BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c88294_g1_i1 len=1729 path=[1707:0-1728]

Length=1729
                                                                      Score     E

ref|XP_009759105.1|  PREDICTED: uncharacterized protein LOC104211710    330   6e-103   
ref|XP_009594282.1|  PREDICTED: ATP-dependent RNA helicase A-like...    328   1e-102   
ref|XP_009594283.1|  PREDICTED: ATP-dependent RNA helicase A-like...    324   5e-101   
ref|XP_009785484.1|  PREDICTED: uncharacterized protein LOC104233...    320   4e-99    
ref|XP_009785486.1|  PREDICTED: uncharacterized protein LOC104233...    315   2e-97    
ref|XP_009613040.1|  PREDICTED: uncharacterized protein LOC104106...    314   6e-97    
ref|XP_006365138.1|  PREDICTED: uncharacterized protein LOC102597833    310   2e-95    
ref|XP_009613041.1|  PREDICTED: uncharacterized protein LOC104106...    310   2e-95    
ref|XP_004228404.1|  PREDICTED: uncharacterized protein LOC101255911    306   9e-94    
ref|XP_009762263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    294   3e-90    
gb|KDP21243.1|  hypothetical protein JCGZ_21714                         296   9e-90    
ref|XP_008352995.1|  PREDICTED: uncharacterized protein LOC103416528    295   2e-89    
ref|XP_008389541.1|  PREDICTED: uncharacterized protein LOC103451881    294   3e-89    
ref|XP_010096321.1|  hypothetical protein L484_021067                   294   5e-89    
ref|XP_010256182.1|  PREDICTED: uncharacterized protein LOC104596615    293   1e-88    
ref|XP_011086413.1|  PREDICTED: uncharacterized protein LOC105168156    287   2e-86    
ref|XP_010272217.1|  PREDICTED: uncharacterized protein LOC104608...    286   5e-86    
gb|EYU22447.1|  hypothetical protein MIMGU_mgv1a006912mg                285   9e-86    
ref|XP_002890619.1|  hypothetical protein ARALYDRAFT_472693             284   1e-85    
ref|XP_009360410.1|  PREDICTED: uncharacterized protein LOC103950885    284   2e-85    
ref|NP_174029.1|  uncharacterized glycine-rich protein                  281   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477771.1|  PREDICTED: uncharacterized protein LOC104756820    281   1e-84    
gb|EYU22446.1|  hypothetical protein MIMGU_mgv1a006912mg                280   9e-84    
ref|XP_002269144.1|  PREDICTED: uncharacterized protein LOC100248339    280   1e-83    Vitis vinifera
ref|XP_004155395.1|  PREDICTED: uncharacterized protein LOC101229960    273   5e-83    
ref|XP_010460222.1|  PREDICTED: uncharacterized protein LOC104741134    277   7e-83    
ref|XP_008446299.1|  PREDICTED: uncharacterized protein LOC103489...    277   1e-82    
ref|XP_006307636.1|  hypothetical protein CARUB_v10009264mg             276   1e-82    
gb|KDO82715.1|  hypothetical protein CISIN_1g013233mg                   276   3e-82    
ref|XP_008446298.1|  PREDICTED: uncharacterized protein LOC103489...    276   8e-82    
ref|XP_006438557.1|  hypothetical protein CICLE_v10031519mg             275   8e-82    
ref|XP_010498969.1|  PREDICTED: uncharacterized protein LOC104776570    274   8e-82    
ref|XP_002312704.1|  glycine-rich family protein                        273   3e-81    Populus trichocarpa [western balsam poplar]
ref|XP_006438558.1|  hypothetical protein CICLE_v10031519mg             273   3e-81    
ref|XP_008221700.1|  PREDICTED: keratin, type I cytoskeletal 10         273   3e-81    
emb|CDP00272.1|  unnamed protein product                                269   4e-81    
ref|XP_010551493.1|  PREDICTED: uncharacterized protein LOC104822...    272   6e-81    
ref|XP_010551492.1|  PREDICTED: uncharacterized protein LOC104822...    272   1e-80    
ref|XP_004135203.1|  PREDICTED: uncharacterized protein LOC101205164    273   1e-80    
ref|XP_006357249.1|  PREDICTED: uncharacterized protein LOC102594597    268   2e-79    
ref|XP_007044388.1|  Glycine-rich protein, putative isoform 1           268   3e-79    
ref|XP_010272218.1|  PREDICTED: uncharacterized protein LOC104608...    267   4e-79    
ref|XP_006415997.1|  hypothetical protein EUTSA_v10007745mg             266   5e-79    
gb|KDO82716.1|  hypothetical protein CISIN_1g013233mg                   264   6e-79    
ref|XP_010272216.1|  PREDICTED: uncharacterized protein LOC104608...    268   2e-78    
gb|EYU28691.1|  hypothetical protein MIMGU_mgv1a007116mg                263   2e-78    
ref|XP_011034203.1|  PREDICTED: uncharacterized protein LOC105132411    265   4e-78    
ref|XP_004238757.1|  PREDICTED: uncharacterized protein LOC101253779    263   2e-77    
ref|XP_011011854.1|  PREDICTED: uncharacterized protein LOC105116275    263   2e-77    
ref|XP_004489967.1|  PREDICTED: keratin, type I cytoskeletal 10-like    263   3e-77    
gb|EYU28690.1|  hypothetical protein MIMGU_mgv1a007116mg                262   4e-77    
ref|XP_006378167.1|  glycine-rich family protein                        254   3e-76    
ref|XP_002520157.1|  conserved hypothetical protein                     260   4e-76    Ricinus communis
ref|XP_007044389.1|  Glycine-rich protein, putative isoform 2           253   7e-75    
ref|XP_003613550.1|  hypothetical protein MTR_5g037960                  256   1e-74    
ref|XP_003517917.1|  PREDICTED: uncharacterized protein LOC100819759    256   2e-74    
ref|XP_007157411.1|  hypothetical protein PHAVU_002G067800g             255   3e-74    
gb|AGV54212.1|  hypothetical protein                                    254   7e-74    
ref|XP_009115436.1|  PREDICTED: uncharacterized protein LOC103840676    249   2e-72    
ref|XP_003519125.1|  PREDICTED: uncharacterized protein LOC100816406    248   8e-72    
ref|XP_004297812.1|  PREDICTED: uncharacterized protein LOC101315...    248   1e-71    
ref|XP_004297813.1|  PREDICTED: uncharacterized protein LOC101315...    247   1e-71    
ref|XP_010683287.1|  PREDICTED: uncharacterized protein LOC104897...    247   3e-71    
ref|XP_010683286.1|  PREDICTED: uncharacterized protein LOC104897...    241   2e-68    
emb|CDY52255.1|  BnaC08g20270D                                          237   7e-68    
emb|CAN72059.1|  hypothetical protein VITISV_039073                     236   2e-67    Vitis vinifera
gb|EPS60452.1|  hypothetical protein M569_14351                         229   2e-67    
emb|CDY14707.1|  BnaC05g19640D                                          233   2e-66    
emb|CDY46422.1|  BnaA08g20080D                                          233   3e-66    
ref|XP_010043853.1|  PREDICTED: uncharacterized protein LOC104432951    233   3e-66    
ref|XP_009110060.1|  PREDICTED: uncharacterized protein LOC103835629    230   2e-65    
emb|CBI32031.3|  unnamed protein product                                230   3e-65    
ref|XP_010923301.1|  PREDICTED: uncharacterized protein LOC105046420    229   2e-64    
ref|XP_008807865.1|  PREDICTED: uncharacterized protein LOC103720...    227   1e-63    
ref|XP_008807866.1|  PREDICTED: uncharacterized protein LOC103720...    226   2e-63    
ref|XP_009398398.1|  PREDICTED: uncharacterized protein LOC103983002    223   4e-62    
ref|XP_010933750.1|  PREDICTED: uncharacterized protein LOC105054054    219   6e-61    
ref|NP_001168517.1|  hypothetical protein                               219   8e-61    Zea mays [maize]
ref|XP_008807868.1|  PREDICTED: uncharacterized protein LOC103720...    214   2e-60    
ref|XP_008807869.1|  PREDICTED: uncharacterized protein LOC103720...    214   2e-60    
ref|XP_006838798.1|  hypothetical protein AMTR_s00002p00260390          216   1e-59    
ref|XP_008796647.1|  PREDICTED: uncharacterized protein LOC103712049    215   2e-59    
ref|NP_001168582.1|  uncharacterized protein LOC100382366               213   2e-58    Zea mays [maize]
ref|XP_009396953.1|  PREDICTED: uncharacterized protein LOC103981916    209   2e-57    
ref|XP_002466649.1|  hypothetical protein SORBIDRAFT_01g011640          210   2e-57    Sorghum bicolor [broomcorn]
ref|XP_003561154.1|  PREDICTED: uncharacterized protein LOC100834871    208   2e-56    
ref|XP_004982143.1|  PREDICTED: glycine, alanine and asparagine-r...    191   3e-50    
ref|XP_006573960.1|  PREDICTED: uncharacterized protein LOC100816385    185   6e-49    
gb|ABR16221.1|  unknown                                                 184   3e-47    Picea sitchensis
gb|EEC75970.1|  hypothetical protein OsI_13079                          182   3e-47    Oryza sativa Indica Group [Indian rice]
emb|CDM83736.1|  unnamed protein product                                185   6e-47    
ref|XP_001771935.1|  predicted protein                                  179   1e-46    
ref|NP_001050943.1|  Os03g0688200                                       179   3e-46    Oryza sativa Japonica Group [Japonica rice]
gb|EMT18822.1|  hypothetical protein F775_06861                         181   3e-45    
gb|EMS56397.1|  hypothetical protein TRIUR3_34734                       176   2e-44    
gb|EAZ28187.1|  hypothetical protein OsJ_12160                          172   1e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001761769.1|  predicted protein                                  169   9e-43    
ref|XP_002988977.1|  hypothetical protein SELMODRAFT_129003             164   7e-41    
gb|ABR16471.1|  unknown                                                 162   1e-39    Picea sitchensis
ref|XP_002975088.1|  hypothetical protein SELMODRAFT_442638             157   2e-38    
gb|EMT18821.1|  hypothetical protein F775_02142                         155   1e-36    
gb|KFK44624.1|  hypothetical protein AALP_AA1G282900                    144   8e-35    
gb|KHN01223.1|  Abietadienol/abietadienal oxidase                       140   5e-34    
ref|XP_006651701.1|  PREDICTED: heterogeneous nuclear ribonucleop...    124   8e-28    
emb|CDP22197.1|  unnamed protein product                                120   5e-27    
gb|EMS62622.1|  hypothetical protein TRIUR3_18305                       124   9e-27    
gb|KHN01162.1|  hypothetical protein glysoja_008064                     115   3e-25    
gb|EEE59723.1|  hypothetical protein OsJ_12161                          111   7e-24    Oryza sativa Japonica Group [Japonica rice]
gb|KHN28715.1|  hypothetical protein glysoja_025449                   97.1    3e-19    
ref|XP_002883544.1|  hypothetical protein ARALYDRAFT_479980           89.4    5e-17    
ref|XP_005652064.1|  hypothetical protein COCSUDRAFT_64270            92.4    2e-16    
ref|NP_189112.1|  uncharacterized protein                             85.1    1e-15    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488577.1|  PREDICTED: uncharacterized protein LOC104766398  79.3    1e-13    
ref|XP_010466896.1|  PREDICTED: uncharacterized protein LOC104747029  79.3    1e-13    
ref|XP_010513678.1|  PREDICTED: uncharacterized protein LOC104789722  79.0    2e-13    
ref|XP_006396698.1|  hypothetical protein EUTSA_v10029189mg           76.3    2e-12    
emb|CDX94550.1|  BnaC09g22860D                                        74.7    6e-12    
ref|XP_009114578.1|  PREDICTED: uncharacterized protein LOC103839843  73.2    2e-11    
ref|XP_003613551.1|  hypothetical protein MTR_5g037970                72.0    3e-11    
gb|ABA92081.1|  hypothetical protein LOC_Os11g11180                   73.9    3e-11    Oryza sativa Japonica Group [Japonica rice]
gb|KFK37826.1|  hypothetical protein AALP_AA3G034300                  71.6    6e-11    
gb|KHN36467.1|  Abietadienol/abietadienal oxidase                     69.7    2e-10    
ref|XP_009626346.1|  PREDICTED: uncharacterized protein LOC104117072  59.7    5e-07    
emb|CCI41035.1|  unnamed protein product                              62.0    6e-07    
emb|CCI41034.1|  unnamed protein product                              62.0    7e-07    
emb|CDY40281.1|  BnaA07g09190D                                        58.9    1e-06    
gb|KHN23080.1|  hypothetical protein glysoja_040901                   55.8    4e-06    
gb|EEE51859.1|  hypothetical protein OsJ_33386                        53.9    3e-05    Oryza sativa Japonica Group [Japonica rice]
emb|CCA24791.1|  conserved hypothetical protein                       54.7    2e-04    
emb|CCA21941.1|  conserved hypothetical protein                       54.3    2e-04    
gb|AFW67957.1|  hypothetical protein ZEAMMB73_254492                  50.8    2e-04    
gb|EEC67891.1|  hypothetical protein OsI_35559                        53.5    2e-04    Oryza sativa Indica Group [Indian rice]
gb|KFM24336.1|  hypothetical protein F751_3054                        53.5    3e-04    
gb|EPS71996.1|  hypothetical protein M569_02765                       48.9    0.001    



>ref|XP_009759105.1| PREDICTED: uncharacterized protein LOC104211710 [Nicotiana sylvestris]
Length=429

 Score =   330 bits (845),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 227/447 (51%), Positives = 288/447 (64%), Gaps = 31/447 (7%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAA   SDVS+GPV SVINKR+RAL+KK NRI QME+S+SKGKTLNKEQEETLR+KP+V+
Sbjct  1     MAA---SDVSEGPVRSVINKRLRALRKKYNRIVQMEESVSKGKTLNKEQEETLRSKPSVI  57

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             AGIDELEK+R+PL++AV EEI+L        A    AP       P+ + +N+GE +  +
Sbjct  58    AGIDELEKLREPLASAVAEEINL--------ATSVSAP-------PDNNSKNEGEGEVIM  102

Query  428   VIEDLLNLLYFGSMFDVKTLQNHF-TEVMLSREHERSSCLSYDYMKdddsidllgesdld  604
              +EDLL LLYFG MFDVK+LQ+ F T  ML+R HER+ CL+YD M++D+S D++      
Sbjct  103   CVEDLLYLLYFGCMFDVKSLQSDFSTATMLTRTHERACCLNYDCMQEDESSDVIDLLGEK  162

Query  605   llsllsglli---sRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKL  775
              L L+S L     SR  NS L HK ALQ+CIEHAKLWL  S QPI PDS+ TYAGL+ KL
Sbjct  163   DLDLISMLSGLLISRPVNSPLSHKRALQQCIEHAKLWLTKSDQPIVPDSDATYAGLKSKL  222

Query  776   DKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEE  955
             ++IM+S YFT  PV ++A+A NYG Y  P+ ESV  V V   VQVH   I +Q QQKEEE
Sbjct  223   NRIMSSLYFTTDPVKVEASAANYGPYSVPIEESVGAVPVNEPVQVHT--IAMQSQQKEEE  280

Query  956   SISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQQN  1135
              +SS GN T+   +S V+++ QG  G E+LS LP E E V  E EGV      + KEQQ+
Sbjct  281   CLSSQGNHTNEMHASTVEEIQQGVQG-ENLSELPAEAEEVTPEAEGVNNLKDMNFKEQQS  339

Query  1136  IPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPR--NS  1309
             +P R  + N        G  G   G        G  G+YQNGR+ Y DQ  NY  +  N+
Sbjct  340   VP-RRSYQNQNYRGHHNGDGGGRRGYSNAHGGHGREGSYQNGRNQYYDQSGNYYQKSHNN  398

Query  1310  HFrgrggrgg---HYNNHPPGAQVGNY  1381
             ++R R GRG    +YN H  G Q  N+
Sbjct  399   NYRERCGRGTVGGNYNPHASGGQAANF  425



>ref|XP_009594282.1| PREDICTED: ATP-dependent RNA helicase A-like protein isoform 
X1 [Nicotiana tomentosiformis]
Length=425

 Score =   328 bits (842),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 241/445 (54%), Positives = 293/445 (66%), Gaps = 31/445 (7%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAA   SDVS+GPVLSVINKR+RAL+KK NRI QME+S+SKGKTLNKEQEETLR+KPAV+
Sbjct  1     MAA---SDVSEGPVLSVINKRLRALRKKYNRIVQMEESVSKGKTLNKEQEETLRSKPAVI  57

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             AGIDELEK+R+PL++A+ EEI+L+      SA  T          P+ + +N+GE +G +
Sbjct  58    AGIDELEKLREPLASAIAEEINLA-----TSASAT----------PDNNPKNEGEGEGVM  102

Query  428   VIEDLLNLLYFGSMFDVKTLQNHF-TEVMLSREHERSSCLSYDYM---Kdddsidllges  595
              +EDLLNLLYFG MFDVK+LQ+ F T  ML+R HER+ CLSYD M   +  D IDLLGE+
Sbjct  103   CVEDLLNLLYFGCMFDVKSLQSEFSTATMLTRTHERACCLSYDCMPEDESSDVIDLLGEN  162

Query  596   dldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKL  775
             DLDL+S+LSGLLI R  NS L HK AL++CIEHAKLWL  S QPI PDS+VTY GLR KL
Sbjct  163   DLDLISMLSGLLIYRPVNSPLSHKRALRQCIEHAKLWLTKSDQPIVPDSDVTYTGLRSKL  222

Query  776   DKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEE  955
             ++I++S YFT  PV ++A A NY  Y  PV ESV  V     VQVH   I +Q Q KEEE
Sbjct  223   NRIISSLYFTTDPVKVEATAANYEPYSVPVEESVGVVTANESVQVHT--IAIQSQHKEEE  280

Query  956   SISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQQN  1135
              +SS GN+T+  Q+S V ++ QGE G E+LS LP E E V  E EG       + KEQQ+
Sbjct  281   CLSSQGNDTNGIQASSV-EVQQGEQG-ENLSELPAEVEEVTPEAEGDDNLKDMNFKEQQS  338

Query  1136  IPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRNSHF  1315
             +PRRSY N    G       G      G G     G   QNGR+ Y DQ  NY  + SH 
Sbjct  339   VPRRSYQNQNYRGHRNGDGGGRRGYSNGRGGRGRGGSY-QNGRNQYYDQSGNYYQK-SHN  396

Query  1316  rgrggrggHYNN---HPPGAQVGNY  1381
                 GRGG   N   H  G Q GN+
Sbjct  397   NNYRGRGGRGGNYNPHASGGQAGNF  421



>ref|XP_009594283.1| PREDICTED: ATP-dependent RNA helicase A-like protein isoform 
X2 [Nicotiana tomentosiformis]
Length=422

 Score =   324 bits (831),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 236/445 (53%), Positives = 289/445 (65%), Gaps = 34/445 (8%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAA   SDVS+GPVLSVINKR+RAL+KK NRI QME+S+SKGKTLNKEQEETLR+KPAV+
Sbjct  1     MAA---SDVSEGPVLSVINKRLRALRKKYNRIVQMEESVSKGKTLNKEQEETLRSKPAVI  57

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             AGIDELEK+R+PL++A+ EEI+L+                 +   P+ + +N+GE +G +
Sbjct  58    AGIDELEKLREPLASAIAEEINLATS---------------ASATPDNNPKNEGEGEGVM  102

Query  428   VIEDLLNLLYFGSMFDVKTLQNHF-TEVMLSREHERSSCLSYDYM---Kdddsidllges  595
              +EDLLNLLYFG MFDVK+LQ+ F T  ML+R HER+ CLSYD M   +  D IDLLGE+
Sbjct  103   CVEDLLNLLYFGCMFDVKSLQSEFSTATMLTRTHERACCLSYDCMPEDESSDVIDLLGEN  162

Query  596   dldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKL  775
             DLDL+S+LSGLLI R  NS L HK AL++CIEHAKLWL  S QPI PDS+VTY GLR KL
Sbjct  163   DLDLISMLSGLLIYRPVNSPLSHKRALRQCIEHAKLWLTKSDQPIVPDSDVTYTGLRSKL  222

Query  776   DKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEE  955
             ++I++S YFT  PV ++A A NY  Y  PV ESV  V     VQVH   I +Q Q KEEE
Sbjct  223   NRIISSLYFTTDPVKVEATAANYEPYSVPVEESVGVVTANESVQVHT--IAIQSQHKEEE  280

Query  956   SISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQQN  1135
              +SS GN+T+  Q+S V ++ QG    E+LS LP E E V  E EG       + KEQQ+
Sbjct  281   CLSSQGNDTNGIQASSV-EVQQG----ENLSELPAEVEEVTPEAEGDDNLKDMNFKEQQS  335

Query  1136  IPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRNSHF  1315
             +PRRSY N    G       G      G G     G   QNGR+ Y DQ  NY  + SH 
Sbjct  336   VPRRSYQNQNYRGHRNGDGGGRRGYSNGRGGRGRGGSY-QNGRNQYYDQSGNYYQK-SHN  393

Query  1316  rgrggrggHYNN---HPPGAQVGNY  1381
                 GRGG   N   H  G Q GN+
Sbjct  394   NNYRGRGGRGGNYNPHASGGQAGNF  418



>ref|XP_009785484.1| PREDICTED: uncharacterized protein LOC104233745 isoform X1 [Nicotiana 
sylvestris]
Length=437

 Score =   320 bits (819),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 229/455 (50%), Positives = 279/455 (61%), Gaps = 33/455 (7%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MA+T  S++SDGPVLSVINKR+RAL+KK NRI QME+SLSKGKTLNKEQEET R+K AVL
Sbjct  1     MASTPASELSDGPVLSVINKRLRALRKKYNRIVQMEESLSKGKTLNKEQEETFRSKSAVL  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSV-QRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
             AGIDELEK+RQPL+AAV EEI+L+V Q+ QV       PSE +   P  D   KGE    
Sbjct  61    AGIDELEKLRQPLAAAVAEEINLAVEQQRQV------PPSESAVDTPIDDSNIKGE----  110

Query  425   VVIEDLLNLLYFGSMFDVKTL-QNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  601
               +EDLLNLLYFGS+FDVK+L Q+  T  ML+R  ER+ CLSYD M +D+S D + +   
Sbjct  111   -CVEDLLNLLYFGSLFDVKSLQQSDLTATMLTRTMERACCLSYDCMPEDESTDDVMDLLG  169

Query  602   dllsllsglli----sRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRL  769
             +    L  +L     SR  NS L HK+ALQKC EHAKLWL  S QPIEP+S+ TYAGLR 
Sbjct  170   ERDLDLISMLSGLLVSRPVNSPLSHKHALQKCTEHAKLWLSKSDQPIEPNSDATYAGLRS  229

