyrin-like protein                             84.0    4e-15   Zea mays [maize]
emb|CDY17234.1|  BnaA05g09540D                                        84.3    5e-15   
ref|XP_003563554.1|  PREDICTED: probable methyltransferase PMT25      84.0    5e-15   
ref|XP_009115236.1|  PREDICTED: probable methyltransferase PMT24 ...  84.0    6e-15   
emb|CDX84330.1|  BnaC04g10920D                                        84.0    6e-15   
ref|XP_009366818.1|  PREDICTED: probable methyltransferase PMT24      84.0    6e-15   
ref|XP_004978303.1|  PREDICTED: probable methyltransferase PMT26-...  84.0    6e-15   
gb|EEC78319.1|  hypothetical protein OsI_18053                        83.6    7e-15   Oryza sativa Indica Group [Indian rice]
gb|EMT26912.1|  hypothetical protein F775_10259                       83.6    7e-15   
ref|XP_006662791.1|  PREDICTED: probable methyltransferase PMT26-...  83.6    7e-15   
ref|XP_009115237.1|  PREDICTED: probable methyltransferase PMT24 ...  83.6    8e-15   
emb|CBI18946.3|  unnamed protein product                              82.8    8e-15   
ref|XP_009143789.1|  PREDICTED: probable methyltransferase PMT25      83.6    8e-15   
ref|XP_008371671.1|  PREDICTED: probable methyltransferase PMT26      82.8    9e-15   
ref|XP_007156094.1|  hypothetical protein PHAVU_003G258000g           83.2    1e-14   
dbj|BAJ85194.1|  predicted protein                                    83.2    1e-14   
ref|XP_008345949.1|  PREDICTED: probable methyltransferase PMT26      82.4    1e-14   
gb|AAX96339.1|  Putative methyltransferase                            82.4    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009779710.1|  PREDICTED: probable methyltransferase PMT26      82.4    2e-14   
ref|XP_006657337.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  82.4    2e-14   
ref|XP_004959929.1|  PREDICTED: probable methyltransferase PMT26-...  82.0    2e-14   
gb|KHG06416.1|  hypothetical protein F383_32222                       82.0    2e-14   
ref|XP_006653085.1|  PREDICTED: probable methyltransferase PMT26-...  81.6    3e-14   
gb|EEE51778.1|  hypothetical protein OsJ_33227                        81.6    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065922.2|  Os11g0186300                                     81.6    4e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EMT24893.1|  hypothetical protein F775_19481                       81.3    5e-14   
ref|XP_009602526.1|  PREDICTED: probable methyltransferase PMT24      80.9    6e-14   
ref|XP_004509323.1|  PREDICTED: probable methyltransferase PMT27-...  80.9    7e-14   
ref|XP_006365916.1|  PREDICTED: probable methyltransferase PMT24-...  80.5    7e-14   
ref|XP_002442915.1|  hypothetical protein SORBIDRAFT_08g004870        80.9    7e-14   Sorghum bicolor [broomcorn]
gb|EMS61672.1|  putative methyltransferase PMT26                      80.9    7e-14   
ref|XP_010679267.1|  PREDICTED: probable methyltransferase PMT26      80.5    7e-14   
ref|XP_008674424.1|  PREDICTED: probable methyltransferase PMT26      80.5    8e-14   
ref|XP_007199628.1|  hypothetical protein PRUPE_ppa001750mg           80.5    8e-14   
tpg|DAA55524.1|  TPA: hypothetical protein ZEAMMB73_749730            80.5    8e-14   
ref|XP_002447385.1|  hypothetical protein SORBIDRAFT_06g034130        80.1    8e-14   Sorghum bicolor [broomcorn]
gb|KHG04009.1|  hypothetical protein F383_29196                       80.1    9e-14   
ref|XP_008244575.1|  PREDICTED: probable methyltransferase PMT24      80.1    1e-13   
ref|XP_009360657.1|  PREDICTED: probable methyltransferase PMT24      80.1    1e-13   
ref|XP_010547883.1|  PREDICTED: probable methyltransferase PMT26      79.7    1e-13   
ref|XP_004239625.1|  PREDICTED: probable methyltransferase PMT26      79.7    1e-13   
gb|KEH35375.1|  methyltransferase PMT26-like protein, putative        79.3    2e-13   
gb|EEC67819.1|  hypothetical protein OsI_35396                        79.3    2e-13   Oryza sativa Indica Group [Indian rice]
gb|KHG21530.1|  hypothetical protein F383_05601                       78.6    3e-13   
gb|EEE61974.1|  hypothetical protein OsJ_16751                        78.2    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004237701.1|  PREDICTED: probable methyltransferase PMT24      78.2    4e-13   
ref|NP_001054368.1|  Os04g0692400                                     78.2    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004978888.1|  PREDICTED: probable methyltransferase PMT26-...  78.2    4e-13   
emb|CAE05785.2|  OSJNBb0020J19.14                                     78.2    5e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KEH20400.1|  methyltransferase PMT16, putative                     77.8    6e-13   
gb|EMS50396.1|  putative methyltransferase PMT26                      77.4    6e-13   
ref|XP_006574692.1|  PREDICTED: probable methyltransferase PMT27-...  77.4    8e-13   
ref|XP_003576215.1|  PREDICTED: probable methyltransferase PMT24      77.4    8e-13   
ref|XP_010679237.1|  PREDICTED: probable methyltransferase PMT26 ...  77.0    1e-12   
gb|EMT06244.1|  hypothetical protein F775_19651                       76.6    1e-12   
ref|XP_010679222.1|  PREDICTED: probable methyltransferase PMT25 ...  77.0    1e-12   
gb|KHN00508.1|  Putative methyltransferase PMT27                      76.6    1e-12   
ref|XP_003519883.1|  PREDICTED: probable methyltransferase PMT27-...  76.6    1e-12   
ref|XP_008669787.1|  PREDICTED: probable methyltransferase PMT26      75.9    2e-12   
tpg|DAA38926.1|  TPA: hypothetical protein ZEAMMB73_582749            75.5    3e-12   
ref|XP_010063908.1|  PREDICTED: probable methyltransferase PMT25      75.5    4e-12   
dbj|BAK08087.1|  predicted protein                                    75.1    5e-12   
ref|XP_002449126.1|  hypothetical protein SORBIDRAFT_05g005510        72.8    2e-11   
ref|XP_002981388.1|  hypothetical protein SELMODRAFT_114169           68.9    4e-10   
emb|CAN73341.1|  hypothetical protein VITISV_042403                   68.9    4e-10   
ref|XP_002969911.1|  hypothetical protein SELMODRAFT_170913           68.9    4e-10   
ref|XP_002273466.1|  PREDICTED: probable methyltransferase PMT23      68.6    4e-10   
gb|EPS66241.1|  hypothetical protein M569_08536                       67.4    6e-10   
ref|XP_002520775.1|  ATP binding protein, putative                    68.2    6e-10   
ref|XP_006847414.1|  hypothetical protein AMTR_s00153p00060550        67.8    8e-10   
emb|CAN60874.1|  hypothetical protein VITISV_030592                   66.6    2e-09   
ref|XP_010239480.1|  PREDICTED: probable methyltransferase PMT25      67.0    2e-09   
ref|XP_006353441.1|  PREDICTED: probable methyltransferase PMT22-...  66.2    3e-09   
gb|AES71217.2|  methyltransferase PMT16, putative                     65.9    3e-09   
ref|XP_003600966.1|  hypothetical protein MTR_3g071530                65.9    3e-09   
gb|AES99641.2|  methyltransferase PMT16, putative                     65.5    4e-09   
ref|XP_003616683.1|  hypothetical protein MTR_5g083150                65.5    5e-09   
ref|XP_001768084.1|  predicted protein                                65.5    5e-09   
ref|XP_004239948.1|  PREDICTED: probable methyltransferase PMT23      65.1    6e-09   
ref|XP_004241111.1|  PREDICTED: probable methyltransferase PMT22      65.1    6e-09   
ref|XP_002488859.1|  hypothetical protein SORBIDRAFT_3268s002010      62.8    8e-09   
ref|XP_004500572.1|  PREDICTED: probable methyltransferase PMT23-...  64.7    8e-09   
ref|XP_007141740.1|  hypothetical protein PHAVU_008G221500g           64.7    9e-09   
emb|CDP13979.1|  unnamed protein product                              64.7    9e-09   
ref|XP_010264560.1|  PREDICTED: probable methyltransferase PMT23 ...  64.7    9e-09   
ref|XP_010264561.1|  PREDICTED: probable methyltransferase PMT23 ...  64.3    1e-08   
ref|XP_009631455.1|  PREDICTED: probable methyltransferase PMT23      64.3    1e-08   
ref|XP_009345335.1|  PREDICTED: probable methyltransferase PMT23      64.3    1e-08   
ref|XP_003519422.1|  PREDICTED: probable methyltransferase PMT23-...  64.3    1e-08   
gb|KHN38532.1|  Putative methyltransferase PMT23                      64.3    1e-08   
ref|XP_010693057.1|  PREDICTED: probable methyltransferase PMT23      64.3    1e-08   
ref|XP_006355647.1|  PREDICTED: probable methyltransferase PMT23-...  63.9    1e-08   
ref|XP_007220560.1|  hypothetical protein PRUPE_ppa003289mg           63.9    1e-08   
ref|XP_008233802.1|  PREDICTED: probable methyltransferase PMT23      63.9    2e-08   
ref|XP_006595854.1|  PREDICTED: probable methyltransferase PMT23-...  63.5    2e-08   
ref|XP_009758520.1|  PREDICTED: probable methyltransferase PMT23      63.5    2e-08   
ref|XP_010508886.1|  PREDICTED: probable methyltransferase PMT23      63.5    2e-08   
ref|XP_011084874.1|  PREDICTED: probable methyltransferase PMT23      63.5    2e-08   
ref|XP_002969525.1|  hypothetical protein SELMODRAFT_170677           63.5    2e-08   
gb|KHN48584.1|  Putative methyltransferase PMT23                      63.2    2e-08   
ref|XP_003545223.1|  PREDICTED: probable methyltransferase PMT23-...  63.2    2e-08   
ref|XP_004491015.1|  PREDICTED: probable methyltransferase PMT23-...  63.2    2e-08   
ref|XP_010087523.1|  putative methyltransferase PMT23                 63.2    3e-08   
ref|XP_010257056.1|  PREDICTED: probable methyltransferase PMT23 ...  62.8    3e-08   
ref|XP_009769140.1|  PREDICTED: probable methyltransferase PMT23      62.8    3e-08   
gb|EEC71735.1|  hypothetical protein OsI_04288                        62.8    3e-08   
ref|XP_009613322.1|  PREDICTED: probable methyltransferase PMT23      62.8    3e-08   
ref|NP_001044685.1|  Os01g0828300                                     62.8    4e-08   
gb|KHG30668.1|  hypothetical protein F383_12718                       62.8    4e-08   
ref|XP_001780682.1|  predicted protein                                62.4    4e-08   
ref|XP_008674871.1|  PREDICTED: probable methyltransferase PMT23 ...  62.4    4e-08   
tpg|DAA57017.1|  TPA: hypothetical protein ZEAMMB73_561931            62.0    4e-08   
ref|XP_011076659.1|  PREDICTED: probable methyltransferase PMT23      62.0    6e-08   
ref|XP_008454816.1|  PREDICTED: probable methyltransferase PMT23      62.0    6e-08   
ref|XP_009369208.1|  PREDICTED: probable methyltransferase PMT23      61.6    8e-08   
ref|XP_010517446.1|  PREDICTED: probable methyltransferase PMT23      61.6    9e-08   
ref|XP_008369289.1|  PREDICTED: probable methyltransferase PMT23      61.6    9e-08   
ref|XP_007163573.1|  hypothetical protein PHAVU_001G245500g           61.6    9e-08   
ref|XP_010554681.1|  PREDICTED: probable methyltransferase PMT23 ...  61.6    9e-08   
ref|XP_006293840.1|  hypothetical protein CARUB_v10022824mg           61.2    1e-07   
gb|EMS51937.1|  putative methyltransferase PMT23                      61.2    1e-07   
ref|XP_008354164.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  60.8    1e-07   
ref|XP_010554680.1|  PREDICTED: probable methyltransferase PMT23 ...  60.8    2e-07   
ref|XP_008362733.1|  PREDICTED: probable methyltransferase PMT23      60.8    2e-07   
gb|EEE55614.1|  hypothetical protein OsJ_03940                        60.5    2e-07   
gb|KHN04781.1|  Putative methyltransferase PMT23                      60.5    2e-07   
ref|XP_003537495.1|  PREDICTED: probable methyltransferase PMT23-...  60.5    2e-07   
ref|XP_007008884.1|  S-adenosyl-L-methionine-dependent methyltran...  60.5    2e-07   
ref|XP_002456576.1|  hypothetical protein SORBIDRAFT_03g038660        60.1    3e-07   
ref|XP_006390107.1|  hypothetical protein EUTSA_v10018241mg           60.1    3e-07   
ref|XP_004970434.1|  PREDICTED: probable methyltransferase PMT23-...  60.1    3e-07   
dbj|BAK03153.1|  predicted protein                                    59.7    3e-07   
ref|XP_002986762.1|  hypothetical protein SELMODRAFT_20660            59.7    4e-07   
ref|XP_002315142.2|  hypothetical protein POPTR_0010s19240g           59.7    4e-07   
ref|XP_004148176.1|  PREDICTED: probable methyltransferase PMT23-...  59.7    4e-07   
gb|KGN50684.1|  hypothetical protein Csa_5G211570                     59.7    4e-07   
emb|CDY24913.1|  BnaC03g22590D                                        59.7    4e-07   
ref|XP_002881711.1|  dehydration-responsive family protein            59.3    5e-07   
gb|KDP44715.1|  hypothetical protein JCGZ_01215                       59.3    5e-07   
ref|XP_011035889.1|  PREDICTED: probable methyltransferase PMT23      59.3    5e-07   
ref|XP_006411284.1|  hypothetical protein EUTSA_v10016421mg           58.9    7e-07   
ref|XP_010922608.1|  PREDICTED: probable methyltransferase PMT23 ...  58.9    7e-07   
ref|XP_002282557.1|  PREDICTED: probable methyltransferase PMT11      58.9    8e-07   
ref|XP_010922607.1|  PREDICTED: probable methyltransferase PMT23 ...  58.5    8e-07   
gb|KFK36919.1|  hypothetical protein AALP_AA4G189700                  58.5    8e-07   
ref|XP_010427415.1|  PREDICTED: probable methyltransferase PMT22      58.5    8e-07   
ref|XP_002965218.1|  hypothetical protein SELMODRAFT_142980           58.5    1e-06   
ref|XP_006846361.1|  hypothetical protein AMTR_s00012p00261500        58.2    1e-06   
gb|EPS68791.1|  hypothetical protein M569_05965                       58.2    1e-06   
ref|XP_008674868.1|  PREDICTED: probable methyltransferase PMT23 ...  58.2    1e-06   
ref|XP_009133427.1|  PREDICTED: probable methyltransferase PMT23      57.8    1e-06   
emb|CDP13980.1|  unnamed protein product                              57.8    2e-06   
ref|XP_008656391.1|  PREDICTED: probable methyltransferase PMT26 ...  57.4    2e-06   
ref|XP_006593782.1|  PREDICTED: probable methyltransferase PMT10-...  57.8    2e-06   
ref|XP_008656392.1|  PREDICTED: probable methyltransferase PMT26 ...  57.0    2e-06   
ref|XP_010067556.1|  PREDICTED: probable methyltransferase PMT23      57.8    2e-06   
ref|XP_008461708.1|  PREDICTED: probable methyltransferase PMT11      57.8    2e-06   
ref|NP_565926.1|  putative methyltransferase PMT23                    57.4    2e-06   
ref|XP_006644942.1|  PREDICTED: probable methyltransferase PMT23-...  57.4    2e-06   
ref|XP_007161418.1|  hypothetical protein PHAVU_001G067200g           57.4    2e-06   
gb|KFK42123.1|  hypothetical protein AALP_AA2G214000                  57.4    2e-06   
ref|XP_006435799.1|  hypothetical protein CICLE_v10030978mg           57.0    3e-06   
ref|XP_010554685.1|  PREDICTED: probable methyltransferase PMT22      57.0    3e-06   
ref|XP_009773760.1|  PREDICTED: probable methyltransferase PMT11      57.0    3e-06   
ref|XP_010516207.1|  PREDICTED: probable methyltransferase PMT22      57.0    3e-06   
ref|XP_011085019.1|  PREDICTED: probable methyltransferase PMT11      56.6    4e-06   
ref|XP_009397093.1|  PREDICTED: probable methyltransferase PMT23      56.6    5e-06   
ref|XP_004150637.1|  PREDICTED: probable methyltransferase PMT11-...  56.2    5e-06   
ref|XP_010539686.1|  PREDICTED: probable methyltransferase PMT10      56.2    5e-06   
ref|XP_010067444.1|  PREDICTED: probable methyltransferase PMT11      56.2    5e-06   
ref|XP_002962298.1|  hypothetical protein SELMODRAFT_140935           56.2    6e-06   
ref|XP_006596244.1|  PREDICTED: probable methyltransferase PMT10-...  56.2    6e-06   
ref|NP_565153.1|  putative methyltransferase PMT10                    56.2    6e-06   
gb|KDO37251.1|  hypothetical protein CISIN_1g030303mg                 54.3    6e-06   
emb|CDM84813.1|  unnamed protein product                              55.8    7e-06   
gb|AAC34356.1|  Hypothetical protein                                  55.8    9e-06   
ref|XP_010931216.1|  PREDICTED: probable methyltransferase PMT11 ...  55.5    9e-06   
emb|CDY20475.1|  BnaC04g05690D                                        55.5    1e-05   
ref|XP_008777501.1|  PREDICTED: probable methyltransferase PMT11      55.5    1e-05   
gb|KHF99989.1|  hypothetical protein F383_03567                       55.5    1e-05   
ref|XP_001754440.1|  predicted protein                                55.1    1e-05   
ref|XP_009122211.1|  PREDICTED: probable methyltransferase PMT12      55.1    1e-05   
ref|XP_006292224.1|  hypothetical protein CARUB_v10018430mg           55.1    1e-05   
ref|XP_006856006.1|  hypothetical protein AMTR_s00059p00036110        54.7    2e-05   
ref|XP_010256808.1|  PREDICTED: probable methyltransferase PMT11      55.1    2e-05   
ref|XP_004307681.1|  PREDICTED: probable methyltransferase PMT23-...  54.7    2e-05   
ref|XP_002889132.1|  hypothetical protein ARALYDRAFT_339887           55.1    2e-05   
gb|EAY98391.1|  hypothetical protein OsI_20304                        54.7    2e-05   
ref|XP_009402272.1|  PREDICTED: probable methyltransferase PMT11      54.7    2e-05   
gb|EYU19943.1|  hypothetical protein MIMGU_mgv1a002452mg              54.7    2e-05   
emb|CDY43341.1|  BnaC04g25150D                                        54.7    2e-05   
tpg|DAA56858.1|  TPA: hypothetical protein ZEAMMB73_419928            54.7    2e-05   
gb|KHN07215.1|  Putative methyltransferase PMT10                      54.3    2e-05   
ref|NP_567033.2|  probable methyltransferase PMT22                    54.7    2e-05   
ref|XP_003564520.1|  PREDICTED: probable methyltransferase PMT23      54.3    2e-05   
ref|XP_009139122.1|  PREDICTED: probable methyltransferase PMT22      54.3    2e-05   
ref|XP_002878065.1|  hypothetical protein ARALYDRAFT_907046           54.3    2e-05   
gb|AAT93959.1|  unknown protein                                       54.3    2e-05   
emb|CDX76062.1|  BnaA04g03260D                                        54.3    2e-05   
ref|XP_002441250.1|  hypothetical protein SORBIDRAFT_09g023140        54.3    2e-05   
dbj|BAJ85758.1|  predicted protein                                    54.3    3e-05   
emb|CDX70102.1|  BnaA10g24510D                                        54.3    3e-05   
ref|XP_006355693.1|  PREDICTED: probable methyltransferase PMT11-...  54.3    3e-05   
ref|XP_009143288.1|  PREDICTED: probable methyltransferase PMT11      54.3    3e-05   
gb|EEE64058.1|  hypothetical protein OsJ_18888                        53.9    3e-05   
ref|XP_009605447.1|  PREDICTED: probable methyltransferase PMT11      53.9    3e-05   
gb|KHN17890.1|  Putative methyltransferase PMT11                      53.9    3e-05   
ref|XP_003538427.1|  PREDICTED: probable methyltransferase PMT11-...  53.9    3e-05   
ref|XP_007009281.1|  S-adenosyl-L-methionine-dependent methyltran...  53.9    3e-05   
ref|XP_001753452.1|  predicted protein                                53.9    3e-05   
ref|NP_001044791.1|  Os01g0846600                                     53.9    4e-05   
ref|XP_009802040.1|  PREDICTED: probable methyltransferase PMT11      53.9    4e-05   
ref|XP_002308282.1|  dehydration-responsive family protein            50.8    4e-05   
emb|CBI31622.3|  unnamed protein product                              53.5    4e-05   
emb|CDX74837.1|  BnaA05g05830D                                        53.5    4e-05   
ref|XP_006399064.1|  hypothetical protein EUTSA_v10012860mg           53.5    4e-05   
ref|XP_010269090.1|  PREDICTED: probable methyltransferase PMT11      53.5    5e-05   
ref|XP_002520297.1|  ATP binding protein, putative                    53.5    5e-05   
ref|XP_006655400.1|  PREDICTED: probable methyltransferase PMT23-...  53.1    5e-05   
ref|XP_003564599.1|  PREDICTED: probable methyltransferase PMT11      53.1    6e-05   
gb|KHG22555.1|  hypothetical protein F383_08406                       53.1    6e-05   
gb|KFK34851.1|  hypothetical protein AALP_AA5G201400                  53.1    6e-05   
ref|XP_008801628.1|  PREDICTED: probable methyltransferase PMT11      53.1    6e-05   
ref|XP_006645001.1|  PREDICTED: probable methyltransferase PMT11-...  53.1    6e-05   
ref|XP_010474375.1|  PREDICTED: probable methyltransferase PMT10      53.1    7e-05   
ref|XP_002312116.1|  dehydration-responsive family protein            53.1    7e-05   
gb|EPS59859.1|  hypothetical protein M569_14946                       53.1    7e-05   
ref|XP_010507473.1|  PREDICTED: probable methyltransferase PMT22      52.8    7e-05   
ref|XP_004307467.1|  PREDICTED: probable methyltransferase PMT11-...  52.8    8e-05   
ref|XP_009597736.1|  PREDICTED: probable methyltransferase PMT11      52.8    8e-05   
ref|NP_001168416.1|  uncharacterized protein LOC100382186             52.0    9e-05   
ref|XP_009106390.1|  PREDICTED: probable methyltransferase PMT10      52.8    9e-05   
gb|EYU35239.1|  hypothetical protein MIMGU_mgv1a002315mg              52.8    9e-05   
ref|XP_010419238.1|  PREDICTED: probable methyltransferase PMT10      52.4    1e-04   
ref|XP_010428798.1|  PREDICTED: probable methyltransferase PMT10      52.4    1e-04   
emb|CDX87530.1|  BnaA07g33430D                                        52.4    1e-04   
ref|XP_006411207.1|  hypothetical protein EUTSA_v10016330mg           52.4    1e-04   
emb|CDX88354.1|  BnaC06g37980D                                        52.4    1e-04   
ref|XP_006403024.1|  hypothetical protein EUTSA_v10005845mg           52.4    1e-04   
ref|XP_002302213.2|  hypothetical protein POPTR_0002s07760g           52.4    1e-04   
ref|XP_002881674.1|  dehydration-responsive family protein            52.4    1e-04   
gb|KFK24997.1|  hypothetical protein AALP_AA8G053000                  52.0    1e-04   
ref|XP_009351422.1|  PREDICTED: probable methyltransferase PMT11      52.0    1e-04   
ref|XP_002458754.1|  hypothetical protein SORBIDRAFT_03g039680        52.0    1e-04   
ref|XP_010517333.1|  PREDICTED: probable methyltransferase PMT11      52.0    1e-04   
ref|XP_008441393.1|  PREDICTED: probable methyltransferase PMT11      52.0    1e-04   
ref|XP_010505659.1|  PREDICTED: probable methyltransferase PMT11      52.0    1e-04   
ref|XP_007009285.1|  S-adenosyl-L-methionine-dependent methyltran...  52.0    1e-04   
ref|XP_010508982.1|  PREDICTED: probable methyltransferase PMT11      52.0    2e-04   
ref|XP_004970562.1|  PREDICTED: probable methyltransferase PMT11-...  52.0    2e-04   
gb|AGT17249.1|  methyltransferase                                     52.0    2e-04   
ref|XP_007009286.1|  S-adenosyl-L-methionine-dependent methyltran...  51.6    2e-04   
ref|XP_006301565.1|  hypothetical protein CARUB_v10022001mg           51.6    2e-04   
emb|CDP00136.1|  unnamed protein product                              51.6    2e-04   
gb|KHG22665.1|  hypothetical protein F383_10369                       51.6    2e-04   
ref|XP_008803122.1|  PREDICTED: probable methyltransferase PMT11 ...  51.6    2e-04   
ref|XP_010532651.1|  PREDICTED: probable methyltransferase PMT11      51.6    2e-04   
ref|XP_004498352.1|  PREDICTED: probable methyltransferase PMT10-...  51.2    3e-04   
ref|XP_004239912.1|  PREDICTED: probable methyltransferase PMT11      51.2    3e-04   
ref|XP_010931217.1|  PREDICTED: probable methyltransferase PMT11 ...  51.2    3e-04   
gb|KDO69169.1|  hypothetical protein CISIN_1g0059812mg                51.2    3e-04   
gb|KDO84547.1|  hypothetical protein CISIN_1g044932mg                 51.2    3e-04   
ref|XP_006293784.1|  hypothetical protein CARUB_v10022763mg           51.2    3e-04   
ref|XP_010254848.1|  PREDICTED: probable methyltransferase PMT28      51.2    3e-04   
ref|XP_010060949.1|  PREDICTED: probable methyltransferase PMT28      51.2    3e-04   
ref|XP_008372044.1|  PREDICTED: probable methyltransferase PMT11      51.2    3e-04   
ref|XP_006434984.1|  hypothetical protein CICLE_v10003946mg           51.2    3e-04   
ref|XP_003600754.1|  hypothetical protein MTR_3g068990                50.8    3e-04   
gb|KFK36867.1|  hypothetical protein AALP_AA4G181900                  51.2    3e-04   
ref|XP_004138455.1|  PREDICTED: probable methyltransferase PMT11-...  50.8    3e-04   
ref|XP_004154736.1|  PREDICTED: probable methyltransferase PMT11-...  50.8    3e-04   
emb|CDX98897.1|  BnaC09g49380D                                        50.8    3e-04   
ref|XP_008654917.1|  PREDICTED: LOC100281537 isoform X1               50.8    4e-04   
ref|XP_010491150.1|  PREDICTED: probable methyltransferase PMT12      50.8    4e-04   



>ref|XP_006340936.1| PREDICTED: probable methyltransferase PMT27-like [Solanum tuberosum]
Length=888

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 115/175 (66%), Gaps = 22/175 (13%)
 Frame = -2

Query  502  EHESQGITSEDQIQHDEATVSGDEDTLKTHPsfssssstdSNQEKAQID---SVPA----  344
            E  ++G+TS+DQI+HDEA +  D                  N  KA ++   +VP     
Sbjct  267  EEHTEGVTSKDQIKHDEAPIVKD--------------VKIQNDHKAPVNLTNNVPVLKNE  312

Query  343  -RKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
              KT   +P ESK+SKKAWSTQA QSV+QKER       +++ IP  NWQLC V A  DY
Sbjct  313  NHKTEIIVPKESKESKKAWSTQADQSVNQKERRTVGKNNQDSSIPEQNWQLCKVEALADY  372

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDNE A+ KL+T +H+EHRERHCP+EPPTCLV LP+GYK PIEWPKSR+KIW
Sbjct  373  IPCLDNEDAIKKLKTTKHYEHRERHCPQEPPTCLVPLPQGYKTPIEWPKSRDKIW  427



>ref|XP_009590098.1| PREDICTED: probable methyltransferase PMT27 [Nicotiana tomentosiformis]
Length=897

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 110/164 (67%), Gaps = 10/164 (6%)
 Frame = -2

Query  487  GITSEDQIQHDEATVSGDEDTLKTH--PsfssssstdSNQEKAQIDSVPARKTSPQIPSE  314
            G+TS+DQI+HDEA +  D      H  P   +++      E          KT   +P E
Sbjct  281  GVTSKDQIKHDEAPILKDVKIQHDHKAPVNLTNNLPVLKTEN--------HKTETIVPKE  332

Query  313  SKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALH  134
            SK+SKK+WSTQA  SV+QKER       +++ +P  NWQLC V AG DYIPCLDNE A+ 
Sbjct  333  SKESKKSWSTQADHSVNQKERRTVGSNNKDSSVPEQNWQLCKVAAGADYIPCLDNEEAIK  392

Query  133  KLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            KL+T +H+EHRERHCP+EPPTCLV LP+GYK PIEWPKSR+KIW
Sbjct  393  KLKTTKHYEHRERHCPQEPPTCLVPLPQGYKTPIEWPKSRDKIW  436



>ref|XP_009798747.1| PREDICTED: probable methyltransferase PMT27 [Nicotiana sylvestris]
Length=894

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 109/164 (66%), Gaps = 10/164 (6%)
 Frame = -2

Query  487  GITSEDQIQHDEATVSGDEDTLKTH--PsfssssstdSNQEKAQIDSVPARKTSPQIPSE  314
            G+ S+DQI+HDEA +  D      H  P   +++      E          KT   +P E
Sbjct  278  GVMSKDQIKHDEAPILKDVKIQHDHKAPVNLTNNLPVLKTEN--------HKTETIVPKE  329

Query  313  SKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALH  134
            SK+SKK+WSTQA  SV+QKER       +++ +P  NWQLC V AG DYIPCLDNE A+ 
Sbjct  330  SKESKKSWSTQADHSVNQKERRTVGSNNKDSSVPEQNWQLCEVAAGADYIPCLDNEEAIQ  389

Query  133  KLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            KL+T +H+EHRERHCP+EPPTCLV LP+GYK PIEWPKSR+KIW
Sbjct  390  KLKTTKHYEHRERHCPQEPPTCLVPLPQGYKTPIEWPKSRDKIW  433



>ref|XP_004233730.2| PREDICTED: probable methyltransferase PMT27 [Solanum lycopersicum]
Length=818

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 113/172 (66%), Gaps = 10/172 (6%)
 Frame = -2

Query  511  RHPEHESQGITSEDQIQHDEATVSGDEDTLKTH--PsfssssstdSNQEKAQIDSVPARK  338
            + PE  +QG+TS+DQI+HDEA +  D      H  P   +++      E          K
Sbjct  194  KQPEEHTQGVTSKDQIKHDEAPLLKDVKIQNDHKAPVNLTNNPPVLKNEN--------NK  245

Query  337  TSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPC  158
            T   +P ESK+SKKAWSTQA QSV+QKER       +++ +P  NWQLC V A  DYIPC
Sbjct  246  TEMIVPKESKESKKAWSTQADQSVNQKERRTVGKNNQDSSVPEQNWQLCEVEALADYIPC  305

Query  157  LDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            LDNE A+ KL++ +H+EHRERHCP+EPPTCLV LP+GYK  IEWP SR+KIW
Sbjct  306  LDNEDAIKKLKSTKHYEHRERHCPQEPPTCLVPLPEGYKPSIEWPTSRDKIW  357



>ref|XP_002533655.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF28726.1| ATP binding protein, putative [Ricinus communis]
Length=961

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  355  SVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAG  176
            S P   TS +IP ESK+SKK+WSTQA +S +QKER K   + + +I     W LCNVTAG
Sbjct  384  SFPGGGTSTEIPKESKESKKSWSTQATESENQKERRKGESDGKESIY-GYTWHLCNVTAG  442

Query  175  QDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             DYIPCLDNE A+ +LRT RHFEHRERHCPEE PTCLV LP GYKRPI WP SR+KIW
Sbjct  443  PDYIPCLDNEKAIRQLRTTRHFEHRERHCPEEGPTCLVPLPDGYKRPIAWPASRDKIW  500



>ref|XP_010030876.1| PREDICTED: probable methyltransferase PMT27 [Eucalyptus grandis]
 gb|KCW56680.1| hypothetical protein EUGRSUZ_I02378 [Eucalyptus grandis]
Length=964

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ESK+SKK+WSTQA QS +QKER        ++ I    WQLCNVTAG DYIPCLDN+
Sbjct  396  IPKESKESKKSWSTQAAQSENQKERRGQGATGGDDSIYGYTWQLCNVTAGPDYIPCLDNQ  455

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             AL KLR+ +HFEHRERHCPE+ PTCLV  P+GYKR IEWPKSREKIW
Sbjct  456  KALKKLRSTKHFEHRERHCPEDAPTCLVPAPEGYKRSIEWPKSREKIW  503



>ref|XP_004170954.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT27-like, 
partial [Cucumis sativus]
Length=611

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ESK+SKK+WSTQA QS ++K+R +     + +I     WQ+CNVTAG DYIPCLDNE
Sbjct  361  IPKESKESKKSWSTQAAQSENEKDRRREESSSDGSIY-GYTWQMCNVTAGPDYIPCLDNE  419

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+ +LRT +HFEHRERHCPEE PTCLV LP+GYKR IEWP+SR+KIW
Sbjct  420  KAIKQLRTTKHFEHRERHCPEEGPTCLVSLPEGYKRSIEWPRSRDKIW  467



>ref|XP_010271514.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=983

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            +IP ESK+SKK WSTQA QS ++KER K      +  I    W+LCNVTAG DYIPCLDN
Sbjct  414  EIPKESKESKKTWSTQADQSENEKERRKGESNSMDGSIYGYTWELCNVTAGPDYIPCLDN  473

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E AL +LRT +H+EHRERHCP+E P+CLV LP+GY+R IEWPKSR+KIW
Sbjct  474  EKALRQLRTTKHYEHRERHCPDESPSCLVPLPEGYRRSIEWPKSRDKIW  522



>ref|XP_008241902.1| PREDICTED: probable methyltransferase PMT27 [Prunus mume]
Length=983

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 88/109 (81%), Gaps = 3/109 (3%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTK-TTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            IP ESK+SKK+WSTQA QS +QKER K  TD Q+   I    WQ+CNVTAG DYIPCLDN
Sbjct  414  IPKESKESKKSWSTQADQSENQKERRKDETDGQDG--IYGYTWQICNVTAGPDYIPCLDN  471

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E AL +LR+ +HF+HRERHCP+E PTCLV LP+GYKR IEWP+SR+KIW
Sbjct  472  EKALKQLRSTKHFQHRERHCPQEGPTCLVPLPEGYKRSIEWPQSRDKIW  520



>ref|XP_008440784.1| PREDICTED: probable methyltransferase PMT27 [Cucumis melo]
Length=933

 Score =   119 bits (297),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ESK+SKK+WSTQA QS ++K+R +     + +I     WQ+CNVTAG DYIPCLDNE
Sbjct  366  IPKESKESKKSWSTQAAQSENEKDRRREESSSDGSIY-GYTWQICNVTAGPDYIPCLDNE  424

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+ +LRT +HFEHRERHCPEE PTCLV LP+GYKR IEWPKSR+KIW
Sbjct  425  KAIKQLRTTKHFEHRERHCPEEGPTCLVSLPEGYKRSIEWPKSRDKIW  472



>ref|XP_010263954.1| PREDICTED: probable methyltransferase PMT27 [Nelumbo nucifera]
Length=934

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -2

Query  331  PQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLD  152
            P+IP ES +SK++WSTQAVQS ++KER K      +  +    W+LCNVTAG DYIPCLD
Sbjct  364  PEIPKESTESKQSWSTQAVQSENEKERRKEGPNGIDRNLYGYTWELCNVTAGPDYIPCLD  423

Query  151  NEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            NE AL KL + RH+EHRERHCP+E PTCLV LP GYKR IEWPKSR+KIW
Sbjct  424  NEKALKKLHSTRHYEHRERHCPDEAPTCLVPLPDGYKRSIEWPKSRDKIW  473



>ref|XP_007203224.1| hypothetical protein PRUPE_ppa000863mg [Prunus persica]
 gb|EMJ04423.1| hypothetical protein PRUPE_ppa000863mg [Prunus persica]
Length=977

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 87/109 (80%), Gaps = 3/109 (3%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTK-TTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            IP ESK+SKK+WSTQA QS +QKER K  TD Q+   I    WQ CNVTAG DYIPCLDN
Sbjct  408  IPKESKESKKSWSTQADQSENQKERRKDETDGQDG--IYGYTWQNCNVTAGPDYIPCLDN  465

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E AL +LRT +HFEHRERHCP+E PTCLV LP+GYKR IEWP+SR+KIW
Sbjct  466  EKALKQLRTTKHFEHRERHCPQEGPTCLVPLPEGYKRSIEWPESRDKIW  514



>ref|XP_004149997.1| PREDICTED: probable methyltransferase PMT27-like [Cucumis sativus]
Length=882

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ESK+SKK+WSTQA QS ++K+R +     + +I     WQ+CNVTAG DYIPCLDNE
Sbjct  315  IPKESKESKKSWSTQAAQSENEKDRRREESSSDGSIY-GYTWQMCNVTAGPDYIPCLDNE  373

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+ +LRT +HFEHRERHCPEE PTCLV LP+GYKR IEWP+SR+KIW
Sbjct  374  KAIKQLRTTKHFEHRERHCPEEGPTCLVSLPEGYKRSIEWPRSRDKIW  421



>gb|KGN48886.1| hypothetical protein Csa_6G504660 [Cucumis sativus]
Length=928

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ESK+SKK+WSTQA QS ++K+R +     + +I     WQ+CNVTAG DYIPCLDNE
Sbjct  361  IPKESKESKKSWSTQAAQSENEKDRRREESSSDGSIY-GYTWQMCNVTAGPDYIPCLDNE  419

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+ +LRT +HFEHRERHCPEE PTCLV LP+GYKR IEWP+SR+KIW
Sbjct  420  KAIKQLRTTKHFEHRERHCPEEGPTCLVSLPEGYKRSIEWPRSRDKIW  467



>ref|XP_011028617.1| PREDICTED: probable methyltransferase PMT27 [Populus euphratica]
Length=948

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 83/108 (77%), Gaps = 1/108 (1%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ESK+SKK+WSTQA +S +QKER K  +   N+ +    WQLCNVTAG DYIPCLDNE
Sbjct  381  IPKESKESKKSWSTQAAESENQKERRKE-ESDGNDSMYGYTWQLCNVTAGPDYIPCLDNE  439

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             AL +L T  HFEHRERHCPE  PTCLV L +GYKRPI WP+SR+KIW
Sbjct  440  KALRQLHTTGHFEHRERHCPEVGPTCLVPLSEGYKRPITWPQSRDKIW  487



>ref|XP_008338020.1| PREDICTED: probable methyltransferase PMT27 [Malus domestica]
Length=965

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            +  ESK+SKK+WSTQA QS  +KER K   + ++ I     WQLCNVTAG DYIPCLDNE
Sbjct  396  VRKESKESKKSWSTQAAQSEXEKERRKDESDGQDGIY-GYTWQLCNVTAGPDYIPCLDNE  454

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             AL KLR+ +HFEHRERHC +E PTCLV LP GYK  IEWPKSR+KIW
Sbjct  455  KALKKLRSTKHFEHRERHCRQEGPTCLVPLPDGYKMSIEWPKSRDKIW  502



>emb|CDP01948.1| unnamed protein product [Coffea canephora]
Length=793

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            D  P  + S QIP ESK  K +WSTQA +S +QK+R +   + ++  I +  WQLCNVTA
Sbjct  217  DFFPTGERS-QIPKESK--KNSWSTQANESENQKDRRQNGQDDQDGSIINYKWQLCNVTA  273

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            GQDYIPCLDNE A+ KLR+R H+EHRERHCPE+ PTCLV LPKGYK+P++WP+SR+KIW
Sbjct  274  GQDYIPCLDNEKAIAKLRSRTHYEHRERHCPEDAPTCLVPLPKGYKKPLQWPQSRDKIW  332



>ref|XP_006383147.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|ERP60944.1| dehydration-responsive family protein [Populus trichocarpa]
Length=949

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = -2

Query  334  SPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCL  155
            +P IP ESK+SKK+WSTQA +S +QKER K  +   N+ +    WQLCNVTAG DYIPCL
Sbjct  379  NPGIPKESKESKKSWSTQAAESENQKERRKE-ESDGNDSMYGYTWQLCNVTAGPDYIPCL  437

Query  154  DNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            DNE AL +L T  HFEHRERHCPE  PTCLV   +GYKRPI WP+SR+KIW
Sbjct  438  DNEKALRQLHTTGHFEHRERHCPEVGPTCLVPPSEGYKRPITWPQSRDKIW  488



>ref|XP_002310282.2| hypothetical protein POPTR_0007s13620g [Populus trichocarpa]
 gb|EEE90732.2| hypothetical protein POPTR_0007s13620g [Populus trichocarpa]
Length=847

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 88/125 (70%), Gaps = 4/125 (3%)
 Frame = -2

Query  376  QEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQ  197
            QE +  +S      +P IP ESK+S   WSTQA +S +QKER K  +   N+ +    WQ
Sbjct  266  QESSSGESAFPGGGNPGIPKESKES---WSTQAAESENQKERRKE-ESDGNDSMYGYTWQ  321

Query  196  LCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKS  17
            LCNVTAG DYIPCLDNE AL +L T  HFEHRERHCPE  PTCLV LP+GYKRPI WP+S
Sbjct  322  LCNVTAGPDYIPCLDNEKALRQLHTTGHFEHRERHCPELGPTCLVPLPQGYKRPITWPQS  381

Query  16   REKIW  2
            R+KIW
Sbjct  382  RDKIW  386



>gb|EPS60899.1| hypothetical protein M569_13900, partial [Genlisea aurea]
Length=577

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = -2

Query  355  SVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAG  176
            S P  +TS  IP ESK+SKK+WSTQA QS ++ ER KT    ++N     +W+LCN TAG
Sbjct  286  SFPNGETS-GIPIESKESKKSWSTQAGQSENENERRKTIPTDKDNSNYGYSWKLCNETAG  344

Query  175  QDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             DYIPCLDNE  + KLR+R H+EHRERHCP++PPTCLV LP GYK+ ++WPKSR+KIW
Sbjct  345  ADYIPCLDNEKYISKLRSRMHYEHRERHCPKDPPTCLVPLPPGYKKSVQWPKSRDKIW  402



>ref|XP_009346291.1| PREDICTED: probable methyltransferase PMT27 [Pyrus x bretschneideri]
Length=962

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            +  ESK+SKK+WSTQA QS ++KER K     ++ I     WQLCNVTAG DYIPCLDNE
Sbjct  393  VRKESKESKKSWSTQAAQSENEKERRKDESAGQDGIY-GYTWQLCNVTAGPDYIPCLDNE  451

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             AL KLR+ +HF+HRERHCP+E PTCLV LP+GY++ I WPKSR+KIW
Sbjct  452  KALKKLRSTKHFQHRERHCPQEGPTCLVPLPEGYQKSIAWPKSRDKIW  499



>ref|XP_008337883.1| PREDICTED: probable methyltransferase PMT27 [Malus domestica]
Length=968

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            +  ESK+SKK+WSTQA QS ++KER K     ++ I     WQLCNVTAG DYIPCLDNE
Sbjct  399  VRKESKESKKSWSTQAAQSENEKERRKDESAGQDGIY-GYTWQLCNVTAGPDYIPCLDNE  457

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             AL KLR+ +HF+HRERHCP+E PTCLV LP+GY++ I WPKSR+KIW
Sbjct  458  KALKKLRSTKHFQHRERHCPQEGPTCLVPLPEGYQKSIAWPKSRDKIW  505



>gb|KHG06183.1| hypothetical protein F383_31802 [Gossypium arboreum]
Length=1220

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ES +SK AW +Q  QS ++KER +     +  +     W LCNVTAG DYIPCLDNE
Sbjct  653  IPKESTESKNAWKSQKAQSENEKERRRDESSGKEGLY-GYTWHLCNVTAGPDYIPCLDNE  711

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             AL KLR+ RHFEHRERHCPEE PTCLV LPKGYKRPI WPKSR+KIW
Sbjct  712  KALKKLRSTRHFEHRERHCPEEGPTCLVPLPKGYKRPISWPKSRDKIW  759



>ref|XP_011025891.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT27 
[Populus euphratica]
Length=1039

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 87/125 (70%), Gaps = 4/125 (3%)
 Frame = -2

Query  376  QEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQ  197
            QE +  +S      +P IP ESK+S   WSTQA +S +QKER K   +  N+ +    WQ
Sbjct  458  QESSSGESAFPGGGNPGIPKESKES---WSTQAAESENQKERRKEESDG-NDSMYGYTWQ  513

Query  196  LCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKS  17
            LCNVTAG DYIPCLDNE AL +L T  HFEHRERHCPE  PTCLV LP+GYKRPI W +S
Sbjct  514  LCNVTAGPDYIPCLDNEKALRQLHTTGHFEHRERHCPELGPTCLVPLPQGYKRPITWTQS  573

Query  16   REKIW  2
            R+KIW
Sbjct  574  RDKIW  578



>ref|XP_007046783.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX90940.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=920

 Score =   110 bits (276),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            DS         IP ES +SKK+W TQ  QS ++KER K     + +I     WQLCNVTA
Sbjct  342  DSNSGESLGSSIPKESSESKKSWKTQKTQSENEKERRKDESNGKESIY-GYTWQLCNVTA  400

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G DYIPCLDNE AL KL + +HFEHRERHCPEE PTCLV LP+GYKR I WP+SR+KIW
Sbjct  401  GPDYIPCLDNEKALKKLHSTKHFEHRERHCPEEAPTCLVPLPEGYKRSIPWPQSRDKIW  459



>ref|XP_008805853.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
 ref|XP_008805854.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=806

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
            NQ++   +  P+   S ++ +E+     AWSTQAV+S ++KE   +   +   +    NW
Sbjct  219  NQDQGSNEVFPSGAQS-ELLNETNTQNGAWSTQAVESKNEKEVQASASSRGQTV--DYNW  275

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            +LCNVTAG DYIPCLDNE A+ KLR+ +H+EHRERHCPEE PTCLV LP GYKRP++WPK
Sbjct  276  RLCNVTAGADYIPCLDNEEAIRKLRSTKHYEHRERHCPEEAPTCLVPLPNGYKRPVDWPK  335

Query  19   SREKIW  2
            SREKIW
Sbjct  336  SREKIW  341



>ref|XP_004289108.1| PREDICTED: probable methyltransferase PMT27-like [Fragaria vesca 
subsp. vesca]
Length=840

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = -2

Query  334  SPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCL  155
            S  IP ESK+SKK+W TQA QS ++KER K   E +++I    +WQLCN TA  DYIPCL
Sbjct  270  SSGIPKESKESKKSWGTQADQSENEKERRKDEKEGQDSIY-GYSWQLCNTTADADYIPCL  328

Query  154  DNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            DN  A+ KLR+ +HFEHRERHCP+E PTCLV +P+GYK  IEWP+SR+KIW
Sbjct  329  DNTKAIKKLRSTKHFEHRERHCPQEGPTCLVPVPEGYKTSIEWPQSRDKIW  379



>ref|XP_010679826.1| PREDICTED: probable methyltransferase PMT27 [Beta vulgaris subsp. 
vulgaris]
Length=953

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKER----TKTTDEQENNIIPSPNWQLCNVTAGQDYIPC  158
            IP ES +SKK+WSTQ   S  +K+R     K  DE+    +    W+LCNVTAG DYIPC
Sbjct  387  IPKESNESKKSWSTQLDHSHDEKQRRGENVKGKDEESGESLYGYTWKLCNVTAGHDYIPC  446

Query  157  LDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            LDNE AL KLRT +HFEHRERHCPE+PPTCLV  P+GYK+ ++WP+SR++IW
Sbjct  447  LDNEKALKKLRTTKHFEHRERHCPEDPPTCLVPAPEGYKKSVQWPQSRDRIW  498



>emb|CDY72237.1| BnaC08g48790D, partial [Brassica napus]
Length=401

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ES +S+K+W +QA +S  +K+R  +     ++I+    W+LCN TA  DYIPCLDNE
Sbjct  191  IPKESAESQKSWKSQATESKDEKQRQTSESNNADSIMTGKAWELCNATAAYDYIPCLDNE  250

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+ KL +R HFEHRERHCPE+PPTCLV LP+GYK  I+WP+SR+KIW
Sbjct  251  EAIKKLTSRGHFEHRERHCPEDPPTCLVSLPEGYKESIKWPESRDKIW  298



>ref|XP_010908928.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=800

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 100/165 (61%), Gaps = 9/165 (5%)
 Frame = -2

Query  493  SQGITSEDQIQHDEATVSGDEDTLKTHPsfssssstdSNQEKAQI-DSVPARKTSPQIPS  317
            +QG+ ++ QI+       G E   K+        +   NQ+K Q  + V       ++ +
Sbjct  187  TQGVKNKGQIEEKVEENGGKETGQKS------DDNNAGNQDKDQGSNEVFPSGAQSELLN  240

Query  316  ESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPAL  137
            E+     AWSTQA +S ++KE   +   +   +    NW+LCN  AG DYIPCLDNE A+
Sbjct  241  ETNTQNVAWSTQAAESKNEKEVQASASSKGQTV--GYNWRLCNANAGADYIPCLDNEEAI  298

Query  136  HKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             KLRT +H+EHRERHCPEE PTCLV LP GY+RPI+WPKSREKIW
Sbjct  299  RKLRTTKHYEHRERHCPEEAPTCLVPLPDGYRRPIDWPKSREKIW  343



>ref|XP_002267515.2| PREDICTED: probable methyltransferase PMT27 [Vitis vinifera]
Length=938

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = -2

Query  334  SPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCL  155
            S  IP ESK+SKK+WSTQA QS +QKER K   +  +  I    WQLCN TAG DYIPCL
Sbjct  370  SSGIPIESKESKKSWSTQADQSENQKERRK---DGPDGTIYGYTWQLCNETAGPDYIPCL  426

Query  154  DNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            DNE A+  L  R+H+EHRERHCPEEPP CLV LP+ YK P+EWP+SR+KIW
Sbjct  427  DNEKAIMTLHGRKHYEHRERHCPEEPPACLVPLPEMYKSPVEWPQSRDKIW  477



>emb|CBI17424.3| unnamed protein product [Vitis vinifera]
Length=860

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = -2

Query  334  SPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCL  155
            S  IP ESK+SKK+WSTQA QS +QKER K   +  +  I    WQLCN TAG DYIPCL
Sbjct  292  SSGIPIESKESKKSWSTQADQSENQKERRK---DGPDGTIYGYTWQLCNETAGPDYIPCL  348

Query  154  DNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            DNE A+  L  R+H+EHRERHCPEEPP CLV LP+ YK P+EWP+SR+KIW
Sbjct  349  DNEKAIMTLHGRKHYEHRERHCPEEPPACLVPLPEMYKSPVEWPQSRDKIW  399



>gb|KDP32665.1| hypothetical protein JCGZ_13663 [Jatropha curcas]
Length=855

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = -2

Query  355  SVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAG  176
            S+     S  IP ESK+SK +WSTQA +S +QKER K    ++N  I    WQLCNVT G
Sbjct  328  SILGGGASAGIPKESKESKNSWSTQATESENQKERRKEELGKDN--IYGYIWQLCNVTTG  385