Query  770   KLDKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             KLDKI+ S YFT  PV + AAA  YG+Y            VPV V + VE   VQY+QKE
Sbjct  230   KLDKIIGSLYFTVDPVKVDAAAGKYGSYPV--PVEEHVEVVPVDVPLQVETPNVQYEQKE  287

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQ  1129
             E++ SS   E++   +S+V +L QGE G +++S    E E V  E EGV      D   Q
Sbjct  288   EDAASSEAVESNEIHASNV-ELQQGEQG-DNMSEQFAEPEEVAPETEGVDNLKDADFNRQ  345

Query  1130  QNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRNS  1309
             Q++P     +         G  G   G   G   RG GG+YQNGRS Y DQ  NY  RN 
Sbjct  346   QSVP---QRSYQNYRGNRGGSGGGRRGNSNGRGGRGRGGSYQNGRSQYYDQSGNYHQRN-  401

Query  1310  HFrg--------rggrggHYNNHPPGAQVGNYDEE  1390
             HF           GG GG YNN+  G   G++  E
Sbjct  402   HFNNYRGRGGRGTGGGGGSYNNYASGDHAGSFSAE  436



>ref|XP_009785486.1| PREDICTED: uncharacterized protein LOC104233745 isoform X2 [Nicotiana 
sylvestris]
Length=434

 Score =   315 bits (808),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 236/455 (52%), Positives = 286/455 (63%), Gaps = 36/455 (8%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MA+T  S++SDGPVLSVINKR+RAL+KK NRI QME+SLSKGKTLNKEQEET R+K AVL
Sbjct  1     MASTPASELSDGPVLSVINKRLRALRKKYNRIVQMEESLSKGKTLNKEQEETFRSKSAVL  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSV-QRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
             AGIDELEK+RQPL+AAV EEI+L+V Q+ QV       PSE +   P  D   KGE    
Sbjct  61    AGIDELEKLRQPLAAAVAEEINLAVEQQRQV------PPSESAVDTPIDDSNIKGE----  110

Query  425   VVIEDLLNLLYFGSMFDVKTL-QNHFTEVMLSREHERSSCLSYDYMKdddsidllg----  589
               +EDLLNLLYFGS+FDVK+L Q+  T  ML+R  ER+ CLSYD M +D+S D +     
Sbjct  111   -CVEDLLNLLYFGSLFDVKSLQQSDLTATMLTRTMERACCLSYDCMPEDESTDDVMDLLG  169

Query  590   esdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRL  769
             E DLDL+S+LSGLL+SR  NS L HK+ALQKC EHAKLWL  S QPIEP+S+ TYAGLR 
Sbjct  170   ERDLDLISMLSGLLVSRPVNSPLSHKHALQKCTEHAKLWLSKSDQPIEPNSDATYAGLRS  229

Query  770   KLDKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             KLDKI+ S YFT  PV + AAA  YG+Y            VPV V + VE   VQY+QKE
Sbjct  230   KLDKIIGSLYFTVDPVKVDAAAGKYGSYPV--PVEEHVEVVPVDVPLQVETPNVQYEQKE  287

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQ  1129
             E++ SS   E++   +S+V +L QG    +++S    E E V  E EGV      D   Q
Sbjct  288   EDAASSEAVESNEIHASNV-ELQQG----DNMSEQFAEPEEVAPETEGVDNLKDADFNRQ  342

Query  1130  QNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRNS  1309
             Q++P     +         G  G   G   G   RG GG+YQNGRS Y DQ  NY  RN 
Sbjct  343   QSVP---QRSYQNYRGNRGGSGGGRRGNSNGRGGRGRGGSYQNGRSQYYDQSGNYHQRN-  398

Query  1310  HFrg--------rggrggHYNNHPPGAQVGNYDEE  1390
             HF           GG GG YNN+  G   G++  E
Sbjct  399   HFNNYRGRGGRGTGGGGGSYNNYASGDHAGSFSAE  433



>ref|XP_009613040.1| PREDICTED: uncharacterized protein LOC104106247 isoform X1 [Nicotiana 
tomentosiformis]
Length=436

 Score =   314 bits (805),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 237/454 (52%), Positives = 290/454 (64%), Gaps = 32/454 (7%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MA+T  S++SDGPVLSVINKR+RAL+KK NRI QME+SLSKGK LNKEQEET R+K AVL
Sbjct  1     MASTPASELSDGPVLSVINKRLRALRKKYNRIVQMEESLSKGKILNKEQEETFRSKSAVL  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSV-QRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
              GIDELEK+RQPL+AAV EEI+L+V Q+ QV       PSE +   P  D  NKGES   
Sbjct  61    VGIDELEKLRQPLAAAVAEEINLAVGQQRQV------PPSESAADTPIDDPNNKGES---  111

Query  425   VVIEDLLNLLYFGSMFDVKTL-QNHFTEVMLSREHERSSCLSYDYMKdddsidllg----  589
               +EDLLNLLYFGSMFDVK+L Q+  T  ML+R  ER+ CLSYD M +D+S D +     
Sbjct  112   --VEDLLNLLYFGSMFDVKSLQQSDLTATMLTRTMERACCLSYDCMPEDESTDDVMDLLG  169

Query  590   esdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRL  769
             E DLDL+S+LSGLL+SR  NS L HK++LQKCIEHAKLWL  S QP EP+S+ TYAGLR 
Sbjct  170   ERDLDLISILSGLLVSRPVNSPLSHKHSLQKCIEHAKLWLSKSNQPFEPNSDATYAGLRS  229

Query  770   KLDKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             KLDKI+ S YFT  PV ++AAA  YG+Y  PV E      +PV V + VE   VQY+QKE
Sbjct  230   KLDKIIGSLYFTTDPVKVEAAAGKYGSYPVPVEE--HVEVLPVDVPLQVETPNVQYEQKE  287

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQ  1129
             E++ SS   E++    ++V +L QGE G +++S    E E V  E EGV      D   Q
Sbjct  288   EDAASSQAVESNEIHDNNV-ELQQGEQG-DNMSEQFAEPEEVAPEAEGVDNLKDADFNRQ  345

Query  1130  QNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRNS  1309
             Q++P     +         G  G   G   G   RG GG+YQNGRS Y DQ  NY  RN 
Sbjct  346   QSVP---QRSYQNYRGNRGGSGGGCRGNSNGRGGRGRGGSYQNGRSQYYDQSGNYHQRN-  401

Query  1310  HFrg-------rggrggHYNNHPPGAQVGNYDEE  1390
             HF           G GG YN++  G   G++  E
Sbjct  402   HFNNYRGRGGRGTGGGGSYNHYASGDHAGSFSAE  435



>ref|XP_006365138.1| PREDICTED: uncharacterized protein LOC102597833 [Solanum tuberosum]
Length=437

 Score =   310 bits (795),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 232/414 (56%), Positives = 283/414 (68%), Gaps = 20/414 (5%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MA+T VS++SDGPVLSVINKR+RAL+KK +RI QME+S +KGKTLNKEQEETLR+K AV+
Sbjct  1     MASTPVSELSDGPVLSVINKRLRALRKKHSRILQMEESRTKGKTLNKEQEETLRSKSAVI  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGE--SDG  421
             A IDELEK+RQPL+AAV EEI+LS ++ QVS    PA   E   +   D  NKGE   +G
Sbjct  61    AAIDELEKLRQPLAAAVVEEINLSTEQRQVS----PA---EFALDTAIDSTNKGEPAREG  113

Query  422   GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYM---Kdddsidllge  592
              + +EDLLNLLYFGSMFDVK+LQ+ FT  ML+R  ER+ CLSYD M   +  D +DLLGE
Sbjct  114   VLEVEDLLNLLYFGSMFDVKSLQSDFTPTMLTRTMERACCLSYDCMPDDESTDVMDLLGE  173

Query  593   sdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLK  772
              DLDL+S+LSGLL+SR  NSSL HK+ALQKCIEHAKLWL  S QPIEP+S+ TYAGLR K
Sbjct  174   RDLDLISMLSGLLVSRPVNSSLSHKHALQKCIEHAKLWLSKSEQPIEPNSDTTYAGLRSK  233

Query  773   LDKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEE  952
             LDKI+AS YFT  PV ++AAA  YG+Y  PV E V  V V V +QV      VQY+QK E
Sbjct  234   LDKIIASLYFTTDPVKVEAAAGKYGSYSVPVEEHVEAVTVDVPLQVDAP--SVQYEQK-E  290

Query  953   ESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQQ  1132
             E++SS   ET++   S+  +L Q   G +D++  P E E V  EVEG+      D  EQQ
Sbjct  291   EAVSSQAIETNDIHISNNIELQQ---GGQDINQ-PAEPEEVVFEVEGIDNMKDTDFNEQQ  346

Query  1133  NIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNY  1294
             ++PRRSY N    G  G     +     G G     G   QNGR+ Y DQ  NY
Sbjct  347   SVPRRSYQNQNYRGNRGGSVGDHRGYSNGRGGRGRGGSY-QNGRNQYYDQSGNY  399



>ref|XP_009613041.1| PREDICTED: uncharacterized protein LOC104106247 isoform X2 [Nicotiana 
tomentosiformis]
Length=433

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 235/454 (52%), Positives = 288/454 (63%), Gaps = 35/454 (8%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MA+T  S++SDGPVLSVINKR+RAL+KK NRI QME+SLSKGK LNKEQEET R+K AVL
Sbjct  1     MASTPASELSDGPVLSVINKRLRALRKKYNRIVQMEESLSKGKILNKEQEETFRSKSAVL  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSV-QRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
              GIDELEK+RQPL+AAV EEI+L+V Q+ QV       PSE +   P  D  NKGES   
Sbjct  61    VGIDELEKLRQPLAAAVAEEINLAVGQQRQV------PPSESAADTPIDDPNNKGES---  111

Query  425   VVIEDLLNLLYFGSMFDVKTL-QNHFTEVMLSREHERSSCLSYDYMKdddsidllg----  589
               +EDLLNLLYFGSMFDVK+L Q+  T  ML+R  ER+ CLSYD M +D+S D +     
Sbjct  112   --VEDLLNLLYFGSMFDVKSLQQSDLTATMLTRTMERACCLSYDCMPEDESTDDVMDLLG  169

Query  590   esdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRL  769
             E DLDL+S+LSGLL+SR  NS L HK++LQKCIEHAKLWL  S QP EP+S+ TYAGLR 
Sbjct  170   ERDLDLISILSGLLVSRPVNSPLSHKHSLQKCIEHAKLWLSKSNQPFEPNSDATYAGLRS  229

Query  770   KLDKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             KLDKI+ S YFT  PV ++AAA  YG+Y  PV E      +PV V + VE   VQY+QKE
Sbjct  230   KLDKIIGSLYFTTDPVKVEAAAGKYGSYPVPVEE--HVEVLPVDVPLQVETPNVQYEQKE  287

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQ  1129
             E++ SS   E++    ++V +L QG    +++S    E E V  E EGV      D   Q
Sbjct  288   EDAASSQAVESNEIHDNNV-ELQQG----DNMSEQFAEPEEVAPEAEGVDNLKDADFNRQ  342

Query  1130  QNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRNS  1309
             Q++P     +         G  G   G   G   RG GG+YQNGRS Y DQ  NY  RN 
Sbjct  343   QSVP---QRSYQNYRGNRGGSGGGCRGNSNGRGGRGRGGSYQNGRSQYYDQSGNYHQRN-  398

Query  1310  HFrg-------rggrggHYNNHPPGAQVGNYDEE  1390
             HF           G GG YN++  G   G++  E
Sbjct  399   HFNNYRGRGGRGTGGGGSYNHYASGDHAGSFSAE  432



>ref|XP_004228404.1| PREDICTED: uncharacterized protein LOC101255911 [Solanum lycopersicum]
Length=442

 Score =   306 bits (784),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 233/414 (56%), Positives = 282/414 (68%), Gaps = 19/414 (5%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MA+T VS++SDGPVLSVINKR+RAL+KK +RI QME+S +KGKTLNKEQEETLR+K AV+
Sbjct  1     MASTPVSELSDGPVLSVINKRLRALRKKHSRILQMEESRTKGKTLNKEQEETLRSKSAVI  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGE--SDG  421
             A IDELEK+RQPL+AAV EEI+LS  +HQVS    PA   ES      D  +KGE   +G
Sbjct  61    AAIDELEKLRQPLAAAVVEEINLSTGQHQVS----PA---ESAVNISIDSTDKGEPAREG  113

Query  422   GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYM---Kdddsidllge  592
              +V+EDLLNLLYFGSMFDVK+LQ+ FT  ML+R  ER+ CLSYD M   +  D +DLLGE
Sbjct  114   VLVVEDLLNLLYFGSMFDVKSLQSDFTPTMLTRTMERACCLSYDCMPDDESTDVMDLLGE  173

Query  593   sdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLK  772
              DLDL+S+LSGLL+SR  NS L HK+ALQKCIEHAKLWL  S QPIEP+S+ TYAGLR K
Sbjct  174   RDLDLISMLSGLLVSRPVNSPLSHKHALQKCIEHAKLWLSKSEQPIEPNSDATYAGLRSK  233

Query  773   LDKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEE  952
             LDKI+AS YFT  PV ++AAA  YG+Y  PV E      VPV V + V+   VQY+QK E
Sbjct  234   LDKIIASLYFTTDPVKVEAAAGKYGSYSVPVEE-HHVEAVPVDVPLQVDTPSVQYEQK-E  291

Query  953   ESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQQ  1132
             E++SS   ET++   S+  +L Q   G +D++  P E E V  EVEGV      D  EQQ
Sbjct  292   EAVSSQAIETNDNHISNNIELQQ---GGQDINQ-PAEPEEVVFEVEGVDNMKDADFNEQQ  347

Query  1133  NIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNY  1294
             ++PRRSY N    G  G           G G     G   QNGR+ Y DQ  NY
Sbjct  348   SVPRRSYQNQNYRGNRGGSVGDRRGYSNGRGGRGRGGSY-QNGRNQYYDQSGNY  400



>ref|XP_009762263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104214311 
[Nicotiana sylvestris]
Length=349

 Score =   294 bits (752),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 193/364 (53%), Positives = 237/364 (65%), Gaps = 21/364 (6%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MA+T  S++SD PVLSVINKR+ AL+KK N I QME+SLSKGKTLNKEQEE  R+K AVL
Sbjct  1     MASTPASELSDRPVLSVINKRLCALRKKYNHIVQMEESLSKGKTLNKEQEEIFRSKSAVL  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSV-QRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
             AGIDELEK+RQPL+AAV EEI+L+V Q+ QV       PSE +   P  D   KGE    
Sbjct  61    AGIDELEKLRQPLAAAVAEEINLTVEQQRQV------PPSEFAVDTPIDDSNIKGE----  110

Query  425   VVIEDLLNLLYFGSMFDVKTLQ-NHFTEVMLSREHERSSCLSYDYM----Kdddsidllg  589
               +EDLLNL YFGSMFDVK+LQ +    +ML+R  ER+ CLSYD M    +         
Sbjct  111   -CVEDLLNLFYFGSMFDVKSLQESDLIAMMLTRTMERACCLSYDCMPEDNRLTTXWICXA  169

Query  590   esdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRL  769
             + DLDL+S+LSG L+SR  NS L HK+AL KCIEHAKLWL  S QPIEP+S+ TYAGLR 
Sbjct  170   KKDLDLISMLSGFLVSRPVNSPLSHKHALHKCIEHAKLWLSKSDQPIEPNSDATYAGLRS  229

Query  770   KLDKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             KLDKI+ S YFT  PV + AAA  YG+Y            V V V + VE   VQY+QKE
Sbjct  230   KLDKIIGSLYFTVYPVKVDAAAGKYGSYPV--PVEEHVEVVHVDVPLQVETPNVQYEQKE  287

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQ  1129
             E++ SS   E++   +S+V +L QGE G +++S    E E V  E E V      D   Q
Sbjct  288   EDAASSEAVESNEIHASNV-ELQQGEQG-DNMSEQFAEPEEVAPETECVDNLKDADFNRQ  345

Query  1130  QNIP  1141
             Q++P
Sbjct  346   QSVP  349



>gb|KDP21243.1| hypothetical protein JCGZ_21714 [Jatropha curcas]
Length=449

 Score =   296 bits (757),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 221/416 (53%), Positives = 282/416 (68%), Gaps = 22/416 (5%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAAT  S+ +DGPVLS INKR+RAL+KK NRI QME+++S+GK +NKEQE+ LR+KP+V 
Sbjct  1     MAATAASEATDGPVLSFINKRLRALRKKYNRILQMEEAISQGKPINKEQEDVLRSKPSVC  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSAL--ETPAPSEESGKEPEGDVENKGESDG  421
             A I+ELEK+RQPL+ AV EEI+L++QRHQ  +       P ++  ++ + D +     DG
Sbjct  61    AAIEELEKLRQPLATAVSEEIALAIQRHQQQSFVSNNAIPDKDDSEKTDCDSDEDTRGDG  120

Query  422   GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  601
             G ++EDLLNLLYFGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DL
Sbjct  121   GSMVEDLLNLLYFGSLFDVKS-QNDFTATMLTRTHERGCCLTYDYV-TDDATDLLGERDL  178

Query  602   dllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDK  781
             D++S L GLLISR  +S+L H+NALQ+CIE AKLWL NS QPIEP++N +YA LR +L+K
Sbjct  179   DMISKLGGLLISRPVDSNLSHRNALQRCIERAKLWLANSDQPIEPNANASYAELRERLNK  238

Query  782   IMASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQK  946
             IMAS YFT      APV + AAA NY ++Q PVH           V V  E    QYQ K
Sbjct  239   IMASDYFTTTPEMKAPVEVAAAAGNYASFQVPVHR-------IPSVSVQAEVSAEQYQPK  291

Query  947   EEESISSHGNETHNYQSSHVDQLHQGEVGEE-DLSALPTETE-AVQAEVEGVQGDHHKDV  1120
             +E++ +  G+E  + QSS  ++L + E+  E  L  + +E E A  +EVE  Q  +  D 
Sbjct  292   DEDTGNLLGHEADDDQSSPAEELDKEELETEIPLEVVSSEQEPARSSEVEYNQ--NEVDP  349

Query  1121  KEQQNIPrr--syhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQ  1282
             KEQQ  PRR        RGG GG GRRGYSNGRGG    RG GG YQNGRS Y DQ
Sbjct  350   KEQQYAPRRNYQNQRGGRGGSGGGGRRGYSNGRGGRSSGRGGGGGYQNGRSQYYDQ  405



>ref|XP_008352995.1| PREDICTED: uncharacterized protein LOC103416528 [Malus domestica]
Length=433

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 211/437 (48%), Positives = 271/437 (62%), Gaps = 35/437 (8%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAAT  SD+SDGPVLS+INKR+RAL+KK NRI QME+SL++GK LNKEQE  L++K  V+
Sbjct  1     MAATSASDLSDGPVLSLINKRLRALRKKQNRIVQMEESLAQGKALNKEQEGVLQSKAGVV  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDG--  421
             A I+ELEK+RQPL+ AV EE SL+VQRH VSA   P   E+   +   +V    ESD   
Sbjct  61    ALIEELEKLRQPLADAVAEEQSLAVQRHXVSASTQPISDEKPQHDDMPNVVQPSESDDRQ  120

Query  422   GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  601
                +E+LLNLLYFGS+FDVK+ Q+ FT ++L+R HER  CL+      DD  ++L   DL
Sbjct  121   AAAVEELLNLLYFGSLFDVKS-QSDFTRIILTRTHERECCLT-YDTITDDDTEMLAPRDL  178

Query  602   dllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDK  781
             DL+S L  LLISR  +SSL HKNALQ+C+EHAKLWL NS QPIE +S+VTYAGLR +L K
Sbjct  179   DLISSLGELLISRPGDSSLSHKNALQQCLEHAKLWLANSEQPIESNSSVTYAGLRERLSK  238

Query  782   IMASQYFTAAP-VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEES  958
             IMAS YFT  P +   AAA NY  +Q PV  S+ P             + + +QQK E++
Sbjct  239   IMASDYFTITPQMKEVAAAGNYAPFQVPVQGSISP-------------VQLDFQQKVEDT  285

Query  959   ISSHGNETHNYQSSHVDQLHQGEVGEEDLS-ALPTETEAVQAEVEGVQGDHHKDVK-EQQ  1132
              +  G+ET + QSSH ++L + EV  E+ S A+  + E VQ E E     + +DV+ EQQ
Sbjct  286   ANFQGHETGDSQSSHTEELQKDEVVTENPSEAVSAQQEEVQLETEA--DYNQRDVEFEQQ  343

Query  1133  NIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRNSH  1312
             +          + G  G G R       GG  +   G +YQNGR+ Y DQP NY PR   
Sbjct  344   H--ASRRPYQNQRGGRGGGGRRGYTNGRGGRGNGRGGSSYQNGRNQYYDQPGNYYPR---  398

Query  1313  FrgrggrggHYNNHPPG  1363
                      HYNN   G
Sbjct  399   --------PHYNNREGG  407



>ref|XP_008389541.1| PREDICTED: uncharacterized protein LOC103451881 [Malus domestica]
Length=435

 Score =   294 bits (753),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 214/420 (51%), Positives = 274/420 (65%), Gaps = 29/420 (7%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             M AT  SD+SDGPVLS+INKRIRAL+KK NRI QME+SL++GK LNKEQE  L++KP V 
Sbjct  1     MEATAASDLSDGPVLSLINKRIRALRKKQNRIIQMEESLAQGKVLNKEQEGVLKSKPGVF  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDG--  421
             A I+ELEK+RQPL+ AV EE SL+VQRHQVSA  TP  S++     + +V    ESD   
Sbjct  61    ALIEELEKLRQPLADAVAEEQSLAVQRHQVSA-PTPPISDD-----KPNVLQPSESDDRQ  114

Query  422   GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  601
                +E+LLNLLYFGS+FDVK+ Q+ FT ++L+R HER  CL+Y     DD  ++L   DL
Sbjct  115   AAAVEELLNLLYFGSLFDVKS-QSDFTRIILTRTHERECCLTY-DTITDDDTEMLAPRDL  172

Query  602   dllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDK  781
             DL+S L G LISR  +SSL HKNALQ+C+EHAK WL  S QPIEP+SNVTYAGLR +L K
Sbjct  173   DLISSLGGFLISRPGDSSLSHKNALQQCLEHAKRWLAKSEQPIEPNSNVTYAGLRERLSK  232

Query  782   IMASQYFTAAP----VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             IMA+ YFT  P    V   AAA NY  +Q PVHES+ PV VP         + + +QQK 
Sbjct  233   IMATDYFTTTPQMKEVSAAAAAGNYAPFQVPVHESISPVQVP---------VQLDFQQKV  283