Query  175  QDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREK  8
             DYIPCLDN+  L KLR+ RHFEHRERHCPEE PTCLV +P+GYK+ I WP SR+K
Sbjct  386  ADYIPCLDNDKQLKKLRSTRHFEHRERHCPEEGPTCLVPIPEGYKKSIPWPASRDK  441



>ref|XP_006403957.1| hypothetical protein EUTSA_v10010109mg [Eutrema salsugineum]
 gb|ESQ45410.1| hypothetical protein EUTSA_v10010109mg [Eutrema salsugineum]
Length=914

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A      IP ES +S+K+W +QA +S  +K+R  +     ++I+    W LCN TAG DY
Sbjct  342  AGGFGSGIPKESAESQKSWKSQATESKDEKQRQTSESNNADSIMGGKTWVLCNATAGPDY  401

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDNE A+ KL +RRHFEHRERHCPE+PPTCLV LP+GYK  I+WP+SR+KIW
Sbjct  402  IPCLDNEEAIRKLTSRRHFEHRERHCPEDPPTCLVSLPEGYKESIKWPESRDKIW  456



>emb|CDY26534.1| BnaC01g23650D [Brassica napus]
Length=767

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A      IP ES +S+K+W +QA +S  +K+R  T      +I+    W+LCN TAG DY
Sbjct  229  ASGFGSGIPKESAESQKSWKSQATESKDEKQRQTTESNTIESIMVGKAWELCNATAGYDY  288

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDNE A+ KL +RRHFEHRERHCPE+PPTCLV LP GYK  I+WP+SR+KIW
Sbjct  289  IPCLDNEAAIKKLTSRRHFEHRERHCPEDPPTCLVSLPDGYKESIKWPESRDKIW  343



>ref|NP_190676.1| putative methyltransferase PMT27 [Arabidopsis thaliana]
 sp|Q9SD39.1|PMTR_ARATH RecName: Full=Probable methyltransferase PMT27 [Arabidopsis thaliana]
 emb|CAB62629.1| putative protein [Arabidopsis thaliana]
 gb|AEE78746.1| putative methyltransferase PMT27 [Arabidopsis thaliana]
Length=895

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A      IP ES +S+K+W +QA +S  +K+R  +       I+    W LCN TAG DY
Sbjct  323  ASGFGSGIPKESAESQKSWKSQATESKDEKQRQTSESNTVERIMDGNAWVLCNATAGTDY  382

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDNE A+ KLR+RRHFEHRERHCPE+PPTCLV LP+GYK  I+WP+SR+KIW
Sbjct  383  IPCLDNEEAIMKLRSRRHFEHRERHCPEDPPTCLVPLPEGYKEAIKWPESRDKIW  437



>ref|XP_009149307.1| PREDICTED: probable methyltransferase PMT27 [Brassica rapa]
Length=902

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  355  SVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAG  176
            S  A      IP ES +S+K+W +QA +S  +K+R  T      +I+    W+LCN TAG
Sbjct  327  SSEASGFGSGIPKESAESQKSWKSQATESKDEKQRQTTESNTIESIMVGKAWELCNATAG  386

Query  175  QDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             DYIPCLDNE A+ KL +RRHFEHRERHCPE+PPTCLV LP GYK  I+WP+SR KIW
Sbjct  387  YDYIPCLDNEAAIKKLTSRRHFEHRERHCPEDPPTCLVSLPDGYKESIKWPESRNKIW  444



>gb|KDO71070.1| hypothetical protein CISIN_1g002884mg [Citrus sinensis]
Length=870

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -2

Query  349  PARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDE--QENNIIPSPNWQLCNVTAG  176
            P  + +   P ES +S+K+WSTQA QS ++KER K   E  + N  I    W+LCN T G
Sbjct  292  PDGRNTGSSPKESLESRKSWSTQASQSQNEKERRKDESEGDEGNGNIDGYTWRLCNETTG  351

Query  175  QDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             D+IPCLDN  A+ +LRT  H+EHRERHCPEE P CLV LP+GYK PI WPKSR+KIW
Sbjct  352  PDFIPCLDNTKAIQQLRTTAHYEHRERHCPEEGPVCLVPLPEGYKVPIPWPKSRDKIW  409



>ref|XP_006467154.1| PREDICTED: probable methyltransferase PMT27-like [Citrus sinensis]
Length=869

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  322  PSESKDSKKAWSTQAVQSVSQKERTKTTDE--QENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            P ES +S+K+WSTQA QS ++KER K   E  + N  I    W+LCN T G D+IPCLDN
Sbjct  300  PKESLESRKSWSTQASQSQNEKERRKDESEGDEGNGNIDGYTWRLCNETTGPDFIPCLDN  359

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ +LRT  H+EHRERHCPEE P CLV LP+GYK PI WPKSR+KIW
Sbjct  360  TKAIQQLRTTAHYEHRERHCPEEGPVCLVPLPEGYKVPIPWPKSRDKIW  408



>emb|CDY33299.1| BnaA01g19660D [Brassica napus]
Length=604

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A      IP ES +S+K+W +QA +S  +K+R  T      +I+    W+LCN TAG DY
Sbjct  66   ASGFGSGIPKESAESQKSWKSQATESKDEKQRQTTESNTIESIMVGKAWELCNATAGYDY  125

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDNE A+ KL +RRHFEHRERHCPE+PPTCLV LP GYK  I+WP+SR KIW
Sbjct  126  IPCLDNEAAIKKLTSRRHFEHRERHCPEDPPTCLVSLPDGYKESIKWPESRNKIW  180



>ref|XP_006425567.1| hypothetical protein CICLE_v10024982mg [Citrus clementina]
 gb|ESR38807.1| hypothetical protein CICLE_v10024982mg [Citrus clementina]
Length=741

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  322  PSESKDSKKAWSTQAVQSVSQKERTKTTDE--QENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            P ES +S+K+WSTQA QS ++KER K   E  + N  I    W+LCN T G D+IPCLDN
Sbjct  172  PKESLESRKSWSTQASQSQNEKERRKDESEGDEGNGNIDGYTWRLCNETTGPDFIPCLDN  231

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ +LRT  H+EHRERHCPEE P CLV LP+GYK PI WPKSR+KIW
Sbjct  232  TKAIQQLRTTAHYEHRERHCPEEGPVCLVPLPEGYKVPIPWPKSRDKIW  280



>ref|XP_006290554.1| hypothetical protein CARUB_v10016641mg [Capsella rubella]
 gb|EOA23452.1| hypothetical protein CARUB_v10016641mg [Capsella rubella]
Length=967

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A      IP ES +S+K+W +QA +S  +K+R  +      + +    W +CNVTAG DY
Sbjct  395  ASGFGSGIPKESAESQKSWKSQATESKDEKQRQTSESNTVESTMDGNAWVICNVTAGTDY  454

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDNE A+ KLR+RRHFEHRERHCPE+PPTCLV LP+GYK  I+WP+SR+KIW
Sbjct  455  IPCLDNEAAIMKLRSRRHFEHRERHCPEDPPTCLVPLPEGYKESIKWPESRDKIW  509



>ref|XP_009115787.1| PREDICTED: probable methyltransferase PMT27 [Brassica rapa]
Length=898

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ES +S+K+W +QA +S  +K+R  +     ++I+    W+LCN TA  DYIPCLDNE
Sbjct  330  IPKESAESQKSWKSQATESKDEKQRQTSESNNADSIMTGKAWELCNATAAYDYIPCLDNE  389

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+ KL +R HFEHRERHCPE+PPTCLV LP+GYK  I+WP+SR+KIW
Sbjct  390  EAIKKLTSRGHFEHRERHCPEDPPTCLVSLPEGYKESIKWPESRDKIW  437



>gb|KDP39437.1| hypothetical protein JCGZ_03719 [Jatropha curcas]
Length=850

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++KE  +++ +Q      + NW++CNVTAG DYIPCLDN
Sbjct  281  ELLNETTTQSGSWSTQAAESKNEKEVQQSSSQQN-----TYNWKVCNVTAGPDYIPCLDN  335

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  LR+ +H+EHRERHCPEEPPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  336  LQAIRSLRSTKHYEHRERHCPEEPPTCLVPLPEGYKRPIEWPKSREKIW  384



>ref|XP_010426649.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=914

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A      IP ES +S+K+W +QA +S  +K+R  +       I+    W LCN TAG DY
Sbjct  342  ASGFGSGIPKESAESQKSWKSQATESKDEKQRQTSESNTVERIMDGNAWVLCNATAGTDY  401

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDNE A+ KLR+RRHFEHRERHCPE+PP+CLV LP+GYK  I+WP+SR+KIW
Sbjct  402  IPCLDNEEAIKKLRSRRHFEHRERHCPEDPPSCLVPLPEGYKESIKWPESRDKIW  456



>ref|XP_010503787.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=913

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A      IP ES +S+K+W +QA +S  +K+R  +       I+    W LCN TAG DY
Sbjct  341  ASGFGSGIPKESAESQKSWKSQATESKDEKQRQTSESNTVERIMDGNAWVLCNATAGTDY  400

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDNE A+ KLR+RRHFEHRERHCPE+PP+CLV LP+GYK  I+WP+SR+KIW
Sbjct  401  IPCLDNEEAIKKLRSRRHFEHRERHCPEDPPSCLVPLPEGYKESIKWPESRDKIW  455



>ref|XP_010515490.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=912

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A      IP ES +S+K+W +QA +S  +K+R  +       I+    W LCN TAG DY
Sbjct  340  ASGFGSGIPKESAESQKSWKSQATESKDEKQRQTSESNTVERIMDGNAWVLCNATAGTDY  399

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDNE A+ KLR+RRHFEHRERHCPE+PP+CLV LP+GYK  I+WP+SR+KIW
Sbjct  400  IPCLDNEEAIKKLRSRRHFEHRERHCPEDPPSCLVPLPEGYKESIKWPESRDKIW  454



>dbj|BAD54068.1| ankyrin-like [Oryza sativa Japonica Group]
 dbj|BAD54567.1| ankyrin-like [Oryza sativa Japonica Group]
Length=447

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = -2

Query  364  QIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPS--------  209
             +D++P  +   ++ +   D + AW+TQA  S  +K+R       ++NI  +        
Sbjct  56   MVDTLPGEEDRAEVSATGVDEQNAWATQADHSHQEKDRRDEAAGVDDNIADATAGGGGGG  115

Query  208  --PNWQLCNVTAGQDYIPCLDNEPALHKLR--TrrhfehrerhcpeepPTCLVQLPKGYK  41
              P W+LCNV AG DYIPCLDN+ A+ KLR    R +EHRERHCP+E PTCLV LP GY+
Sbjct  116  EEPEWRLCNVKAGPDYIPCLDNDKAIKKLRPENYRRYEHRERHCPDEGPTCLVPLPAGYR  175

Query  40   RPIEWPKSREKIW  2
            RPIEWPKSR+++W
Sbjct  176  RPIEWPKSRDRVW  188



>emb|CDY66535.1| BnaA09g54660D [Brassica napus]
Length=655

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ES +S+K+W +QA +S  +K+R  +     ++I+    W+LCN TA  DYIPCLDNE
Sbjct  124  IPKESAESQKSWKSQATESKDEKQRQTSESNNADSIMTGKAWELCNATAAYDYIPCLDNE  183

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+ KL +R HFEHRERHCPE+PPTCLV LP+GYK  I+WP+SR+KIW
Sbjct  184  EAIKKLTSRGHFEHRERHCPEDPPTCLVSLPEGYKESIKWPESRDKIW  231



>gb|KHN36073.1| Putative methyltransferase PMT27 [Glycine soja]
Length=796

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = -2

Query  334  SPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCL  155
            +P+   +   SKK WSTQ  QS  Q+ + +T +   +  +    W LCNVTAG DYIPCL
Sbjct  232  NPKAEKKGGKSKKPWSTQVAQS-QQENKRQTVESNSDEKLEDHTWYLCNVTAGADYIPCL  290

Query  154  DNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            DNE AL +LR+ +H+EHRERHCPE+PPTCLV +PKGYK PIEWP SR+KIW
Sbjct  291  DNEKALKQLRSTKHYEHRERHCPEDPPTCLVPIPKGYKTPIEWPSSRDKIW  341



>ref|XP_008783335.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=807

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     AWSTQA +S ++KE   +   +    +   NW+LCNVTAG D+IPCLDN
Sbjct  236  ELLNETNTQNGAWSTQAAESRNEKEVQASASSKGQ--LVGYNWKLCNVTAGADFIPCLDN  293

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E A+ KL + +H+EHRERHCPEEPPTCLV LP GYKRPI WPKSR+KIW
Sbjct  294  EKAIRKLPSTKHYEHRERHCPEEPPTCLVSLPDGYKRPINWPKSRDKIW  342



>ref|NP_001058561.1| Os06g0712800 [Oryza sativa Japonica Group]
 dbj|BAF20475.1| Os06g0712800, partial [Oryza sativa Japonica Group]
Length=547

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = -2

Query  364  QIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPS--------  209
             +D++P  +   ++ +   D + AW+TQA  S  +K+R       ++NI  +        
Sbjct  156  MVDTLPGEEDRAEVSATGVDEQNAWATQADHSHQEKDRRDEAAGVDDNIADATAGGGGGG  215

Query  208  --PNWQLCNVTAGQDYIPCLDNEPALHKLR--TrrhfehrerhcpeepPTCLVQLPKGYK  41
              P W+LCNV AG DYIPCLDN+ A+ KLR    R +EHRERHCP+E PTCLV LP GY+
Sbjct  216  EEPEWRLCNVKAGPDYIPCLDNDKAIKKLRPENYRRYEHRERHCPDEGPTCLVPLPAGYR  275

Query  40   RPIEWPKSREKIW  2
            RPIEWPKSR+++W
Sbjct  276  RPIEWPKSRDRVW  288



>ref|XP_002516311.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46058.1| ATP binding protein, putative [Ricinus communis]
Length=814

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 83/109 (76%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++K+    +D+Q+     + NW++CNVTAG DYIPCLDN
Sbjct  246  ELLNETATQNGSWSTQAAESKNEKDAQLASDQQK-----TYNWKVCNVTAGPDYIPCLDN  300

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCPEEPPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  301  LQAIRNLHSTKHYEHRERHCPEEPPTCLVPLPEGYKRPIEWPKSREKIW  349



>ref|XP_010412715.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
 ref|XP_010412717.1| PREDICTED: probable methyltransferase PMT27 [Camelina sativa]
Length=467

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ES +S+K+W +QA +S  +K+R  +       I+    W LCN TAG DYIPCLDNE
Sbjct  347  IPKESAESQKSWKSQATESKDEKQRQTSESNTVERIMDGNAWVLCNATAGTDYIPCLDNE  406

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKI  5
             A+ KLR+RRHFEHRERHCPE+PP+CLV LP+GYK  I+WP+SR+K+
Sbjct  407  EAIKKLRSRRHFEHRERHCPEDPPSCLVPLPEGYKESIKWPESRDKV  453



>gb|KDO51661.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
Length=595

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+   K ++STQA +S ++KE  +++++Q        NW+LCNVTAG D+IPCLDN
Sbjct  228  ELTNETTTQKGSFSTQATESKNEKEAQQSSNQQNGY-----NWKLCNVTAGADFIPCLDN  282

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KLR+ +H+EHRERHCPEEPPTCLV LP+GYKR IEWP SREKIW
Sbjct  283  LQAIKKLRSTKHYEHRERHCPEEPPTCLVPLPEGYKRSIEWPTSREKIW  331



>ref|XP_011031158.1| PREDICTED: probable methyltransferase PMT26 isoform X3 [Populus 
euphratica]
 ref|XP_011031159.1| PREDICTED: probable methyltransferase PMT26 isoform X4 [Populus 
euphratica]
Length=830

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++KE  +++++Q+       NW+LCNVTAG D+IPCLDN
Sbjct  262  ELSNETSTQSGSWSTQAAESKNEKETQQSSNQQKGY-----NWKLCNVTAGPDFIPCLDN  316

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L++ +H+EHRERHCPEEPPTCLV LP+GYKRPIEWP SREKIW
Sbjct  317  LQAIRSLQSTKHYEHRERHCPEEPPTCLVLLPEGYKRPIEWPTSREKIW  365



>ref|XP_011031156.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Populus 
euphratica]
Length=846

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++KE  +++++Q+       NW+LCNVTAG D+IPCLDN
Sbjct  278  ELSNETSTQSGSWSTQAAESKNEKETQQSSNQQKGY-----NWKLCNVTAGPDFIPCLDN  332

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L++ +H+EHRERHCPEEPPTCLV LP+GYKRPIEWP SREKIW
Sbjct  333  LQAIRSLQSTKHYEHRERHCPEEPPTCLVLLPEGYKRPIEWPTSREKIW  381



>ref|XP_011031160.1| PREDICTED: probable methyltransferase PMT26 isoform X5 [Populus 
euphratica]
Length=828

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++KE  +++++Q+       NW+LCNVTAG D+IPCLDN
Sbjct  260  ELSNETSTQSGSWSTQAAESKNEKETQQSSNQQK-----GYNWKLCNVTAGPDFIPCLDN  314

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L++ +H+EHRERHCPEEPPTCLV LP+GYKRPIEWP SREKIW
Sbjct  315  LQAIRSLQSTKHYEHRERHCPEEPPTCLVLLPEGYKRPIEWPTSREKIW  363



>ref|XP_011031157.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Populus 
euphratica]
Length=836

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++KE  +++++Q+       NW+LCNVTAG D+IPCLDN
Sbjct  268  ELSNETSTQSGSWSTQAAESKNEKETQQSSNQQK-----GYNWKLCNVTAGPDFIPCLDN  322

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L++ +H+EHRERHCPEEPPTCLV LP+GYKRPIEWP SREKIW
Sbjct  323  LQAIRSLQSTKHYEHRERHCPEEPPTCLVLLPEGYKRPIEWPTSREKIW  371



>ref|XP_009410679.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=797

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     AWSTQAV+S ++KE   ++  +   I  S  W+LCNV AG DYIPCLDN
Sbjct  226  ELLNETSTQNGAWSTQAVESKNEKEIQASSSSKGQTIEYS--WKLCNVKAGADYIPCLDN  283

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E A+ KL + +H+EHRERHCP+  PTCLV LP GYKR I+WPKSREKIW
Sbjct  284  EAAIKKLHSTKHYEHRERHCPDNAPTCLVPLPDGYKRSIKWPKSREKIW  332



>ref|XP_011031161.1| PREDICTED: probable methyltransferase PMT26 isoform X6 [Populus 
euphratica]
Length=828

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++KE  +++++Q+       NW+LCNVTAG D+IPCLDN
Sbjct  260  ELSNETSTQSGSWSTQAAESKNEKETQQSSNQQK-----GYNWKLCNVTAGPDFIPCLDN  314

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L++ +H+EHRERHCPEEPPTCLV LP+GYKRPIEWP SREKIW
Sbjct  315  LQAIRSLQSTKHYEHRERHCPEEPPTCLVLLPEGYKRPIEWPTSREKIW  363



>ref|XP_010674444.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=811

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 82/108 (76%), Gaps = 6/108 (6%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            + +ES     ++STQA +S ++KE  K++++QE        W++CN TAG DYIPCLDN 
Sbjct  245  LLNESAIQNGSFSTQAAESNNEKEAQKSSNQQEFA------WKVCNTTAGPDYIPCLDNW  298

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+H LR+ +HF+HRERHCP +PPTCLV LP+GYKRP+EWPKSREKIW
Sbjct  299  DAIHHLRSTKHFQHRERHCPADPPTCLVPLPEGYKRPVEWPKSREKIW  346



>ref|XP_002306259.2| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE93255.2| dehydration-responsive family protein [Populus trichocarpa]
Length=796

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++KE  +++++Q+       NW+LCNVTAG D+IPCLDN
Sbjct  228  ELSNETSTQSGSWSTQAAESKNEKETQQSSNQQK-----GYNWKLCNVTAGPDFIPCLDN  282

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L++ +H+EHRERHCPEEPPTCLV LP+GYKRPIEWP SREKIW
Sbjct  283  LQAIRSLQSTKHYEHRERHCPEEPPTCLVLLPEGYKRPIEWPTSREKIW  331



>ref|XP_010557710.1| PREDICTED: probable methyltransferase PMT27 [Tarenaya hassleriana]
Length=868

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            IP ES +SKK+W TQA +S ++K+R +   +   + +    W+LCN TAG DYIPCLDNE
Sbjct  300  IPKESPESKKSWKTQATESKNEKQRQRDELDSGESKLDVKAWELCNTTAGPDYIPCLDNE  359

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+ KLR+RRHFEHRERHCPE+PPTCL  LP+GYK  I+WP SR+KIW
Sbjct  360  EAIMKLRSRRHFEHRERHCPEDPPTCLAPLPEGYKESIKWPDSRDKIW  407



>ref|XP_003516560.1| PREDICTED: probable methyltransferase PMT27-like [Glycine max]
Length=796

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = -2

Query  334  SPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCL  155
            +P+   +   SKK WSTQ  QS  Q+ + +T +   +  +    W LCNVTAG DYIPCL
Sbjct  232  NPKAEKKGGKSKKPWSTQVDQS-QQENKRQTVESNSDEKLEDHTWYLCNVTAGADYIPCL  290

Query  154  DNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            DNE AL +LR+ +H+EHRERHCPE+PPTCLV +PKGYK PIEWP SR+KIW
Sbjct  291  DNEKALKQLRSTKHYEHRERHCPEDPPTCLVPIPKGYKTPIEWPSSRDKIW  341



>ref|XP_002285889.2| PREDICTED: probable methyltransferase PMT24 [Vitis vinifera]
 ref|XP_010664148.1| PREDICTED: probable methyltransferase PMT24 [Vitis vinifera]
Length=844

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 86/125 (69%), Gaps = 5/125 (4%)
 Frame = -2

Query  376  QEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQ  197
            +++A  +  PA   S +I +ES     AWSTQ V+S ++KE  ++T  + N       W+
Sbjct  260  KDQASNEVFPAGAQS-EILNESNTGNGAWSTQMVESKNEKESLESTISKPNGY----GWK  314

Query  196  LCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKS  17
            LCNVTAG DYIPCLDN   + +L + +H+EHRERHCP+E PTCLV LP GYKRP++WP S
Sbjct  315  LCNVTAGPDYIPCLDNVQTIRRLPSTKHYEHRERHCPDEAPTCLVPLPGGYKRPVQWPTS  374

Query  16   REKIW  2
            REKIW
Sbjct  375  REKIW  379



>ref|XP_010277710.1| PREDICTED: probable methyltransferase PMT24 [Nelumbo nucifera]
Length=866

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 6/109 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            +I +E+     A+STQA++S ++KE  K+TD++         W+LCNVTAG DYIPCLDN
Sbjct  299  EILNETTTQNGAFSTQALESKNEKESQKSTDQK------GYGWKLCNVTAGPDYIPCLDN  352

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KLR+ +H+EHRERHCPEE PTCLV LP+GY+  I+WPKSREKIW
Sbjct  353  LLAIRKLRSTKHYEHRERHCPEEAPTCLVPLPEGYRSSIKWPKSREKIW  401



>gb|EAZ02339.1| hypothetical protein OsI_24442 [Oryza sativa Indica Group]
Length=934

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 55/132 (42%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -2

Query  361  IDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPS---------  209
            +D++P  +   ++ +   D + AW+TQA  S   K+R       ++NI  +         
Sbjct  342  VDTLPGEEDRAEVSATGVDEQNAWATQADHSHQDKDRRDEAAGVDDNIADATAGGGGGGE  401

Query  208  -PNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhc--peepPTCLVQLPKGYKR  38
             P W+LCNV AG DYIPCLDN+ A+ KLR   +  +  R    P+E PTCLV LP GY+R
Sbjct  402  EPEWRLCNVKAGPDYIPCLDNDKAIKKLRPENYRRYEHRERHCPDEGPTCLVPLPAGYRR  461

Query  37   PIEWPKSREKIW  2
            PIEWPKSR+++W
Sbjct  462  PIEWPKSRDRVW  473



>ref|XP_006432154.1| hypothetical protein CICLE_v10000328mg [Citrus clementina]
 ref|XP_006465082.1| PREDICTED: probable methyltransferase PMT26-like [Citrus sinensis]
 gb|ESR45394.1| hypothetical protein CICLE_v10000328mg [Citrus clementina]
Length=796

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+   K ++STQA +S ++KE  +++++Q        NW+LCNVTAG D+IPCLDN
Sbjct  228  ELTNETTTQKGSFSTQATESKNEKEAQQSSNQQNGY-----NWKLCNVTAGADFIPCLDN  282

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KLR+ +H+EHRERHCPEEPPTCLV LP+GYKR IEWP SREKIW
Sbjct  283  LQAIKKLRSTKHYEHRERHCPEEPPTCLVPLPEGYKRSIEWPTSREKIW  331



>gb|KDO51659.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
 gb|KDO51660.1| hypothetical protein CISIN_1g003776mg [Citrus sinensis]
Length=796

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+   K ++STQA +S ++KE  +++++Q        NW+LCNVTAG D+IPCLDN
Sbjct  228  ELTNETTTQKGSFSTQATESKNEKEAQQSSNQQNGY-----NWKLCNVTAGADFIPCLDN  282

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KLR+ +H+EHRERHCPEEPPTCLV LP+GYKR IEWP SREKIW
Sbjct  283  LQAIKKLRSTKHYEHRERHCPEEPPTCLVPLPEGYKRSIEWPTSREKIW  331



>ref|XP_003630288.1| Ankyrin-like protein [Medicago truncatula]
 gb|AET04764.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=826

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S S+ E  K++ +         NW+LCNVTAG DYIPCLDN
Sbjct  251  ELLNETTTQTGSFSTQAAESKSETESQKSSKQS-----TGFNWKLCNVTAGPDYIPCLDN  305

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L+T +H+EHRER CPE+PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  306  LQAIRNLKTTKHYEHRERQCPEDPPTCLVALPEGYKRPIEWPKSREKIW  354



>ref|XP_003538865.1| PREDICTED: probable methyltransferase PMT27-like [Glycine max]
Length=768

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  304  SKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLR  125
            SKK WSTQ  QS  Q+ + +T +   ++ +    W LCNVT G DYIPCLDNE AL KLR
Sbjct  213  SKKPWSTQVDQS-QQENKRQTVESNSDDKLEGHTWYLCNVTTGADYIPCLDNEKALKKLR  271

Query  124  TrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            + +H+EHRERHCPE+PPTCLV +PKGYK PIEWP SR+KIW
Sbjct  272  STKHYEHRERHCPEDPPTCLVPIPKGYKTPIEWPSSRDKIW  312



>gb|KHN41938.1| Putative methyltransferase PMT27 [Glycine soja]
Length=768

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  304  SKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLR  125
            SKK WSTQ  QS  Q+ + +T +   ++ +    W LCNVT G DYIPCLDNE AL KLR
Sbjct  213  SKKPWSTQVDQS-QQENKRQTVESNSDDKLEGHTWYLCNVTTGADYIPCLDNEKALKKLR  271

Query  124  TrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            + +H+EHRERHCPE+PPTCLV +PKGYK PIEWP SR+KIW
Sbjct  272  STKHYEHRERHCPEDPPTCLVPIPKGYKTPIEWPSSRDKIW  312



>ref|XP_010911089.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
 ref|XP_010911096.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=799

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 88/126 (70%), Gaps = 3/126 (2%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
            +++KA  +  P+   S ++ +E+     AWSTQA +S ++KE   +   +    +   NW
Sbjct  221  DKDKASNEVFPSGAQS-ELLNETNTQNGAWSTQAAESKNEKEVQASASSKGQ--LVGYNW  277

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            +LCNVTA  DYIPCLDNE A+ KL + +H+EHRERHCP+E PTCLV +P GYKRPI+WPK
Sbjct  278  KLCNVTAEADYIPCLDNEEAIRKLPSTKHYEHRERHCPKEAPTCLVHVPDGYKRPIDWPK  337

Query  19   SREKIW  2
            SR+K+W
Sbjct  338  SRDKVW  343



>ref|XP_004143348.1| PREDICTED: probable methyltransferase PMT26-like [Cucumis sativus]
 gb|KGN48314.1| hypothetical protein Csa_6G476050 [Cucumis sativus]
Length=830

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 13/121 (11%)
 Frame = -2

Query  340  KTSPQIPS--------ESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNV  185
            KTS + PS        E+     AWSTQA +S ++KE  +++ +Q   +     W+LCNV
Sbjct  250  KTSEEFPSGAQSELLNETSTQNGAWSTQAAESKNEKETQRSSTKQSGYV-----WKLCNV  304

Query  184  TAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKI  5
            TAG DYIPCLDN  A+  L + +H+EHRERHCPEEPPTCLV LP+GY+RPI WP SREKI
Sbjct  305  TAGSDYIPCLDNLQAIRSLPSTKHYEHRERHCPEEPPTCLVSLPEGYRRPIAWPTSREKI  364

Query  4    W  2
            W
Sbjct  365  W  365



>ref|XP_004166405.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT26-like 
[Cucumis sativus]
Length=829

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 13/121 (11%)
 Frame = -2

Query  340  KTSPQIPS--------ESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNV  185
            KTS + PS        E+     AWSTQA +S ++KE  +++ +Q   +     W+LCNV
Sbjct  249  KTSEEFPSGAQSELLNETSTQNGAWSTQAAESKNEKETQRSSTKQSGYV-----WKLCNV  303

Query  184  TAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKI  5
            TAG DYIPCLDN  A+  L + +H+EHRERHCPEEPPTCLV LP+GY+RPI WP SREKI
Sbjct  304  TAGSDYIPCLDNLQAIRSLPSTKHYEHRERHCPEEPPTCLVSLPEGYRRPIAWPTSREKI  363

Query  4    W  2
            W
Sbjct  364  W  364



>ref|XP_008462649.1| PREDICTED: probable methyltransferase PMT26 [Cucumis melo]
Length=822

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 13/121 (11%)
 Frame = -2

Query  340  KTSPQIPS--------ESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNV  185
            KTS + PS        E+     AWSTQA +S ++KE  +++ +Q   +     W+LCNV
Sbjct  242  KTSEEFPSGAQSELLNETSTQNGAWSTQAAESKNEKETQRSSTKQSGYV-----WKLCNV  296

Query  184  TAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKI  5
            TAG DYIPCLDN  A+  L + +H+EHRERHCPEEPPTCLV LP+GY+RPI WP SREKI
Sbjct  297  TAGSDYIPCLDNLQAIRSLPSTKHYEHRERHCPEEPPTCLVSLPEGYRRPIAWPTSREKI  356

Query  4    W  2
            W
Sbjct  357  W  357



>gb|AES95041.2| methyltransferase PMT16, putative [Medicago truncatula]
Length=841

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = -2

Query  331  PQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPN-WQLCNVTAGQDYIPCL  155
            P+   +   SKK WSTQA QS ++K+R K  +   N      N W LCNVTAG DYIPCL
Sbjct  275  PKAEKKGGKSKKPWSTQADQSQNEKKRQKGDESGGNEKKLQDNKWSLCNVTAGADYIPCL  334

Query  154  DNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            DNE A+ KLR+ +HFEHRERHCPEE PTCLV LP GYK  I+WP SR+K+W
Sbjct  335  DNEKAIKKLRSTKHFEHRERHCPEEGPTCLVPLPNGYKTSIKWPNSRDKVW  385



>ref|XP_009414876.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=637

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 73/98 (74%), Gaps = 4/98 (4%)
 Frame = -2

Query  295  AWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrr  116
            AWSTQA +S  +KE   T+ E         NW+LCNVT G DYIPCLDNE A+ KL+T +
Sbjct  79   AWSTQAAESKKEKEVQATSKEDGTGY----NWKLCNVTTGPDYIPCLDNEDAIKKLKTTK  134

Query  115  hfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            H+EHRERHCP+E PTCL+ LP+GYK+PIEWP SR KIW
Sbjct  135  HYEHRERHCPDEAPTCLLPLPEGYKQPIEWPNSRNKIW  172



>ref|XP_003612083.1| Ankyrin-like protein [Medicago truncatula]
Length=845

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = -2

Query  331  PQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPN-WQLCNVTAGQDYIPCL  155
            P+   +   SKK WSTQA QS ++K+R K  +   N      N W LCNVTAG DYIPCL
Sbjct  275  PKAEKKGGKSKKPWSTQADQSQNEKKRQKGDESGGNEKKLQDNKWSLCNVTAGADYIPCL  334

Query  154  DNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            DNE A+ KLR+ +HFEHRERHCPEE PTCLV LP GYK  I+WP SR+K+W
Sbjct  335  DNEKAIKKLRSTKHFEHRERHCPEEGPTCLVPLPNGYKTSIKWPNSRDKVW  385



>ref|XP_009383568.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=883

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 4/109 (4%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     AWSTQA +S  +KE+      +E+      NW+LCNV+AG DYIPCLDN
Sbjct  314  ELLNETSTQNGAWSTQATES--KKEKAVQAASKEHGT--RNNWKLCNVSAGTDYIPCLDN  369

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E A+ KLR+ +H+EHRERHCP+E P CL+ LP+GYKRPIEWP SR KIW
Sbjct  370  EEAIKKLRSTKHYEHRERHCPDEAPACLLPLPEGYKRPIEWPNSRNKIW  418



>ref|XP_007158605.1| hypothetical protein PHAVU_002G166600g [Phaseolus vulgaris]
 gb|ESW30599.1| hypothetical protein PHAVU_002G166600g [Phaseolus vulgaris]
Length=828

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -2

Query  292  WSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrh  113
            WSTQA QS  + +R K     E  +     W LCNVTA +DYIPCLDNE AL +LRT +H
Sbjct  277  WSTQAAQSQKENKRQKVESNSEEKL-EDHTWYLCNVTANEDYIPCLDNEKALKQLRTTKH  335

Query  112  fehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            +EHRERHCPE+PPTCLV LPKGYK PIEWP SR+KIW
Sbjct  336  YEHRERHCPEDPPTCLVPLPKGYKTPIEWPNSRDKIW  372



>ref|XP_008781596.1| PREDICTED: probable methyltransferase PMT26 [Phoenix dactylifera]
Length=886

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 3/112 (3%)
 Frame = -2

Query  337  TSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPC  158
            T  ++ +E+     AWSTQAV+S ++KE    + + +N    + +W+LCNVTA  DYIPC
Sbjct  312  TQSELLNETNTQNGAWSTQAVESRNEKEVQAASSKGQN---VAYSWKLCNVTAAFDYIPC  368

Query  157  LDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            LDNE A+ KLR+ +HF+HRERHCP+E PTCLV LP+GYK+ I WP SR+KIW
Sbjct  369  LDNEEAIKKLRSTKHFQHRERHCPDEAPTCLVPLPEGYKQQIAWPNSRDKIW  420



>ref|XP_011100953.1| PREDICTED: probable methyltransferase PMT27 [Sesamum indicum]
Length=934

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 107/186 (58%), Gaps = 24/186 (13%)
 Frame = -2

Query  490  QGITSEDQIQHDEATVSGDEDTLKTHPsfssssstdSNQEKA------------QIDSVP  347
            QG TS+DQ+  DE  V+  ED + T      ++    +QE +            Q++   
Sbjct  289  QGATSDDQVHQDETPVNSFED-VHTSQKIDENNEQVKDQETSTDGERNMTSLNQQMNKET  347

Query  346  ARKT----------SPQIPSESKDSKKAWSTQAVQSVSQKERTKT-TDEQENNIIPSPNW  200
            + K           S + P ES   K++WSTQ   S +QKER K    + ++       W
Sbjct  348  SSKKNGEASFPNGESTETPKESNQLKESWSTQVDHSENQKERRKDHALKNKDRSTDGYTW  407

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
             LCNVT G DYIPCLDNE  + K+  R+H+EHRERHCPEEPPTCLV LP+GYKRPI+WP+
Sbjct  408  HLCNVTTGTDYIPCLDNEKLIAKIYNRKHYEHRERHCPEEPPTCLVPLPRGYKRPIDWPQ  467

Query  19   SREKIW  2
            SR+KIW
Sbjct  468  SRDKIW  473



>gb|EEE66346.1| hypothetical protein OsJ_22638 [Oryza sativa Japonica Group]
Length=1001

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 55/132 (42%), Positives = 79/132 (60%), Gaps = 12/132 (9%)
 Frame = -2

Query  361  IDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPS---------  209
            +D++P  +   ++ +   D + AW+TQA  S  +K+R       ++NI  +         
Sbjct  428  VDTLPGEEDRAEVSATGVDEQNAWATQADHSHQEKDRRDEAAGVDDNIADATAGGGGGGE  487

Query  208  -PNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhc--peepPTCLVQLPKGYKR  38
             P W+LCNV AG DYIPCLDN+ A+ KLR   +  +  R    P+E PTCLV LP GY+R
Sbjct  488  EPEWRLCNVKAGPDYIPCLDNDKAIKKLRPENYRRYEHRERHCPDEGPTCLVPLPAGYRR  547

Query  37   PIEWPKSREKIW  2
            PIEWPKSR+++W
Sbjct  548  PIEWPKSRDRVW  559



>ref|XP_011022921.1| PREDICTED: probable methyltransferase PMT26 [Populus euphratica]
Length=840

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++KE  K++++Q        NW+LCNVTAG DYIPCLDN
Sbjct  272  ELLNETTTQSGSWSTQAAESKNEKETQKSSNQQGRY-----NWKLCNVTAGPDYIPCLDN  326

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
               +  L + +H+EHRERHCPEEPPTCLV LP+GYKRPIEWP SREKIW
Sbjct  327  WQKIRSLHSTKHYEHRERHCPEEPPTCLVPLPEGYKRPIEWPTSREKIW  375



>ref|XP_010270332.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Nelumbo 
nucifera]
Length=807

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 91/128 (71%), Gaps = 9/128 (7%)
 Frame = -2

Query  379  NQEKAQIDS--VPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSP  206
            N++  Q+ S   PA   S +I +E+     A+STQAV+S ++K+  K+ D++        
Sbjct  223  NKKDGQVPSEVFPAGSQS-EILNETTTENGAFSTQAVESKNEKDTQKSKDKK------GY  275

Query  205  NWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEW  26
            +W+LCNVTAG DYIPCLDN  A+ KL + +H+EHRERHCPEE PTCLV LP+GYK PI+W
Sbjct  276  SWKLCNVTAGPDYIPCLDNLQAIRKLPSTKHYEHRERHCPEEAPTCLVSLPEGYKIPIKW  335

Query  25   PKSREKIW  2
            PKSREKIW
Sbjct  336  PKSREKIW  343



>ref|XP_010270331.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Nelumbo 
nucifera]
Length=808

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 91/128 (71%), Gaps = 9/128 (7%)
 Frame = -2

Query  379  NQEKAQIDS--VPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSP  206
            N++  Q+ S   PA   S +I +E+     A+STQAV+S ++K+  K+ D++        
Sbjct  223  NKKDGQVPSEVFPAGSQS-EILNETTTENGAFSTQAVESKNEKDTQKSKDKK------GY  275

Query  205  NWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEW  26
            +W+LCNVTAG DYIPCLDN  A+ KL + +H+EHRERHCPEE PTCLV LP+GYK PI+W
Sbjct  276  SWKLCNVTAGPDYIPCLDNLQAIRKLPSTKHYEHRERHCPEEAPTCLVSLPEGYKIPIKW  335

Query  25   PKSREKIW  2
            PKSREKIW
Sbjct  336  PKSREKIW  343



>ref|XP_010527657.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=790

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 89/126 (71%), Gaps = 4/126 (3%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
            N EK+  +  PA + + +I  E+K    AWSTQ V+S ++K+  +++   + +   S  W
Sbjct  205  NAEKSTKEVFPAGEQA-EITREAKTGTGAWSTQLVESQNEKKSQQSSISTDQS---SYGW  260

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            ++CNVTAG DYIPCLDN  A+ KL T  H+EHRERHCPEEPP CLV LP+GYKR I+WPK
Sbjct  261  KVCNVTAGPDYIPCLDNWQAIKKLPTTMHYEHRERHCPEEPPRCLVSLPEGYKRSIKWPK  320

Query  19   SREKIW  2
            SREKIW
Sbjct  321  SREKIW  326



>ref|XP_006295874.1| hypothetical protein CARUB_v10025004mg [Capsella rubella]
 gb|EOA28772.1| hypothetical protein CARUB_v10025004mg [Capsella rubella]
Length=777

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 85/124 (69%), Gaps = 4/124 (3%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQL  194
            EK+  D  PA   + +I  ES  ++ AWSTQ V+S ++K+  +++  ++     S  W+ 
Sbjct  194  EKSNKDVFPAGDQA-EISKESSTTEGAWSTQLVESQNEKKAQESSISKDQK---SYGWKT  249

Query  193  CNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSR  14
            CNVTAG DYIPCLDN  A+ KL T  H+EHRERHCPEE P CLV LP GYKR I+WPKSR
Sbjct  250  CNVTAGPDYIPCLDNWQAIKKLHTTMHYEHRERHCPEESPRCLVSLPDGYKRSIKWPKSR  309

Query  13   EKIW  2
            EKIW
Sbjct  310  EKIW  313



>gb|KHN16949.1| Putative methyltransferase PMT26 [Glycine soja]
Length=832

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 7/109 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +ES     +++TQA +S ++KE   ++ +       S NW+LCNVTAG DYIPCLDN
Sbjct  266  ELLNESTTQNGSFTTQAAESKNEKESQVSSKQ-------SANWKLCNVTAGPDYIPCLDN  318

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRER CP+E PTCLV LP+GYKRPIEWPKSREKIW
Sbjct  319  LKAIKSLPSTKHYEHRERQCPKESPTCLVPLPEGYKRPIEWPKSREKIW  367



>ref|XP_010930722.1| PREDICTED: probable methyltransferase PMT26 [Elaeis guineensis]
Length=887

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     AWSTQA +S ++KE   T+  +  N+  +  W+LCNVT   DYIPCLDN
Sbjct  315  ELLNETNTQNGAWSTQAAESRNEKEVQATSSSEGQNV--AYTWKLCNVTTAFDYIPCLDN  372

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E A+ KLR+ RHFEHRERHCP+E PTCLV LP+GYK+ I WP SR+KIW
Sbjct  373  EEAIKKLRSTRHFEHRERHCPDEAPTCLVPLPEGYKQQIAWPNSRDKIW  421



>ref|XP_002881329.1| hypothetical protein ARALYDRAFT_482372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57588.1| hypothetical protein ARALYDRAFT_482372 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 84/124 (68%), Gaps = 4/124 (3%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQL  194
            EK+  D  PA   + +I  ES     AWSTQ V+S ++K+  +++  ++ +   S  W+ 
Sbjct  190  EKSNKDVFPAGDQA-EITKESSTGDGAWSTQLVESQNEKKAQQSSISKDQS---SYGWKT  245

Query  193  CNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSR  14
            CNVTAG DYIPCLDN  A+ KL T  H+EHRERHCPEE P CLV LP GYKR I+WPKSR
Sbjct  246  CNVTAGPDYIPCLDNWQAIKKLHTTMHYEHRERHCPEETPHCLVSLPDGYKRSIKWPKSR  305

Query  13   EKIW  2
            EKIW
Sbjct  306  EKIW  309



>ref|XP_009398710.1| PREDICTED: probable methyltransferase PMT27 [Musa acuminata subsp. 
malaccensis]
Length=1006

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 83/126 (66%), Gaps = 7/126 (6%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTD-----EQENNIIPSPN--W  200
            +S+  R  S        D K  W+TQA  S ++KER +  +     + E N   S    W
Sbjct  420  ESLSDRAQSDASKDSGGDRKMPWATQADHSDNEKERRREENLSEGSDSEGNAGNSLGQEW  479

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            +LCNVTAG DYIPCLDNE A+ +L + RHFEHRERHCPEE PTCLV+LP GYKR IEWPK
Sbjct  480  KLCNVTAGPDYIPCLDNEKAIKQLHSFRHFEHRERHCPEEGPTCLVRLPDGYKRSIEWPK  539

Query  19   SREKIW  2
            SR++IW
Sbjct  540  SRDRIW  545



>ref|XP_006584650.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006584651.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 ref|XP_006584652.1| PREDICTED: probable methyltransferase PMT26-like isoform X3 [Glycine 
max]
Length=842

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 7/109 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +ES     +++TQA +S ++KE   ++ +       S NW+LCNVTAG DYIPCLDN
Sbjct  276  ELLNESTTQNGSFTTQAAESKNEKESQVSSKQ-------SANWKLCNVTAGPDYIPCLDN  328

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRER CP+E PTCLV LP+GYKRPIEWPKSREKIW
Sbjct  329  LKAIKSLPSTKHYEHRERQCPKESPTCLVPLPEGYKRPIEWPKSREKIW  377



>ref|XP_010027631.1| PREDICTED: probable methyltransferase PMT26 [Eucalyptus grandis]
 gb|KCW54199.1| hypothetical protein EUGRSUZ_I00186 [Eucalyptus grandis]
Length=814

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     A+STQA +S ++KE   ++ +Q      S +W++CNVTAG DYIPCLDN
Sbjct  246  ELLNETTTQNGAFSTQAAESKNEKESQGSSKQQ-----TSYSWKMCNVTAGSDYIPCLDN  300

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ +L + +H+EHRERHCPE PPTCLV LPKGY++PIEWP SREKIW
Sbjct  301  LQAIKRLSSTKHYEHRERHCPENPPTCLVALPKGYRKPIEWPTSREKIW  349



>ref|XP_003523221.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006578784.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 gb|KHN31166.1| Putative methyltransferase PMT26 [Glycine soja]
Length=810

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  ES     +WSTQA +S ++KE  +++ +          W+LCNVTAG D+IPCLDN
Sbjct  242  ELHEESTTETGSWSTQAAESKNEKESQESSKQATGY-----KWKLCNVTAGPDFIPCLDN  296

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  LR+ +H+EHRERHCPEEPPTCLV +P+GYKRPIEWPKSREKIW
Sbjct  297  WKAIRSLRSTKHYEHRERHCPEEPPTCLVPVPEGYKRPIEWPKSREKIW  345



>ref|XP_002520274.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF42060.1| ATP binding protein, putative [Ricinus communis]
Length=802

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = -2

Query  376  QEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQ  197
            +++A ++  PA   S ++ +E+     AWSTQAV+S ++K+  +++  ++     +  W+
Sbjct  218  KDQASVEVFPAGSQS-ELLNETDAQNGAWSTQAVESQNEKKSQQSSISKDQY---AHGWK  273

Query  196  LCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKS  17
            LCNVTAG DYIPCLDN  A+ KL + +H+EHRERHCPEE PTCLV +P+GY+R I+WPKS
Sbjct  274  LCNVTAGPDYIPCLDNWQAIRKLPSTKHYEHRERHCPEEAPTCLVPVPEGYRRSIKWPKS  333

Query  16   REKIW  2
            REKIW
Sbjct  334  REKIW  338



>ref|XP_009355841.1| PREDICTED: probable methyltransferase PMT26 [Pyrus x bretschneideri]
 ref|XP_009355842.1| PREDICTED: probable methyltransferase PMT26 [Pyrus x bretschneideri]
Length=820

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQ+ +S ++KE  + +D++      S NW++CN TAG D+IPCLDN
Sbjct  252  ELLNETTTQNSSWSTQSAESKNEKEAQRASDQK-----TSYNWKVCNSTAGPDFIPCLDN  306

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  LR+ +H+EHRERHCPEE PTCLV LP+GY+RPIEWP SREK+W
Sbjct  307  LQAIKSLRSTKHYEHRERHCPEEAPTCLVPLPEGYRRPIEWPTSREKVW  355



>ref|XP_004503920.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503921.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Cicer 
arietinum]
Length=819

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE T+ T EQ        NW++CNVTAG DYIPCLDN
Sbjct  251  ELLNETTTQTGSFSTQAAESKNEKE-TQKTPEQSTGF----NWKVCNVTAGPDYIPCLDN  305

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRER CP++PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  306  LKAIRNLPSTKHYEHRERQCPQDPPTCLVPLPEGYKRPIEWPKSREKIW  354



>ref|XP_004502956.1| PREDICTED: probable methyltransferase PMT26-like [Cicer arietinum]
Length=803

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++KE T+ + +Q        NW++CNVTAG D+IPCLDN
Sbjct  235  ELLNENTTQTGSWSTQAAESKNEKE-TQESSKQTTGY----NWKVCNVTAGPDFIPCLDN  289

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  LR+ +H+EHRERHCPEEPPTCLV LP+GYKR IEWPKSREKIW
Sbjct  290  WKAIRSLRSTKHYEHRERHCPEEPPTCLVSLPEGYKRSIEWPKSREKIW  338



>emb|CDX94669.1| BnaC07g09890D [Brassica napus]
Length=749

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 76/109 (70%), Gaps = 10/109 (9%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            +I  ES     AWSTQ V+S ++K+            + S  W++CNVTAG DYIPCLDN
Sbjct  187  EITKESSSGSGAWSTQLVESQNEKKAQ----------VSSIKWKVCNVTAGPDYIPCLDN  236

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL + +H+EHRERHCPEE PTCLV LP+GYKR I+WPKSREKIW
Sbjct  237  WQAIKKLHSTKHYEHRERHCPEESPTCLVSLPEGYKRSIKWPKSREKIW  285



>gb|KHN09623.1| Putative methyltransferase PMT26 [Glycine soja]
Length=806

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 7/110 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSP-NWQLCNVTAGQDYIPCLD  152
            ++  ES     +WSTQA QS ++K      D QE++  P+   W+LCNVTAG D+IPCLD
Sbjct  238  ELQEESTAETGSWSTQAAQSKNEK------DSQESSKQPTGYKWKLCNVTAGPDFIPCLD  291

Query  151  NEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            N  A+  L++ +H+EHRERHCPEEPPTCLV +P+GYKRPIEWPKSREKIW
Sbjct  292  NWKAIRSLQSTKHYEHRERHCPEEPPTCLVPVPEGYKRPIEWPKSREKIW  341



>ref|XP_003526869.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006581774.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=806

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 7/110 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSP-NWQLCNVTAGQDYIPCLD  152
            ++  ES     +WSTQA QS ++K      D QE++  P+   W+LCNVTAG D+IPCLD
Sbjct  238  ELQEESTAETGSWSTQAAQSKNEK------DSQESSKQPTGYKWKLCNVTAGPDFIPCLD  291

Query  151  NEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            N  A+  L++ +H+EHRERHCPEEPPTCLV +P+GYKRPIEWPKSREKIW
Sbjct  292  NWKAIRSLQSTKHYEHRERHCPEEPPTCLVPVPEGYKRPIEWPKSREKIW  341



>ref|XP_009102852.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
Length=750

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 76/109 (70%), Gaps = 10/109 (9%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            +I  ES     AWSTQ V+S ++K+            + S  W++CNVTAG DYIPCLDN
Sbjct  188  EITKESSSGSGAWSTQLVESQNEKKAQ----------VSSIKWKVCNVTAGPDYIPCLDN  237

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL + +H+EHRERHCPEE PTCLV LP+GYKR I+WPKSREKIW
Sbjct  238  WQAIKKLHSTKHYEHRERHCPEESPTCLVSLPEGYKRSIKWPKSREKIW  286



>ref|XP_002309924.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE90374.1| dehydration-responsive family protein [Populus trichocarpa]
Length=824

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQA +S ++KE  K++++Q        NW+LCNVTAG DYIPCLDN
Sbjct  256  ELLNETTTQSGSWSTQAAESKNEKETQKSSNQQGGY-----NWKLCNVTAGPDYIPCLDN  310