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDLS-ALPTETEAVQAEVEGVQGDHHKDVK-  1123
             E++ +  G++T + QSSH ++L + EV  E+ S A+  + E VQ E E     + +DV+ 
Sbjct  284   EDTANFQGHDTGDSQSSHTEELQKDEVVTENQSEAVSAQQEKVQLETEA--DYNQRDVEF  341

Query  1124  EQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPR  1303
             EQQ+          + G  G G R       GG  +   GG++QNGR+ Y DQP NY PR
Sbjct  342   EQQH--ASRRPYQNQRGGRGGGGRRGYTNGRGGRGNGRGGGSFQNGRNQYYDQPGNYYPR  399



>ref|XP_010096321.1| hypothetical protein L484_021067 [Morus notabilis]
 gb|EXB63796.1| hypothetical protein L484_021067 [Morus notabilis]
Length=458

 Score =   294 bits (753),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 219/428 (51%), Positives = 275/428 (64%), Gaps = 28/428 (7%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAATEVSD   GPVLS+INKR+RAL+KKLNRI+QME+++S+GK +N+EQEE LR+KP V 
Sbjct  1     MAATEVSD---GPVLSLINKRLRALRKKLNRITQMEEAISQGKPINREQEEVLRSKPGVS  57

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             A IDELEK+RQP++ AV EE+SL+VQ HQVS+L + A  +E   EPE  V      +  V
Sbjct  58    ALIDELEKLRQPIADAVAEEVSLAVQLHQVSSL-SDADRQEKPDEPETAVPEPDRREAEV  116

Query  428   VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
               EDLLNLLYFGS+FDVK  Q+ FT  ML+R HER  CL+YDY+  DD+ DLLGE DLDL
Sbjct  117   --EDLLNLLYFGSLFDVKP-QSDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGERDLDL  172

Query  608   lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
             +S L GLLISR  +SSL HKNALQ+C+EHAKLWL NS Q IEP++N TY+GLR +L+KIM
Sbjct  173   ISKLGGLLISRPVDSSLSHKNALQRCLEHAKLWLANSDQLIEPNANSTYSGLRERLNKIM  232

Query  788   ASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGV-------  931
             AS YFT      APV + AAA NY  +Q P+H SV  V V   V     +  V       
Sbjct  233   ASDYFTTTPEMKAPVEVAAAAGNYAPFQVPIHSSVSSVAVEGSVSSVAMEGSVSSLVVEG  292

Query  932   ---QYQQKEEESISSHGNETHNYQSSHVDQLHQGEVGEED--LSALPTETEAVQAEVEGV  1096
                Q++Q +E +    G+E    QSS V+++H+ +  E +    A+P E E ++ E E  
Sbjct  293   SVSQFEQ-DEGTTDFQGHEIGENQSSTVEEVHKDDEPETENPSEAVPVEQEQIRPETEIE  351

Query  1097  QGDHHKDVKEQQNIPrr--syhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSH  1270
                   + KEQQ +PRR          G GG G R       GG  S   GG YQNGR+ 
Sbjct  352   YSQRDVESKEQQYVPRRPYQNQRGGGRGGGGGGGRRGYPNGRGGRGSSRGGGPYQNGRNQ  411

Query  1271  YSDQPSNY  1294
             Y DQP  Y
Sbjct  412   YYDQPGGY  419



>ref|XP_010256182.1| PREDICTED: uncharacterized protein LOC104596615 [Nelumbo nucifera]
Length=445

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 224/462 (48%), Positives = 290/462 (63%), Gaps = 48/462 (10%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAA+  S+V+DGPVLS+INKR+RAL+KK NRI QMED +S+GK +NKEQEE LR+KPAV 
Sbjct  1     MAASAASEVTDGPVLSLINKRLRALRKKYNRILQMEDGISQGKPINKEQEEVLRSKPAVA  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKE------------PEG  391
             A IDE+EK+RQPL+AA++EE++L+VQRHQVSA  TP   +++ K+            P+ 
Sbjct  61    ALIDEVEKLRQPLTAALQEELNLAVQRHQVSA--TPPVVDDNVKDSEEEGGEPEETRPDW  118

Query  392   DVENKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKddd  571
             D   + E+    V+EDLLNLLYFGS+FDVK  Q+ FT  ML+R HER  CL+YDY+  DD
Sbjct  119   D---RNEA----VLEDLLNLLYFGSLFDVKP-QSDFTSTMLTRTHERGCCLTYDYV-TDD  169

Query  572   sidllgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVT  751
             + DLLGE DLD++S+L  L+ISR  +S   HKNAL+ C++HAKLWL NS QPIEP + VT
Sbjct  170   ATDLLGEKDLDMISMLGSLVISRPVHSIFSHKNALRSCVQHAKLWLSNSEQPIEPGATVT  229

Query  752   YAGLRLKLDKIMASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhv  916
             YAGLR +L+KI++S YFT      APV + AAA  Y   Q PV  S  P  VP+Q     
Sbjct  230   YAGLRERLNKILSSDYFTTTPEMKAPVEVAAAAGKYAPCQVPVQNSTVPSPVPIQADCP-  288

Query  917   EDIGVQYQQKEEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEG-  1093
               +G     KEE+ +   G +T   QS  VD+  + +  E+    +P E  +++ E +  
Sbjct  289   --LG-HCLDKEEDGLHFQGQDTGADQSLPVDEPPKPDEPEQ---LIPDEVTSIEQEQQKP  342

Query  1094  ---VQGDHHKDV--KEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQN  1258
                V+ D  ++V  +EQQ IP       Y   RG  G        G GGR    GG+YQN
Sbjct  343   QLEVEDDDEREVESREQQYIP----RKTYMNQRGRGGGSRRGYPNGRGGRGGKGGGSYQN  398

Query  1259  GRSHYSDQPSNYVPR---NSHFrgrggrggHYNNHPPGAQVG  1375
             GR+ Y DQP NY PR   NS  RG  G G  YNNH P A  G
Sbjct  399   GRNQYYDQPGNYYPRNYYNSRGRGGRGGGNAYNNHAPAAHGG  440



>ref|XP_011086413.1| PREDICTED: uncharacterized protein LOC105168156 [Sesamum indicum]
Length=448

 Score =   287 bits (735),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 210/430 (49%), Positives = 273/430 (63%), Gaps = 25/430 (6%)
 Frame = +2

Query  68    MAATEVSDVS------DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLR  229
             MAAT V+  S      DGPVL++INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQEETLR
Sbjct  1     MAATAVALSSSSEMGSDGPVLNLINKRLRALRKKLNRITQMEESVSQGKTLNKEQEETLR  60

Query  230   TKPAVLAGIDELEKIRQPLSAAVEEEISLSVQRHQVS--ALETPAPSEESGKEPEGDVEN  403
             +KP+VLAGIDELEK+RQPLS AV +EI L++++++ S          EE   EP  D   
Sbjct  61    SKPSVLAGIDELEKLRQPLSQAVNQEIQLALEKNKQSPETTTEERTEEEGTLEPGAD---  117

Query  404   KGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl  583
              GE DG   + DLL L+YF S+FDVKTL     + ML+R HER+ CL+YDY+ DDD+   
Sbjct  118   -GEKDGVSAVSDLLGLVYFASIFDVKTLM-RAQDNMLTRTHERNCCLTYDYVTDDDAAGD  175

Query  584   -lgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAG  760
              L E DLDL+++L  LLISR  NSSL HKNALQ C+EHAKLWL+ S QPI+P+ N+TYAG
Sbjct  176   PLQEWDLDLIAMLGSLLISRPVNSSLSHKNALQTCVEHAKLWLEKSEQPIDPNLNITYAG  235

Query  761   LRLKLDKIMASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDI  925
             LR KLDKIMAS YFT      APV + AA  NY ++Q P+H S   V       + VE  
Sbjct  236   LREKLDKIMASDYFTTTPEIKAPVEVAAAVGNYTSFQVPMHAS---VIPQDSFTLPVEGS  292

Query  926   GVQYQQKEEESISSHGNETHNYQSSHVDQLHQGEVGE-EDLSALPTETEAVQAEVEGVQG  1102
               +Y+Q+EEES +S+GNE +  ++  V++ HQ    E E++S L  + E    + E  Q 
Sbjct  293   AAEYEQEEEESPNSNGNEMYGDETGPVEEPHQAGGSEGENVSELQAQAEPGIPDTEEDQT  352

Query  1103  DHHKDVKEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQ  1282
                 D+KEQQ+       +    G       G      G G      G YQNGR+ + DQ
Sbjct  353   LRDMDLKEQQHT--TRRSHQNYRGGRSGSGGGRRGYANGRGGRGTTRGGYQNGRNQFYDQ  410

Query  1283  PSNYVPRNSH  1312
             P +Y PRN++
Sbjct  411   PGSYYPRNNY  420



>ref|XP_010272217.1| PREDICTED: uncharacterized protein LOC104608055 isoform X2 [Nelumbo 
nucifera]
Length=452

 Score =   286 bits (732),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 213/429 (50%), Positives = 272/429 (63%), Gaps = 26/429 (6%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAA+  S+V+DGPVLS+INKR+RAL+KK NRI QME+ +++GK +NKEQEE LR+KP V 
Sbjct  1     MAASAASEVTDGPVLSLINKRLRALRKKYNRILQMEEGIAQGKPINKEQEEVLRSKPTVA  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSA----LETPAPSEESGKEPEGDVENKGES  415
             A IDE EK+RQPL+AA++EE+ L+VQ HQVSA    ++      + GKE  G+ E KG S
Sbjct  61    ALIDEFEKLRQPLTAALQEELKLTVQHHQVSATPHVVDDNVEDSKDGKEESGESE-KGRS  119

Query  416   DGG---VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidll  586
             DG     ++EDLLNLLYF S+FDVK  Q+ FT  ML+R HER  CL+YDY+  DD+ DLL
Sbjct  120   DGDRDESILEDLLNLLYFASLFDVKP-QSDFTSTMLTRTHERGCCLTYDYV-TDDATDLL  177

Query  587   gesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLR  766
             GE DLD++S+L  LLISR  +S L HKNAL+ C++HAKLWL NS QPIEP + VTY GLR
Sbjct  178   GERDLDMISMLGSLLISRPVHSILSHKNALRSCVQHAKLWLSNSDQPIEPGAAVTYTGLR  237

Query  767   LKLDKIMASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGV  931
              +L++I+AS YFT      APV + AAA  Y   QAPV  SV P  VPVQ +      G 
Sbjct  238   ERLNRILASDYFTTTPEMKAPVEVAAAAGKYAPCQAPVQNSVVPSPVPVQAEGA---FGH  294

Query  932   QYQQKEEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPT--ETEAVQAEVEGVQGD  1105
              + ++EE S      +T   QS  V++  + E  ++  + +    E E  Q E+E  Q  
Sbjct  295   YHDKEEENSTCLQEQDTSTDQSLPVEEPPKDEPEQQTPAVISVKQEQEKPQLELEE-QSQ  353

Query  1106  HHKDVKEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQP  1285
                + KEQQ IP           + G G        G GGRS   GG YQNGRS Y DQP
Sbjct  354   IDLEAKEQQYIP-----RRTYQNQRGRGGGRRGYANGRGGRSGRSGGGYQNGRSQYYDQP  408

Query  1286  SNYVPRNSH  1312
              NY PRN +
Sbjct  409   GNYYPRNYY  417



>gb|EYU22447.1| hypothetical protein MIMGU_mgv1a006912mg [Erythranthe guttata]
Length=423

 Score =   285 bits (728),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 227/318 (71%), Gaps = 25/318 (8%)
 Frame = +2

Query  95    SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  274
             ++GPVL++INKR+RAL+KKLNRISQME+SLS+GK LNKEQEET R+K AVLAGIDELEKI
Sbjct  14    NEGPVLNLINKRLRALRKKLNRISQMEESLSQGKILNKEQEETYRSKSAVLAGIDELEKI  73

Query  275   RQPLSAAVEEEI--SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLN  448
             RQP+  AV++EI  +L  ++     L    P+EE   E    VE  G  D   V  DLLN
Sbjct  74    RQPILQAVDQEIEAALEKKKQDPEILTAETPNEEEYVET---VEKAGNDDVSSV-SDLLN  129

Query  449   LLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl-lgesdldllsllsg  625
             LLYFG++FDVKTL +   + ML+R HER+ CL+YDY+ DDD+    L E DLDL+++L G
Sbjct  130   LLYFGAVFDVKTLMSAH-DNMLTRTHERNCCLTYDYVTDDDAAGAPLKEWDLDLIAILGG  188

Query  626   llisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFT  805
              LISR  +SSL HK++LQKC+EHAKLWL NS QPIEP+S++TYAGLR KL+KIMAS YFT
Sbjct  189   SLISRPVHSSLSHKDSLQKCVEHAKLWLANSEQPIEPNSDITYAGLREKLNKIMASDYFT  248

Query  806   A-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISSH  970
                   APV + AA  NY ++Q PVH             V VED  V+Y+Q+EE+S +SH
Sbjct  249   TTPEIKAPVEVAAAGGNYTSFQVPVH------------SVGVEDSSVEYRQEEEQSPNSH  296

Query  971   GNETHNYQSSHVDQLHQG  1024
              NE +  + SHV++LHQG
Sbjct  297   NNEIYGDEISHVEKLHQG  314



>ref|XP_002890619.1| hypothetical protein ARALYDRAFT_472693 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66878.1| hypothetical protein ARALYDRAFT_472693 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 204/271 (75%), Gaps = 10/271 (4%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAAT  S+ S+GPV+ +INKR+RAL+KK NRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLINKRLRALRKKYNRITQMEESISQGKTLNKEQEEVLRSKPAVV  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
              I+ELEKIR PLSAAV EEISL+ Q ++  + +T AP ++   +   +V      DGG 
Sbjct  61   ILIEELEKIRAPLSAAVAEEISLATQHNRAPSDQTTAPEQKEVTDIPQEVSG---GDGGA  117

Query  428  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             +EDL+NLLYFGS+FDVK+ QN FT +ML+R HERS CLSYDY+  DD+ DLLG+ DLD 
Sbjct  118  KLEDLVNLLYFGSLFDVKS-QNEFTSIMLTRTHERSCCLSYDYV-TDDATDLLGDRDLDS  175

Query  608  lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
            +S L  L++SR  +SSL HKNAL++C+EHAKLWL NS QPIE + N++YA LR KL KIM
Sbjct  176  ISQLWSLMVSRPVDSSLSHKNALERCVEHAKLWLANSEQPIESNCNISYAALREKLKKIM  235

Query  788  ASQYFTA-----APVGLQAAAMNYGAYQAPV  865
             S YFT      APV + AAA NY +YQ PV
Sbjct  236  GSDYFTTTPEMKAPVDVAAAAGNYTSYQVPV  266



>ref|XP_009360410.1| PREDICTED: uncharacterized protein LOC103950885 [Pyrus x bretschneideri]
Length=434

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 209/419 (50%), Positives = 270/419 (64%), Gaps = 28/419 (7%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             M AT  SD+SDGPVLS+INKRIRAL+KK NRI QME+SL++GK LNKEQE  L++K  V 
Sbjct  1     MEATAASDLSDGPVLSLINKRIRALRKKQNRIIQMEESLAQGKVLNKEQEGVLKSKSGVF  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDG-G  424
             A I+ELEK+RQPL+ AV EE SL++QRHQVSA   P     S  +P  +V    E D   
Sbjct  61    ALIEELEKLRQPLADAVAEEQSLALQRHQVSASTQPI----SDDKP--NVVQPSEDDCQA  114

Query  425   VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  604
               +E+LLNLLYFGS+FDVK+ Q+ FT ++L+R HER  CL+      DD  ++L   DLD
Sbjct  115   AAVEELLNLLYFGSLFDVKS-QSDFTRIILTRTHERECCLT-YDTITDDDTEMLAPRDLD  172

Query  605   llsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKI  784
             L+S L G LISR  +SSL HKNALQ+C+EHAK WL  S QPIEP+SNVTYAGLR +L KI
Sbjct  173   LISSLGGFLISRPGDSSLSHKNALQQCLEHAKRWLAKSEQPIEPNSNVTYAGLRERLSKI  232

Query  785   MASQYFTAAP----VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEE  952
             MAS YFT  P    V   AAA NY  +Q PVHE + PV+VP         + + +QQK E
Sbjct  233   MASDYFTTTPQMKEVSAAAAAGNYAPFQVPVHEPILPVEVP---------VQLDFQQKVE  283

Query  953   ESISSHGNETHNYQSSHVDQLHQGEVGEEDLS-ALPTETEAVQAEVEGVQGDHHKDVK-E  1126
             ++ +  G+ T + QS+H ++L + EV +E+ S A+ T+ E VQ E E     + +DV+ E
Sbjct  284   DTANFQGHNTGDSQSNHTEELQKDEVVKENQSEAVSTQQEQVQLETEA--DYNQRDVEFE  341

Query  1127  QQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPR  1303
             QQ+          + G  G G R       GG  +   GG++QNGR+ Y DQP +Y PR
Sbjct  342   QQH--ASRRPYQNQRGGRGGGGRRGYTNGRGGRGNGRGGGSFQNGRNQYYDQPGSYYPR  398



>ref|NP_174029.1| uncharacterized glycine-rich protein [Arabidopsis thaliana]
 gb|AAF79875.1|AC000348_28 T7N9.15 [Arabidopsis thaliana]
 gb|AAL67063.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14329.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30778.1| uncharacterized glycine-rich protein [Arabidopsis thaliana]
Length=420

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 202/271 (75%), Gaps = 10/271 (4%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAAT  S+ S+GPV+ +INKR+RAL+KK NRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLINKRLRALRKKYNRITQMEESISQGKTLNKEQEEVLRSKPAVV  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
              IDELEKIR PLSAAV EEISL+ Q ++ S+ +T A  ++   +   +V      D G 
Sbjct  61   ILIDELEKIRAPLSAAVTEEISLATQLNRASSDQTTASEQKEVTDIPQEVSG---GDDGA  117

Query  428  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             +EDL+N LYFGS+FDVK+ QN FT +ML+R HERS CLSYDY+  DD+ DLLG+ DLD 
Sbjct  118  KLEDLVNFLYFGSLFDVKS-QNEFTSIMLTRTHERSCCLSYDYV-TDDATDLLGDRDLDS  175

Query  608  lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
            +S L  L++SR  +SSL HKNAL++C+EHAKLWL NS QPIE + N +YA LR KL KIM
Sbjct  176  ISQLWSLMVSRPVDSSLSHKNALERCVEHAKLWLANSEQPIESNCNTSYAALREKLKKIM  235

Query  788  ASQYFTA-----APVGLQAAAMNYGAYQAPV  865
            AS YFT      APV + AAA NY +YQ PV
Sbjct  236  ASDYFTTTPEMKAPVDVAAAAGNYTSYQVPV  266



>ref|XP_010477771.1| PREDICTED: uncharacterized protein LOC104756820 [Camelina sativa]
Length=421

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 226/328 (69%), Gaps = 27/328 (8%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAAT  S+ S+GPV+ ++NKR+RAL+KKLNRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1     MAATASSEASEGPVMGLVNKRLRALRKKLNRITQMEESVSQGKTLNKEQEEVLRSKPAVV  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQ---VSALETPAPSEESGKEPEGDVENKGESD  418
               I+ELEK+R PLSAAV EEISL+  ++     SA +   PSE+  KE E     +   D
Sbjct  61    VLIEELEKLRAPLSAAVSEEISLATNKNHNRDSSASDPTTPSEQ--KEIEVAEPPQSGDD  118

Query  419   GGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesd  598
              GV +EDL+NLLYFGS+FDVK+ QN FT +ML+R HER  CLSYDY+  DD+ DLLG+ D
Sbjct  119   DGVKLEDLVNLLYFGSLFDVKS-QNEFTSIMLTRSHERGCCLSYDYV-SDDATDLLGDRD  176

Query  599   ldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLD  778
             LD LS L  L++SR  +SSL HKNAL++C+EHAKLWL NS QPIE + N++YA LR KL 
Sbjct  177   LDSLSQLWSLMVSRPVDSSLSHKNALERCVEHAKLWLANSEQPIESNCNISYAALREKLK  236

Query  779   KIMASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQ  943
             KIMAS YFT      APV + AAA NY +YQ PV                +E   V YQQ
Sbjct  237   KIMASDYFTTTPEMKAPVEVAAAAGNYTSYQVPVD---------------IEAPAVHYQQ  281

Query  944   KEEESISSHGNETHNYQSSHVDQLHQGE  1027
             ++E++ ++   E+     S  D+  +GE
Sbjct  282   QDEDAFNNKEQESVVNDQSLQDEHQKGE  309



>gb|EYU22446.1| hypothetical protein MIMGU_mgv1a006912mg [Erythranthe guttata]
Length=426

 Score =   280 bits (715),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 227/321 (71%), Gaps = 28/321 (9%)
 Frame = +2

Query  95    SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  274
             ++GPVL++INKR+RAL+KKLNRISQME+SLS+GK LNKEQEET R+K AVLAGIDELEKI
Sbjct  14    NEGPVLNLINKRLRALRKKLNRISQMEESLSQGKILNKEQEETYRSKSAVLAGIDELEKI  73

Query  275   RQPLSAAVEEEI--SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLN  448
             RQP+  AV++EI  +L  ++     L    P+EE   E    VE  G  D   V  DLLN
Sbjct  74    RQPILQAVDQEIEAALEKKKQDPEILTAETPNEEEYVET---VEKAGNDDVSSV-SDLLN  129

Query  449   LLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl-lgesdldllsllsg  625
             LLYFG++FDVKTL +   + ML+R HER+ CL+YDY+ DDD+    L E DLDL+++L G
Sbjct  130   LLYFGAVFDVKTLMSAH-DNMLTRTHERNCCLTYDYVTDDDAAGAPLKEWDLDLIAILGG  188

Query  626   llisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFT  805
              LISR  +SSL HK++LQKC+EHAKLWL NS QPIEP+S++TYAGLR KL+KIMAS YFT
Sbjct  189   SLISRPVHSSLSHKDSLQKCVEHAKLWLANSEQPIEPNSDITYAGLREKLNKIMASDYFT  248

Query  806   A-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQ---KEEESI  961
                   APV + AA  NY ++Q PVH             V VED  V+Y+Q   +EE+S 
Sbjct  249   TTPEIKAPVEVAAAGGNYTSFQVPVH------------SVGVEDSSVEYRQETLQEEQSP  296

Query  962   SSHGNETHNYQSSHVDQLHQG  1024
             +SH NE +  + SHV++LHQG
Sbjct  297   NSHNNEIYGDEISHVEKLHQG  317



>ref|XP_002269144.1| PREDICTED: uncharacterized protein LOC100248339 [Vitis vinifera]
Length=444