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
               +  L + +H+EHRERHCPEEPPTCLV LP+GYKRPIEW  SREKIW
Sbjct  311  WQKIRSLHSTKHYEHRERHCPEEPPTCLVPLPEGYKRPIEWSTSREKIW  359



>emb|CDY44314.1| BnaA07g07980D [Brassica napus]
Length=744

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 76/109 (70%), Gaps = 10/109 (9%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            +I  ES     AWSTQ V+S ++K+            + S  W++CNVTAG DYIPCLDN
Sbjct  182  EITKESSSGSGAWSTQLVESQNEKKAQ----------VSSIKWKVCNVTAGPDYIPCLDN  231

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL + +H+EHRERHCPEE PTCLV LP+GYKR I+WPKSREKIW
Sbjct  232  WQAIKKLHSTKHYEHRERHCPEESPTCLVSLPEGYKRSIKWPKSREKIW  280



>ref|XP_008811930.1| PREDICTED: probable methyltransferase PMT24 [Phoenix dactylifera]
Length=955

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 80/113 (71%), Gaps = 4/113 (4%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPN----WQLCNVTAGQDYIP  161
            ++ +E     + W+TQA  S ++KER K  + Q N           W+LC++TAG DYIP
Sbjct  389  EVSNEKNGETRPWATQADHSDTEKERRKGEELQSNGGGGDQEGHIEWKLCDITAGTDYIP  448

Query  160  CLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            CLDN+ A+ KL + RHF+HRERHCPEE PTCLV LPKGY+RPI+WP+SR++IW
Sbjct  449  CLDNKKAIKKLHSFRHFQHRERHCPEEGPTCLVPLPKGYRRPIKWPESRDRIW  501



>ref|XP_010501645.1| PREDICTED: probable methyltransferase PMT24, partial [Camelina 
sativa]
Length=721

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
            N EK++ D  PA   + +I  ES     AWSTQ V+S ++K+            + S  W
Sbjct  192  NTEKSK-DVFPAGDQA-EITKESSTGSGAWSTQLVESQNEKKAQ----------VSSIKW  239

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            ++CNVTAG DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPK
Sbjct  240  KVCNVTAGPDYIPCLDNWQAIRKLHSTKHYEHRERHCPEESPRCLVALPEGYKRSIKWPK  299

Query  19   SREKIW  2
            SREKIW
Sbjct  300  SREKIW  305



>ref|XP_010478312.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Camelina 
sativa]
 ref|XP_010478313.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Camelina 
sativa]
 ref|XP_010478314.1| PREDICTED: probable methyltransferase PMT24 isoform X3 [Camelina 
sativa]
Length=769

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
            N EK++ D  PA   + +I  ES     AWSTQ V+S ++K+            + S  W
Sbjct  192  NTEKSK-DVFPAGDQA-EITKESSTGSGAWSTQLVESQNEKKAQ----------VSSIKW  239

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            ++CNVTAG DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPK
Sbjct  240  KVCNVTAGPDYIPCLDNWQAIRKLHSTKHYEHRERHCPEESPRCLVALPEGYKRSIKWPK  299

Query  19   SREKIW  2
            SREKIW
Sbjct  300  SREKIW  305



>ref|XP_010460728.1| PREDICTED: probable methyltransferase PMT24 [Camelina sativa]
 ref|XP_010460729.1| PREDICTED: probable methyltransferase PMT24 [Camelina sativa]
Length=764

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
            N EK++ D  PA   + +I  ES     AWSTQ V+S ++K+            + S  W
Sbjct  187  NTEKSK-DVFPAGDQA-EITKESSTGSGAWSTQLVESQNEKKAQ----------VSSIKW  234

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            ++CNVTAG DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPK
Sbjct  235  KVCNVTAGPDYIPCLDNWQAIRKLHSTKHYEHRERHCPEESPRCLVALPEGYKRSIKWPK  294

Query  19   SREKIW  2
            SREKIW
Sbjct  295  SREKIW  300



>ref|XP_004288094.1| PREDICTED: probable methyltransferase PMT26-like [Fragaria vesca 
subsp. vesca]
Length=800

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 82/109 (75%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQ+ +S ++KE  +++D+Q        NW+LCN TAG D+IPCLDN
Sbjct  232  ELLNETTVQNGSWSTQSAESKNEKEAQRSSDQQTGY-----NWKLCNSTAGPDFIPCLDN  286

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L++ +H+EHRERHCPEEPPTCL+ LP+GYKRPIEWP SREKIW
Sbjct  287  LQAIRSLQSTKHYEHRERHCPEEPPTCLLPLPEGYKRPIEWPTSREKIW  335



>dbj|BAE99717.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH20160.1| AT2G34300 [Arabidopsis thaliana]
Length=770

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 84/124 (68%), Gaps = 4/124 (3%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQL  194
            EK+  +  PA   + +I  ES     AWSTQ V+S ++K+  +++  ++ +   S  W+ 
Sbjct  187  EKSSKEVFPAGDQA-EITKESSTGDGAWSTQLVESQNEKKAQQSSISKDQS---SYGWKT  242

Query  193  CNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSR  14
            CNVTAG DYIPCLDN  A+ KL T  H+EHRERHCPEE P CLV LP GYKR I+WPKSR
Sbjct  243  CNVTAGPDYIPCLDNWQAIKKLHTTMHYEHRERHCPEESPHCLVSLPDGYKRSIKWPKSR  302

Query  13   EKIW  2
            EKIW
Sbjct  303  EKIW  306



>ref|XP_004502550.1| PREDICTED: probable methyltransferase PMT26-like [Cicer arietinum]
Length=782

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 5/115 (4%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A K    I + +K+   AWSTQA +S   K+  K++   +N+      W+LCN T+G DY
Sbjct  207  ASKEGTSIEASTKNG--AWSTQAAKSWHDKKSQKSSISIDNS---KYEWKLCNTTSGSDY  261

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDN  A+ KLR+  H++HRERHCP+E PTCLV LPKGY+ PI WPKSRE IW
Sbjct  262  IPCLDNLKAIRKLRSISHYQHRERHCPDEVPTCLVSLPKGYRSPIRWPKSREMIW  316



>ref|NP_180977.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 ref|NP_001031477.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 sp|Q0WT31.2|PMTP_ARATH RecName: Full=Probable methyltransferase PMT25 [Arabidopsis thaliana]
 gb|AAC27406.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08950.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
 gb|AEC08951.1| putative methyltransferase PMT25 [Arabidopsis thaliana]
Length=770

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 84/124 (68%), Gaps = 4/124 (3%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQL  194
            EK+  +  PA   + +I  ES     AWSTQ V+S ++K+  +++  ++ +   S  W+ 
Sbjct  187  EKSSKEVFPAGDQA-EITKESSTGDGAWSTQLVESQNEKKAQQSSISKDQS---SYGWKT  242

Query  193  CNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSR  14
            CNVTAG DYIPCLDN  A+ KL T  H+EHRERHCPEE P CLV LP GYKR I+WPKSR
Sbjct  243  CNVTAGPDYIPCLDNWQAIKKLHTTMHYEHRERHCPEESPHCLVSLPDGYKRSIKWPKSR  302

Query  13   EKIW  2
            EKIW
Sbjct  303  EKIW  306



>ref|XP_008394173.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Malus 
domestica]
 ref|XP_008394174.1| PREDICTED: probable methyltransferase PMT26 isoform X1 [Malus 
domestica]
Length=820

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQ+ +S ++KE  + +D++      S NW++CN TAG D+IPCLDN
Sbjct  252  ELLNETTTQNSSWSTQSAESKNEKEAQRASDQK-----TSYNWKVCNSTAGPDFIPCLDN  306

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  LR+ +H+EHRERHCPEE P+CLV LP+GY+RPIEWP SREK+W
Sbjct  307  LQAIKSLRSTKHYEHRERHCPEEAPSCLVPLPEGYRRPIEWPTSREKVW  355



>ref|XP_008394175.1| PREDICTED: probable methyltransferase PMT26 isoform X2 [Malus 
domestica]
Length=807

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQ+ +S ++KE  + +D++      S NW++CN TAG D+IPCLDN
Sbjct  239  ELLNETTTQNSSWSTQSAESKNEKEAQRASDQK-----TSYNWKVCNSTAGPDFIPCLDN  293

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  LR+ +H+EHRERHCPEE P+CLV LP+GY+RPIEWP SREK+W
Sbjct  294  LQAIKSLRSTKHYEHRERHCPEEAPSCLVPLPEGYRRPIEWPTSREKVW  342



>ref|XP_009150474.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
Length=975

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +++TQA +S ++KE  K + +Q +       W LCN TAG DYIPCLDN
Sbjct  406  ELLNETTAQNGSFTTQATESKNEKEAQKGSGDQVDF-----KWTLCNTTAGPDYIPCLDN  460

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L+T +H+EHRERHCP  PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  461  VQAIKSLKTTKHYEHRERHCPVTPPTCLVPLPEGYKRPIEWPKSREKIW  509



>ref|XP_011006302.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Populus 
euphratica]
Length=826

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 86/120 (72%), Gaps = 4/120 (3%)
 Frame = -2

Query  361  IDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVT  182
            I+ +PA   S ++ +E+     AWSTQ V+S+ +K   +++  ++ N+     W+LCNVT
Sbjct  247  IEILPAGAQS-ELLNETNTQNGAWSTQVVESLKEKISQQSSISKDQNV---HAWKLCNVT  302

Query  181  AGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            AG DY+PCLDN   + +L + +H+EHRERHCP+E PTCLV +P+GY+R I+WPKSR+KIW
Sbjct  303  AGPDYVPCLDNWYVIRRLSSTKHYEHRERHCPQEAPTCLVSIPEGYRRSIKWPKSRDKIW  362



>ref|XP_006415572.1| hypothetical protein EUTSA_v10006884mg [Eutrema salsugineum]
 gb|ESQ33925.1| hypothetical protein EUTSA_v10006884mg [Eutrema salsugineum]
Length=761

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 11/119 (9%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            D  PA   + +I  ES     AWSTQ V+S ++K+            + S  W++CNVTA
Sbjct  190  DVFPAGDQA-EITKESSTGSGAWSTQLVESQNEKKAQ----------VSSIKWKVCNVTA  238

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPKSREKIW
Sbjct  239  GPDYIPCLDNWEAIRKLHSTKHYEHRERHCPEESPRCLVSLPEGYKRSIKWPKSREKIW  297



>ref|XP_002893569.1| hypothetical protein ARALYDRAFT_473159 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69828.1| hypothetical protein ARALYDRAFT_473159 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 11/119 (9%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            D  PA   + +I  ES     AWSTQ V+S ++K+            + S  W++CNVTA
Sbjct  200  DVFPAGDQA-EITKESSTGSGAWSTQLVESQNEKKAQ----------VSSIKWKVCNVTA  248

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPKSREKIW
Sbjct  249  GPDYIPCLDNWLAIRKLHSTKHYEHRERHCPEESPRCLVSLPEGYKRSIKWPKSREKIW  307



>ref|XP_006303155.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 ref|XP_006303156.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 gb|EOA36053.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
 gb|EOA36054.1| hypothetical protein CARUB_v10008372mg [Capsella rubella]
Length=767

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 11/119 (9%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            D  PA   + +I  ES     AWSTQ V+S ++K+            + S  W++CNVTA
Sbjct  196  DVFPAGDQA-EITKESSTGSGAWSTQLVESQNEKKAQ----------VSSIKWKVCNVTA  244

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPKSREKIW
Sbjct  245  GPDYIPCLDNWQAIRKLHSTKHYEHRERHCPEEAPRCLVSLPEGYKRSIKWPKSREKIW  303



>emb|CDY43782.1| BnaA06g23180D [Brassica napus]
Length=799

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 101/168 (60%), Gaps = 14/168 (8%)
 Frame = -2

Query  478  SEDQIQHDEATVSGDEDTLKTHPsfssssstdSNQEKAQIDSVPARKTSP---------Q  326
            SE +   D+    GD++T   +    + +  +S +   + +S+   +TS          +
Sbjct  171  SEKKFSDDDTEAKGDKETKTGNEVAETKTEKESTETIVEQESIAKNETSGDLSPPVAQLE  230

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            + +E+     +++TQA +S ++KE  K + +Q +       W LCN TAG DYIPCLDN 
Sbjct  231  LLNETTAQNGSFTTQATESKNEKEAQKGSGDQVDF-----KWTLCNTTAGPDYIPCLDNV  285

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+  L+T +H+EHRERHCP  PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  286  QAIKSLKTTKHYEHRERHCPVTPPTCLVPLPEGYKRPIEWPKSREKIW  333



>ref|XP_011006303.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Populus 
euphratica]
Length=812

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 88/124 (71%), Gaps = 4/124 (3%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQL  194
            ++  I+ +PA   S ++ +E+     AWSTQ V+S+ +K   +++  ++ N+     W+L
Sbjct  229  DQTSIEILPAGAQS-ELLNETNTQNGAWSTQVVESLKEKISQQSSISKDQNV---HAWKL  284

Query  193  CNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSR  14
            CNVTAG DY+PCLDN   + +L + +H+EHRERHCP+E PTCLV +P+GY+R I+WPKSR
Sbjct  285  CNVTAGPDYVPCLDNWYVIRRLSSTKHYEHRERHCPQEAPTCLVSIPEGYRRSIKWPKSR  344

Query  13   EKIW  2
            +KIW
Sbjct  345  DKIW  348



>gb|AAG51752.1|AC068667_31 unknown protein; 55790-52851 [Arabidopsis thaliana]
Length=768

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 11/119 (9%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            D  PA   + +I  ES     AWSTQ V+S ++K+            + S  W++CNVTA
Sbjct  197  DVFPAGDQA-EITKESSTGSGAWSTQLVESQNEKKAQ----------VSSIKWKVCNVTA  245

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPKSREKIW
Sbjct  246  GPDYIPCLDNWQAIRKLHSTKHYEHRERHCPEESPRCLVSLPEGYKRSIKWPKSREKIW  304



>emb|CDX84478.1| BnaC03g50220D [Brassica napus]
Length=840

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 5/112 (4%)
 Frame = -2

Query  337  TSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPC  158
            T  ++ +E+     +++TQA +S ++KE  K + +Q +       W LCN TAG DYIPC
Sbjct  268  TQLELLNETTAQNGSFTTQATESKNEKEAQKGSGDQVDF-----KWTLCNTTAGPDYIPC  322

Query  157  LDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            LDN  A+  L+T +H+EHRERHCP+ PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  323  LDNVQAIKSLKTTKHYEHRERHCPDTPPTCLVPLPEGYKRPIEWPKSREKIW  374



>dbj|BAE99079.1| hypothetical protein [Arabidopsis thaliana]
Length=770

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 11/119 (9%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            D  PA   + +I  ES     AWSTQ V+S ++K+            + S  W++CNVTA
Sbjct  199  DVFPAGDQA-EITKESSTGSGAWSTQLVESQNEKKAQ----------VSSIKWKVCNVTA  247

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPKSREKIW
Sbjct  248  GPDYIPCLDNWQAIRKLHSTKHYEHRERHCPEESPRCLVSLPEGYKRSIKWPKSREKIW  306



>ref|NP_174240.2| putative methyltransferase PMT24 [Arabidopsis thaliana]
 ref|NP_001031109.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
 sp|Q6NPR7.1|PMTO_ARATH RecName: Full=Probable methyltransferase PMT24 [Arabidopsis thaliana]
 gb|AAR23721.1| At1g29470 [Arabidopsis thaliana]
 gb|AEE31093.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
 gb|AEE31094.1| putative methyltransferase PMT24 [Arabidopsis thaliana]
Length=770

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 79/119 (66%), Gaps = 11/119 (9%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            D  PA   + +I  ES     AWSTQ V+S ++K+            + S  W++CNVTA
Sbjct  199  DVFPAGDQA-EITKESSTGSGAWSTQLVESQNEKKAQ----------VSSIKWKVCNVTA  247

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPKSREKIW
Sbjct  248  GPDYIPCLDNWQAIRKLHSTKHYEHRERHCPEESPRCLVSLPEGYKRSIKWPKSREKIW  306



>ref|XP_006828886.1| hypothetical protein AMTR_s00001p00185010 [Amborella trichopoda]
 gb|ERM96302.1| hypothetical protein AMTR_s00001p00185010 [Amborella trichopoda]
Length=918

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 84/126 (67%), Gaps = 9/126 (7%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKER-------TKTTDEQENNIIPSPNW  200
            DS P    S +I +  K    +W+TQA QS ++K+R        + + E+E +I     W
Sbjct  334  DSFPNGSQS-EILNVPKAENGSWATQASQSQNEKKRQNESHANNQGSAEKEGSIYDY-TW  391

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            +LCNVTAG DYIPCLDNE AL KL +  H+EHRERHCPEE PTCLV LP GYK+ +EWP 
Sbjct  392  ELCNVTAGPDYIPCLDNELALKKLHSTGHYEHRERHCPEESPTCLVPLPWGYKKSLEWPG  451

Query  19   SREKIW  2
            SR+KIW
Sbjct  452  SRDKIW  457



>emb|CDY66721.1| BnaC03g76010D, partial [Brassica napus]
Length=529

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 85/126 (67%), Gaps = 10/126 (8%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
            N EK++ D  PA   + +I  ES     +WSTQ V+S ++K+   ++         S  W
Sbjct  142  NAEKSK-DVFPAGDQA-EITKESTTRTGSWSTQLVESQNEKKAQVSSS--------SIKW  191

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            +LCNVTAG DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPK
Sbjct  192  KLCNVTAGPDYIPCLDNLQAIRKLHSTKHYEHRERHCPEEAPRCLVPLPEGYKRSIKWPK  251

Query  19   SREKIW  2
            SREKIW
Sbjct  252  SREKIW  257



>ref|XP_006645134.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=798

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  ES     ++STQ  +S ++KE   +++   +    + NW+LCN  AG DYIPCLDN
Sbjct  231  ELLKESNTENGSFSTQDAESKNEKEAQASSESSGDET--TYNWKLCNTNAGTDYIPCLDN  288

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E A+ KLRT +H+EHRERHCP EPPTC+V LP+GYKRP+EWP SR+K+W
Sbjct  289  EKAIKKLRTTKHYEHRERHCPVEPPTCVVPLPEGYKRPVEWPTSRDKVW  337



>ref|XP_010906388.1| PREDICTED: probable methyltransferase PMT24 [Elaeis guineensis]
Length=955

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 81/116 (70%), Gaps = 11/116 (9%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTD-------EQENNIIPSPNWQLCNVTAGQD  170
            ++ +E     + W+TQA  S ++KER K  +       +QE +I     W+LCNV AG D
Sbjct  383  EVSNEKNGETRPWATQADHSDTEKERRKGEELESNEGGDQEGHI----EWKLCNVIAGTD  438

Query  169  YIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            YIPCLDN  A+ KL + RH++HRERHCPEE PTCLV LP+GY+RPI+WP+SR++IW
Sbjct  439  YIPCLDNVKAIKKLHSFRHYQHRERHCPEEGPTCLVPLPEGYRRPIKWPESRDRIW  494



>gb|EPS67515.1| hypothetical protein M569_07258, partial [Genlisea aurea]
Length=454

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 2/115 (2%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A    P++  ES     ++STQA  S ++KE   ++ E EN    +  W++CN TAG DY
Sbjct  18   ASGNQPELSDESTIQNGSFSTQAAMSKNEKETQGSSSEYENK--NNYTWKVCNTTAGPDY  75

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDN  A+ KLR+ +H+EHRERHCP  PPTCLV LP+GYK+ I WP SREKIW
Sbjct  76   IPCLDNLEAIRKLRSTKHYEHRERHCPSNPPTCLVPLPEGYKKSIPWPTSREKIW  130



>ref|XP_010469377.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=779

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQL  194
            EK+  D  PA   + +I  ES     AWSTQ V+S ++K+  +++  ++ +   S  W+ 
Sbjct  196  EKSNKDVFPAGDQA-EITKESSTRDGAWSTQLVESQNEKKVQESSISKDQS---SYGWKT  251

Query  193  CNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSR  14
            CNVTAG DYIPCLDN   + KL+T  H+EHRERHCP E P CLV LP GYKR I+WPKSR
Sbjct  252  CNVTAGPDYIPCLDNWQVIKKLQTTMHYEHRERHCPTESPHCLVTLPDGYKRSIKWPKSR  311

Query  13   EKIW  2
            E+IW
Sbjct  312  ERIW  315



>ref|XP_006410572.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 ref|XP_006410573.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 gb|ESQ52025.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
 gb|ESQ52026.1| hypothetical protein EUTSA_v10016285mg [Eutrema salsugineum]
Length=771

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 81/124 (65%), Gaps = 3/124 (2%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQL  194
            EK+  D  PA   +      +     AWSTQ V+S ++K+  +++  ++ +   S  W+ 
Sbjct  187  EKSNKDVFPAGDQAEITKETTTTGDGAWSTQLVESQNEKKAQQSSIYKDQS---SYGWKT  243

Query  193  CNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSR  14
            CNVTAG DYIPCLDN  A+ KL T  H+EHRERHCPEE P CLV LP GYKR I+WPKSR
Sbjct  244  CNVTAGPDYIPCLDNLQAIKKLHTTMHYEHRERHCPEESPRCLVSLPDGYKRSIKWPKSR  303

Query  13   EKIW  2
            EKIW
Sbjct  304  EKIW  307



>ref|XP_003564784.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
 ref|XP_010232657.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
Length=812

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 85/125 (68%), Gaps = 2/125 (2%)
 Frame = -2

Query  376  QEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQ  197
            ++ A+ + V       ++  ES     ++STQA +S  +KE   ++    + I  S  W+
Sbjct  228  EQAAKANEVFPDAAQSELLKESNTENGSFSTQAAESKKEKEAQASSKSSGDGITYS--WK  285

Query  196  LCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKS  17
            LCN +A  DYIPCLDNE A+ KL + +H+EHRERHCP+EPPTCLV LP+GYKRPIEWPKS
Sbjct  286  LCNSSAVTDYIPCLDNEKAIKKLHSTKHYEHRERHCPDEPPTCLVPLPEGYKRPIEWPKS  345

Query  16   REKIW  2
            R+K+W
Sbjct  346  RDKVW  350



>ref|XP_008360714.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=840

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQ  +S ++KE  +T++++      S NW++CN TAG D+IPCLDN
Sbjct  272  ELLNETTTQNGSWSTQLAESKNEKEAQRTSNQK-----ASYNWKVCNSTAGPDFIPCLDN  326

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A++ LR+ +H+EHRERHCPEE PTCL+ LP+GY+R IEWP SREKIW
Sbjct  327  LQAINSLRSTKHYEHRERHCPEEAPTCLLPLPEGYRRSIEWPTSREKIW  375



>ref|XP_006847154.1| hypothetical protein AMTR_s00017p00240980 [Amborella trichopoda]
 gb|ERN08735.1| hypothetical protein AMTR_s00017p00240980 [Amborella trichopoda]
Length=850

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
             +E   +++ PA   S +I +E+     +WSTQAV+S ++K+      E+ +       W
Sbjct  256  GKEHVPLETFPAGAQS-EILNETNIQGGSWSTQAVESKNEKQ----VQEEASTSSKVYTW  310

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            +LCNV+AG DYIPCLDN+ A+ +LR+ +H+EHRERHCP+E PTCLV L +GYK PIEWP+
Sbjct  311  KLCNVSAGPDYIPCLDNDEAIRQLRSTKHYEHRERHCPKENPTCLVPLTEGYKCPIEWPQ  370

Query  19   SREKIW  2
            SR+KIW
Sbjct  371  SRDKIW  376



>ref|XP_004967286.1| PREDICTED: probable methyltransferase PMT27-like, partial [Setaria 
italica]
Length=895

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 72/178 (40%), Positives = 99/178 (56%), Gaps = 7/178 (4%)
 Frame = -2

Query  514  KRHPEHE--SQGITSEDQIQHDEATVSGDEDTLKTHPsfssssstdSNQEKAQIDSVPAR  341
            +R PE E  ++   +E+Q+    +  SG E     +           +++     S   R
Sbjct  257  QRQPEEERGNEHPQNEEQVHSSVSDASGGEVFRDQNGDGGDGDKPAVSEDADGNASQDGR  316

Query  340  KTSPQIPSESK-DSKKAWSTQAVQSVSQKER--TKTTDEQENNIIPSPNWQLCNVTAGQD  170
                 +  E++ +  KAW+TQA QS  +K+R         EN+      W++CNV AG D
Sbjct  317  SVEDSLVGEARTEEHKAWATQADQSHREKDRRDENAGSSSENDGGEEHEWRVCNVKAGAD  376

Query  169  YIPCLDNEPALHKLRTrr--hfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            YIPCLDNE A+ KLR      +EHRERHCP+E PTCLV LP GY+RPIEWPKSR++IW
Sbjct  377  YIPCLDNEKAIKKLRPENFRRYEHRERHCPDEGPTCLVPLPGGYRRPIEWPKSRDRIW  434



>ref|XP_007137790.1| hypothetical protein PHAVU_009G155600g [Phaseolus vulgaris]
 gb|ESW09784.1| hypothetical protein PHAVU_009G155600g [Phaseolus vulgaris]
Length=818

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 6/109 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  ES     +WSTQA +S S+KE       QE++     NW++CNV+AG D+IPCLDN
Sbjct  251  ELQDESTTETGSWSTQAAESKSEKE------SQESSKPTGYNWKVCNVSAGPDFIPCLDN  304

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  LR+ +H+EHRERHCPEEPPTC+V +P+GYKR IEWP+SREKIW
Sbjct  305  WKAIRTLRSTKHYEHRERHCPEEPPTCVVPVPEGYKRSIEWPRSREKIW  353



>emb|CDY31339.1| BnaA02g34020D [Brassica napus]
Length=764

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S  +KE  K++ +Q +       W++CN TAG DYIPCLDN
Sbjct  195  ELVNETIAQNGSFSTQATESKKEKEAQKSSGDQIDF-----KWKVCNTTAGPDYIPCLDN  249

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L++ +H+EHRERHCP+ PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  250  VQAIRSLKSTKHYEHRERHCPDSPPTCLVPLPEGYKRPIEWPKSREKIW  298



>ref|XP_009130433.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
 ref|XP_009130434.1| PREDICTED: probable methyltransferase PMT26 [Brassica rapa]
Length=764

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S  +KE  K++ +Q +       W++CN TAG DYIPCLDN
Sbjct  195  ELVNETIAQNGSFSTQATESKKEKEAQKSSGDQIDF-----KWKVCNTTAGPDYIPCLDN  249

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L++ +H+EHRERHCP+ PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  250  VQAIRSLKSTKHYEHRERHCPDSPPTCLVPLPEGYKRPIEWPKSREKIW  298



>ref|XP_006394213.1| hypothetical protein EUTSA_v10003654mg [Eutrema salsugineum]
 gb|ESQ31499.1| hypothetical protein EUTSA_v10003654mg [Eutrema salsugineum]
Length=831

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  K +  Q +       W LCN TAG DYIPCLDN
Sbjct  263  ELLNETIAQNGSFSTQATESKNEKEAQKGSGNQIDF-----KWTLCNTTAGPDYIPCLDN  317

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L++ +H+EHRERHCP+ PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  318  LQAIRSLKSTKHYEHRERHCPDSPPTCLVPLPEGYKRPIEWPKSREKIW  366



>ref|XP_011099715.1| PREDICTED: probable methyltransferase PMT26 [Sesamum indicum]
Length=818

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (72%), Gaps = 3/109 (3%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +ES     ++STQA +S + KE    +  Q  N   + +W+LCN TAG DYIPCLDN
Sbjct  248  ELLNESTTQNGSFSTQATESKNAKEVQGASQPQNQN---TYSWKLCNTTAGPDYIPCLDN  304

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KLRT +H+EHRERHCP+ PPTCLV +P+GY+R IEWP SREKIW
Sbjct  305  LEAIMKLRTTKHYEHRERHCPDNPPTCLVPMPEGYRRTIEWPASREKIW  353



>gb|AAP72961.1| putative ankyrin-like protein [Lactuca sativa]
Length=721

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 83/119 (70%), Gaps = 4/119 (3%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            +S PA   S +I +ES+    A+STQA +S S+KE ++  D  +N       W+ CNVT 
Sbjct  152  ESFPAADQS-EILNESRTENGAFSTQAAESASEKE-SRQPDVLKNE--DGYEWKTCNVTT  207

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G D+IPCLDN  AL K+RT  H+EHRERHCP E PTCLV LP+GYK PI+WP+SR++IW
Sbjct  208  GPDFIPCLDNIGALRKIRTTLHYEHRERHCPVESPTCLVPLPQGYKTPIKWPRSRDQIW  266



>ref|XP_010413759.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=779

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 84/124 (68%), Gaps = 4/124 (3%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQL  194
            EK+  D  PA   + +I  ES     AWSTQ V+S ++K+  +++  ++ +   S  W+ 
Sbjct  196  EKSNKDVFPAGDQA-EITKESSTRDGAWSTQLVESQNEKKVQESSISKDQS---SYGWKT  251

Query  193  CNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSR  14
            CNVTAG DYIPCLDN   + KL++  H+EHRERHCPEE P CLV LP GYKR I+WPKSR
Sbjct  252  CNVTAGPDYIPCLDNWQVIKKLQSTMHYEHRERHCPEESPHCLVTLPDGYKRSIKWPKSR  311

Query  13   EKIW  2
            EKIW
Sbjct  312  EKIW  315



>ref|XP_010090820.1| putative methyltransferase PMT26 [Morus notabilis]
 gb|EXB40945.1| putative methyltransferase PMT26 [Morus notabilis]
Length=816

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     AW TQA +S ++KE  +++++Q      + +W+LCN TAG D+IPCLDN
Sbjct  247  ELLNETATQNSAWKTQAAESKNEKEAQRSSNQQ-----TTYSWKLCNSTAGPDFIPCLDN  301

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCPEE PTCLV LP+GYKR I+WPKSREKIW
Sbjct  302  WQAIRTLHSTKHYEHRERHCPEEAPTCLVPLPEGYKRSIQWPKSREKIW  350



>ref|XP_011078779.1| PREDICTED: probable methyltransferase PMT26 [Sesamum indicum]
Length=817

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 3/109 (3%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +ES     A+STQA +S  +KE  K++  +  N     +W+LCN TAG DYIPCLDN
Sbjct  247  ELLNESTTENGAFSTQATESKKEKEAQKSSLGENQN---GNSWKLCNTTAGPDYIPCLDN  303

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL + +H+EHRERHCPE PPTCLV LP+GY+R IEWP SREKIW
Sbjct  304  LAAIRKLSSTKHYEHRERHCPENPPTCLVPLPEGYQRSIEWPTSREKIW  352



>gb|KHN34092.1| Putative methyltransferase PMT26 [Glycine soja]
Length=849

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 7/109 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +ES     +++TQA +S ++KE   ++ +       S  W+LCNVTAG DYIPCLDN
Sbjct  283  ELLNESTTQNGSFTTQAAESKNEKESQVSSKQ-------STIWKLCNVTAGPDYIPCLDN  335

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRER CPEEPPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  336  LKAIRSLPSTKHYEHRERQCPEEPPTCLVPLPEGYKRPIEWPKSREKIW  384



>ref|XP_006580338.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006580339.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=831

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 7/109 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +ES     +++TQA +S ++KE   ++ +       S  W+LCNVTAG DYIPCLDN
Sbjct  265  ELLNESTTQNGSFTTQAAESKNEKESQVSSKQ-------STIWKLCNVTAGPDYIPCLDN  317

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRER CPEEPPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  318  LKAIRSLPSTKHYEHRERQCPEEPPTCLVPLPEGYKRPIEWPKSREKIW  366



>emb|CDY39830.1| BnaC02g42880D [Brassica napus]
Length=772

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 4/109 (4%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  K++ ++    I    W++CN TAG DYIPCLDN
Sbjct  202  ELVNETIAQNGSFSTQATESKNEKEAQKSSGDR----IIDFKWKVCNTTAGPDYIPCLDN  257

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP+ PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  258  VQAIRSLTSTKHYEHRERHCPDSPPTCLVPLPEGYKRPIEWPKSREKIW  306



>ref|XP_009411900.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009411901.1| PREDICTED: probable methyltransferase PMT26 [Musa acuminata subsp. 
malaccensis]
Length=750

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 78/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  E+     AWSTQAV+S +++E   +   +   +  S +W+LCN TA  DYIPCLDN
Sbjct  182  ELLKETNGQNGAWSTQAVESKNEEEVQASASSKGQKV--SYSWKLCNTTARADYIPCLDN  239

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KLR+ +H+EHRERHCPE+ PTCLV LP GYK+PIEW +SR+K+W
Sbjct  240  VAAIKKLRSTKHYEHRERHCPEQAPTCLVPLPVGYKQPIEWSRSRDKVW  288



>ref|XP_003527960.1| PREDICTED: probable methyltransferase PMT26-like [Glycine max]
Length=835

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 3/117 (3%)
 Frame = -2

Query  352  VPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQ  173
            +    TS +I  E+      WSTQA +S  +KE  K+    ++    + +W+LCN T G 
Sbjct  256  ILVTGTSSEILIETSTENGTWSTQAAESQHEKESQKSLVSIDSR---TYDWKLCNTTTGS  312

Query  172  DYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            +YIPCLDN  A+ KL++  H+EHRERHCP+E  TCLV LP+GY+ PI WPKSRE IW
Sbjct  313  EYIPCLDNWKAIRKLQSISHYEHRERHCPDEATTCLVSLPEGYRSPIRWPKSREMIW  369



>gb|KDO83500.1| hypothetical protein CISIN_1g015557mg [Citrus sinensis]
Length=404

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = -2

Query  295  AWSTQAVQSVSQKE--RTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRT  122
            AWSTQA +S ++KE  ++  T +Q  ++     W++CN TAG DYIPCLDN  A+ KL +
Sbjct  250  AWSTQASESQNEKESQQSSITTDQHGHL-----WKVCNATAGPDYIPCLDNWQAIRKLSS  304

Query  121  rrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             +H+EHRERHCPEE PTC+V LP+GYKR I+WPKSR++IW
Sbjct  305  TKHYEHRERHCPEEAPTCIVPLPEGYKRSIKWPKSRDRIW  344



>dbj|BAD82580.1| ankyrin-like protein [Oryza sativa Japonica Group]
 gb|EAZ14397.1| hypothetical protein OsJ_04316 [Oryza sativa Japonica Group]
Length=798

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 2/154 (1%)
 Frame = -2

Query  463  QHDEATVSGDEDTLKTHPsfssssstdSNQEKAQIDSVPARKTSPQIPSESKDSKKAWST  284
            Q ++A  SG +DT        +   +    + A+ + V       ++  ES     ++ T
Sbjct  186  QEEKAEGSGSKDTTDQPQIEETVDESGEKGQGAKSNEVFPDGAQSELLKESNTENGSFKT  245

Query  283  QAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfeh  104
            Q  +S ++KE    ++  ++    + NW+LCN  AG DYIPCLDNE A+ KLRT +H+EH
Sbjct  246  QDAESKNEKESQAASNSSDDET--TYNWKLCNNNAGTDYIPCLDNEKAIKKLRTTKHYEH  303

Query  103  rerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            RERHCP EPPTC+V LP+GYKRP+EWP SR+K+W
Sbjct  304  RERHCPVEPPTCVVPLPEGYKRPVEWPTSRDKVW  337



>ref|NP_001045015.1| Os01g0883900 [Oryza sativa Japonica Group]
 dbj|BAF06929.1| Os01g0883900 [Oryza sativa Japonica Group]
 dbj|BAG94735.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99723.1| unnamed protein product [Oryza sativa Japonica Group]
Length=806

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 2/154 (1%)
 Frame = -2

Query  463  QHDEATVSGDEDTLKTHPsfssssstdSNQEKAQIDSVPARKTSPQIPSESKDSKKAWST  284
            Q ++A  SG +DT        +   +    + A+ + V       ++  ES     ++ T
Sbjct  194  QEEKAEGSGSKDTTDQPQIEETVDESGEKGQGAKSNEVFPDGAQSELLKESNTENGSFKT  253

Query  283  QAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfeh  104
            Q  +S ++KE    ++  ++    + NW+LCN  AG DYIPCLDNE A+ KLRT +H+EH
Sbjct  254  QDAESKNEKESQAASNSSDDET--TYNWKLCNNNAGTDYIPCLDNEKAIKKLRTTKHYEH  311

Query  103  rerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            RERHCP EPPTC+V LP+GYKRP+EWP SR+K+W
Sbjct  312  RERHCPVEPPTCVVPLPEGYKRPVEWPTSRDKVW  345



>emb|CDX90190.1| BnaA08g17940D [Brassica napus]
Length=687

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 84/126 (67%), Gaps = 7/126 (6%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
            N++    D  PA   + +I  ES     +WSTQ V+S ++K+       Q ++   S  W
Sbjct  105  NEKDTDKDVFPAGDQA-EITKESTTRTGSWSTQLVESQNEKK------AQVSSSSTSIKW  157

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            +LCNVTAG DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPK
Sbjct  158  KLCNVTAGPDYIPCLDNLQAIRKLHSTKHYEHRERHCPEEAPRCLVPLPEGYKRSIKWPK  217

Query  19   SREKIW  2
            SREKIW
Sbjct  218  SREKIW  223



>emb|CDP04655.1| unnamed protein product [Coffea canephora]
Length=766

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 86/125 (69%), Gaps = 3/125 (2%)
 Frame = -2

Query  376  QEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQ  197
            +E  Q   V       ++ +E+     ++STQA +S ++KE ++ + E EN      +W+
Sbjct  180  KENNQTTEVFPSGAQSELLNETTTQNGSFSTQAAESKNEKE-SQQSSEPENQ--SGTSWK  236

Query  196  LCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKS  17
            LCNVTAG DYIPCLDN  A+  LRT +H+EHRERHCP++PPTCLV LP+GY+R IEWP S
Sbjct  237  LCNVTAGPDYIPCLDNLEAIKNLRTTKHYEHRERHCPDDPPTCLVPLPEGYQRSIEWPAS  296

Query  16   REKIW  2
            REKIW
Sbjct  297  REKIW  301



>ref|XP_010679252.1| PREDICTED: probable methyltransferase PMT26 [Beta vulgaris subsp. 
vulgaris]
Length=788

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 86/137 (63%), Gaps = 16/137 (12%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTS-----------PQIPSESKDSKKAWSTQAVQSVSQKERTKTTDE  233
            +Q + Q+DS  ++ TS           P++  E+     AWSTQA +S  QK   K+  +
Sbjct  192  SQSQEQVDSEMSKDTSEKETESGSKDQPELEKETSTEIGAWSTQAAESEKQKVSEKSFKD  251

Query  232  QENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLP  53
            Q+        W++CNVTAG DYIPCLDN   + KL +  H+EHRERHCP+E PTCLV LP
Sbjct  252  QKGY-----KWKICNVTAGPDYIPCLDNIKTIRKLPSTGHYEHRERHCPDEAPTCLVPLP  306

Query  52   KGYKRPIEWPKSREKIW  2
            +GY+  ++WPKSREKIW
Sbjct  307  EGYRTSVKWPKSREKIW  323



>gb|KHN46967.1| Putative methyltransferase PMT25 [Glycine soja]
Length=689

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = -2

Query  337  TSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPC  158
            TS +I  E+      WSTQA +S  +KE  K+    ++    + +W+LCN T G +YIPC
Sbjct  115  TSSEILIETSTENGTWSTQAAESQHEKESQKSLVSIDSR---TYDWKLCNTTTGSEYIPC  171

Query  157  LDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            LDN  A+ KL++  H+EHRERHCP+E  TCLV LP+GY+ PI WPKSRE IW
Sbjct  172  LDNWKAIRKLQSISHYEHRERHCPDEATTCLVSLPEGYRSPIRWPKSREMIW  223



>ref|XP_010546331.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=838

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE    + +          W LCN TAG DYIPCLDN
Sbjct  273  ELLNETVAQNGSFSTQATESKNEKEAQHVSSDYR--------WTLCNTTAGPDYIPCLDN  324

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  LR+ +H+EHRERHCPE  PTCLV LP+GY+RPIEWPKSREKIW
Sbjct  325  LQAIRSLRSTKHYEHRERHCPENQPTCLVPLPEGYRRPIEWPKSREKIW  373



>ref|XP_002458871.1| hypothetical protein SORBIDRAFT_03g041910 [Sorghum bicolor]
 gb|EES03991.1| hypothetical protein SORBIDRAFT_03g041910 [Sorghum bicolor]
Length=791

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 81/109 (74%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  ES     ++ TQA +S ++KE   ++  + +    S +W+LCN +A  DYIPCLDN
Sbjct  224  ELLKESNTQNGSFPTQAAESKNEKEVQASS--KSSGDATSYSWKLCNSSASTDYIPCLDN  281

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E A+ KLRT +H+EHRERHCPEEPPTCLV LP+GYKRPIEWP+SR+K+W
Sbjct  282  EKAIKKLRTTKHYEHRERHCPEEPPTCLVPLPEGYKRPIEWPRSRDKVW  330



>gb|EAY76734.1| hypothetical protein OsI_04689 [Oryza sativa Indica Group]
Length=798

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 2/154 (1%)
 Frame = -2

Query  463  QHDEATVSGDEDTLKTHPsfssssstdSNQEKAQIDSVPARKTSPQIPSESKDSKKAWST  284
            Q ++A  SG +DT        +   +    + A+ + V       ++  ES     ++ T
Sbjct  186  QEEKAEGSGSKDTTDQPQIEETVDESGEKGQGAKSNEVFPDGAQSELLKESNTENGSFKT  245

Query  283  QAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfeh  104
            Q  +S ++KE    ++  ++    + NW+LCN  AG DYIPCLDNE A+ KLRT +H+EH
Sbjct  246  QDAESKNEKESQAASNSSDDET--TYNWKLCNNNAGTDYIPCLDNEKAIKKLRTTKHYEH  303

Query  103  rerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            RERHCP EPPTC+V LP+GYKRP+EWP SR+K+W
Sbjct  304  RERHCPVEPPTCVVPLPEGYKRPVEWPTSRDKVW  337



>ref|XP_009109665.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
 ref|XP_009109666.1| PREDICTED: probable methyltransferase PMT24 [Brassica rapa]
Length=682

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 80/119 (67%), Gaps = 8/119 (7%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            D  PA   + +I  ES     +WSTQ V+S ++K+   ++         S  W+LCNVTA
Sbjct  108  DVFPAGDQA-EITKESTTRTGSWSTQLVESQNEKKAQVSSSS-------SIKWKLCNVTA  159

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G DYIPCLDN  A+ KL + +H+EHRERHCPEE P CLV LP+GYKR I+WPKSREKIW
Sbjct  160  GPDYIPCLDNLLAIRKLHSTKHYEHRERHCPEEAPRCLVPLPEGYKRSIKWPKSREKIW  218



>ref|XP_010484172.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
 ref|XP_010484174.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=821

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  K + ++ +       W LCN TAG DYIPCLDN
Sbjct  253  ELLNETTTQNGSFSTQATESKNEKEAQKGSGDKLDY-----KWALCNTTAGPDYIPCLDN  307

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP+ PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  308  VKAIRSLPSTKHYEHRERHCPDSPPTCLVPLPEGYKRPIEWPKSREKIW  356



>ref|XP_007214544.1| hypothetical protein PRUPE_ppa001471mg [Prunus persica]
 gb|EMJ15743.1| hypothetical protein PRUPE_ppa001471mg [Prunus persica]
Length=819

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQ+ +S ++KE   ++++Q      S NW+LCN TAG D+IPCLDN
Sbjct  251  ELLNETATQNGSWSTQSAESKNEKEAQLSSNQQ-----TSYNWKLCNSTAGPDFIPCLDN  305

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCPEE PTCL+ +P+GY+R IEWPKSREKIW
Sbjct  306  LQAIKSLHSTKHYEHRERHCPEEAPTCLLPVPEGYRRSIEWPKSREKIW  354



>ref|XP_010444329.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=822

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  K + ++ +       W LCN TAG DYIPCLDN
Sbjct  254  ELLNETTTQNGSFSTQATESKNEKEAQKASGDKLDY-----KWALCNTTAGPDYIPCLDN  308

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP+ PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  309  VQAIRSLPSTKHYEHRERHCPDSPPTCLVPLPEGYKRPIEWPKSREKIW  357



>ref|XP_002437585.1| hypothetical protein SORBIDRAFT_10g029820 [Sorghum bicolor]
 gb|EER88952.1| hypothetical protein SORBIDRAFT_10g029820 [Sorghum bicolor]
Length=923

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQ-----ENNIIPSPNWQLCNVTAGQDYIP  161
            +  +  + +KAW+TQA +S  + +R +   E      EN       W+LCNV AG DYIP
Sbjct  347  VAEDRVEEQKAWATQADESHRETDRREEGGENDGNGAENAGFEEHEWRLCNVKAGADYIP  406

Query  160  CLDNEPALHKLRTrr--hfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            CLDNE A+ KLR      +EHRERHCP+E PTCLV LP GY+RPIEWPKSR+++W
Sbjct  407  CLDNEKAIKKLRPENFRRYEHRERHCPDEGPTCLVALPSGYRRPIEWPKSRDRVW  461



>gb|KDP32896.1| hypothetical protein JCGZ_12188 [Jatropha curcas]
Length=813

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = -2

Query  376  QEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQ  197
            ++++ ++  PA   S ++ +E+     AWSTQAV+S ++K+  +++  ++ N      W+
Sbjct  229  KDQSTVEVFPAGSQS-ELLNETDSQNGAWSTQAVESQNEKKSQQSSISKDQN---GQRWK  284

Query  196  LCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKS  17
            LCN TAG DYIPCLDN   + +L + +H+EHRERHCP+E PTCLV LP+GYK+ I+WPKS
Sbjct  285  LCNATAGPDYIPCLDNWQVIRRLPSTKHYEHRERHCPQEAPTCLVPLPEGYKQSIKWPKS  344

Query  16   REKIW  2
            R+KIW
Sbjct  345  RDKIW  349



>ref|XP_006345748.1| PREDICTED: probable methyltransferase PMT26-like [Solanum tuberosum]
Length=813

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 84/119 (71%), Gaps = 5/119 (4%)
 Frame = -2

Query  355  SVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTD-EQENNIIPSPNWQLCNVTA  179
            +V +  T   + +E+     A+ TQA +S ++KE  K++  ++EN+ I    W+LCN TA
Sbjct  234  AVFSSGTQSDLLNETTTQNGAFLTQASESKNEKEMQKSSGSDKENSYI----WKLCNSTA  289

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G DYIPCLDN  A+  LR+ +H+EHRERHCP+ PPTCLV LP+GY+R +EWP SREKIW
Sbjct  290  GPDYIPCLDNLEAIRNLRSTKHYEHRERHCPDNPPTCLVPLPEGYQRSVEWPTSREKIW  348



>ref|XP_010533385.1| PREDICTED: probable methyltransferase PMT24 [Tarenaya hassleriana]
Length=783

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 4/126 (3%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
            N EK+  +  PA   + +I  E+K    AW+TQ V+S  +K+  +++  ++ +   S  W
Sbjct  198  NAEKSTKEVFPAGDQA-EIMQEAKAESGAWTTQLVESQDEKKSQQSSISKDQS---SYGW  253

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            ++CNVTAG DYIPCLDN   +  L T  H+EHRERHCPEEPP CLV LP+GYKR ++WPK
Sbjct  254  KVCNVTAGPDYIPCLDNWQTIKNLPTTTHYEHRERHCPEEPPRCLVSLPEGYKRSVKWPK  313

Query  19   SREKIW  2
            SREKIW
Sbjct  314  SREKIW  319



>ref|NP_001140988.1| uncharacterized protein LOC100273067 [Zea mays]
 gb|ACF85115.1| unknown [Zea mays]
 gb|AFW84364.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
 gb|AFW84365.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
Length=343

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  ES     ++ TQA +S ++KE       + +    S  W+LCN +A  DYIPCLDN
Sbjct  225  ELLKESNTQNGSFPTQAAESKNEKEVQALP--KSSGDATSYTWKLCNSSASTDYIPCLDN  282

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKI  5
            E A+ KLRT +H+EHRERHCPEEPPTCLV LP+GYKRPIEWPKSR+K+
Sbjct  283  EKAIKKLRTTKHYEHRERHCPEEPPTCLVPLPEGYKRPIEWPKSRDKV  330



>ref|XP_010112029.1| putative methyltransferase PMT24 [Morus notabilis]
 gb|EXC32448.1| putative methyltransferase PMT24 [Morus notabilis]
Length=739

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = -2

Query  307  DSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKL  128
            ++   WSTQAV+S  Q E+    +   NN     +W+LCNVTAG DYIPCLDN  A+  L
Sbjct  176  ENNGGWSTQAVES--QNEKRSQHNSISNNNRNGISWRLCNVTAGPDYIPCLDNWEAIRNL  233

Query  127  RTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             + +H+EHRERHCP+EPPTCLV LP+GYKRP++WP SR+KIW
Sbjct  234  PSTKHYEHRERHCPDEPPTCLVPLPEGYKRPVKWPTSRDKIW  275



>ref|XP_008227415.1| PREDICTED: probable methyltransferase PMT26 [Prunus mume]
Length=819

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     +WSTQ+ +S ++KE   ++++Q      S NW+LCN TAG D+IPCLDN
Sbjct  251  ELLNETATQNGSWSTQSTESKNEKEAQLSSNQQ-----TSYNWKLCNSTAGPDFIPCLDN  305

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCPEE PTCL+ +P+GY+R IEWPKSREKIW
Sbjct  306  LQAIKSLHSTKHYEHRERHCPEEAPTCLLPVPEGYRRSIEWPKSREKIW  354



>ref|XP_010461320.1| PREDICTED: probable methyltransferase PMT26 [Camelina sativa]
Length=819

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  K + ++ +       W LCN TAG DYIPCLDN
Sbjct  251  ELLNETTTQNGSFSTQATESKNEKEAQKGSGDKLDY-----KWALCNTTAGPDYIPCLDN  305

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP+ PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  306  VQAIRSLPSTKHYEHRERHCPDIPPTCLVPLPEGYKRPIEWPKSREKIW  354



>ref|XP_010509773.1| PREDICTED: probable methyltransferase PMT25 [Camelina sativa]
Length=771

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 73/124 (59%), Gaps = 8/124 (6%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQL  194
            EK+  D  PA   + +I  ES     AWSTQ V+S ++K+  +++ +Q      S  W+ 
Sbjct  192  EKSNKDVFPAGDQA-EITKESSTRDGAWSTQLVESQNEKKVQESSKDQN-----SYGWKT  245

Query  193  CNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSR  14
            CNVTAG DYIPCLDN   + KL T  H+E R          CLV LP GYKR I+WPKSR
Sbjct  246  CNVTAGPDYIPCLDNWQVIKKLPTTMHYERRHCPEESPH--CLVSLPDGYKRSIKWPKSR  303

Query  13   EKIW  2
            EKIW
Sbjct  304  EKIW  307



>ref|XP_007019267.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY16492.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=837

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 84/123 (68%), Gaps = 4/123 (3%)
 Frame = -2

Query  370  KAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLC  191
            +A  + +PA   S +I +ES     AWSTQAV+S ++K+   ++   E N     +W++C
Sbjct  256  QASNEMLPAGAQS-EILTESTTQNGAWSTQAVESQNEKKSQHSSISSEKN---GHHWKVC  311

Query  190  NVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSRE  11
              TAG DYIPCLDN   + KL + +H+EHRERHCP E PTCLV LP+GYKR ++WPKSR+
Sbjct  312  KSTAGPDYIPCLDNWQVIRKLPSTKHYEHRERHCPAEAPTCLVPLPEGYKRSVKWPKSRD  371