 Score =   280 bits (715),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 239/454 (53%), Positives = 292/454 (64%), Gaps = 38/454 (8%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAA   SDV+DGPVLS+INKR+R L+KK NRI+QME+++++GK +NKEQE+ LR+KPAV 
Sbjct  1     MAA---SDVTDGPVLSLINKRLRGLRKKYNRITQMEEAIAQGKPINKEQEDVLRSKPAVT  57

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
               IDELE++RQPLSAAVEEE+SL++Q + +     P PS    K+   D E K ESD  +
Sbjct  58    VLIDELERLRQPLSAAVEEELSLALQSNHLPPSPPPQPSSIINKDGADDGEEKPESD-HL  116

Query  428   VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
              +E+LLNLLYFG +FDVK  Q  FT  ML+R HER  CL+YDY+  DD+ DLLGE DLDL
Sbjct  117   NVENLLNLLYFGYLFDVKP-QTDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGERDLDL  174

Query  608   lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
             +S LSGLLISR  +SSL HKNALQ+CIEHA+LWL NS +PIEPD+ VTYAGLR KL+KIM
Sbjct  175   ISQLSGLLISRPVDSSLSHKNALQRCIEHARLWLANSDRPIEPDATVTYAGLREKLNKIM  234

Query  788   ASQYFTAAP-------VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQK  946
             AS YFT  P       V   AAA NY ++Q P+H S         V V VE    QYQQK
Sbjct  235   ASDYFTTTPEMKAPVEVAAAAAAGNYVSFQVPLHSS--------VVPVQVEGSIAQYQQK  286

Query  947   EEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAV-------QAEVEGVQGD  1105
             +E++ +  G+ET + QSS V++LHQ E+  E+    P E  +V       QAEVE  QGD
Sbjct  287   DEDNSNVQGHETGDDQSSPVEELHQDELEIEN----PAEVVSVQQEQAKQQAEVEWSQGD  342

Query  1106  HHKDVKEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQP  1285
                + KEQ    R   +     G GG GRRG      GG     VGG+YQNGRS Y DQP
Sbjct  343   --VESKEQYVPRRNYQNTRGGRGGGGSGRRGGYPNGRGGRSGGRVGGSYQNGRSQYYDQP  400

Query  1286  SNYVPRNSHFrgrggrggH----YNNHPPGAQVG  1375
              NY  R  H     G  G     YNNH  G Q G
Sbjct  401   GNYYSRGYHNNRGRGGRGAGGNSYNNHVLGIQGG  434



>ref|XP_004155395.1| PREDICTED: uncharacterized protein LOC101229960 [Cucumis sativus]
Length=294

 Score =   273 bits (698),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 207/276 (75%), Gaps = 15/276 (5%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA   SDV DGPVLS+INKR+RAL+KK NRI QME+++S GK +NKEQEE LR+KP+V 
Sbjct  1    MAAPSPSDVIDGPVLSLINKRLRALRKKHNRILQMEEAISLGKPINKEQEEVLRSKPSVT  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPE----GDVENKGES  415
            A IDELEK+RQPL++AV EEI+L+VQR Q S    P  +++S  E       DV+++ E 
Sbjct  61   ALIDELEKLRQPLASAVSEEINLAVQRQQASVSSLPVSTDDSHTEVRDEDTSDVKDQSE-  119

Query  416  DGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllges  595
                V+EDLLNLLYFGS+FDVK+ Q+ FT  ML+R HERS C++YDY+  DD+ DLL E 
Sbjct  120  --HAVVEDLLNLLYFGSLFDVKS-QSDFTSTMLTRTHERSCCITYDYV-TDDATDLLVER  175

Query  596  dldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKL  775
            DLDL+S++SGLL+SR  +S+LPHKNAL++CIEHAKLWL  + QPIEP+++VTYA LR +L
Sbjct  176  DLDLISMMSGLLVSRPVDSNLPHKNALERCIEHAKLWLTKADQPIEPNTDVTYANLRERL  235

Query  776  DKIMASQYFTAA-----PVGLQA-AAMNYGAYQAPV  865
             KIMAS YFT       PV + A AA NY  +Q PV
Sbjct  236  HKIMASDYFTTTPEIKGPVEVAAVAAGNYANFQVPV  271



>ref|XP_010460222.1| PREDICTED: uncharacterized protein LOC104741134 [Camelina sativa]
Length=418

 Score =   277 bits (708),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 202/271 (75%), Gaps = 10/271 (4%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAAT  S+ S+GPV+ ++NKR+RAL+KKLNRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLVNKRLRALRKKLNRITQMEESVSQGKTLNKEQEEVLRSKPAVV  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
              I+ELEK+R PLSAAV EEISL+  +    + +    SE+  KE E   E     D GV
Sbjct  61   VLIEELEKLRAPLSAAVSEEISLATTKDHRDSSDPTTASEQ--KEIEV-AEPPQSGDDGV  117

Query  428  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             +EDL+NLLYFGS+FDVK+ QN FT +ML+R HER  CLSYDY+  DD+ DLLG+ DLD 
Sbjct  118  KLEDLVNLLYFGSLFDVKS-QNEFTSIMLTRSHERGCCLSYDYV-SDDATDLLGDRDLDS  175

Query  608  lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
            +S L  L++SR  +SSL HKNAL++C+EHAKLWL NS QPIE + N++YA LR KL KIM
Sbjct  176  ISQLWSLMVSRPVDSSLSHKNALERCVEHAKLWLANSEQPIESNCNISYAALREKLKKIM  235

Query  788  ASQYFTA-----APVGLQAAAMNYGAYQAPV  865
            AS YFT      APV + AAA NY +YQ PV
Sbjct  236  ASDYFTTTPEMKAPVEVAAAAGNYTSYQVPV  266



>ref|XP_008446299.1| PREDICTED: uncharacterized protein LOC103489075 isoform X2 [Cucumis 
melo]
Length=443

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 205/415 (49%), Positives = 264/415 (64%), Gaps = 30/415 (7%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAA   SDVSDGPVLS+INKR+RAL+KK NRI QME+++S+GK +NKEQEE LR+KP+V 
Sbjct  1     MAALAPSDVSDGPVLSLINKRLRALRKKHNRILQMEEAISQGKPINKEQEEVLRSKPSVT  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKE--PEGDVENKGESDG  421
             A IDELEK+R PLS+AV EEI L+VQR Q S    P  +++S  E   E D + K +S+ 
Sbjct  61    ALIDELEKLRLPLSSAVSEEICLAVQRQQASVSSQPVSTDDSPTEVRDENDSDVKDQSEH  120

Query  422   GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  601
              VV EDLLNLLYFGS+FDVK+ Q+ FT  ML+R HERS C++YDY+  DD+ DLL E DL
Sbjct  121   AVV-EDLLNLLYFGSLFDVKS-QSDFTSTMLTRTHERSCCITYDYV-TDDATDLLVERDL  177

Query  602   dllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDK  781
             DL+S++SGLL+SR  +S+LPHKNAL++CIEHAKLWL  + QPIEP+++VTYA LR +L K
Sbjct  178   DLISMMSGLLVSRPVDSNLPHKNALERCIEHAKLWLMKADQPIEPNTDVTYANLRERLHK  237

Query  782   IMASQYFTA-----APVGLQA-AAMNYGAYQAP--VHESvppvdvpvqvqvhvEDIGVQY  937
             IMAS YFT       PV + A AA NY  +Q P  VHE               E    ++
Sbjct  238   IMASDYFTTTPEIKGPVEVAAVAAGNYANFQVPVAVHE---------------EGSDEKF  282

Query  938   QQKEEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKD  1117
              Q + +     G++  + Q    D+L   +V E   S+     + V+ E E  Q     D
Sbjct  283   LQTDADVGDVQGDDISDGQPGSADEL-PSDVQETGNSSEFVTQQEVRPEEEFEQKHADGD  341

Query  1118  VKEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQ  1282
              +EQQ +P R      + G  GVG R   +   GG      GG+YQNGRS Y DQ
Sbjct  342   AREQQYVP-RRGGYMNQRGGRGVGGRRGYSNGRGGRGDGRGGGSYQNGRSRYYDQ  395



>ref|XP_006307636.1| hypothetical protein CARUB_v10009264mg [Capsella rubella]
 gb|EOA40534.1| hypothetical protein CARUB_v10009264mg [Capsella rubella]
Length=418

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 202/271 (75%), Gaps = 8/271 (3%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAAT  S+ S+GPV+ +INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLINKRLRALRKKLNRITQMEESVSQGKTLNKEQEEVLRSKPAVV  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
              I+ELEK+R PLSAAV EEISL+ + H+ S+  T A SE+   E     +    SD G 
Sbjct  61   VLIEELEKLRAPLSAAVSEEISLATKHHRDSSDPTTA-SEQKEIEVCDPPQGVSGSDDGA  119

Query  428  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             +EDL+NLLYFGS+FDVK+ QN FT +ML+R HER  CLSYDY+  DD+ DLLG+ DLD 
Sbjct  120  KLEDLVNLLYFGSLFDVKS-QNEFTSIMLTRTHERGCCLSYDYV-ADDATDLLGDRDLDS  177

Query  608  lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
            +S L  L++SR  +SSL HKNAL++C+EHAK WL NS QPIE + N++YA LR KL KIM
Sbjct  178  ISQLWSLMVSRPMDSSLSHKNALERCVEHAKQWLANSEQPIESNCNISYAALREKLKKIM  237

Query  788  ASQYFTA-----APVGLQAAAMNYGAYQAPV  865
            AS YFT      APV + AA  NY +YQ PV
Sbjct  238  ASDYFTTTPEMKAPVDVAAAVGNYTSYQVPV  268



>gb|KDO82715.1| hypothetical protein CISIN_1g013233mg [Citrus sinensis]
Length=447

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 273/418 (65%), Gaps = 30/418 (7%)
 Frame = +2

Query  65    SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  244
             +  A   SD+SDGPVLSVINKR+RAL+KK NRI QME+S+S+GKTLNKEQEE LR+KP V
Sbjct  5     TATAAPASDMSDGPVLSVINKRLRALRKKYNRIVQMEESVSQGKTLNKEQEEVLRSKPIV  64

Query  245   LAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
              A IDEL+K+R PL +A+ EE+SL  QR   SA  TP            D  +  + D  
Sbjct  65    TALIDELDKLRSPLCSALSEELSLH-QRQ--SAPPTPDNQPNHVANSTKDDNDDNDDDDS  121

Query  425   VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  604
               + DLLNLLYFGS+FDVK+ Q+ FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD
Sbjct  122   SSVSDLLNLLYFGSLFDVKS-QSDFTATMLTRTHERGCCLTYDYV-TDDATDLLGEKDLD  179

Query  605   llsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKI  784
             L+S+LSGLLISR  +SS  HK+AL +CIEHAKLWL NS QPI+P++NVTYAGLR +LDKI
Sbjct  180   LISMLSGLLISRPIDSSWSHKSALHRCIEHAKLWLANSDQPIDPNANVTYAGLRERLDKI  239

Query  785   MASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             M+S YFT      APV + AAA +YG++Q PVH S         V V VE   VQYQ+K+
Sbjct  240   MSSDYFTTTPEMKAPVEM-AAAASYGSFQVPVHGS---------VPVQVEGAAVQYQEKD  289

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGD---HHKDV  1120
             E++++   +ET + Q +   +  Q E+  E+    PTE  +VQAE      +   +H DV
Sbjct  290   EDTVNFQEHETGDNQFTPAHEHQQDELETEN----PTEGVSVQAEQVNSHAELEHNHGDV  345

Query  1121  --KEQQNIPrr-syhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQP  1285
               KEQQ +PRR   +     G GG G R   +   GG  S   GGAYQNGRS Y DQP
Sbjct  346   ESKEQQYVPRRPYQNQRGGRGGGGGGGRRGYSNGRGGRGSSRGGGAYQNGRSQYYDQP  403



>ref|XP_008446298.1| PREDICTED: uncharacterized protein LOC103489075 isoform X1 [Cucumis 
melo]
Length=469

 Score =   276 bits (705),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 166/274 (61%), Positives = 208/274 (76%), Gaps = 11/274 (4%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA   SDVSDGPVLS+INKR+RAL+KK NRI QME+++S+GK +NKEQEE LR+KP+V 
Sbjct  1    MAALAPSDVSDGPVLSLINKRLRALRKKHNRILQMEEAISQGKPINKEQEEVLRSKPSVT  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKE--PEGDVENKGESDG  421
            A IDELEK+R PLS+AV EEI L+VQR Q S    P  +++S  E   E D + K +S+ 
Sbjct  61   ALIDELEKLRLPLSSAVSEEICLAVQRQQASVSSQPVSTDDSPTEVRDENDSDVKDQSEH  120

Query  422  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  601
             VV EDLLNLLYFGS+FDVK+ Q+ FT  ML+R HERS C++YDY+  DD+ DLL E DL
Sbjct  121  AVV-EDLLNLLYFGSLFDVKS-QSDFTSTMLTRTHERSCCITYDYV-TDDATDLLVERDL  177

Query  602  dllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDK  781
            DL+S++SGLL+SR  +S+LPHKNAL++CIEHAKLWL  + QPIEP+++VTYA LR +L K
Sbjct  178  DLISMMSGLLVSRPVDSNLPHKNALERCIEHAKLWLMKADQPIEPNTDVTYANLRERLHK  237

Query  782  IMASQYFTA-----APVGLQA-AAMNYGAYQAPV  865
            IMAS YFT       PV + A AA NY  +Q PV
Sbjct  238  IMASDYFTTTPEIKGPVEVAAVAAGNYANFQVPV  271



>ref|XP_006438557.1| hypothetical protein CICLE_v10031519mg [Citrus clementina]
 ref|XP_006483261.1| PREDICTED: uncharacterized protein LOC102619416 isoform X2 [Citrus 
sinensis]
 gb|ESR51797.1| hypothetical protein CICLE_v10031519mg [Citrus clementina]
Length=445

 Score =   275 bits (703),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 275/417 (66%), Gaps = 30/417 (7%)
 Frame = +2

Query  65    SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  244
             +  A   SD+SDGPVLSVINKR+RAL+KK NRI QME+S+S+GKTLNKEQEE  R+KP V
Sbjct  5     TATAAPASDMSDGPVLSVINKRLRALRKKYNRIVQMEESVSQGKTLNKEQEEVFRSKPIV  64

Query  245   LAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
              A IDEL+K+R PL +A+ EE+SL  QR   SA  TP            D  +  + D  
Sbjct  65    TALIDELDKLRSPLCSALSEELSLH-QRQ--SAPPTPDNQPNHVANSTKDDNDDNDDDDS  121

Query  425   VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  604
               + DLLNLLYFGS+FDVK+ Q+ FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD
Sbjct  122   SSVSDLLNLLYFGSLFDVKS-QSDFTATMLTRTHERGCCLTYDYV-TDDATDLLGEKDLD  179

Query  605   llsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKI  784
             L+S+LSGLLISR  +SS  HK+AL +CIEHAKLWL NS QPI+P++NVTYAGLR +LDKI
Sbjct  180   LISMLSGLLISRPIDSSWSHKSALHRCIEHAKLWLANSDQPIDPNANVTYAGLRERLDKI  239

Query  785   MASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             M+S YFT      APV + AAA +YG++Q PVH S         V V VE   VQYQ+K+
Sbjct  240   MSSDYFTTTPEMKAPVEM-AAAASYGSFQVPVHGS---------VPVQVEGAAVQYQEKD  289

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGD---HHKDV  1120
             E++++   +ET + Q +   +  Q E+  E+    PTE  +VQAE      +   +H DV
Sbjct  290   EDTVNFQEHETGDNQFTPAHEHQQDELETEN----PTEGVSVQAEQVNSHAELEHNHGDV  345

Query  1121  --KEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQP  1285
               KEQQ +P R  + N RGGRGG G R   +   GG  S   GGAYQNGRS Y DQP
Sbjct  346   ESKEQQYVP-RRPYQNQRGGRGGGGGRRGYSNGRGGRGSSRGGGAYQNGRSQYYDQP  401



>ref|XP_010498969.1| PREDICTED: uncharacterized protein LOC104776570 [Camelina sativa]
Length=418

 Score =   274 bits (701),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 159/271 (59%), Positives = 202/271 (75%), Gaps = 10/271 (4%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAAT  S+ S+GPV+ ++NKR+RAL+KKLNRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLVNKRLRALRKKLNRITQMEESVSQGKTLNKEQEEVLRSKPAVV  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
              I+ELEK+R PLSAAV EEISL+  ++   + +    SE+  KE E   E     D GV
Sbjct  61   VLIEELEKLRAPLSAAVSEEISLATTKNHRDSSDPTTASEQ--KEIEV-AEPPQSGDDGV  117

Query  428  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             +EDL+NLLYFGS+FDVK+ QN FT +ML+R HER  CLSYD++  DD+ DLLG+ DLD 
Sbjct  118  KLEDLVNLLYFGSLFDVKS-QNEFTSIMLTRSHERGCCLSYDFV-SDDATDLLGDRDLDS  175

Query  608  lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
            +S L  L++SR  +S L HKNAL++C+EHAKLWL NS QPIE + N++YA LR KL KIM
Sbjct  176  ISQLWSLMVSRPVDSRLSHKNALERCVEHAKLWLANSEQPIESNCNISYAALREKLKKIM  235

Query  788  ASQYFTA-----APVGLQAAAMNYGAYQAPV  865
            AS YFT      APV + AAA NY +YQ PV
Sbjct  236  ASDYFTTTPEMKAPVEVAAAAGNYTSYQVPV  266



>ref|XP_002312704.1| glycine-rich family protein [Populus trichocarpa]
 gb|EEE90071.1| glycine-rich family protein [Populus trichocarpa]
Length=434

 Score =   273 bits (698),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 197/436 (45%), Positives = 256/436 (59%), Gaps = 54/436 (12%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAA   S++++GPVLS+I KR+R LKKK NRI QME+S+++GK +NKEQE+ LR+KP+V 
Sbjct  1     MAAASTSEITEGPVLSLITKRLRGLKKKFNRIVQMEESIAQGKPINKEQEDFLRSKPSVA  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             A IDELEK+RQPLS AV EEI L+  R    +  T  P   +G                 
Sbjct  61    AAIDELEKLRQPLSVAVSEEIELAAHRLNPKSDSTVVPEASNG-----------------  103

Query  428   VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             V+EDLL+L YFG +FDV++ QN FT  ML+R HER  CL+YDY+ DD +  L       +
Sbjct  104   VVEDLLHLFYFGCLFDVRS-QNDFTATMLTRTHERGCCLTYDYVTDDATDLLSERDLDMI  162

Query  608   lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
               L  GL+ISR  NSSL HKNALQ+C+EHAKLWL NS QPI+ + NV+YA LR KL+KIM
Sbjct  163   SILGGGLIISRPVNSSLSHKNALQRCMEHAKLWLANSDQPIDSNVNVSYAELREKLNKIM  222

Query  788   ASQYFTA-----APVGLQAAAMNYGAYQAP--VHESvppvdvpvqvqvhvEDIGVQYQQK  946
             AS YFT      APV + AAA NY  +Q P  VH                ED   QYQ K
Sbjct  223   ASDYFTTTPEIKAPVEMAAAAGNYVPFQVPFSVH--------------MDEDSVAQYQPK  268

Query  947   EEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSAL---------PTETEAV--QAEVEG  1093
             E+E+ +   +ET + QSS  ++L + E   E+ + +          TE E    Q EVE 
Sbjct  269   EQETENIQ-HETGDDQSSPAEELQKDEQETENPAVVSDQEEQDNPSTEVEVYYNQREVEH  327

Query  1094  VQGDHHK---DVKEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGR  1264
              + DH++   + KEQQ + RR+Y N   G  GG G R   +   GG      GG YQ  R
Sbjct  328   GEVDHNQREAEPKEQQYVSRRNYQNQRGGRGGGNGGRRGYSNGRGGRSGGRGGGGYQTDR  387

Query  1265  SHYSDQPSNYVPRNSH  1312
             + + DQP NY  RN++
Sbjct  388   NQHCDQPGNYYQRNNY  403



>ref|XP_006438558.1| hypothetical protein CICLE_v10031519mg [Citrus clementina]
 ref|XP_006483260.1| PREDICTED: uncharacterized protein LOC102619416 isoform X1 [Citrus 
sinensis]
 gb|ESR51798.1| hypothetical protein CICLE_v10031519mg [Citrus clementina]
Length=450

 Score =   273 bits (699),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 219/418 (52%), Positives = 276/418 (66%), Gaps = 27/418 (6%)
 Frame = +2

Query  65    SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  244
             +  A   SD+SDGPVLSVINKR+RAL+KK NRI QME+S+S+GKTLNKEQEE  R+KP V
Sbjct  5     TATAAPASDMSDGPVLSVINKRLRALRKKYNRIVQMEESVSQGKTLNKEQEEVFRSKPIV  64

Query  245   LAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
              A IDEL+K+R PL +A+ EE+SL  QR   SA  TP            D  +  + D  
Sbjct  65    TALIDELDKLRSPLCSALSEELSLH-QRQ--SAPPTPDNQPNHVANSTKDDNDDNDDDDS  121

Query  425   VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  604
               + DLLNLLYFGS+FDVK+ Q+ FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD
Sbjct  122   SSVSDLLNLLYFGSLFDVKS-QSDFTATMLTRTHERGCCLTYDYV-TDDATDLLGEKDLD  179

Query  605   llsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKI  784
             L+S+LSGLLISR  +SS  HK+AL +CIEHAKLWL NS QPI+P++NVTYAGLR +LDKI
Sbjct  180   LISMLSGLLISRPIDSSWSHKSALHRCIEHAKLWLANSDQPIDPNANVTYAGLRERLDKI  239

Query  785   MASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             M+S YFT      APV + AAA +YG++Q PVH S         V V VE   VQYQ+K+
Sbjct  240   MSSDYFTTTPEMKAPVEM-AAAASYGSFQVPVHGS---------VPVQVEGAAVQYQEKD  289

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDL-SALPTETEAVQAEVEGVQGD---HHKD  1117
             E++++   +ET + Q +   +  Q    +++L +  PTE  +VQAE      +   +H D
Sbjct  290   EDTVNFQEHETGDNQFTPAHEHQQDCASQDELETENPTEGVSVQAEQVNSHAELEHNHGD  349

Query  1118  V--KEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQP  1285
             V  KEQQ +P R  + N RGGRGG G R   +   GG  S   GGAYQNGRS Y DQP
Sbjct  350   VESKEQQYVP-RRPYQNQRGGRGGGGGRRGYSNGRGGRGSSRGGGAYQNGRSQYYDQP  406



>ref|XP_008221700.1| PREDICTED: keratin, type I cytoskeletal 10 [Prunus mume]
Length=443