Query  10   KIW  2
            KIW
Sbjct  372  KIW  374



>gb|EMT17461.1| hypothetical protein F775_31288 [Aegilops tauschii]
Length=795

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  ES     ++ TQA +S ++KE    +    + I  S  W+LCN +A  DYIPCLDN
Sbjct  228  ELLKESNTENGSFPTQAAESKNEKEAQAASKSSGDEITYS--WKLCNSSAVTDYIPCLDN  285

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E A+ KL + +H+EHRERHCP EPPTCLV LP+GYKRPIEWPKSR+K+W
Sbjct  286  EKAIKKLHSTKHYEHRERHCPAEPPTCLVPLPEGYKRPIEWPKSRDKVW  334



>ref|XP_009414612.1| PREDICTED: probable methyltransferase PMT24 [Musa acuminata subsp. 
malaccensis]
Length=817

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     AWS+QA +S ++KE    +     N      W+LCNVT G+DYIPCLDN
Sbjct  249  ELLNETNTQNGAWSSQAAESKNEKEVQILSSPDGQNF--DSTWKLCNVTTGEDYIPCLDN  306

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL    H+EHRERHCPEEPPTCLV LP GY+ P+ WP SREKIW
Sbjct  307  VAAIKKLHFTGHYEHRERHCPEEPPTCLVPLPDGYRLPVRWPNSREKIW  355



>ref|NP_201208.2| putative methyltransferase PMT26 [Arabidopsis thaliana]
 sp|Q8L7V3.1|PMTQ_ARATH RecName: Full=Probable methyltransferase PMT26 [Arabidopsis thaliana]
 gb|AAM78114.1| AT5g64030/MBM17_13 [Arabidopsis thaliana]
 gb|AAO23578.1| At5g64030/MBM17_13 [Arabidopsis thaliana]
 gb|AED97831.1| putative methyltransferase PMT26 [Arabidopsis thaliana]
Length=829

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  K + ++ +       W LCN TAG DYIPCLDN
Sbjct  261  ELLNETTAQNGSFSTQATESKNEKEAQKGSGDKLDY-----KWALCNTTAGPDYIPCLDN  315

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP+ PPTCLV LP GYKRPIEWPKSREKIW
Sbjct  316  VQAIRSLPSTKHYEHRERHCPDSPPTCLVPLPDGYKRPIEWPKSREKIW  364



>dbj|BAB10271.1| ankyrin-like protein [Arabidopsis thaliana]
Length=786

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  K + ++ +       W LCN TAG DYIPCLDN
Sbjct  218  ELLNETTAQNGSFSTQATESKNEKEAQKGSGDKLDY-----KWALCNTTAGPDYIPCLDN  272

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP+ PPTCLV LP GYKRPIEWPKSREKIW
Sbjct  273  VQAIRSLPSTKHYEHRERHCPDSPPTCLVPLPDGYKRPIEWPKSREKIW  321



>gb|ACN28572.1| unknown [Zea mays]
 gb|AFW84363.1| hypothetical protein ZEAMMB73_169809 [Zea mays]
Length=792

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  ES     ++ TQA +S ++KE       + +    S  W+LCN +A  DYIPCLDN
Sbjct  225  ELLKESNTQNGSFPTQAAESKNEKEVQALP--KSSGDATSYTWKLCNSSASTDYIPCLDN  282

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E A+ KLRT +H+EHRERHCPEEPPTCLV LP+GYKRPIEWPKSR+K+W
Sbjct  283  EKAIKKLRTTKHYEHRERHCPEEPPTCLVPLPEGYKRPIEWPKSRDKVW  331



>ref|XP_002307464.2| hypothetical protein POPTR_0005s20670g [Populus trichocarpa]
 gb|EEE94460.2| hypothetical protein POPTR_0005s20670g [Populus trichocarpa]
Length=826

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 86/124 (69%), Gaps = 4/124 (3%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQL  194
            ++  I+ +PA   S ++ +E+     AWSTQ V+S  +K   +++  ++ N      W+L
Sbjct  243  DQTSIEILPAGAQS-ELLNETNTQNGAWSTQVVESQKEKISQQSSISKDQN---GHAWKL  298

Query  193  CNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSR  14
            CNVTAG DY+PCLDN   + +L + +H+EHRERHCP+E PTCLV +P+GY+R I+WPKS+
Sbjct  299  CNVTAGPDYVPCLDNWYVIRRLSSTKHYEHRERHCPQEAPTCLVSIPEGYRRSIKWPKSK  358

Query  13   EKIW  2
            +KIW
Sbjct  359  DKIW  362



>ref|XP_006434319.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 ref|XP_006434320.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47559.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47560.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
Length=581

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = -2

Query  295  AWSTQAVQSVSQKE--RTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRT  122
            AWSTQA +S ++KE  ++  T +Q  ++     W++CN TAG DYIPCLDN  A+ KL +
Sbjct  250  AWSTQASESQNEKESQQSSITTDQHGHL-----WKVCNATAGPDYIPCLDNWQAIRKLSS  304

Query  121  rrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             +H+EHRERHCPEE PTC+V LP+GYKR I+WPKSR++IW
Sbjct  305  TKHYEHRERHCPEEAPTCIVPLPEGYKRSIKWPKSRDRIW  344



>gb|EMT26126.1| hypothetical protein F775_52504 [Aegilops tauschii]
Length=718

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 70/113 (62%), Gaps = 14/113 (12%)
 Frame = -2

Query  313  SKDSKKAWSTQAVQSVSQKERTK-------TTDEQENNIIPSPNWQLCNVTAGQDYIPCL  155
            ++  + AW+TQ  QS  +K+R +       +TD +E +      W+ CNV AG DYIPCL
Sbjct  108  AEGDQSAWATQRDQSHREKDRRQEDAGDGNSTDGEEQH-----EWRTCNVKAGADYIPCL  162

Query  154  DNEPALHKLRTrrhfehrerhc--peepPTCLVQLPKGYKRPIEWPKSREKIW  2
            DNE A+ KLR      +  R    P+E PTCLV LP GY+RP+EWPKSR++IW
Sbjct  163  DNEKAVKKLRPENFRRYEHRERHCPDEGPTCLVALPSGYRRPVEWPKSRDRIW  215



>ref|XP_007159858.1| hypothetical protein PHAVU_002G273700g [Phaseolus vulgaris]
 gb|ESW31852.1| hypothetical protein PHAVU_002G273700g [Phaseolus vulgaris]
Length=832

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 79/108 (73%), Gaps = 5/108 (5%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            + +ES     ++STQA +S ++K+  +++ +         +W+LCNVTAG D+IPCLDN 
Sbjct  261  LLNESTAQNGSFSTQASKSNNEKKSQESSKQSTGY-----DWKLCNVTAGPDFIPCLDNV  315

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+  L + +H+EHRER CP+EPPTCLV LP+GYKRPIEWPKSREK+W
Sbjct  316  KAISSLPSTKHYEHRERQCPQEPPTCLVALPEGYKRPIEWPKSREKVW  363



>ref|XP_006281931.1| hypothetical protein CARUB_v10028139mg [Capsella rubella]
 gb|EOA14829.1| hypothetical protein CARUB_v10028139mg [Capsella rubella]
Length=817

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  K   ++ +       W +CN TAG DYIPCLDN
Sbjct  249  ELLNETTAQNGSFSTQATESKNEKEAQKGAGDKLDY-----KWAICNTTAGPDYIPCLDN  303

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP+ PPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  304  VQAIRSLPSTKHYEHRERHCPDTPPTCLVPLPEGYKRPIEWPKSREKIW  352



>ref|XP_007048444.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX92601.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=815

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 8/109 (7%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE   ++ E         +W+LCN TAG DYIPCLDN
Sbjct  249  ELLNENMAQNGSFSTQATESKNEKEAQLSSKEY--------SWKLCNSTAGPDYIPCLDN  300

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCPEEPPTCLV LP+GYKRPIEWPKSREKIW
Sbjct  301  WNAIRHLPSTKHYEHRERHCPEEPPTCLVPLPEGYKRPIEWPKSREKIW  349



>gb|EMS51988.1| putative methyltransferase PMT27 [Triticum urartu]
Length=704

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 14/107 (13%)
 Frame = -2

Query  295  AWSTQAVQSVSQKERTK-------TTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPAL  137
            AW+TQ  QS  +K+R +       +TD +E +      W+ CNV AG DYIPCLDNE A+
Sbjct  233  AWTTQRDQSHREKDRRQEDAGDGNSTDGEEQH-----EWRTCNVKAGADYIPCLDNEKAV  287

Query  136  HKLR--TrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             KLR    R +EHRERHCP+E PTCLV LP+GY+RP+EWPKSR++IW
Sbjct  288  KKLRPENFRRYEHRERHCPDEGPTCLVALPRGYRRPVEWPKSRDRIW  334



>ref|XP_004970814.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=797

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  ES     ++ TQA +S ++KE   ++    +    S  W+LCN +A  DYIPCLDN
Sbjct  230  ELLKESNTQNGSFPTQAAESKNEKEVRASSKSSGDESSYS--WKLCNSSASTDYIPCLDN  287

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E A+ KLR+ +H+EHRERHCPEEPPTCLV LP+GYKRPIEWPKSR+K+W
Sbjct  288  EKAIKKLRSTKHYEHRERHCPEEPPTCLVPLPEGYKRPIEWPKSRDKVW  336



>ref|XP_010063906.1| PREDICTED: probable methyltransferase PMT25 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010063907.1| PREDICTED: probable methyltransferase PMT25 isoform X2 [Eucalyptus 
grandis]
 gb|KCW71194.1| hypothetical protein EUGRSUZ_F04285 [Eucalyptus grandis]
Length=825

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 5/106 (5%)
 Frame = -2

Query  319  SESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPA  140
            +++  S   WSTQ V+S  Q E+    D +E N      W++CN TAG DYIPCLDN  A
Sbjct  262  AQTTASDGTWSTQVVES--QNEKLSQQDSKEQN---DYTWKVCNTTAGPDYIPCLDNVHA  316

Query  139  LHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            + +L +  HFEHRERHCPE+ PTCLV LP GY++PI+WPKSR+KIW
Sbjct  317  VRRLPSTMHFEHRERHCPEDAPTCLVPLPAGYRKPIQWPKSRDKIW  362



>gb|ABA96619.1| dehydration-responsive protein, putative [Oryza sativa Japonica 
Group]
Length=990

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  205  NWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEW  26
             W+LCNV+ G+DYIPCLDNE A+ KL+T +H+EHRERHCP   PTCLV LP GY+RPI W
Sbjct  458  GWKLCNVSTGEDYIPCLDNEAAIKKLKTTKHYEHRERHCPAAAPTCLVPLPGGYRRPIPW  517

Query  25   PKSREKIW  2
            P SR+KIW
Sbjct  518  PYSRDKIW  525



>gb|EAZ19833.1| hypothetical protein OsJ_35417 [Oryza sativa Japonica Group]
Length=990

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  205  NWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEW  26
             W+LCNV+ G+DYIPCLDNE A+ KL+T +H+EHRERHCP   PTCLV LP GY+RPI W
Sbjct  458  GWKLCNVSTGEDYIPCLDNEAAIKKLKTTKHYEHRERHCPAAAPTCLVPLPGGYRRPIPW  517

Query  25   PKSREKIW  2
            P SR+KIW
Sbjct  518  PYSRDKIW  525



>emb|CDX99828.1| BnaC05g22500D [Brassica napus]
Length=750

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 12/119 (10%)
 Frame = -2

Query  358  DSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTA  179
            D  PA   + +I  ES     AWSTQ V+S ++K+            + S  W++CNVTA
Sbjct  175  DVFPAGDQA-EITKESSTGSGAWSTQLVESQNEKKAQ----------VSSIKWKVCNVTA  223

Query  178  GQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            G DYIPCLDN  A+ KL  R+H+EHRERHCPEE P+CLV LP+GYKR I+WPKSREKIW
Sbjct  224  GPDYIPCLDNWQAIRKL-ARKHYEHRERHCPEESPSCLVPLPEGYKRSIKWPKSREKIW  281



>gb|KHG15143.1| hypothetical protein F383_09666 [Gossypium arboreum]
Length=891

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 81/115 (70%), Gaps = 8/115 (7%)
 Frame = -2

Query  346  ARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDY  167
            A  ++ ++ SE      ++STQA  S ++K+    +++         NW+LCN TAG D+
Sbjct  320  AFPSASELLSERITRNGSFSTQAAVSKNEKKDRLPSNKY--------NWKLCNSTAGPDF  371

Query  166  IPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            IPCLDN  A+  LRT +H+EHRERHCP+EPPTCLV LP+GYKRPI+WPKSRE+IW
Sbjct  372  IPCLDNWEAIKHLRTNKHYEHRERHCPKEPPTCLVPLPEGYKRPIKWPKSRERIW  426



>gb|KHN44285.1| Putative methyltransferase PMT25 [Glycine soja]
Length=797

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = -2

Query  316  ESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPAL  137
            E+      WSTQA +S  +KE  K++   ++    + +W+LCN T G +YIPCLDN  A+
Sbjct  230  ETSTENGTWSTQAAESQHEKESQKSSVSIDSR---TYDWKLCNTTTGSEYIPCLDNWQAI  286

Query  136  HKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             KL++ RH+EHRERHCP+E  TCLV LP+GY+ PI WPKSRE IW
Sbjct  287  RKLQSIRHYEHRERHCPDEATTCLVSLPEGYRSPIRWPKSREMIW  331



>ref|XP_003602639.1| Ankyrin-like protein [Medicago truncatula]
Length=501

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 78/109 (72%), Gaps = 7/109 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  +++           NW++CNVTAG D+IPCLDN
Sbjct  223  ELLNETTTQTGSFSTQAAESKNEKEIQESSK-------TGYNWKVCNVTAGPDFIPCLDN  275

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
               +  LR+ +H+EHRERHCPEEPPTCLV LP+GYK  IEWPKSREKIW
Sbjct  276  WKVIRSLRSTKHYEHRERHCPEEPPTCLVSLPEGYKCSIEWPKSREKIW  324



>gb|EYU23728.1| hypothetical protein MIMGU_mgv1a001484mg [Erythranthe guttata]
Length=810

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 78/109 (72%), Gaps = 3/109 (3%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +ES     ++STQA +S  +KE  K++  +  +      W+LCN TAG DYIPCLDN
Sbjct  240  ELTNESTVQNGSFSTQATESKKEKEAQKSSQSESQS---KSTWKLCNTTAGYDYIPCLDN  296

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL T +H+EHRERHCP+ PPTCLV LP+GY+R IEWP+SREKIW
Sbjct  297  LEAIKKLHTTKHYEHRERHCPDNPPTCLVPLPEGYQRSIEWPRSREKIW  345



>ref|XP_003602638.1| Ankyrin-like protein [Medicago truncatula]
Length=508

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 78/109 (72%), Gaps = 7/109 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  +++           NW++CNVTAG D+IPCLDN
Sbjct  223  ELLNETTTQTGSFSTQAAESKNEKEIQESSK-------TGYNWKVCNVTAGPDFIPCLDN  275

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
               +  LR+ +H+EHRERHCPEEPPTCLV LP+GYK  IEWPKSREKIW
Sbjct  276  WKVIRSLRSTKHYEHRERHCPEEPPTCLVSLPEGYKCSIEWPKSREKIW  324



>gb|EAY82457.1| hypothetical protein OsI_37674 [Oryza sativa Indica Group]
Length=932

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  205  NWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEW  26
             W+LCNV+ G+DYIPCLDNE A+ KL+T +H+EHRERHCP   PTCLV LP GY+RPI W
Sbjct  400  GWKLCNVSTGEDYIPCLDNEAAIKKLKTTKHYEHRERHCPAAAPTCLVPLPGGYRRPIPW  459

Query  25   PKSREKIW  2
            P SR+KIW
Sbjct  460  PYSRDKIW  467



>ref|XP_006578949.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006578950.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
Length=834

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = -2

Query  316  ESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPAL  137
            E+      WSTQA +S  +KE  K++   ++    + +W+LCN T G +YIPCLDN  A+
Sbjct  267  ETSTENGTWSTQAAESQHEKESQKSSVSIDSR---TYDWKLCNTTTGSEYIPCLDNWQAI  323

Query  136  HKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             KL++ RH+EHRERHCP+E  TCLV LP+GY+ PI WPKSRE IW
Sbjct  324  RKLQSIRHYEHRERHCPDEATTCLVSLPEGYRSPIRWPKSREMIW  368



>ref|XP_002864883.1| hypothetical protein ARALYDRAFT_496597 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41142.1| hypothetical protein ARALYDRAFT_496597 [Arabidopsis lyrata subsp. 
lyrata]
Length=821

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  K + ++ +       W LCN TAG DYIPCLDN
Sbjct  253  ELLNETTAQNGSFSTQATESKNEKEAQKGSGDKLDY-----KWALCNTTAGPDYIPCLDN  307

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP+ PPTCLV LP+GYK+PIEWPKSREKIW
Sbjct  308  VQAIKSLPSTKHYEHRERHCPDNPPTCLVPLPEGYKQPIEWPKSREKIW  356



>gb|AFW75800.1| hypothetical protein ZEAMMB73_544570 [Zea mays]
Length=915

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 7/109 (6%)
 Frame = -2

Query  307  DSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSP-----NWQLCNVTAGQDYIPCLDNEP  143
            + +KAW+TQA +S  + +R     + + N   +       W++CNV AG DYIPCLDNE 
Sbjct  346  EEQKAWATQADESHRETDRRDEGGDIDGNGAENAGGEEREWRVCNVKAGADYIPCLDNEK  405

Query  142  ALHKLRTrrhfehrerhc--peepPTCLVQLPKGYKRPIEWPKSREKIW  2
            A+ KLR      +  R    P+E PTCLV LP GY+RPIEWPKSR+++W
Sbjct  406  AIKKLRPENFRRYEHRERHCPDEGPTCLVALPSGYRRPIEWPKSRDRVW  454



>ref|XP_008648870.1| PREDICTED: probable methyltransferase PMT24 [Zea mays]
Length=920

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 7/109 (6%)
 Frame = -2

Query  307  DSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSP-----NWQLCNVTAGQDYIPCLDNEP  143
            + +KAW+TQA +S  + +R     + + N   +       W++CNV AG DYIPCLDNE 
Sbjct  351  EEQKAWATQADESHRETDRRDEGGDIDGNGAENAGGEEREWRVCNVKAGADYIPCLDNEK  410

Query  142  ALHKLRTrrhfehrerhc--peepPTCLVQLPKGYKRPIEWPKSREKIW  2
            A+ KLR      +  R    P+E PTCLV LP GY+RPIEWPKSR+++W
Sbjct  411  AIKKLRPENFRRYEHRERHCPDEGPTCLVALPSGYRRPIEWPKSRDRVW  459



>ref|XP_006434317.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 ref|XP_006434318.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47557.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
 gb|ESR47558.1| hypothetical protein CICLE_v10000311mg [Citrus clementina]
Length=808

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = -2

Query  295  AWSTQAVQSVSQKE--RTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRT  122
            AWSTQA +S ++KE  ++  T +Q  ++     W++CN TAG DYIPCLDN  A+ KL +
Sbjct  250  AWSTQASESQNEKESQQSSITTDQHGHL-----WKVCNATAGPDYIPCLDNWQAIRKLSS  304

Query  121  rrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             +H+EHRERHCPEE PTC+V LP+GYKR I+WPKSR++IW
Sbjct  305  TKHYEHRERHCPEEAPTCIVPLPEGYKRSIKWPKSRDRIW  344



>ref|XP_006578951.1| PREDICTED: probable methyltransferase PMT26-like isoform X3 [Glycine 
max]
Length=689

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = -2

Query  316  ESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPAL  137
            E+      WSTQA +S  +KE  K++   ++    + +W+LCN T G +YIPCLDN  A+
Sbjct  122  ETSTENGTWSTQAAESQHEKESQKSSVSIDSR---TYDWKLCNTTTGSEYIPCLDNWQAI  178

Query  136  HKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             KL++ RH+EHRERHCP+E  TCLV LP+GY+ PI WPKSRE IW
Sbjct  179  RKLQSIRHYEHRERHCPDEATTCLVSLPEGYRSPIRWPKSREMIW  223



>gb|KHG22120.1| hypothetical protein F383_28461 [Gossypium arboreum]
Length=834

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 86/126 (68%), Gaps = 6/126 (5%)
 Frame = -2

Query  379  NQEKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNW  200
            NQ   +I  +PA   S +I +E+     AWSTQAV+S ++K+  +++   +NN     +W
Sbjct  251  NQASNEI--LPAGAQS-EILTETTTQNGAWSTQAVESQNEKKSQESSTSSKNN---DYHW  304

Query  199  QLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPK  20
            +LC  TAG DYIPCLDN   + KL +  H+EHRERHCP+E PTCLV LP+GYK  ++WPK
Sbjct  305  KLCKSTAGPDYIPCLDNWQVIRKLPSTMHYEHRERHCPDEAPTCLVPLPEGYKCSVKWPK  364

Query  19   SREKIW  2
            SR+KIW
Sbjct  365  SRDKIW  370



>ref|XP_006472883.1| PREDICTED: probable methyltransferase PMT25-like [Citrus sinensis]
Length=808

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = -2

Query  295  AWSTQAVQSVSQKE--RTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRT  122
            AWSTQA +S ++KE  ++  T +Q  ++     W++CN TAG DYIPCLDN  A+ KL +
Sbjct  250  AWSTQASESQNEKESQQSSITTDQHGHL-----WKVCNATAGPDYIPCLDNWHAIRKLSS  304

Query  121  rrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             +H+EHRERHCPEE PTC+V LP+GYKR I+WPKSR++IW
Sbjct  305  TKHYEHRERHCPEEAPTCIVPLPEGYKRSIKWPKSRDRIW  344



>ref|XP_003580900.1| PREDICTED: probable methyltransferase PMT26 [Brachypodium distachyon]
Length=716

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 74/97 (76%), Gaps = 4/97 (4%)
 Frame = -2

Query  292  WSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrh  113
            W TQA +S + + + KTT    ++I  S +W+LCNV AG DYIPCLDN  A+ KLR+  H
Sbjct  166  WRTQAAES-NMETKEKTT---ASSIPASFSWKLCNVEAGADYIPCLDNVEAIKKLRSDTH  221

Query  112  fehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            +EHRERHCP+EPPTCLV LPKGY+ PI WP+SR++IW
Sbjct  222  YEHRERHCPQEPPTCLVPLPKGYRSPIRWPESRDQIW  258



>emb|CDM85080.1| unnamed protein product [Triticum aestivum]
Length=803

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  ES     ++ TQA +S ++KE    +    + I  S  W+LCN +A  DYIPCLDN
Sbjct  236  ELLKESNTENGSFPTQAAESKNEKEAQAASKSSGDEITYS--WKLCNSSAVTDYIPCLDN  293

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            E A+ KL + +H+EHRERHCP EPPTCLV LP+GYK PIEWPKSR+K+W
Sbjct  294  EKAIKKLHSTKHYEHRERHCPAEPPTCLVPLPEGYKHPIEWPKSRDKVW  342



>ref|XP_009590749.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana tomentosiformis]
 ref|XP_009590750.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana tomentosiformis]
Length=807

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 3/108 (3%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            + +E+     A+STQA +S ++KE  K+ +  + +   S  W++CN TAG DYIPCLDN 
Sbjct  238  LLNETTTQNGAFSTQASESKNEKETQKSPESDKES---SYTWKVCNSTAGPDYIPCLDNL  294

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+  LR+ +H+EHRERHCP+ PPTCLV LP+GY+R +EWP SREKIW
Sbjct  295  EAIRNLRSTKHYEHRERHCPDNPPTCLVPLPEGYQRSVEWPTSREKIW  342



>ref|XP_011027424.1| PREDICTED: probable methyltransferase PMT24 [Populus euphratica]
Length=690

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 84/120 (70%), Gaps = 4/120 (3%)
 Frame = -2

Query  361  IDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVT  182
            I+ +PA  T  ++ +E+     AWSTQ V+S ++K   +++  +++       W+LCNVT
Sbjct  109  IEILPA-GTQSELLNETNTQNGAWSTQVVESQNEKISQQSSIAKDHY---GHGWKLCNVT  164

Query  181  AGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            AG  Y+PCLDN   + +L + +H+EHRERHCP+E PTCLV +P+GY+R ++WPKSREKIW
Sbjct  165  AGPAYVPCLDNWYVIRRLPSTKHYEHRERHCPQEAPTCLVPIPEGYRRSVKWPKSREKIW  224



>ref|XP_004289881.1| PREDICTED: probable methyltransferase PMT25-like [Fragaria vesca 
subsp. vesca]
Length=797

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 84/125 (67%), Gaps = 6/125 (5%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPS-ESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQ  197
            EK Q D VP++    ++ + E K+S+K+ ++  ++S  + +++  +  Q        +W+
Sbjct  213  EKKQEDEVPSQTDEEKVENNEDKNSEKSDTSNNMESGKETQKSSISKTQSEY-----SWK  267

Query  196  LCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKS  17
            LCNVTAG DYIPCLDN   +  L +  H+EHRERHCPEE  TCLV LP+GY+RPI+WP S
Sbjct  268  LCNVTAGPDYIPCLDNWKTIRNLPSTMHYEHRERHCPEEASTCLVSLPEGYRRPIKWPTS  327

Query  16   REKIW  2
            REKIW
Sbjct  328  REKIW  332



>ref|XP_002266357.1| PREDICTED: probable methyltransferase PMT26 [Vitis vinifera]
Length=825

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 10/109 (9%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     A+ TQA +S  +KE  +T            +W++CNVTAG DYIPCLDN
Sbjct  262  ELLNETTTQNGAFLTQAAESKKEKESQQTV----------YSWKVCNVTAGPDYIPCLDN  311

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP EPPTCLV LP+GYKRPIEWP SR+KIW
Sbjct  312  LQAIKSLPSTKHYEHRERHCPNEPPTCLVSLPEGYKRPIEWPTSRDKIW  360



>gb|EYU24085.1| hypothetical protein MIMGU_mgv1a001214mg [Erythranthe guttata]
Length=864

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 97/171 (57%), Gaps = 10/171 (6%)
 Frame = -2

Query  514  KRHPEHESQGITSEDQIQHDEATVSGDEDTLKTHPsfssssstdSNQEKAQIDSVPARKT  335
            K HP+++  G TS DQIQHDE      ++ +  H     +   D         +   +K+
Sbjct  241  KWHPKNDPTGATSHDQIQHDE------QEPITLHHEQIINHDDDDQASSKDDQTKNKKKS  294

Query  334  SPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCL  155
            S Q   ES  S +          ++ E  K++  ++        WQ+CN +AG DYIPCL
Sbjct  295  STQADDESTVSSEKERRNNGGGSNKDEEDKSSSSEDYGY----KWQMCNTSAGADYIPCL  350

Query  154  DNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            DNE  + ++ TR+H EHRERHCPE+PPTCLV LP GYKR I+WP+SR+KIW
Sbjct  351  DNEKVISQIHTRKHHEHRERHCPEDPPTCLVPLPNGYKRRIDWPQSRDKIW  401



>ref|XP_003602637.1| Ankyrin-like protein [Medicago truncatula]
 gb|AES72888.1| methyltransferase PMT26-like protein, putative [Medicago truncatula]
Length=789

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 78/109 (72%), Gaps = 7/109 (6%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  +++           NW++CNVTAG D+IPCLDN
Sbjct  223  ELLNETTTQTGSFSTQAAESKNEKEIQESSK-------TGYNWKVCNVTAGPDFIPCLDN  275

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
               +  LR+ +H+EHRERHCPEEPPTCLV LP+GYK  IEWPKSREKIW
Sbjct  276  WKVIRSLRSTKHYEHRERHCPEEPPTCLVSLPEGYKCSIEWPKSREKIW  324



>ref|XP_002300957.2| hypothetical protein POPTR_0002s07640g [Populus trichocarpa]
 gb|ABK94843.1| unknown [Populus trichocarpa]
 gb|EEE80230.2| hypothetical protein POPTR_0002s07640g [Populus trichocarpa]
Length=817

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 83/120 (69%), Gaps = 4/120 (3%)
 Frame = -2

Query  361  IDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVT  182
            I+ +PA  T  ++ +E+     AWSTQ V+S ++K   +++  ++        W+LCNVT
Sbjct  236  IEILPA-GTQSELLNETNTRNGAWSTQVVESQNEKISQQSSIAKDQY---GHGWKLCNVT  291

Query  181  AGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            AG  Y+PCLDN   + +L + +H+EHRERHCP+E PTCLV +P+GY+R ++WPKSREKIW
Sbjct  292  AGPAYVPCLDNWYVIRRLPSTKHYEHRERHCPQEAPTCLVPIPEGYRRSVKWPKSREKIW  351



>emb|CBI37509.3| unnamed protein product [Vitis vinifera]
Length=761

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 10/109 (9%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     A+ TQA +S  +KE  +T            +W++CNVTAG DYIPCLDN
Sbjct  198  ELLNETTTQNGAFLTQAAESKKEKESQQTV----------YSWKVCNVTAGPDYIPCLDN  247

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP EPPTCLV LP+GYKRPIEWP SR+KIW
Sbjct  248  LQAIKSLPSTKHYEHRERHCPNEPPTCLVSLPEGYKRPIEWPTSRDKIW  296



>ref|XP_007137499.1| hypothetical protein PHAVU_009G132000g [Phaseolus vulgaris]
 gb|ESW09493.1| hypothetical protein PHAVU_009G132000g [Phaseolus vulgaris]
Length=833

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  316  ESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPAL  137
            E+      WSTQA +S  +KE  K++   +N      +W+LCN T G +YIPCLDN   +
Sbjct  266  ETSTENGTWSTQAAESQHEKESQKSSVSIDNR---RYDWKLCNTTTGSEYIPCLDNWQTI  322

Query  136  HKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             +L++  H+EHRERHCP+E  TCLV LP+GY+ P  WPKSRE IW
Sbjct  323  RRLQSISHYEHRERHCPDEATTCLVSLPEGYRSPFRWPKSREMIW  367



>dbj|BAK05773.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 65/104 (63%), Gaps = 4/104 (4%)
 Frame = -2

Query  301  KKAWSTQAVQSVSQKERTKTTDEQENNIIPSPN--WQLCNVTAGQDYIPCLDNEPALHKL  128
            + AW+TQ  QS  +K+R +   +  N         W+ CNV AG DYIPCLDNE A+ KL
Sbjct  352  QSAWATQRDQSHREKDRRQEDADDGNGTDGEEQHEWRTCNVKAGADYIPCLDNEKAVKKL  411

Query  127  RTrrhfehrerhc--peepPTCLVQLPKGYKRPIEWPKSREKIW  2
            R      +  R    P+E PTCLV LP+GY+RP+EWPKSR++IW
Sbjct  412  RPENFRRYEHRERHCPDEGPTCLVALPRGYRRPVEWPKSRDRIW  455



>gb|EMS53293.1| putative methyltransferase PMT26 [Triticum urartu]
Length=946

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = -2

Query  331  PQIPSESKDSKK----AWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYI  164
            PQI  + ++S +    A + +A +S ++KE    +    + I  S  W+LCN +A  DYI
Sbjct  361  PQIEEKVEESGEKEPAAKANEAAESKNEKEAQAASKSSGDEITYS--WKLCNSSAVTDYI  418

Query  163  PCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            PCLDNE A+ KL + +H+EHRERHCP EPPTCLV LP+GYKRPIEWPKSR+K+W
Sbjct  419  PCLDNEKAIKKLHSTKHYEHRERHCPAEPPTCLVPLPEGYKRPIEWPKSRDKVW  472



>ref|XP_010521110.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
 ref|XP_010521118.1| PREDICTED: probable methyltransferase PMT26 [Tarenaya hassleriana]
Length=861

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 77/109 (71%), Gaps = 4/109 (4%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S ++KE  +    ++N+        LCN TAG DYIPCLDN
Sbjct  292  ELLNETVAQNGSFSTQATESKNEKEAQQEVPPEQNDY----KLTLCNTTAGPDYIPCLDN  347

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCP+ PPTCLV LP+GY+RPIEWPKSREKIW
Sbjct  348  LQAIKSLSSTKHYEHRERHCPDNPPTCLVPLPEGYRRPIEWPKSREKIW  396



>gb|EPS72708.1| hypothetical protein M569_02045, partial [Genlisea aurea]
Length=585

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 3/109 (3%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++  ES     ++STQA  S ++KE  K+++ +  N   S  W++CN TAG DYIPCLDN
Sbjct  17   ELSDESATQNGSFSTQATVSKNEKESQKSSESENQN---SYTWKVCNTTAGPDYIPCLDN  73

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL + +H+EHRERHCP  PPTCLV LP+GY+R   WP SREKIW
Sbjct  74   MEAIRKLISTKHYEHRERHCPSNPPTCLVPLPEGYQRSTPWPTSREKIW  122



>emb|CDY48339.1| BnaA09g26820D [Brassica napus]
Length=756

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 75/109 (69%), Gaps = 11/109 (10%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            +I  E+     AWSTQ  +S ++K+            + S  W++CNVTAG DYIPCLDN
Sbjct  190  EITKEASTGSGAWSTQLDESQNEKKTQ----------VSSIKWKVCNVTAGPDYIPCLDN  239

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL  R+H+EHRERHCPEE PTCLV LP+GYKR I+WPKSREKIW
Sbjct  240  WQAIRKL-ARKHYEHRERHCPEESPTCLVPLPEGYKRSIKWPKSREKIW  287



>gb|EMS56319.1| putative methyltransferase PMT26 [Triticum urartu]
Length=953

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = -2

Query  292  WSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrh  113
            W TQA +S   KE  + T+   +    S +W+LC+  AG DYIPCLDN  A+ KLR+ +H
Sbjct  416  WRTQAAES--NKETNERTNASSSVPAASHSWKLCDAEAGADYIPCLDNVEAIRKLRSDKH  473

Query  112  fehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            +EHRERHCPEEPPTCLV LP GY+ PI WPKSRE+IW
Sbjct  474  YEHRERHCPEEPPTCLVPLPPGYRSPIRWPKSREQIW  510



>ref|XP_009771172.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
 ref|XP_009771173.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
Length=807

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 3/108 (3%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNE  146
            + +E+     A+STQA +S ++KE  K+ +  + +      W++CN TAG DYIPCLDN 
Sbjct  238  LLNETTTQNGAFSTQASESKNEKETQKSPESDKES---RYTWKVCNSTAGPDYIPCLDNL  294

Query  145  PALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             A+  LR+ +H+EHRERHCP+ PPTCLV LP+GY+R +EWP SREKIW
Sbjct  295  EAIRSLRSTKHYEHRERHCPDNPPTCLVPLPEGYQRSVEWPTSREKIW  342



>ref|NP_001151565.1| ankyrin-like protein [Zea mays]
 gb|ACG43365.1| ankyrin-like protein [Zea mays]
 tpg|DAA36810.1| TPA: ankyrin-like protein [Zea mays]
Length=671

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 6/98 (6%)
 Frame = -2

Query  292  WSTQAVQS-VSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrr  116
            WST+A QS    KE+T T+         S  W LCNV AG DYIPCLDN  A+ KLR+ +
Sbjct  118  WSTKAEQSNKDAKEQTLTSSSPL-----SFRWALCNVDAGADYIPCLDNVAAIKKLRSTK  172

Query  115  hfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            H+EHRERHCPE+ PTCLV LP+GY+ PI WPKSR++IW
Sbjct  173  HYEHRERHCPEKSPTCLVPLPEGYRNPIRWPKSRDQIW  210



>emb|CDY17234.1| BnaA05g09540D [Brassica napus]
Length=762

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 82/127 (65%), Gaps = 9/127 (7%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTT---DEQENNIIPSPN  203
            EK+  +  PA   + +I  E+     +WSTQ V+S ++K+  +++   D+Q         
Sbjct  178  EKSNKEVFPAGDQA-EITKETTTKDGSWSTQLVESQNEKKAQESSVPKDQQSGY-----E  231

Query  202  WQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWP  23
            W+ CNVTAG DYIPCLDN   + KL++  H+EHRERHCPEE P CLV LP GYKR I+WP
Sbjct  232  WKTCNVTAGPDYIPCLDNLQVIKKLQSTMHYEHRERHCPEESPRCLVSLPDGYKRSIKWP  291

Query  22   KSREKIW  2
             SREKIW
Sbjct  292  NSREKIW  298



>ref|XP_003563554.1| PREDICTED: probable methyltransferase PMT25 [Brachypodium distachyon]
Length=928

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 50/101 (50%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = -2

Query  295  AWSTQAVQSVSQKER-TKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTr  119
            AW+TQA +S  +K+R  +   E   N      W+ CNV AG DYIPCLDNE A+ KLR  
Sbjct  361  AWATQADESHREKDRREEDAAEGTQNDDQQHEWRTCNVKAGPDYIPCLDNEKAVKKLRPE  420

Query  118  rhfehrerhc--peepPTCLVQLPKGYKRPIEWPKSREKIW  2
                +  R    P+E PTCLV LP+ Y+RP+EWPKSR++IW
Sbjct  421  NFRRYEHRERHCPDEGPTCLVPLPRAYRRPVEWPKSRDRIW  461



>ref|XP_009115236.1| PREDICTED: probable methyltransferase PMT24 isoform X1 [Brassica 
rapa]
Length=753

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 11/109 (10%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            +I  E+     AWSTQ  +S ++K+            + S  W++CNVTAG DYIPCLDN
Sbjct  190  EITKEASTGSGAWSTQLDESQNEKKTQ----------VSSIKWKVCNVTAGPDYIPCLDN  239

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL  R+H+EH ERHCPE+ PTCLV LP+GYKR I+WPKSREKIW
Sbjct  240  WQAIRKL-ARKHYEHHERHCPEDSPTCLVPLPEGYKRSIKWPKSREKIW  287



>emb|CDX84330.1| BnaC04g10920D [Brassica napus]
Length=713

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 8/112 (7%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTT---DEQENNIIPSPNWQLCNVTAGQDYIPC  158
            +I  E+     +WSTQ V+S ++K+  +++   D+Q      S  W+ CNVTAG DYIPC
Sbjct  143  EITKETTTKDGSWSTQLVESQNEKKAQESSVPKDQQS-----SYEWKTCNVTAGPDYIPC  197

Query  157  LDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            LDN   + KL++  H+EHRERHCPEE P CLV LP GYKR I+WP SREKIW
Sbjct  198  LDNLQVIKKLQSTMHYEHRERHCPEESPRCLVSLPDGYKRSIKWPNSREKIW  249



>ref|XP_009366818.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
 ref|XP_009366819.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
Length=805

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = -2

Query  286  TQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfe  107
            T+ ++S + KE  ++  E+  +      W++C+VTAG DYIPCLDN  ++ KL +  H+E
Sbjct  247  TEVIESQNAKETQQSLSEEHKSRHDERKWKVCDVTAGPDYIPCLDNWGSIRKLPSTGHYE  306

Query  106  hrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            HRERHCP+E  TCLV LP+GYKRPI+WP SREKIW
Sbjct  307  HRERHCPDEASTCLVPLPEGYKRPIQWPTSREKIW  341



>ref|XP_004978303.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=1032

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  211  SPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPI  32
            S  W+LCN T G DYIPCLDNE A+ KL+T +H+EHRERHCP + P CLV LP+GY++PI
Sbjct  502  SYTWKLCNATTGADYIPCLDNEAAIRKLKTNKHYEHRERHCPADAPACLVPLPEGYRQPI  561

Query  31   EWPKSREKIW  2
             WP SR+KIW
Sbjct  562  PWPYSRDKIW  571



>gb|EEC78319.1| hypothetical protein OsI_18053 [Oryza sativa Indica Group]
Length=672

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = -2

Query  283  QAVQSVSQKERTKTTDEQENNIIPSPN---WQLCNVTAGQDYIPCLDNEPALHKLRTrrh  113
            QA QS S  + T    +Q+    P+P+   W+LCN  AG DYIPCLDN  A+  LRT +H
Sbjct  113  QAAQSTSNTKDTPHNKQQQQTASPTPSSYAWKLCNTEAGPDYIPCLDNLQAIRNLRTTKH  172

Query  112  fehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            +EHRERHCP+  PTCLV LPKGY  PI WP SR++IW
Sbjct  173  YEHRERHCPQHLPTCLVPLPKGYTNPIRWPNSRDQIW  209



>gb|EMT26912.1| hypothetical protein F775_10259 [Aegilops tauschii]
Length=706

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = -2

Query  295  AWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrr  116
            +W TQA +S   KE  + T+        S +W+LC+V AG DYIPCLDN  A+ KLR+ +
Sbjct  152  SWRTQAAES--NKETNERTNPSSTVPAASHSWKLCDVDAGADYIPCLDNVEAIRKLRSDK  209

Query  115  hfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            H+EHRERHCPEE PTCLV LP GY+ PI WP+SR++IW
Sbjct  210  HYEHRERHCPEEAPTCLVPLPSGYRSPIRWPESRDQIW  247



>ref|XP_006662791.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=871

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 76/123 (62%), Gaps = 15/123 (12%)
 Frame = -2

Query  325  IPSESKDSKKAWSTQAVQSVSQKE---------------RTKTTDEQENNIIPSPNWQLC  191
            + +E      +++TQA +S+ +K+               R+      E +   S  W+LC
Sbjct  289  LLTERAAQNGSFTTQAAESIKEKKTRAEKTKKKKGKDKKRSSAAAAVEEDGDTSFGWKLC  348

Query  190  NVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSRE  11
            N +AG DYIPCLDNE A+ KL+T  H+EHRERHCP EPPTCLV  P+GY+ PI WP+SR+
Sbjct  349  NTSAGADYIPCLDNEAAIKKLKTDAHYEHRERHCPGEPPTCLVPAPEGYREPIRWPRSRD  408

Query  10   KIW  2
            KIW
Sbjct  409  KIW  411



>ref|XP_009115237.1| PREDICTED: probable methyltransferase PMT24 isoform X2 [Brassica 
rapa]
Length=725

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 11/109 (10%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            +I  E+     AWSTQ  +S ++K+            + S  W++CNVTAG DYIPCLDN
Sbjct  162  EITKEASTGSGAWSTQLDESQNEKKTQ----------VSSIKWKVCNVTAGPDYIPCLDN  211

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL  R+H+EH ERHCPE+ PTCLV LP+GYKR I+WPKSREKIW
Sbjct  212  WQAIRKL-ARKHYEHHERHCPEDSPTCLVPLPEGYKRSIKWPKSREKIW  259



>emb|CBI18946.3| unnamed protein product [Vitis vinifera]
Length=554

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 68/92 (74%), Gaps = 4/92 (4%)
 Frame = -2

Query  277  VQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehre  98
            V+S ++KE  ++T  + N       W+LCNVTAG DYIPCLDN   + +L + +H+EHRE
Sbjct  2    VESKNEKESLESTISKPNGY----GWKLCNVTAGPDYIPCLDNVQTIRRLPSTKHYEHRE  57

Query  97   rhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            RHCP+E PTCLV LP GYKRP++WP SREKIW
Sbjct  58   RHCPDEAPTCLVPLPGGYKRPVQWPTSREKIW  89



>ref|XP_009143789.1| PREDICTED: probable methyltransferase PMT25 [Brassica rapa]
Length=762

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 82/127 (65%), Gaps = 9/127 (7%)
 Frame = -2

Query  373  EKAQIDSVPARKTSPQIPSESKDSKKAWSTQAVQSVSQKERTKTT---DEQENNIIPSPN  203
            EK+  +  PA   + +I  E+     +WSTQ V+S ++K+  +++   D+Q         
Sbjct  178  EKSNKEVFPAGDQA-EITKETTTKDGSWSTQLVESQNEKKAQESSVPKDQQSGY-----E  231

Query  202  WQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWP  23
            W+ CNVTAG DYIPCLDN   + +L++  H+EHRERHCPEE P CLV LP GYKR I+WP
Sbjct  232  WKTCNVTAGPDYIPCLDNLQVIKRLQSTMHYEHRERHCPEESPRCLVSLPDGYKRSIKWP  291

Query  22   KSREKIW  2
             SREKIW
Sbjct  292  NSREKIW  298



>ref|XP_008371671.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=502

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -2

Query  289  STQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhf  110
            +T+ V+S ++KE  +++  +  +      W++C+VTAG DYIPCLDN  ++ KL  R H+
Sbjct  243  TTEVVESQNEKETQESSSAEHKSGHHEWKWKVCDVTAGPDYIPCLDNWGSIKKLPGRGHY  302

Query  109  ehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            EHRERHCP+E PTCLV LP+GYKRPI+WP SREKIW
Sbjct  303  EHRERHCPDEAPTCLVPLPEGYKRPIQWPTSREKIW  338



>ref|XP_007156094.1| hypothetical protein PHAVU_003G258000g [Phaseolus vulgaris]
 gb|ESW28088.1| hypothetical protein PHAVU_003G258000g [Phaseolus vulgaris]
Length=838

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = -2

Query  301  KKAWSTQAVQSVSQKERTKTTDEQENNIIP--SPNWQLCNVTAGQDYIPCLDNEPALHKL  128
            KK W TQ  +S  +K+R K      N+ +     NW +CNV+ G DYIPCLDNE  L K 
Sbjct  334  KKEWPTQGDESEVEKKRQKEELGGGNDEVKLQDLNWSICNVSTGHDYIPCLDNEKYL-KT  392

Query  127  RTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
             TR+HF HRERHCPE+ PTCLV LPKGYK PI+WP SR+KIW
Sbjct  393  STRKHFVHRERHCPEDAPTCLVPLPKGYKIPIQWPASRDKIW  434



>dbj|BAJ85194.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=689

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = -2

Query  292  WSTQAVQS--VSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTr  119
            W TQA +S  V  KERT            S +W+LC+V AG DYIPCLDN  A+ KLR+ 
Sbjct  135  WRTQAAESNKVETKERTTAPSLPATT---SYSWKLCDVEAGADYIPCLDNVDAIKKLRSD  191

Query  118  rhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            +H+EHRERHCPEEPPTCLV LP GY+ PI WPKSR++IW
Sbjct  192  KHYEHRERHCPEEPPTCLVPLPPGYRSPIRWPKSRDQIW  230



>ref|XP_008345949.1| PREDICTED: probable methyltransferase PMT26 [Malus domestica]
Length=497

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -2

Query  289  STQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDNEPALHKLRTrrhf  110
            +T+ V+S ++KE  +++  +  +      W++C+VTAG DYIPCLDN  ++ KL  R H+
Sbjct  243  TTEVVESQNEKETQESSSAEHKSGHHEWKWKVCDVTAGPDYIPCLDNWGSIKKLPGRGHY  302

Query  109  ehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            EHRERHCP+E PTCLV LP+GYKRPI+WP SREKIW
Sbjct  303  EHRERHCPDEAPTCLVPLPEGYKRPIQWPTSREKIW  338



>gb|AAX96339.1| Putative methyltransferase [Oryza sativa Japonica Group]
 gb|AAY23280.1| Putative methyltransferase [Oryza sativa Japonica Group]
Length=663

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  205  NWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEW  26
             W+LCN +AG DYIPCLDNE A+ KL+T  H+EHRERHCP  PPTCLV  P+GY+ PI W
Sbjct  340  GWRLCNTSAGADYIPCLDNEAAIKKLKTTAHYEHRERHCPASPPTCLVPSPEGYRDPIRW  399

Query  25   PKSREKIW  2
            P+SR+KIW
Sbjct  400  PRSRDKIW  407



>ref|XP_009779710.1| PREDICTED: probable methyltransferase PMT26 [Nicotiana sylvestris]
Length=766

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 67/109 (61%), Gaps = 11/109 (10%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            +I  E+      WSTQA +S           E+EN    SP W+ C   AG DYIPCLDN
Sbjct  204  EILKETTTQNGPWSTQAAES-----------EKENESQDSPKWKACKTDAGPDYIPCLDN  252

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+ KL +  H+EHRERHCP E  TCLV LP GYK+PI WP+SRE+IW
Sbjct  253  VQAIRKLPSTSHYEHRERHCPIEASTCLVPLPSGYKQPIGWPRSREQIW  301



>ref|XP_006657337.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT27-like 
[Oryza brachyantha]
Length=895

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = -2

Query  208  PNWQLCNVTAGQDYIPCLDNEPALHKLR--TrrhfehrerhcpeepPTCLVQLPKGYKRP  35
            P W+LCNV AG DYIPCL+NE A+ KLR    R  EHRERHCP+E PTCLV LP GY+RP
Sbjct  364  PEWRLCNVKAGPDYIPCLENEKAIKKLRPENYRRDEHRERHCPDEGPTCLVPLPAGYRRP  423

Query  34   IEWPKSREKIW  2
            IEWPK R++IW
Sbjct  424  IEWPKCRDRIW  434



>ref|XP_004959929.1| PREDICTED: probable methyltransferase PMT26-like [Setaria italica]
Length=737

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQS-VSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLD  152
            ++ +E+   +  W TQA QS    KE+T T+         S +W+LCNV A  DYIPCLD
Sbjct  172  ELLNETTTERGPWPTQAAQSNKDTKEQTATSSTPM-----SFSWKLCNVDARADYIPCLD  226

Query  151  NEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            N  A++KLR+ +H+EHRERHCPE+PPTCLV LP+GY  PI WPKSR++IW
Sbjct  227  NVQAINKLRSTKHYEHRERHCPEKPPTCLVPLPEGYSNPIRWPKSRDQIW  276



>gb|KHG06416.1| hypothetical protein F383_32222 [Gossypium arboreum]
Length=820

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 77/109 (71%), Gaps = 8/109 (7%)
 Frame = -2

Query  328  QIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLDN  149
            ++ +E+     ++STQA +S  +KE   ++ +         +W+LCN TAG DYIPCLDN
Sbjct  255  ELLNETVTQTGSFSTQATESKIEKETQLSSKKY--------SWKLCNSTAGPDYIPCLDN  306

Query  148  EPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
              A+  L + +H+EHRERHCPEEPPTCLV LP+ YKRPIEWPKSREKIW
Sbjct  307  LEAIRHLPSTKHYEHRERHCPEEPPTCLVPLPERYKRPIEWPKSREKIW  355



>ref|XP_006653085.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=666

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = -2

Query  331  PQIPSESKDSKKAWSTQAVQSVSQKERTKTTDEQENNIIPSPNWQLCNVTAGQDYIPCLD  152
            P   +  +  + +W TQA  S    + T+   +Q+     S  W+LCN  AG DYIPCLD
Sbjct  97   PAEATRGESDRGSWPTQAAGS---NKDTRQQQQQQTAAPSSYGWKLCNTEAGPDYIPCLD  153

Query  151  NEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEWPKSREKIW  2
            N  A+ KLRT +H+EHRERHCP+ PPTCLV LP+GY+ PI WPKSR++IW
Sbjct  154  NLQAISKLRTTKHYEHRERHCPQHPPTCLVPLPEGYRNPIRWPKSRDQIW  203



>gb|EEE51778.1| hypothetical protein OsJ_33227 [Oryza sativa Japonica Group]
Length=867

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  205  NWQLCNVTAGQDYIPCLDNEPALHKLRTrrhfehrerhcpeepPTCLVQLPKGYKRPIEW  26
             W+LCN +AG DYIPCLDNE A+ KL+T  H+EHRERHCP  PPTCLV  P+GY+ PI W
Sbjct  340  GWRLCNTSAGADYIPCLDNEAAIKKLKTTAHYEHRERHCPASPPTCLVPSPEGYRDPIRW  399

Query  25   PKSREKIW  2
            P+SR+KIW
Sbjct  400  PRSRDKIW  407



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 997384586720