 Score =   273 bits (698),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 208/419 (50%), Positives = 266/419 (63%), Gaps = 32/419 (8%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAAT  SD+SDGPVLS+INKRIRAL+KK NRI QME++LS+GK LNKEQEE LR+KPAV+
Sbjct  1     MAATAASDLSDGPVLSLINKRIRALRKKQNRIIQMEEALSQGKVLNKEQEEVLRSKPAVI  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDG--  421
               I+ELEK+RQPLS AV EE  L+V RHQVSA   P   ++  +E + +V    ESD   
Sbjct  61    VLIEELEKLRQPLSVAVTEEHDLAVHRHQVSASTQPLLDDKPQEEDKSNVAQPTESDDRQ  120

Query  422   GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  601
             G  +E+LLNLLYFGS+FDVK+  + FT ++L+R HER  CL+Y     DD  ++LG  DL
Sbjct  121   GASVEELLNLLYFGSLFDVKSPSD-FTRIILTRTHERECCLTY-DTITDDDTEMLGARDL  178

Query  602   dllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDK  781
             DL+S L GLLISR  +SSL HKNALQ+CIEHAKLWL  S QPIEP+++VTYA LR +L K
Sbjct  179   DLISTLGGLLISRPVDSSLSHKNALQRCIEHAKLWLAKSDQPIEPNASVTYASLRERLSK  238

Query  782   IMASQYFTAAP-------VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQ  940
             IMAS YFT  P       V   AAA NY  +Q             VQV V VE     +Q
Sbjct  239   IMASVYFTTTPEMKAPVEVAAAAAAGNYAPFQV-----------QVQVPVQVEGEVAHFQ  287

Query  941   QKEEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGD---HH  1111
             QK+E++ +  GNET + QSS  ++L + E+  E+    P+E  +VQ E   ++ +   + 
Sbjct  288   QKDEDTANFQGNETGDNQSSRTEELQKDELETEN----PSEVVSVQQEQAKLETEVEYNQ  343

Query  1112  KDVK-EQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQP  1285
             +DV+ EQQ           + G  G G R  +    G   S   GG YQNGR+ + DQP
Sbjct  344   RDVESEQQQF--SRRPYQNQRGGRGGGGRRVNTNGRGVRGSGRGGGPYQNGRNQFYDQP  400



>emb|CDP00272.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 208/305 (68%), Gaps = 26/305 (9%)
 Frame = +2

Query  95   SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  274
            +DGPVLS+INKR+RAL+KK NRI QME+SLS GK LNKEQEETLR+KP V+A IDELEK+
Sbjct  14   TDGPVLSLINKRLRALRKKHNRILQMEESLSLGKALNKEQEETLRSKPYVIAAIDELEKL  73

Query  275  RQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  454
            +QPL+ AV EEI+ ++Q H            E+         +K ES    V EDLLNLL
Sbjct  74   KQPLAVAVSEEINAAIQSHS-----------ENSPTTTDSTTDKAESGEHGVAEDLLNLL  122

Query  455  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllg-esdldllsllsgll  631
            YFGSMFDVK  QN FT  ML+R HER  CL+YDY+ DDD+ DLL  E DLDL+S+L GLL
Sbjct  123  YFGSMFDVKN-QNDFTATMLTRTHERGCCLTYDYVTDDDAADLLLGERDLDLISMLGGLL  181

Query  632  isRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA-  808
            ISR  NSSL HKNALQKCIEHAKLWL  S Q +EP SNVTY+GLR KL+KIMAS YFT  
Sbjct  182  ISRPVNSSLSHKNALQKCIEHAKLWLAKSDQLVEPASNVTYSGLREKLNKIMASDYFTTT  241

Query  809  ----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISSHGN  976
                APV + AAA +YG++Q P H S         + V VE   VQYQQK  + +     
Sbjct  242  PEMKAPVEVAAAAGSYGSFQVPAHGS--------VMPVQVEGSVVQYQQKVRDVVMLDWV  293

Query  977  ETHNY  991
            +T  +
Sbjct  294  DTLKF  298



>ref|XP_010551493.1| PREDICTED: uncharacterized protein LOC104822090 isoform X2 [Tarenaya 
hassleriana]
Length=432

 Score =   272 bits (696),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 158/269 (59%), Positives = 202/269 (75%), Gaps = 7/269 (3%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA   SD +DGPVLS+INKR+RAL+KK NRI QME+S+++GKT+NKEQEE LR+KP ++
Sbjct  1    MAAIASSDATDGPVLSLINKRLRALRKKYNRILQMEESIAQGKTINKEQEEVLRSKPGLV  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
            A IDELEK+R PLSAAV EEISL++Q HQVS+ +T A   +  +  +  V  +    GG 
Sbjct  61   ATIDELEKLRAPLSAAVSEEISLAIQCHQVSSDQTNALDNKERQSDDSAVPQESGGHGGA  120

Query  428  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             ++DL+NLLYFGS+FDVK+ Q+ F   ML+R HER  CL+YDY+  DD+ DLLGE DLDL
Sbjct  121  AVDDLMNLLYFGSLFDVKS-QSEFASTMLTRTHERGCCLTYDYV-TDDATDLLGERDLDL  178

Query  608  lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
            +S L  L+ISR  +SSL HKNAL++CIEHAKLWL NS QPIE ++NV+YAGLR KL KIM
Sbjct  179  ISRLGSLMISRPVDSSLSHKNALERCIEHAKLWLVNSDQPIEQNANVSYAGLREKLRKIM  238

Query  788  ASQYFTA-----APVGLQAAAMNYGAYQA  859
            A  Y +      APV + AAA +Y ++QA
Sbjct  239  AFDYLSTVPEMKAPVEVAAAAGHYVSFQA  267



>ref|XP_010551492.1| PREDICTED: uncharacterized protein LOC104822090 isoform X1 [Tarenaya 
hassleriana]
Length=452

 Score =   272 bits (696),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/269 (59%), Positives = 202/269 (75%), Gaps = 7/269 (3%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA   SD +DGPVLS+INKR+RAL+KK NRI QME+S+++GKT+NKEQEE LR+KP ++
Sbjct  1    MAAIASSDATDGPVLSLINKRLRALRKKYNRILQMEESIAQGKTINKEQEEVLRSKPGLV  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
            A IDELEK+R PLSAAV EEISL++Q HQVS+ +T A   +  +  +  V  +    GG 
Sbjct  61   ATIDELEKLRAPLSAAVSEEISLAIQCHQVSSDQTNALDNKERQSDDSAVPQESGGHGGA  120

Query  428  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             ++DL+NLLYFGS+FDVK+ Q+ F   ML+R HER  CL+YDY+  DD+ DLLGE DLDL
Sbjct  121  AVDDLMNLLYFGSLFDVKS-QSEFASTMLTRTHERGCCLTYDYV-TDDATDLLGERDLDL  178

Query  608  lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
            +S L  L+ISR  +SSL HKNAL++CIEHAKLWL NS QPIE ++NV+YAGLR KL KIM
Sbjct  179  ISRLGSLMISRPVDSSLSHKNALERCIEHAKLWLVNSDQPIEQNANVSYAGLREKLRKIM  238

Query  788  ASQYFTA-----APVGLQAAAMNYGAYQA  859
            A  Y +      APV + AAA +Y ++QA
Sbjct  239  AFDYLSTVPEMKAPVEVAAAAGHYVSFQA  267



>ref|XP_004135203.1| PREDICTED: uncharacterized protein LOC101205164 [Cucumis sativus]
 gb|KGN51871.1| hypothetical protein Csa_5G604160 [Cucumis sativus]
Length=470

 Score =   273 bits (697),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 207/276 (75%), Gaps = 15/276 (5%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA   SDV DGPVLS+INKR+RAL+KK NRI QME+++S GK +NKEQEE LR+KP+V 
Sbjct  1    MAAPSPSDVIDGPVLSLINKRLRALRKKHNRILQMEEAISLGKPINKEQEEVLRSKPSVT  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEES----GKEPEGDVENKGES  415
            A IDELEK+RQPL++AV EEI+L+VQR Q S    P  +++S      E   DV+++ E 
Sbjct  61   ALIDELEKLRQPLASAVSEEINLAVQRQQASVSSLPVSTDDSHTEVRDEDTSDVKDQSEH  120

Query  416  DGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllges  595
                V+EDLLNLLYFGS+FDVK+ Q+ FT  ML+R HERS C++YDY+  DD+ DLL E 
Sbjct  121  ---AVVEDLLNLLYFGSLFDVKS-QSDFTSTMLTRTHERSCCITYDYV-TDDATDLLVER  175

Query  596  dldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKL  775
            DLDL+S++SGLL+SR  +S+LPHKNAL++CIEHAKLWL  + QPIEP+++VTYA LR +L
Sbjct  176  DLDLISMMSGLLVSRPVDSNLPHKNALERCIEHAKLWLTKADQPIEPNTDVTYANLRERL  235

Query  776  DKIMASQYFTA-----APVGLQA-AAMNYGAYQAPV  865
             KIMAS YFT       PV + A AA NY  +Q PV
Sbjct  236  HKIMASDYFTTTPEIKGPVEVAAVAAGNYANFQVPV  271



>ref|XP_006357249.1| PREDICTED: uncharacterized protein LOC102594597 [Solanum tuberosum]
Length=428

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 205/448 (46%), Positives = 266/448 (59%), Gaps = 36/448 (8%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             M AT  S+ SDGPVL+VINKR+RAL+KK NRI QME+SL+ GKTLNKEQEET R+K +V+
Sbjct  1     MEATAASETSDGPVLNVINKRLRALRKKHNRILQMEESLANGKTLNKEQEETFRSKTSVV  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
               IDELEK+RQPL+AAV EEI+L+ Q H VSA ++          P+  +  KG++  G 
Sbjct  61    VAIDELEKLRQPLAAAVTEEINLATQHHLVSAADS----------PDEKLAGKGDNSCGE  110

Query  428   VIEDLLNLLYFGSMFDVKTL-QNHFTEVMLSRE-HERSSCLSYDYM---Kdddsidllge  592
             V EDLLN++YFGSMF      +N F   M  R  HER+ CL+YD M   +  D +D+L E
Sbjct  111   V-EDLLNIIYFGSMFAHANWGKNDFVSTMWKRAMHERACCLNYDCMPEDESTDVMDMLSE  169

Query  593   sdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLK  772
              DLDL+S+LS LLI R  NS+L HK+ALQ C EHAKLW+  S Q I P+S+ TYAGLR K
Sbjct  170   KDLDLISMLSELLICRPVNSTLSHKHALQACFEHAKLWITKSDQHIVPESDATYAGLRSK  229

Query  773   LDKIMASQYFTAAPV-GLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             L+KIM+S YFT  PV  ++     Y +YQ PV E+V PV+   QV+  VE    +YQ+KE
Sbjct  230   LNKIMSSLYFTTEPVFRVEQDVAEYESYQVPVEETVLPVNATGQVESPVE----RYQEKE  285

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQ  1129
              E ++S  +++     S    LHQ    EE+LS    E E V  E EGV+     +V  Q
Sbjct  286   GEHVNSQADKSREIHDSSATDLHQ----EENLSEQRAEPEEVGHEGEGVEDPKDANVDNQ  341

Query  1130  QNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRN-  1306
             Q++P                R G   G   G   RG G +Y +  + Y DQP NY PRN 
Sbjct  342   QSVP------RRSNQHFRGNRGGGRRGYNNGRGGRGRGRSYYDDHNLYYDQPGNYYPRNY  395

Query  1307  ----SHFrgrggrggHYNNHPPGAQVGN  1378
                           G+Y+++  G Q GN
Sbjct  396   PNYRGRGGRGSRGDGNYSHYASGDQAGN  423



>ref|XP_007044388.1| Glycine-rich protein, putative isoform 1 [Theobroma cacao]
 gb|EOY00220.1| Glycine-rich protein, putative isoform 1 [Theobroma cacao]
Length=453

 Score =   268 bits (686),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 205/407 (50%), Positives = 265/407 (65%), Gaps = 27/407 (7%)
 Frame = +2

Query  98    DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
             +GPVL++INKR+RAL+KK NRI QME+S+S+GK LNKEQEE LR+KPAV A IDELEK+R
Sbjct  20    EGPVLNLINKRLRALRKKYNRILQMEESVSQGKPLNKEQEEVLRSKPAVSALIDELEKLR  79

Query  278   QPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  457
             QPLS+AV EEISL++Q   +   ET + +++     E +V+ +  ++    +EDLLNLLY
Sbjct  80    QPLSSAVSEEISLALQCQTIFPDETASEAQQD----ETEVQEQQPNEPDHAVEDLLNLLY  135

Query  458   FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  637
             FGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLL E DLDL+S+LSGLL S
Sbjct  136   FGSIFDVKS-QNDFTSTMLTRTHERGCCLTYDYV-TDDATDLLSEKDLDLISMLSGLLTS  193

Query  638   RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAP-  814
             R A+SSL HKNAL +C+ HAKLWL NS QPIEP+++V+YAGLR +L+KIMA  YFT  P 
Sbjct  194   RPADSSLSHKNALHRCLHHAKLWLSNSDQPIEPNADVSYAGLRERLNKIMALDYFTTTPE  253

Query  815   -----VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISSHGNE  979
                       AA  Y  +Q PVH                  +G QYQQKEE++ +    E
Sbjct  254   MKAPVEVAAVAAGTYTTFQVPVH-----GVPISVPVQAEGSVG-QYQQKEEDTSNYQEAE  307

Query  980   THNYQSSHVDQLHQGEV-----GEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQQNIPr  1144
             T + Q S  ++L + E+       ED++ +  E   +Q +VE  Q D   + KEQQ +P 
Sbjct  308   TGDNQYSAAEELQKEELEIENHAPEDIT-VQDEQGTLQVDVEHNQRD--VEPKEQQYVP-  363

Query  1145  rsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQP  1285
             R  + N RGGRG  G R   +   GG  S   GGAYQNGRS Y DQP
Sbjct  364   RRPYQNQRGGRGTGGGRRGYSNGRGGRGSGRGGGAYQNGRSQYYDQP  410



>ref|XP_010272218.1| PREDICTED: uncharacterized protein LOC104608055 isoform X3 [Nelumbo 
nucifera]
Length=424

 Score =   267 bits (683),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 164/283 (58%), Positives = 205/283 (72%), Gaps = 19/283 (7%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA+  S+V+DGPVLS+INKR+RAL+KK NRI QME+ +++GK +NKEQEE LR+KP V 
Sbjct  1    MAASAASEVTDGPVLSLINKRLRALRKKYNRILQMEEGIAQGKPINKEQEEVLRSKPTVA  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETP------APSEESGKEPEGDVENKG  409
            A IDE EK+RQPL+AA++EE+ L+VQ HQVSA  TP          + GKE  G+ E KG
Sbjct  61   ALIDEFEKLRQPLTAALQEELKLTVQHHQVSA--TPHVVDDNVEDSKDGKEESGESE-KG  117

Query  410  ESDGG---VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsid  580
             SDG     ++EDLLNLLYF S+FDVK  Q+ FT  ML+R HER  CL+YDY+  DD+ D
Sbjct  118  RSDGDRDESILEDLLNLLYFASLFDVKP-QSDFTSTMLTRTHERGCCLTYDYV-TDDATD  175

Query  581  llgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAG  760
            LLGE DLD++S+L  LLISR  +S L HKNAL+ C++HAKLWL NS QPIEP + VTY G
Sbjct  176  LLGERDLDMISMLGSLLISRPVHSILSHKNALRSCVQHAKLWLSNSDQPIEPGAAVTYTG  235

Query  761  LRLKLDKIMASQYFTA-----APVGLQAAAMNYGAYQAPVHES  874
            LR +L++I+AS YFT      APV + AAA  Y   QAPV  S
Sbjct  236  LRERLNRILASDYFTTTPEMKAPVEVAAAAGKYAPCQAPVQNS  278



>ref|XP_006415997.1| hypothetical protein EUTSA_v10007745mg [Eutrema salsugineum]
 gb|ESQ34350.1| hypothetical protein EUTSA_v10007745mg [Eutrema salsugineum]
Length=417

 Score =   266 bits (681),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 221/321 (69%), Gaps = 33/321 (10%)
 Frame = +2

Query  98    DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
             +GPV+++INKR+RAL+KK NRI+QME+S+S+GKTLNKEQ+E LR+KPAV+  I+ELEK+R
Sbjct  13    EGPVMALINKRLRALRKKYNRITQMEESISQGKTLNKEQQEVLRSKPAVVVLIEELEKLR  72

Query  278   QPLSAAVEEEISL-SVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  454
              PLSAAV EEISL + Q H+ S+ +TPA         + ++  +  SDG   +EDL+NLL
Sbjct  73    APLSAAVSEEISLATTQHHRESSDQTPAC-------VQVNIPEESHSDGDAKLEDLVNLL  125

Query  455   YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  634
             YFGS+FDVK+ QN FT +M++R HER  CL+YDY+  DD+ +LL + DLDL+S L  ++I
Sbjct  126   YFGSLFDVKS-QNDFTSIMMTRMHERGCCLTYDYV-TDDAEELLSDRDLDLISNLWSMMI  183

Query  635   sRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA--  808
             SR  +SSL HKNAL++CIEHAKLWL NS QPIE + N++YA LR KL KIM S YFT   
Sbjct  184   SRPVDSSLSHKNALERCIEHAKLWLANSDQPIESNCNISYASLREKLKKIMGSDYFTTTP  243

Query  809   ---APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISSHGNE  979
                APV + AAA NY ++QA                  VE    QYQQKEEE+ ++   E
Sbjct  244   VMKAPVEVAAAAGNYASFQA---------------IGDVEASAGQYQQKEEEASNNKEQE  288

Query  980   T---HNYQSSHVDQLHQGEVG  1033
             +     +++   + + +GEVG
Sbjct  289   SVVNDQFENQKDESVTEGEVG  309



>gb|KDO82716.1| hypothetical protein CISIN_1g013233mg [Citrus sinensis]
Length=337

 Score =   264 bits (674),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 181/338 (54%), Positives = 232/338 (69%), Gaps = 20/338 (6%)
 Frame = +2

Query  65    SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  244
             +  A   SD+SDGPVLSVINKR+RAL+KK NRI QME+S+S+GKTLNKEQEE LR+KP V
Sbjct  5     TATAAPASDMSDGPVLSVINKRLRALRKKYNRIVQMEESVSQGKTLNKEQEEVLRSKPIV  64

Query  245   LAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
              A IDEL+K+R PL +A+ EE+SL  QR   SA  TP            D  +  + D  
Sbjct  65    TALIDELDKLRSPLCSALSEELSLH-QRQ--SAPPTPDNQPNHVANSTKDDNDDNDDDDS  121

Query  425   VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  604
               + DLLNLLYFGS+FDVK+ Q+ FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD
Sbjct  122   SSVSDLLNLLYFGSLFDVKS-QSDFTATMLTRTHERGCCLTYDYV-TDDATDLLGEKDLD  179

Query  605   llsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKI  784
             L+S+LSGLLISR  +SS  HK+AL +CIEHAKLWL NS QPI+P++NVTYAGLR +LDKI
Sbjct  180   LISMLSGLLISRPIDSSWSHKSALHRCIEHAKLWLANSDQPIDPNANVTYAGLRERLDKI  239

Query  785   MASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKE  949
             M+S YFT      APV + AAA +YG++Q PVH S         V V VE   VQYQ+K+
Sbjct  240   MSSDYFTTTPEMKAPVEMAAAA-SYGSFQVPVHGS---------VPVQVEGAAVQYQEKD  289

Query  950   EESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTE  1063
             E++++   +ET + Q +   +  Q      D++ +P+E
Sbjct  290   EDTVNFQEHETGDNQFTPAHEHQQVLPFSSDITLIPSE  327



>ref|XP_010272216.1| PREDICTED: uncharacterized protein LOC104608055 isoform X1 [Nelumbo 
nucifera]
Length=516

 Score =   268 bits (686),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 162/281 (58%), Positives = 205/281 (73%), Gaps = 15/281 (5%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA+  S+V+DGPVLS+INKR+RAL+KK NRI QME+ +++GK +NKEQEE LR+KP V 
Sbjct  1    MAASAASEVTDGPVLSLINKRLRALRKKYNRILQMEEGIAQGKPINKEQEEVLRSKPTVA  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSA----LETPAPSEESGKEPEGDVENKGES  415
            A IDE EK+RQPL+AA++EE+ L+VQ HQVSA    ++      + GKE  G+ E KG S
Sbjct  61   ALIDEFEKLRQPLTAALQEELKLTVQHHQVSATPHVVDDNVEDSKDGKEESGESE-KGRS  119

Query  416  DGG---VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidll  586
            DG     ++EDLLNLLYF S+FDVK  Q+ FT  ML+R HER  CL+YDY+  DD+ DLL
Sbjct  120  DGDRDESILEDLLNLLYFASLFDVKP-QSDFTSTMLTRTHERGCCLTYDYV-TDDATDLL  177

Query  587  gesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLR  766
            GE DLD++S+L  LLISR  +S L HKNAL+ C++HAKLWL NS QPIEP + VTY GLR
Sbjct  178  GERDLDMISMLGSLLISRPVHSILSHKNALRSCVQHAKLWLSNSDQPIEPGAAVTYTGLR  237

Query  767  LKLDKIMASQYFTA-----APVGLQAAAMNYGAYQAPVHES  874
             +L++I+AS YFT      APV + AAA  Y   QAPV  S
Sbjct  238  ERLNRILASDYFTTTPEMKAPVEVAAAAGKYAPCQAPVQNS  278



>gb|EYU28691.1| hypothetical protein MIMGU_mgv1a007116mg [Erythranthe guttata]
Length=355

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 230/318 (72%), Gaps = 14/318 (4%)
 Frame = +2

Query  92    VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEK  271
             +++GPVL++INKR+RAL+KK+NRISQME+SLS+GK LNKEQEETLR+K +VLAGIDELEK
Sbjct  14    ITEGPVLNLINKRLRALRKKMNRISQMEESLSQGKALNKEQEETLRSKSSVLAGIDELEK  73

Query  272   IRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENK--GESDGGVVIEDLL  445
             +RQPLS AV +EI L+++++   + ET    E S +E +G VE    GE+DG   + DLL
Sbjct  74    LRQPLSEAVNQEIQLALEKNTQRS-ET-LTGERSDEEEDGTVEPNAGGENDGVSALSDLL  131

Query  446   NLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl-lgesdldllslls  622
             +L+YFGS+FDV+ L +     +L+R HER+ CL+YDY+ DDD+    L E DLDL++++ 
Sbjct  132   SLVYFGSIFDVQALMSAHDN-LLTRTHERNCCLTYDYVTDDDAEGDPLREWDLDLIAMMG  190

Query  623   gllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYF  802
             GLLISR  NS L HK+ALQKC+EHAKLWL NS QPIEPDS++TYA LR KL++IMAS Y+
Sbjct  191   GLLISRPVNSCLSHKDALQKCVEHAKLWLANSEQPIEPDSDITYAWLREKLNRIMASDYY  250

Query  803   TA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISS  967
             T      APV + A   NY ++Q PVHE    V   V   V VED   +Y Q+EEES +S
Sbjct  251   TTIPEIRAPVEVAATGGNYTSFQLPVHEP---VLPQVVSTVSVEDSATEYDQEEEESENS  307

Query  968   HGNETHNYQSSHVDQLHQ  1021
               N+  N ++  +++L Q
Sbjct  308   DDNDIDNQEACPIEELKQ  325



>ref|XP_011034203.1| PREDICTED: uncharacterized protein LOC105132411 [Populus euphratica]
Length=437

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 229/378 (61%), Gaps = 54/378 (14%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAA   S++++GPVLS+I KR+R LKKK NRI QME+S+++GK +NKEQE+ LR+KP+V 
Sbjct  1     MAAVSTSEITEGPVLSLITKRLRGLKKKFNRIVQMEESIAQGKPINKEQEDFLRSKPSVS  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             A IDELEK+RQPLS AV EEI L+  R          P  +S   PE        S+G  
Sbjct  61    AAIDELEKLRQPLSVAVSEEIELAAHRLN--------PKSDSTVFPEA-------SNG--  103

Query  428   VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             V EDLL+L YFGS+FDV++ QN FT  ML+R HER  CL+YDY+ DD +  L       +
Sbjct  104   VAEDLLHLFYFGSLFDVRS-QNDFTATMLTRTHERGCCLTYDYVTDDATDLLSERDLDMI  162

Query  608   lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
               L  GLLISR  NSS  HKNALQ+C+EHA+LWL NS QPI+ + NV+YA LR KL+KIM
Sbjct  163   SILGGGLLISRPVNSSSSHKNALQRCMEHAELWLANSDQPIDSNVNVSYAELREKLNKIM  222

Query  788   ASQYFTA-----APVGLQAAAMNYGAYQAP--VHESvppvdvpvqvqvhvEDIGVQYQQK  946
             AS YFT      APV + AAA NY  +Q P  VH                ED   QYQ K
Sbjct  223   ASDYFTTTPEIKAPVEMAAAAGNYVPFQVPFSVH--------------VDEDSVAQYQPK  268

Query  947   EEESISSHGNETHNYQSSHVDQLHQGE-----------VGEEDLSALPTETEAVQAEVEG  1093
             E+E+  +  +ET + QSS  ++L + E            GE+D  +   E    Q EVE 
Sbjct  269   EQET-ENIQHETGDDQSSPAEELQKDEQETENPAVVLDQGEQDNPSKEVEVYYNQREVEH  327

Query  1094  VQGDHHK---DVKEQQNI  1138
             V+ DH++   + KEQQ I
Sbjct  328   VEVDHNQREAEPKEQQYI  345



>ref|XP_004238757.1| PREDICTED: uncharacterized protein LOC101253779 [Solanum lycopersicum]
Length=428

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 197/420 (47%), Positives = 254/420 (60%), Gaps = 33/420 (8%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             M AT  S+ SDGPVL+VINKR+RAL+KK NRI QME+SL+ GKTLNKEQEET R+KP+V+
Sbjct  1     MEATAASETSDGPVLNVINKRLRALRKKYNRILQMEESLANGKTLNKEQEETFRSKPSVV  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             A IDELEK+RQPL+AAV EEI+L+ Q H VSA ++P            D +  G+ D   
Sbjct  61    AAIDELEKLRQPLAAAVTEEINLATQHHLVSAADSP------------DEKLAGKGDNSC  108

Query  428   V-IEDLLNLLYFGSMFDVKTL-QNHFTEVMLSRE-HERSSCLSYDYM---Kdddsidllg  589
             V +EDLLN++YFGSMF      +N F   M  R  HER+ CL+YD M   +  D ID+L 
Sbjct  109   VEVEDLLNIIYFGSMFAHANWGKNDFVSTMWKRAMHERACCLNYDCMPEDESTDVIDMLS  168

Query  590   esdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRL  769
             E DLDL+S+LS LLI R  NS+L HK+ALQ CIEHAKLW+  S Q I P+S+ TYAGLR 
Sbjct  169   EKDLDLISMLSELLICRPVNSTLSHKHALQACIEHAKLWITKSDQLIVPESDATYAGLRS  228

Query  770   KLDKIMASQYFTAAPVG-LQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQK  946
             KL+KIM+S YFT  PV  ++     Y +YQ PV E+V PV+   QV+  VE    +Y +K
Sbjct  229   KLNKIMSSFYFTTEPVFRVEQTVAEYESYQVPVEETVLPVNATGQVESSVE----RYHEK  284

Query  947   EEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKE  1126
               E ++S  +     +SS +      ++ +E+LS      E V  E EGV+     +V  
Sbjct  285   GGEHVNSQAD-----KSSEIHDSSAKDINQENLSEQHAAPEEVGHEGEGVEDPKDANVDN  339

Query  1127  QQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRN  1306
             QQ+ P             G    G   G   G   RG G +Y +  + Y DQP NY PRN
Sbjct  340   QQSNP-----RRSHQHFRGNRGGGGRRGYNNGRGGRGRGRSYHDDHNPYYDQPGNYYPRN  394



>ref|XP_011011854.1| PREDICTED: uncharacterized protein LOC105116275 [Populus euphratica]
Length=425

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 206/420 (49%), Positives = 261/420 (62%), Gaps = 46/420 (11%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAAT  S+++DGP+LSVI KR+RALKKK NRI QME+S+++GK +NKEQE+ LR+KP+V 
Sbjct  1     MAATPTSEMTDGPILSVITKRLRALKKKHNRILQMEESIAQGKPINKEQEDFLRSKPSVS  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             A IDELEK+RQPLS AV EEI L+  R          P  +S   PE   E         
Sbjct  61    AAIDELEKLRQPLSIAVSEEIELAAHRLN--------PKSDSTVVPEASDE---------  103

Query  428   VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             ++EDLL+LLYFGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD+
Sbjct  104   MLEDLLHLLYFGSLFDVKS-QNDFTATMLTRTHERGCCLTYDYV-TDDATDLLGERDLDM  161

Query  608   lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
             +S+L GLLISR  N+SL HKNALQ+C+EHAKLWL NS QPI+  +NV+YA LR +L+KI 
Sbjct  162   ISMLGGLLISRPGNTSLSHKNALQRCMEHAKLWLANSDQPIDSTTNVSYAELRERLNKIK  221

Query  788   ASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEE  952
             AS YFT      APV + AAA NY  +Q P             V V V+D   QYQ KE+
Sbjct  222   ASDYFTTTPEMKAPVEVAAAAGNYVPFQVPF-----------SVPVQVDDSVAQYQPKEQ  270

Query  953   ESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVE------GVQGDHHK  1114
             E+  +  +ET + QSS  ++  +    +E  +  P E    QAE E      GV  +   
Sbjct  271   ET-ENFQHETGDNQSSPTEESQK----DEQETGNPAEVVPDQAEQEKPLTEVGVDHNQRG  325

Query  1115  DVKEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNY  1294
                EQQ + RR+Y N   G  GG G R   +   GG      GG YQNGR+ Y DQP N+
Sbjct  326   LEPEQQYVNRRNYQNQRGGRGGGNGSRRGYSNGRGGRSGSRGGGGYQNGRNQYYDQPGNF  385



>ref|XP_004489967.1| PREDICTED: keratin, type I cytoskeletal 10-like [Cicer arietinum]
Length=433

 Score =   263 bits (671),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 156/274 (57%), Positives = 202/274 (74%), Gaps = 18/274 (7%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA   S  +DGPV+S+INKR+RAL+KKLNRI+ ME+S S+GK LNKEQEE LR+K +VL
Sbjct  1    MAA---STTTDGPVMSLINKRLRALRKKLNRITAMEESQSQGKPLNKEQEEVLRSKSSVL  57

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
            A IDE EK+RQPLS+A+ EE+ L++Q  + +  E  AP  E          N+ ++  G 
Sbjct  58   ALIDEFEKLRQPLSSALTEELDLALQNTRETLPENSAPVSER--------LNESQNKNGD  109

Query  428  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
            V+ED++NLLYFGS+F+VK+ QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD 
Sbjct  110  VVEDVINLLYFGSLFEVKS-QNDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGEKDLDS  167

Query  608  lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
            +S L GLLISR A+SS  HKNAL++CIEHAKLW+  + QPI+P+ +VTYAGLR KL+KIM
Sbjct  168  ISALFGLLISRPADSSFSHKNALRRCIEHAKLWISRAEQPIDPNVDVTYAGLREKLNKIM  227

Query  788  ASQYFTAAP-----VGLQAAAMNYGAYQAPVHES  874
            +S+YFT  P     V + AAA NY ++Q PVH S
Sbjct  228  SSEYFTTTPEMKDTVEVAAAAGNYASFQVPVHGS  261



>gb|EYU28690.1| hypothetical protein MIMGU_mgv1a007116mg [Erythranthe guttata]
Length=418

 Score =   262 bits (669),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 205/269 (76%), Gaps = 13/269 (5%)
 Frame = +2

Query  92   VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEK  271
            +++GPVL++INKR+RAL+KK+NRISQME+SLS+GK LNKEQEETLR+K +VLAGIDELEK
Sbjct  14   ITEGPVLNLINKRLRALRKKMNRISQMEESLSQGKALNKEQEETLRSKSSVLAGIDELEK  73

Query  272  IRQPLSAAVEEEISLSVQRH-QVSALETPAPSEESGKEPEGDVENK--GESDGGVVIEDL  442
            +RQPLS AV +EI L+++++ Q S   T    E S +E +G VE    GE+DG   + DL
Sbjct  74   LRQPLSEAVNQEIQLALEKNTQRSETLT---GERSDEEEDGTVEPNAGGENDGVSALSDL  130

Query  443  LNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl-lgesdldllsll  619
            L+L+YFGS+FDV+ L +   + +L+R HER+ CL+YDY+ DDD+    L E DLDL++++
Sbjct  131  LSLVYFGSIFDVQALMSAH-DNLLTRTHERNCCLTYDYVTDDDAEGDPLREWDLDLIAMM  189

Query  620  sgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQY  799
             GLLISR  NS L HK+ALQKC+EHAKLWL NS QPIEPDS++TYA LR KL++IMAS Y
Sbjct  190  GGLLISRPVNSCLSHKDALQKCVEHAKLWLANSEQPIEPDSDITYAWLREKLNRIMASDY  249

Query  800  FTA-----APVGLQAAAMNYGAYQAPVHE  871
            +T      APV + A   NY ++Q PVHE
Sbjct  250  YTTIPEIRAPVEVAATGGNYTSFQLPVHE  278



>ref|XP_006378167.1| glycine-rich family protein [Populus trichocarpa]
 gb|ERP55964.1| glycine-rich family protein [Populus trichocarpa]
Length=273

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 157/270 (58%), Positives = 195/270 (72%), Gaps = 24/270 (9%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAAT  S+++DGPVLS+I KR+RALKKK NRI QME+S+++GK +NKEQE+ LR+KP+V 
Sbjct  1    MAATPTSEMADGPVLSLITKRLRALKKKHNRILQMEESIAQGKPINKEQEDFLRSKPSVS  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
            A IDELEK+RQPLS AV EEI L+  R          P  +S   PE   E         
Sbjct  61   AAIDELEKLRQPLSIAVSEEIELAAHRLN--------PKSDSTVVPEASDE---------  103

Query  428  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
            ++EDLL+LLYFGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD+
Sbjct  104  MLEDLLHLLYFGSLFDVKS-QNDFTATMLTRTHERGCCLTYDYV-TDDATDLLGERDLDM  161

Query  608  lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
            +S+L GLLISR  N+SL HKNALQ+C+EHAKLWL NS QPI+  +NV+YA LR +L+KIM
Sbjct  162  ISMLGGLLISRPGNTSLSHKNALQRCMEHAKLWLANSDQPIDSTANVSYAELRERLNKIM  221

Query  788  ASQYFTA-----APVGLQAAAMNYGAYQAP  862
            AS YFT      APV + AAA NY  +Q P
Sbjct  222  ASDYFTTTPEMKAPVEVAAAAGNYVPFQVP  251



>ref|XP_002520157.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42212.1| conserved hypothetical protein [Ricinus communis]
Length=440

 Score =   260 bits (664),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 198/274 (72%), Gaps = 18/274 (7%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAAT  S+ ++GPVL++INKR+RAL+KK NRI QME+S+S+GK +NKEQE+ LR+KP V 
Sbjct  1    MAATSSSEATEGPVLNLINKRLRALRKKYNRIIQMEESISQGKPINKEQEDVLRSKPYVT  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
            A I+ELEK++QPLS AV EEI L++QR Q  +  +   + E+  +  G         GG+
Sbjct  61   ASIEELEKLKQPLSVAVSEEIDLAIQRQQQQSSSSDRTTNEANGDSNG---------GGL  111

Query  428  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             IEDLLNLLYFGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD+
Sbjct  112  AIEDLLNLLYFGSLFDVKS-QNEFTATMLTRTHERGCCLTYDYV-TDDATDLLGERDLDM  169

Query  608  lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
            +S L  LLISR  +SSL HKNAL KCIEHAKLWL NS Q I+P +NV+Y+GLR +L+KIM
Sbjct  170  ISKLGALLISRPVDSSLSHKNALVKCIEHAKLWLSNSDQFIDPIANVSYSGLRERLNKIM  229

Query  788  ASQYFTAAP-------VGLQAAAMNYGAYQAPVH  868
            AS YF   P       V   AAA NY ++Q PVH
Sbjct  230  ASDYFITTPEMKAPVEVAAAAAAGNYASFQVPVH  263



>ref|XP_007044389.1| Glycine-rich protein, putative isoform 2 [Theobroma cacao]
 gb|EOY00221.1| Glycine-rich protein, putative isoform 2 [Theobroma cacao]
Length=325

 Score =   253 bits (646),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 195/263 (74%), Gaps = 12/263 (5%)
 Frame = +2

Query  98   DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
            +GPVL++INKR+RAL+KK NRI QME+S+S+GK LNKEQEE LR+KPAV A IDELEK+R
Sbjct  20   EGPVLNLINKRLRALRKKYNRILQMEESVSQGKPLNKEQEEVLRSKPAVSALIDELEKLR  79

Query  278  QPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  457
            QPLS+AV EEISL++Q   +   ET + +++     E +V+ +  ++    +EDLLNLLY
Sbjct  80   QPLSSAVSEEISLALQCQTIFPDETASEAQQD----ETEVQEQQPNEPDHAVEDLLNLLY  135

Query  458  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  637
            FGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLL E DLDL+S+LSGLL S
Sbjct  136  FGSIFDVKS-QNDFTSTMLTRTHERGCCLTYDYV-TDDATDLLSEKDLDLISMLSGLLTS  193

Query  638  RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAP-  814
            R A+SSL HKNAL +C+ HAKLWL NS QPIEP+++V+YAGLR +L+KIMA  YFT  P 
Sbjct  194  RPADSSLSHKNALHRCLHHAKLWLSNSDQPIEPNADVSYAGLRERLNKIMALDYFTTTPE  253

Query  815  -----VGLQAAAMNYGAYQAPVH  868
                      AA  Y  +Q PVH
Sbjct  254  MKAPVEVAAVAAGTYTTFQVPVH  276



>ref|XP_003613550.1| hypothetical protein MTR_5g037960 [Medicago truncatula]
 gb|AES96508.1| hypothetical protein MTR_5g037960 [Medicago truncatula]
Length=433

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 159/269 (59%), Positives = 201/269 (75%), Gaps = 17/269 (6%)
 Frame = +2

Query  86   SDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDEL  265
            S  +DGPVL++INKR+RAL+KKLNRI+ ME+SLS+GK+LN EQ+E LR+K +VL  IDEL
Sbjct  5    STTTDGPVLNLINKRLRALRKKLNRITSMEESLSQGKSLNSEQQEVLRSKSSVLVLIDEL  64

Query  266  EKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLL  445
            EK+RQPLS+A+ EE+ L+ Q     A ET   +E S   P G+      SD   V+ED+L
Sbjct  65   EKLRQPLSSALTEELELATQTKN-DARETETQAENSEPRPSGE-----NSD---VVEDIL  115

Query  446  NLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsg  625
            NLLYFGS+F+VKT QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L G
Sbjct  116  NLLYFGSLFEVKT-QNDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGEKDLDAISGLYG  173

Query  626  llisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFT  805
            LLISR A+SS  HKNAL++CIEHAKLW+  + QPI+P+ +VTYAGLR KL+KIM+S+YFT
Sbjct  174  LLISRPADSSFSHKNALRRCIEHAKLWVSKAQQPIDPNVDVTYAGLREKLNKIMSSEYFT  233

Query  806  A-----APVGLQAAAM-NYGAYQAPVHES  874
                  APV + AAA  NYG++Q PVH S
Sbjct  234  TTPEMKAPVEVAAAAAGNYGSFQVPVHGS  262



>ref|XP_003517917.1| PREDICTED: uncharacterized protein LOC100819759 [Glycine max]
Length=446

 Score =   256 bits (653),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 200/421 (48%), Positives = 260/421 (62%), Gaps = 33/421 (8%)
 Frame = +2

Query  68    MAAT----EVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTK  235
             MAAT    +V+  +DGPV+S+INKR+RAL+KKLNRI  ME+++++GK LNKEQEE LR+K
Sbjct  1     MAATASNNDVAAAADGPVMSLINKRLRALRKKLNRILAMEEAVTQGKPLNKEQEEVLRSK  60

Query  236   PAVLAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVE-NKGE  412
             P+VLA IDELEK+RQPL+ A+ EE+  +    Q S         E+  E  G VE N   
Sbjct  61    PSVLALIDELEKLRQPLATALSEELQNNGTSSQNSRETETETENETLAESSGSVEPNTNS  120

Query  413   SDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllge  592
             +   VV+EDLLNLLYFGS+FDVK+    F   ML+R HER  CL+YDY+  DD+ DLLGE
Sbjct  121   TTNDVVVEDLLNLLYFGSLFDVKS---DFASTMLTRTHERGCCLTYDYV-TDDATDLLGE  176

Query  593   sdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLK  772
              DLD +S L GLL+SR A+SS  HKNALQ+C+EHA+LWL  S QPIEPD++VTYA LR K
Sbjct  177   KDLDSISALRGLLVSRPADSSFSHKNALQRCLEHARLWLTKSEQPIEPDTDVTYAALREK  236

Query  773   LDKIMASQYFTAAP-------VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGV  931
             L+KIM+S+YF   P       V   AA  NY ++  PVH SV PV+V   V         
Sbjct  237   LNKIMSSEYFITTPEMKAPVEVAAAAAGGNYVSFHVPVHGSVVPVEVEQPV--------F  288

Query  932   QYQQKEEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPT---ETEAVQAEVEGVQG  1102
             Q Q+K+E + +  G+ +    S H  +L + EV  E+   + +   E    QA+VE  + 
Sbjct  289   QSQEKDEGTANFQGHGSEEDLSDHEGELQKDEVEAENAGEVVSAQHEQANQQADVEYNER  348

Query  1103  DHHKDVKEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQ  1282
             D   + K+QQ+ P       Y+  RGG G  G      G G   G  G YQNGR+ Y DQ
Sbjct  349   D--VEAKDQQSYP----RRGYQNHRGGRGGGGRRGYSNGRGGRSGGRGGYQNGRNQYYDQ  402

Query  1283  P  1285
             P
Sbjct  403   P  403



>ref|XP_007157411.1| hypothetical protein PHAVU_002G067800g [Phaseolus vulgaris]
 gb|ESW29405.1| hypothetical protein PHAVU_002G067800g [Phaseolus vulgaris]
Length=438

 Score =   255 bits (651),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 205/414 (50%), Positives = 266/414 (64%), Gaps = 26/414 (6%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MA     DV+DGPV+++INKRIRA +KK+NRI  ME+SLS+GKTLNKEQEE LRTKP++L
Sbjct  1     MATPASPDVADGPVMNLINKRIRAYRKKINRIQAMEESLSQGKTLNKEQEEFLRTKPSIL  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             A IDE EK+RQPL++A+ EE+  +         ETP  +E SG   +   ++   S+  V
Sbjct  61    ALIDEFEKLRQPLASALTEELQGAAP--NARGAETPTLAESSGSFEQPPPQH---SEDDV  115

Query  428   VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             V+EDLLNLLYFGS+FDVK+    F   ML+R HER  CL+YDY+  DD+ DLLGE DLD 
Sbjct  116   VVEDLLNLLYFGSLFDVKS---DFASTMLTRTHERGCCLTYDYV-TDDATDLLGEKDLDS  171

Query  608   lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
             +S L GLL+SR A+SS  HKNALQ+C+EHAKLWL  S  PI PD++VTYAGLR KLDKIM
Sbjct  172   ISALRGLLVSRPADSSFSHKNALQRCVEHAKLWLAKSEHPIGPDADVTYAGLREKLDKIM  231

Query  788   ASQYFTAAP-------VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQK  946
             +S+YFT  P       V   AA  NY ++   VH S         V V VE    Q Q+K
Sbjct  232   SSEYFTTTPEMKAPVEVAAAAAGGNYVSFHVSVHGS--------VVPVEVEQPIYQSQEK  283

Query  947   EEESISSHGNETHNYQSSHVDQLHQGEVGEEDLS-ALPTETEAVQAEVEGVQGDHHKDVK  1123
             +E + +  G+ + + Q+    +L + EV  E+ +  +  +      + +  Q +   + K
Sbjct  284   DEGTTNFQGHGSEDDQTDPEGELQKDEVEAENANEVVSVQHGQTNPQADAEQNERDFEGK  343

Query  1124  EQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQP  1285
             EQQ+ P R  + N+RGGRGG GRRGYSNGRGG       GG YQNGR+ Y DQP
Sbjct  344   EQQSYP-RRGYQNHRGGRGGGGRRGYSNGRGGRSGGGRGGGGYQNGRNPYYDQP  396



>gb|AGV54212.1| hypothetical protein [Phaseolus vulgaris]
Length=438

 Score =   254 bits (648),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 202/414 (49%), Positives = 263/414 (64%), Gaps = 26/414 (6%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MA     DV+DGPV+++INKRIRA +KK+NRI  ME+SLS+GKTLNKEQEE LRTKP++L
Sbjct  1     MATPASPDVADGPVMNLINKRIRAYRKKINRIQAMEESLSQGKTLNKEQEEFLRTKPSIL  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             A IDE EK+RQPL++A+ EE+  +         ETP  +E SG   +   ++   S+  V
Sbjct  61    ALIDEFEKLRQPLASALTEELQGAAP--NARGAETPTLAESSGSFEQPPPQH---SEDDV  115

Query  428   VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
             V+EDLLNLLYFGS+FDVK+    F   ML+R HER  CL+YDY+  DD+ DLL E DLD 
Sbjct  116   VVEDLLNLLYFGSLFDVKS---DFASTMLTRTHERGCCLTYDYV-TDDATDLLSEKDLDS  171

Query  608   lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
             +S L GL +S  A+SS  HKNAL +C+EHAKLWL  S  PI PD++VTYAGLR KLDKIM
Sbjct  172   ISALRGLFVSWPADSSFSHKNALARCVEHAKLWLAKSEHPIGPDADVTYAGLREKLDKIM  231

Query  788   ASQYFTAAP-------VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQK  946
             +S+YFT  P       V   AA  NY ++  PVH S         V V VE    Q Q+K
Sbjct  232   SSEYFTTTPEMKAPVEVAAAAAGGNYVSFHVPVHGS--------VVPVEVEQPIYQSQEK  283

Query  947   EEESISSHGNETHNYQSSHVDQLHQGEVGEEDLS-ALPTETEAVQAEVEGVQGDHHKDVK  1123
             +E + +  G+ + + Q+    +L + EV  E+ +  +  +      + +  Q +   + K
Sbjct  284   DEGTTNFQGHGSEDDQTDPEGELQKDEVEAENANEVVSVQHGQTNPQADAEQNERDFEGK  343

Query  1124  EQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQP  1285
             EQQ+ P R  + N+RGGRGG GRRGYSNGRGG       GG YQNGR+ Y DQP
Sbjct  344   EQQSYP-RRGYQNHRGGRGGGGRRGYSNGRGGRSGGGRGGGGYQNGRNPYYDQP  396



>ref|XP_009115436.1| PREDICTED: uncharacterized protein LOC103840676 [Brassica rapa]
 emb|CDY16217.1| BnaA09g29510D [Brassica napus]
Length=407

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 186/266 (70%), Gaps = 24/266 (9%)
 Frame = +2

Query  86   SDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDEL  265
            SD S+GPV+ +INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQ+E LR+KP+VL  I+EL
Sbjct  15   SDASEGPVMGLINKRLRALRKKLNRITQMEESISQGKTLNKEQQEVLRSKPSVLILIEEL  74

Query  266  EKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLL  445
            +K+R PLSAAV EEI+L+   H   A    AP EE  K                 +EDL+
Sbjct  75   DKLRAPLSAAVSEEITLATTHHHDQAHVADAPEEEEAK----------------TLEDLV  118

Query  446  NLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsg  625
            NLLYFGS+FDVK+ QN    +ML+R HER  CL YD +  D+S DLL + DLDL+S L  
Sbjct  119  NLLYFGSLFDVKS-QNELASIMLTRTHERGCCLVYDTV-TDESTDLLCDKDLDLISELWT  176

Query  626  llisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFT  805
            +++SR A+S L HKNAL++C+EHAKLWL NS QPI  + NV+YAGLR KL KIM S YFT
Sbjct  177  MMVSRPADSFLSHKNALERCVEHAKLWLANSDQPIASNCNVSYAGLREKLKKIMGSNYFT  236

Query  806  -----AAPVGLQAAAM-NYGAYQAPV  865
                  APV   AAA  NYG+YQ P 
Sbjct  237  ITPEMVAPVEAAAAAAGNYGSYQVPA  262



>ref|XP_003519125.1| PREDICTED: uncharacterized protein LOC100816406 [Glycine max]
Length=445

 Score =   248 bits (634),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 204/423 (48%), Positives = 260/423 (61%), Gaps = 38/423 (9%)
 Frame = +2

Query  68    MAAT----EVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTK  235
             MAAT    +V+  +DGPV+S+INKR+RAL+KKLNRI  ME++++ GK LNKEQEE LR+K
Sbjct  1     MAATASNNDVAAANDGPVMSLINKRLRALRKKLNRILAMEEAVTLGKPLNKEQEEVLRSK  60

Query  236   PAVLAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGES  415
             P+VLA IDEL+K+RQPL+ A+ EE+ ++    Q    ET   + E+  E  G  E    S
Sbjct  61    PSVLALIDELDKLRQPLATALSEELQINGTSSQNPRHETETEN-ETLAESSGSTEPNSNS  119

Query  416   DGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllges  595
                VV+EDLLNLLYFGS+FDVK+    F   ML+R HER  CL+YDY+  DD+ DLLGE 
Sbjct  120   RNDVVVEDLLNLLYFGSLFDVKS---DFASTMLTRTHERGCCLTYDYV-TDDATDLLGEK  175

Query  596   dldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKL  775
             DLD +S L GLL+SR A+SS  HKNAL +C+EHAKLWL  S QPI PD++VTYA LR KL
Sbjct  176   DLDSISALRGLLVSRPADSSFSHKNALHRCVEHAKLWLAKSEQPIGPDADVTYAALREKL  235

Query  776   DKIMASQYFTAAP-------VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQ  934
             +KIM+S+YFT  P       V   AA  NY ++  PVH SV PV+V   V         Q
Sbjct  236   NKIMSSEYFTTTPEMKAPVEVAAAAAGGNYVSFHVPVHGSVVPVEVEQPV--------FQ  287

Query  935   YQQKEE-ESISSHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGD--  1105
              Q+K+E  +I  HG+E     S    +L + EV  E  +A   E  +VQ E    Q D  
Sbjct  288   SQEKDEGTAIQGHGSEED--PSDPEGELLKDEVEAEAENA--GEVVSVQHEQTNQQVDLE  343

Query  1106  -HHKDV--KEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYS  1276
              + +DV  K+QQ+ P       Y+  RGG G  G      G G   G  G YQNGR+ Y 
Sbjct  344   YNERDVEAKDQQSYP----RRGYQNHRGGRGGGGRRGYSNGRGGRSGGRGGYQNGRNQYY  399

Query  1277  DQP  1285
             DQP
Sbjct  400   DQP  402



>ref|XP_004297812.1| PREDICTED: uncharacterized protein LOC101315141 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=439

 Score =   248 bits (633),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 206/441 (47%), Positives = 256/441 (58%), Gaps = 30/441 (7%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MA T  S+VSDGPVLS+INKRIR L+KK NRISQME+SL++GKTLN EQ E LRTK A++
Sbjct  1     MATTASSEVSDGPVLSLINKRIRGLRKKQNRISQMEESLAQGKTLNNEQLEVLRTKSAIV  60

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSAL---------ETPAPSEESGKEPEGDVE  400
             A IDELEK+RQPLS AV EEISL+VQ     A          ETP  + +   E   DV+
Sbjct  61    ASIDELEKLRQPLSVAVAEEISLAVQVTAPPAAAATEPEEHHETPPNAVQQSGESAADVD  120

Query  401   NKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsid  580
              +      V  E+LLNLLYFGS+FDVKT Q+ FT +M +R HER  CL+      DD  D
Sbjct  121   EQNHHQAAV--EELLNLLYFGSLFDVKT-QSDFTSIMFTRSHERGCCLT-YDTVTDDDTD  176

Query  581   llgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAG  760
             +L E DLDLLS LSGLLISR   S L HKNALQ+CIEHAKLWL NS QPIEP+S+VTY  
Sbjct  177   MLAEKDLDLLSSLSGLLISRPVASGLSHKNALQRCIEHAKLWLANSDQPIEPNSSVTYVS  236

Query  761   LRLKLDKIMASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQ  940
             LR +L KIMAS YFT  P       M      A              V V    +  Q Q
Sbjct  237   LRERLSKIMASDYFTITP------EMKAPEAMAAAAGGNFAPFQVRGVDVDSSFVQFQ-Q  289

Query  941   QKEEESISSHGNETHNYQSSHVDQLHQGEVGEEDLS-ALPTETEAVQAEVEGVQGDHHKD  1117
             QK EE  +  G+++ + QS  V+++ + E   E+ +  +  + E ++ E E    +  +D
Sbjct  290   QKGEEMPNLEGHDSGDNQSGPVEEVQKDEFETENFAEVVLVQHEQIKPETEVEHNE--RD  347

Query  1118  VK-EQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNY  1294
             V+ EQ N P           + G    G      G G     GG+YQNG++ + DQP NY
Sbjct  348   VEFEQHNGP-----RRQYQNQRGGRGGGRRGYSNGRGGRGRGGGSYQNGQNQFYDQPGNY  402

Query  1295  VPRN-SHFrgrggrggHYNNH  1354
               RN +  RG  G G  YNNH
Sbjct  403   YSRNYNRARGGRGGGPSYNNH  423



>ref|XP_004297813.1| PREDICTED: uncharacterized protein LOC101315141 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=422

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 156/258 (60%), Positives = 181/258 (70%), Gaps = 13/258 (5%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MA T  S+VSDGPVLS+INKRIR L+KK NRISQME+SL++GKTLN EQ E LRTK A++
Sbjct  1    MATTASSEVSDGPVLSLINKRIRGLRKKQNRISQMEESLAQGKTLNNEQLEVLRTKSAIV  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSAL---------ETPAPSEESGKEPEGDVE  400
            A IDELEK+RQPLS AV EEISL+VQ     A          ETP  + +   E   DV+
Sbjct  61   ASIDELEKLRQPLSVAVAEEISLAVQVTAPPAAAATEPEEHHETPPNAVQQSGESAADVD  120

Query  401  NKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsid  580
             +      V  E+LLNLLYFGS+FDVKT Q+ FT +M +R HER  CL+      DD  D
Sbjct  121  EQNHHQAAV--EELLNLLYFGSLFDVKT-QSDFTSIMFTRSHERGCCLT-YDTVTDDDTD  176

Query  581  llgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAG  760
            +L E DLDLLS LSGLLISR   S L HKNALQ+CIEHAKLWL NS QPIEP+S+VTY  
Sbjct  177  MLAEKDLDLLSSLSGLLISRPVASGLSHKNALQRCIEHAKLWLANSDQPIEPNSSVTYVS  236

Query  761  LRLKLDKIMASQYFTAAP  814
            LR +L KIMAS YFT  P
Sbjct  237  LRERLSKIMASDYFTITP  254



>ref|XP_010683287.1| PREDICTED: uncharacterized protein LOC104897994 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=451

 Score =   247 bits (631),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 249/371 (67%), Gaps = 24/371 (6%)
 Frame = +2

Query  68    MAATEVSD---VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKP  238
             MAAT  S     ++GPVLSVI+KR+RAL+KK NRI+QME+SL++GKTLNKEQ++ LR+KP
Sbjct  1     MAATSTSSDPATTEGPVLSVISKRLRALRKKHNRITQMEESLAQGKTLNKEQQDVLRSKP  60

Query  239   AVLAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESD  418
             +VL  IDELEK+R PLS+AV+EEISL++     ++ E    S E+ ++ +   E + +  
Sbjct  61    SVLTLIDELEKLRAPLSSAVDEEISLAISSK--TSPENHQSSTENHRDNDDVDEVEVDRI  118

Query  419   GGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesd  598
              GVV +DLL L+YFGS+FDVK  Q+ FT +ML+R HER  CL+YDY+  DD+ DLL E D
Sbjct  119   EGVV-KDLLYLMYFGSLFDVKP-QSEFTSLMLTRTHERGCCLTYDYV-TDDATDLLAERD  175

Query  599   ldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLD  778
             LDL+S +  L+ISR  NS+L H+NAL+KCI HAKLWLQ+S + ++  S VTYAGLR KL+
Sbjct  176   LDLISAVQALMISRPVNSALSHQNALEKCIHHAKLWLQSSDETLDSQSVVTYAGLREKLN  235

Query  779   KIMASQYFTAAP-------VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQY  937
             KIMAS YFTA P       V   AA  N+G++Q PV ES+ PV+VPVQ++   E    QY
Sbjct  236   KIMASDYFTATPQMKGPGEVAAAAAVGNFGSFQVPVQESMVPVEVPVQIEGSAE----QY  291

Query  938   QQKEEESISSHGNETHNYQSSHVDQLHQGEVGEED---LSALPTETEAVQAEVEGVQGDH  1108
                EE   +    ET  +Q+ + ++  + ++  E+   + +  TE +  QAE E   G  
Sbjct  292   ADTEENLANYEEYETGEHQTGNGEEFQKDDLEAENPPEVVSAQTEQDQFQAEEEF--GYR  349

Query  1109  HKDVKEQQNIP  1141
             + D KE Q IP
Sbjct  350   NADYKEHQYIP  360



>ref|XP_010683286.1| PREDICTED: uncharacterized protein LOC104897994 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   241 bits (614),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 203/279 (73%), Gaps = 15/279 (5%)
 Frame = +2

Query  68   MAATEVSD---VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKP  238
            MAAT  S     ++GPVLSVI+KR+RAL+KK NRI+QME+SL++GKTLNKEQ++ LR+KP
Sbjct  1    MAATSTSSDPATTEGPVLSVISKRLRALRKKHNRITQMEESLAQGKTLNKEQQDVLRSKP  60

Query  239  AVLAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESD  418
            +VL  IDELEK+R PLS+AV+EEISL++     ++ E    S E+ ++ +   E + +  
Sbjct  61   SVLTLIDELEKLRAPLSSAVDEEISLAISSK--TSPENHQSSTENHRDNDDVDEVEVDRI  118

Query  419  GGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesd  598
             GVV +DLL L+YFGS+FDVK  Q+ FT +ML+R HER  CL+YDY+  DD+ DLL E D
Sbjct  119  EGVV-KDLLYLMYFGSLFDVKP-QSEFTSLMLTRTHERGCCLTYDYV-TDDATDLLAERD  175

Query  599  ldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLD  778
            LDL+S +  L+ISR  NS+L H+NAL+KCI HAKLWLQ+S + ++  S VTYAGLR KL+
Sbjct  176  LDLISAVQALMISRPVNSALSHQNALEKCIHHAKLWLQSSDETLDSQSVVTYAGLREKLN  235

Query  779  KIMASQYFTAAP-------VGLQAAAMNYGAYQAPVHES  874
            KIMAS YFTA P       V   AA  N+G++Q PV ES
Sbjct  236  KIMASDYFTATPQMKGPGEVAAAAAVGNFGSFQVPVQES  274



>emb|CDY52255.1| BnaC08g20270D [Brassica napus]
Length=411

 Score =   237 bits (604),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 184/266 (69%), Gaps = 14/266 (5%)
 Frame = +2

Query  77   TEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGI  256
            T  SD  +GPV+++INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQ+E LR+KP+VL  I
Sbjct  5    TATSDAGEGPVMALINKRLRALRKKLNRIAQMEESISQGKTLNKEQQEVLRSKPSVLVLI  64

Query  257  DELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIE  436
            +EL+K+R PLS AV EEI+L+   H        APS +         E K +      +E
Sbjct  65   EELDKLRNPLSNAVSEEIALATTHHN-------APSSDQNTTVAVAPEEKEKEKEVEKLE  117

Query  437  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  616
            DL+NLLYFGS+FDVK+ QN    +M++R HER  CL YD + D+ + DLL + DLDL+S 
Sbjct  118  DLVNLLYFGSLFDVKS-QNELASIMMTRTHERGCCLVYDTVTDESTADLLCDKDLDLISR  176

Query  617  lsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQ  796
            L  +++SR A+SSL HKNAL++C+EHAKLWL NS QPI  +  V+YA LR K+ KIM S 
Sbjct  177  LWSMMVSRPADSSLSHKNALERCVEHAKLWLANSDQPIASNCEVSYATLREKVKKIMGSN  236

Query  797  YFT------AAPVGLQAAAMNYGAYQ  856
            YFT       APV   A A +YG++Q
Sbjct  237  YFTITPEMVVAPVEATAEAGSYGSFQ  262



>emb|CAN72059.1| hypothetical protein VITISV_039073 [Vitis vinifera]
Length=415

 Score =   236 bits (601),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 157/251 (63%), Positives = 194/251 (77%), Gaps = 7/251 (3%)
 Frame = +2

Query  65   SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  244
            +MAA   SDV+DGPVLS+INKR+R L+KK NRI+QME+++++GK +NKEQE+ LR+KPAV
Sbjct  92   TMAA---SDVTDGPVLSLINKRLRGLRKKYNRITQMEEAIAQGKPINKEQEDVLRSKPAV  148

Query  245  LAGIDELEKIRQPLSAAVEEEISLSVQR-HQVSALETPAPSEESGKEPEGDVENKGESDG  421
               IDELE++RQPLSAAVEEE+SL++Q+ H +     P PS    K+   D E K ESD 
Sbjct  149  TVLIDELERLRQPLSAAVEEELSLALQQAHHLPPSPPPQPSSIINKDGADDGEEKPESD-  207

Query  422  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  601
             + +E+LLNLLYFG +FDVK  Q  FT  ML+R HER  CL+YDY+  DD+ DLLGE DL
Sbjct  208  HLNVENLLNLLYFGYLFDVKP-QTDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGERDL  265

Query  602  dllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDK  781
            DL+S LSGLLISR  +SSL HKNALQ+CIEHA+LWL NS +PIEPD+ VTY GLR KL+K
Sbjct  266  DLISQLSGLLISRPVDSSLSHKNALQRCIEHARLWLANSDRPIEPDATVTYXGLREKLNK  325

Query  782  IMASQYFTAAP  814
            IMAS YFT  P
Sbjct  326  IMASDYFTTTP  336



>gb|EPS60452.1| hypothetical protein M569_14351 [Genlisea aurea]
Length=225

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 174/230 (76%), Gaps = 9/230 (4%)
 Frame = +2

Query  68   MAATEVSDVS-DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  244
            MAAT  S+V+ +GPVL +INKR+RALKKKLNRI  ME+S+S+GKTLNKEQEETLR+K +V
Sbjct  1    MAATLGSEVAAEGPVLGLINKRLRALKKKLNRIMLMEESVSQGKTLNKEQEETLRSKASV  60

Query  245  LAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
            LAGIDELEK+RQPLS AV++EI L+V+++Q S   T      SG + EG V  + E DG 
Sbjct  61   LAGIDELEKLRQPLSQAVDQEIQLAVEKNQKSDALT------SGVQSEGAVHAEAEGDGT  114

Query  425  VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllges-dl  601
              + DLL LLYFGS+FDVKTL     + ML+R HER+ CL+YDY+ DDD+     +  DL
Sbjct  115  PAVSDLLALLYFGSIFDVKTLFGA-PDNMLARTHERNCCLTYDYVTDDDTAGDPLKEHDL  173

Query  602  dllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVT  751
            DL+S+L  LL+SR  NSS  HKNALQKC+EHAKLWL  S QPIEP+SNVT
Sbjct  174  DLISMLGSLLVSRPMNSSSSHKNALQKCMEHAKLWLSGSEQPIEPNSNVT  223



>emb|CDY14707.1| BnaC05g19640D [Brassica napus]
Length=417

 Score =   233 bits (595),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 183/260 (70%), Gaps = 17/260 (7%)
 Frame = +2

Query  98   DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
            +GPV+ +INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQ+E LR+KP+VL  I+EL+K+R
Sbjct  19   EGPVMGLINKRLRALRKKLNRITQMEESISQGKTLNKEQQEVLRSKPSVLVLIEELDKLR  78

Query  278  QPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  457
             PLSAAV EEI+L+   H     + P    E    PE +   K        +EDL+NLLY
Sbjct  79   APLSAAVSEEITLATTHHLHHHNQAPPDQNEVADAPEEEEAKK--------LEDLVNLLY  130

Query  458  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  637
            FGS+FDVK+ QN    +ML+R HER  CL YD +  D+S DLL + DLDL+S L  +++S
Sbjct  131  FGSLFDVKS-QNELASIMLTRTHERGCCLVYDTV-TDESTDLLCDKDLDLISELWTMMVS  188

Query  638  RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFT----  805
            R A+S L HKNAL++C+EHAKLWL NS QPI  + NV+YAGLR KL KIM S YFT    
Sbjct  189  RPADSFLSHKNALERCVEHAKLWLANSNQPIASNCNVSYAGLREKLKKIMGSNYFTITPE  248

Query  806  -AAPVGLQAAAM--NYGAYQ  856
              APV   +AA   NYGA+Q
Sbjct  249  MVAPVEAASAAAAGNYGAFQ  268



>emb|CDY46422.1| BnaA08g20080D [Brassica napus]
Length=404

 Score =   233 bits (593),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 181/246 (74%), Gaps = 17/246 (7%)
 Frame = +2

Query  77   TEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGI  256
            T  SD  +GPV+++INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQ+E LR+KP+V+  I
Sbjct  5    TATSDAGEGPVMALINKRLRALRKKLNRITQMEESISQGKTLNKEQQEVLRSKPSVVVLI  64

Query  257  DELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIE  436
            +EL+K+R PLSAAV EEI+L+   H  S+ +T A + E  KE +              +E
Sbjct  65   EELDKLRAPLSAAVSEEIALAT--HHTSSDQTTAVAPEEEKEVQK-------------LE  109

Query  437  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  616
            DL+NLLYFGS+F+VK+ Q+    +M++R HER  CL YD +  D+S DLL + DLDL+S 
Sbjct  110  DLVNLLYFGSLFEVKS-QSELASIMMTRTHERGCCLVYDTV-TDESTDLLCDKDLDLISR  167

Query  617  lsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQ  796
            L G+++SR A+SSL HKNAL++C+EHAKLWL NS QPIE + +V+YA LR K+ KIM S 
Sbjct  168  LWGMMVSRPADSSLSHKNALERCVEHAKLWLANSDQPIESNCDVSYAVLREKVKKIMGSN  227

Query  797  YFTAAP  814
            YFT  P
Sbjct  228  YFTITP  233



>ref|XP_010043853.1| PREDICTED: uncharacterized protein LOC104432951 [Eucalyptus grandis]
 gb|KCW85854.1| hypothetical protein EUGRSUZ_B02587 [Eucalyptus grandis]
Length=442

 Score =   233 bits (595),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 191/407 (47%), Positives = 251/407 (62%), Gaps = 22/407 (5%)
 Frame = +2

Query  86    SDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDEL  265
             S+ +DGPV+S+INKR+RAL+KKLNRI QME+S+++GK +NKEQE+ LR+KP+VLA IDEL
Sbjct  8     SEATDGPVVSLINKRLRALRKKLNRIHQMEESMAQGKPINKEQEDVLRSKPSVLASIDEL  67

Query  266   EKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLL  445
             EK+R  LS AV+EE+SL+ +R         A      +  + + +  G+  G  V++D+L
Sbjct  68    EKLRPQLSFAVQEELSLAARRLPRDDDAAAAADAAEKQPQQQEEQEAGDG-GDAVVKDVL  126

Query  446   NLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsg  625
              LLYFGSMF V + Q+ +T  ML+R HER  CL+YDY+  D++ DLL E DLDL++ LS 
Sbjct  127   KLLYFGSMFAVSS-QSDYTSTMLTRTHERGCCLTYDYV-TDEATDLLKERDLDLIATLSS  184

Query  626   llisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFT  805
             LLISR A+SSL HKNALQKC+ HA  W+ NS +PIEPDS+VTYA LR +L+KIMAS YFT
Sbjct  185   LLISRPADSSLSHKNALQKCLHHATQWIANSDEPIEPDSSVTYASLRERLNKIMASDYFT  244

Query  806   A-----APVGLQAAAM--NYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESIS  964
                   APV + AAA   NY  +Q            PV V V VE    QY+QKEE    
Sbjct  245   TTPEMKAPVDMAAAAASGNYVPFQV-----------PVTVPVQVESEEPQYEQKEEAGTD  293

Query  965   SHGNETHNYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQQNIPr  1144
               G+E  N  ++  D      V +        + E V ++VE +     ++ K+ Q IPR
Sbjct  294   FQGHEVDNESNAVDDVHKDDVVADNPSEFASAQQENVNSQVEEL-NQREREQKDHQYIPR  352

Query  1145  rsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQP  1285
             R+Y N   G  GG G R       GG      GG YQNGR HY +QP
Sbjct  353   RNYQNQRGGRGGGNGGRRGYPNGRGGRSGGRGGGPYQNGRGHYYEQP  399



>ref|XP_009110060.1| PREDICTED: uncharacterized protein LOC103835629 [Brassica rapa]
Length=407

 Score =   230 bits (587),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 180/246 (73%), Gaps = 17/246 (7%)
 Frame = +2

Query  77   TEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGI  256
            T  SD  +GPV+++INKR+RAL+KKLNRI+QME+S+S+GKTLN EQ+E LR+KP+V+  I
Sbjct  5    TATSDAGEGPVMALINKRLRALRKKLNRITQMEESISQGKTLNTEQQEVLRSKPSVVVLI  64

Query  257  DELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIE  436
            +EL+K+R PLSAAV EEI+L+   H  S+ +T A + E  KE +              +E
Sbjct  65   EELDKLRAPLSAAVSEEIALAT--HHTSSDQTTAVAPEEEKEVQK-------------LE  109

Query  437  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  616
            DL+NLLYFGS+F+VK+ Q+    +M++R HER  CL YD +  D+S DLL + DLDL+S 
Sbjct  110  DLVNLLYFGSLFEVKS-QSELASIMMTRTHERGCCLVYDTV-TDESTDLLCDKDLDLISR  167

Query  617  lsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQ  796
            L G+++SR A+SSL HKNAL++C+EHAKLWL NS QPIE + +V+YA LR K+ KIM S 
Sbjct  168  LWGMMVSRPADSSLSHKNALERCVEHAKLWLANSDQPIESNCDVSYAVLREKVKKIMGSN  227

Query  797  YFTAAP  814
            YFT  P
Sbjct  228  YFTITP  233



>emb|CBI32031.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   230 bits (586),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 216/450 (48%), Positives = 263/450 (58%), Gaps = 74/450 (16%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             MAA   SDV+DGPVLS+INKR+R L+KK NRI+QME+++++GK +NKEQE+ LR+KPAV 
Sbjct  1     MAA---SDVTDGPVLSLINKRLRGLRKKYNRITQMEEAIAQGKPINKEQEDVLRSKPAVT  57

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
              G D                                            D E K ESD  +
Sbjct  58    DGAD--------------------------------------------DGEEKPESDH-L  72

Query  428   VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
              +E+LLNLLYFG +FDVK  Q  FT  ML+R HER  CL+YDY+  DD+ DLLGE DLDL
Sbjct  73    NVENLLNLLYFGYLFDVKP-QTDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGERDLDL  130

Query  608   lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
             +S LSGLLISR  +SSL HKNALQ+CIEHA+LWL NS +PIEPD+ VTYAGLR KL+KIM
Sbjct  131   ISQLSGLLISRPVDSSLSHKNALQRCIEHARLWLANSDRPIEPDATVTYAGLREKLNKIM  190

Query  788   ASQYFTAAP-------VGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQK  946
             AS YFT  P       V   AAA NY ++Q P+H S         V V VE    QYQQK
Sbjct  191   ASDYFTTTPEMKAPVEVAAAAAAGNYVSFQVPLHSS--------VVPVQVEGSIAQYQQK  242

Query  947   EEESISSHGNETHNYQSSHVDQLHQGEVGEED---LSALPTETEAVQAEVEGVQGDHHKD  1117
             +E++ +  G+ET + QSS V++LHQ E+  E+   + ++  E    QAEVE  QGD   +
Sbjct  243   DEDNSNVQGHETGDDQSSPVEELHQDELEIENPAEVVSVQQEQAKQQAEVEWSQGD--VE  300

Query  1118  VKEQQNIPrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYV  1297
              KEQ    R   +     G GG GRRG      GG     VGG+YQNGRS Y DQP NY 
Sbjct  301   SKEQYVPRRNYQNTRGGRGGGGSGRRGGYPNGRGGRSGGRVGGSYQNGRSQYYDQPGNYY  360

Query  1298  PRNSHFrgrggrggH----YNNHPPGAQVG  1375
              R  H     G  G     YNNH  G Q G
Sbjct  361   SRGYHNNRGRGGRGAGGNSYNNHVLGIQGG  390



>ref|XP_010923301.1| PREDICTED: uncharacterized protein LOC105046420 [Elaeis guineensis]
Length=451

 Score =   229 bits (584),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 166/370 (45%), Positives = 221/370 (60%), Gaps = 31/370 (8%)
 Frame = +2

Query  68    MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
             + A   ++V+DGPVLS+I+KR+RAL+KK NRI Q E+SL++GK LNKEQEE LR+KPAV 
Sbjct  5     LVAAGAAEVADGPVLSLISKRLRALRKKHNRILQTEESLAQGKPLNKEQEELLRSKPAVT  64

Query  248   AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  427
             A IDELEK+R PL+AA+ EE+S            TP P        E +         G 
Sbjct  65    ALIDELEKLRSPLAAALHEELSRCPSPPPQDPSPTPPPPPPLAVAAESN---------GK  115

Query  428   VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  607
              IEDLL LLYFG +FD++  Q+ FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD 
Sbjct  116   AIEDLLALLYFGCLFDIRP-QSEFTGMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDA  173

Query  608   lsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIM  787
             +S+L  L+ SR   S + HKNALQ+C++HAK WLQ S QPI    +VTYAGLR KL+KIM
Sbjct  174   ISVLGSLVTSRPTYSGVSHKNALQECVQHAKFWLQKSDQPIHSGVSVTYAGLREKLNKIM  233

Query  788   ASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEE  952
             AS YFT      APV + AA   Y         S   +          E     +Q KE+
Sbjct  234   ASDYFTTTPEMKAPVDVAAAVGKYST------TSQVQISETTSPSAQTEGSPTHHQHKED  287

Query  953   ESISSHGNETH-NYQSSHVDQ---LHQGEV--GEEDLSALPTETEAVQAEV-EGVQGDHH  1111
             E       E H N+QS+ VD+   + + +V     D+ + P E + ++++V E  QGD  
Sbjct  288   EQQDFQATEVHPNHQSTPVDEPSKMDEADVLNPSGDIGSAPQEQQKLESDVEEQNQGD--  345

Query  1112  KDVKEQQNIP  1141
              + K+QQ +P
Sbjct  346   PEPKDQQYVP  355



>ref|XP_008807865.1| PREDICTED: uncharacterized protein LOC103720099 isoform X1 [Phoenix 
dactylifera]
Length=448

 Score =   227 bits (578),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 195/439 (44%), Positives = 250/439 (57%), Gaps = 43/439 (10%)
 Frame = +2

Query  101   GPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQ  280
             GPVL +I+KR+RAL+KK NRI Q E+SL++GK+LNKEQEE LR+KPAV A IDELEK+R 
Sbjct  19    GPVLGLISKRLRALRKKNNRILQTEESLAQGKSLNKEQEELLRSKPAVTALIDELEKLRS  78

Query  281   PLSAAVEEEI-SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  457
             PL+AA+++E         Q  +   P  +E   K                 IEDLL+LLY
Sbjct  79    PLAAALQDEFSRRPSPPPQQPSPSAPVAAEPDDK----------------AIEDLLSLLY  122

Query  458   FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  637
             FG +FDV+  QN FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+IS
Sbjct  123   FGCLFDVRP-QNEFTAMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDTISALGSLVIS  180

Query  638   RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA---  808
             R A S + HKNALQ+C++ A+LW Q S QPI P ++VTYAGL+ KL+KIMAS YFTA   
Sbjct  181   RPAYSGVSHKNALQECVQRARLWFQKSNQPIHPGASVTYAGLKEKLNKIMASDYFTATPE  240

Query  809   --APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISSHGNET  982
               APV + AA    G Y       +            +E     YQQKE+E       E 
Sbjct  241   MKAPVDVAAAV---GKYSTTCQVQISEATTVASPAAQMEGSPAHYQQKEDEQDDFQPTEV  297

Query  983   H-NYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHK------DVKEQQNIP  1141
                +QSS  D+    ++ E D+    ++  +VQ E + ++ D  +      + K+QQ IP
Sbjct  298   QPEHQSSPADE--PPKMDEADVLNPSSDIASVQQEQQKLEADEKELNQRDPEPKDQQYIP  355

Query  1142  rr--syhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRNSH-  1312
             RR          G GG G        G GGR RG GG+YQNGRS Y D  S Y PRN + 
Sbjct  356   RRGYQNQRGGSRGGGGGGGGRRGYPNGRGGRGRGGGGSYQNGRSQYYD--SGYHPRNYNS  413

Query  1313  --FrgrggrggHYNNHPPG  1363
                 GR G    YNNH  G
Sbjct  414   RGRGGRSGGSAMYNNHGGG  432



>ref|XP_008807866.1| PREDICTED: uncharacterized protein LOC103720099 isoform X2 [Phoenix 
dactylifera]
Length=447

 Score =   226 bits (577),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 195/439 (44%), Positives = 249/439 (57%), Gaps = 44/439 (10%)
 Frame = +2

Query  101   GPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQ  280
             GPVL +I+KR+RAL+KK NRI Q E+SL++GK+LNKEQEE LR+KPAV A IDELEK+R 
Sbjct  19    GPVLGLISKRLRALRKKNNRILQTEESLAQGKSLNKEQEELLRSKPAVTALIDELEKLRS  78

Query  281   PLSAAVEEEI-SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  457
             PL+AA+++E         Q  +   P  +E   K                 IEDLL+LLY
Sbjct  79    PLAAALQDEFSRRPSPPPQQPSPSAPVAAEPDDK----------------AIEDLLSLLY  122

Query  458   FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  637
             FG +FDV+  QN FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+IS
Sbjct  123   FGCLFDVRP-QNEFTAMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDTISALGSLVIS  180

Query  638   RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA---  808
             R A S + HKNALQ+C++ A+LW Q S QPI P ++VTYAGL+ KL+KIMAS YFTA   
Sbjct  181   RPAYSGVSHKNALQECVQRARLWFQKSNQPIHPGASVTYAGLKEKLNKIMASDYFTATPE  240

Query  809   --APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISSHGNET  982
               APV + AA    G Y       +            +E     YQQKE+E       E 
Sbjct  241   MKAPVDVAAAV---GKYSTTCQVQISEATTVASPAAQMEGSPAHYQQKEDEQDDFQPTEV  297

Query  983   H-NYQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHK------DVKEQQNIP  1141
                +QSS  D+  + E    D+    ++  +VQ E + ++ D  +      + K+QQ IP
Sbjct  298   QPEHQSSPADEPPKDEA---DVLNPSSDIASVQQEQQKLEADEKELNQRDPEPKDQQYIP  354

Query  1142  rr--syhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRNSH-  1312
             RR          G GG G        G GGR RG GG+YQNGRS Y D  S Y PRN + 
Sbjct  355   RRGYQNQRGGSRGGGGGGGGRRGYPNGRGGRGRGGGGSYQNGRSQYYD--SGYHPRNYNS  412

Query  1313  --FrgrggrggHYNNHPPG  1363
                 GR G    YNNH  G
Sbjct  413   RGRGGRSGGSAMYNNHGGG  431



>ref|XP_009398398.1| PREDICTED: uncharacterized protein LOC103983002 [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   223 bits (567),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 192/307 (63%), Gaps = 26/307 (8%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MA++ +    DGPV ++++KR+RAL+KK NRI QME+SL++GK LNKEQEE LR+KPA+ 
Sbjct  1    MASSGMEAAVDGPVQNLMSKRLRALRKKYNRILQMEESLAQGKPLNKEQEEVLRSKPAIT  60

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALE-----TPAPSEESGKEPEGDVENKGE  412
              IDE EK+RQPL+ AV+EE++ +               T APS +  KE          
Sbjct  61   VLIDEYEKLRQPLAVAVQEELARAAAASPPPPPAPQEEPTAAPSADDDKE----------  110

Query  413  SDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllge  592
             + G  +EDLL LLYFG +FDVK  Q+ F   ML+R HER  CL+YDY+  DD+ DLLGE
Sbjct  111  -ELGPAVEDLLTLLYFGCLFDVKP-QSEFAATMLTRTHERGCCLTYDYV-TDDATDLLGE  167

Query  593  sdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLK  772
             DLD +S +  L+ SR   S + HKNALQ C++HAKLWL N  QPI P S+VTYAG+R K
Sbjct  168  QDLDAISAIGSLVTSRPVYSGISHKNALQVCLQHAKLWLLNVDQPIHPGSSVTYAGMREK  227

Query  773  LDKIMASQYFTA-----APVGLQAAAMNYG-AYQAPVHESvppvdvpvqvqvhvEDIGVQ  934
            L+KI+AS YFT      AP  + AA   YG A Q  + ES       VQ +     +G  
Sbjct  228  LNKILASDYFTTTPEMKAPGDVAAAVGKYGAACQVQISESTTMPSPMVQTEDSSVPVG--  285

Query  935  YQQKEEE  955
            YQ KE+E
Sbjct  286  YQHKEDE  292



>ref|XP_010933750.1| PREDICTED: uncharacterized protein LOC105054054 [Elaeis guineensis]
Length=445

 Score =   219 bits (559),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 197/444 (44%), Positives = 262/444 (59%), Gaps = 39/444 (9%)
 Frame = +2

Query  95    SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  274
             ++GPVLS+I+KR+RAL+KK NRI Q E+SL +GK+LNKEQEE LR+KPAV A IDELEK+
Sbjct  14    TEGPVLSLISKRLRALRKKHNRILQTEESLIQGKSLNKEQEELLRSKPAVTALIDELEKL  73

Query  275   RQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  454
             R PL+AA+ +E S    R      +  +P   +      D            IEDL+ LL
Sbjct  74    RSPLAAALHDEFS----RLSSPPPQQSSPPPAAAATQPDD----------KAIEDLVVLL  119

Query  455   YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  634
             YFG++FDVK  QN FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+I
Sbjct  120   YFGNLFDVKP-QNEFTAMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDTISALGSLVI  177

Query  635   sRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA--  808
             SR A S + HKNALQ+C++ A+LWLQ S QPI P +++TYAGLR KLDKIMAS YFTA  
Sbjct  178   SRPAYSGVSHKNALQECLQRARLWLQKSDQPIHPGASLTYAGLRDKLDKIMASDYFTATP  237

Query  809   ---APVGLQAAAMNYG-AYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISSHGN  976
                APV + AA   Y   +Q  + E+           V +E     YQQKE+E       
Sbjct  238   EMKAPVDVAAAVGKYSTTHQVQISEA----TTVASPVVQIEGSPAHYQQKEDEQDDFQPT  293

Query  977   ETH-NYQSSHVDQ---LHQGEV--GEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQQNI  1138
             + H ++QS   D+   + + +V    +D++++  E + ++A+V+ +      + K+QQ +
Sbjct  294   DVHPDHQSDPADEPPKMDEADVLNPSDDVASVQQEQQKLEADVKEL-NQRDPEPKDQQYV  352

Query  1139  -PrrsyhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRNSHF  1315
               R   +       G  G        G GGR RG GG YQNG+S Y D    Y PRN + 
Sbjct  353   HRRGYQNQRGGSRGGAGGGGRRGYPNGRGGRGRGGGGGYQNGQSQYYD--PGYYPRNYNS  410

Query  1316  rgrggrggH---YNNHPPGAQVGN  1378
             RGRGGR G    YNNH  G   GN
Sbjct  411   RGRGGRSGGSAVYNNHGEGPHGGN  434



>ref|NP_001168517.1| hypothetical protein [Zea mays]
 gb|ACN28496.1| unknown [Zea mays]
 gb|AFW67958.1| hypothetical protein ZEAMMB73_254492 [Zea mays]
Length=457

 Score =   219 bits (559),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 207/359 (58%), Gaps = 36/359 (10%)
 Frame = +2

Query  77    TEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGI  256
             T  ++ +DGPVLSV++KR+RAL+KK NRI+QME+SL+ GK+LN+EQEE LR+KP V A I
Sbjct  21    TMAAEAADGPVLSVVSKRLRALRKKYNRITQMEESLAAGKSLNREQEEVLRSKPVVAALI  80

Query  257   DELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIE  436
             DELE++R PL++A+ EE+                    S +           SD    ++
Sbjct  81    DELERLRPPLASALAEEL--------------------SSRSAPAPAATASSSDSDSSVQ  120

Query  437   DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  616
             DLL L+YFGS+FDVK  Q+ F  ++ +RE ERSSCL+YDY+ DD    L+      + +L
Sbjct  121   DLLALVYFGSLFDVKQ-QSDFVSLVYTRELERSSCLTYDYVGDDPEDSLVETDLNAVSAL  179

Query  617   lsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQ  796
              +       A + + H++ALQ C  HA+LWL  + +PI PDS +TYAG+R KLD+IMAS 
Sbjct  180   ATLAASRPPAAAGVSHRDALQACAHHARLWLSRADEPIHPDSTITYAGVRAKLDRIMASG  239

Query  797   YFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESI  961
             Y+TA      P+ L AA  N+GA    V ES+      ++     +D+     +KE+   
Sbjct  240   YYTAQLEMRTPMDLAAAVANFGAGGVQVQESMVVSPQALEAVEESQDVEEHKDEKED---  296

Query  962   SSHGNETHN-YQSSHVDQLHQGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQQN  1135
              S   E ++ +Q+  VD  H   V +E L     E  + +AE E +  D + D +EQ++
Sbjct  297   -SEATEIYSEHQAPVVDAEH---VDDEGLVNPADEVPSAEAEQETL--DDYVDDQEQKD  349



>ref|XP_008807868.1| PREDICTED: uncharacterized protein LOC103720099 isoform X3 [Phoenix 
dactylifera]
Length=337

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 172/254 (68%), Gaps = 24/254 (9%)
 Frame = +2

Query  101  GPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQ  280
            GPVL +I+KR+RAL+KK NRI Q E+SL++GK+LNKEQEE LR+KPAV A IDELEK+R 
Sbjct  19   GPVLGLISKRLRALRKKNNRILQTEESLAQGKSLNKEQEELLRSKPAVTALIDELEKLRS  78

Query  281  PLSAAVEEEI-SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  457
            PL+AA+++E         Q  +   P  +E   K                 IEDLL+LLY
Sbjct  79   PLAAALQDEFSRRPSPPPQQPSPSAPVAAEPDDK----------------AIEDLLSLLY  122

Query  458  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  637
            FG +FDV+  QN FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+IS
Sbjct  123  FGCLFDVRP-QNEFTAMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDTISALGSLVIS  180

Query  638  RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA---  808
            R A S + HKNALQ+C++ A+LW Q S QPI P ++VTYAGL+ KL+KIMAS YFTA   
Sbjct  181  RPAYSGVSHKNALQECVQRARLWFQKSNQPIHPGASVTYAGLKEKLNKIMASDYFTATPE  240

Query  809  --APVGLQAAAMNY  844
              APV + AA   Y
Sbjct  241  MKAPVDVAAAVGKY  254



>ref|XP_008807869.1| PREDICTED: uncharacterized protein LOC103720099 isoform X4 [Phoenix 
dactylifera]
Length=336

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 172/254 (68%), Gaps = 24/254 (9%)
 Frame = +2

Query  101  GPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQ  280
            GPVL +I+KR+RAL+KK NRI Q E+SL++GK+LNKEQEE LR+KPAV A IDELEK+R 
Sbjct  19   GPVLGLISKRLRALRKKNNRILQTEESLAQGKSLNKEQEELLRSKPAVTALIDELEKLRS  78

Query  281  PLSAAVEEEI-SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  457
            PL+AA+++E         Q  +   P  +E   K                 IEDLL+LLY
Sbjct  79   PLAAALQDEFSRRPSPPPQQPSPSAPVAAEPDDK----------------AIEDLLSLLY  122

Query  458  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  637
            FG +FDV+  QN FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+IS
Sbjct  123  FGCLFDVRP-QNEFTAMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDTISALGSLVIS  180

Query  638  RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA---  808
            R A S + HKNALQ+C++ A+LW Q S QPI P ++VTYAGL+ KL+KIMAS YFTA   
Sbjct  181  RPAYSGVSHKNALQECVQRARLWFQKSNQPIHPGASVTYAGLKEKLNKIMASDYFTATPE  240

Query  809  --APVGLQAAAMNY  844
              APV + AA   Y
Sbjct  241  MKAPVDVAAAVGKY  254



>ref|XP_006838798.1| hypothetical protein AMTR_s00002p00260390 [Amborella trichopoda]
 gb|ERN01367.1| hypothetical protein AMTR_s00002p00260390 [Amborella trichopoda]
Length=463

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 198/321 (62%), Gaps = 14/321 (4%)
 Frame = +2

Query  65    SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  244
             +  AT +    DGPVLS+++KR+RALKKK NRI Q+E+S S+GK++ KEQEE LR+KP V
Sbjct  7     AATATSIETCKDGPVLSMMSKRLRALKKKYNRILQIEESRSQGKSIIKEQEEVLRSKPGV  66

Query  245   LAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  424
             LA I+E EK+R PLS A++EE+S             P  +  S K+ +G  +     D  
Sbjct  67    LALIEEYEKLRVPLSNALKEELSSLQPPTPSPPPPLPQDNGTSDKKEKGYHKKGLNHDLD  126

Query  425   VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  604
              VIEDLL LLYFGS+FDVK+ QN FT +ML+R HERSSCL+YDY+  DD+ DLL E DLD
Sbjct  127   EVIEDLLKLLYFGSLFDVKS-QNEFTSIMLTRVHERSSCLTYDYV-TDDATDLLVERDLD  184

Query  605   llsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKI  784
              LS+   L+ +R  NS+L HK AL+ C++ AKLWL  S +P+  D  VTYAGLR +L+KI
Sbjct  185   FLSVCGSLMTARPPNSTLSHKEALRICVDRAKLWLHKSDEPLYSDVGVTYAGLRERLNKI  244

Query  785   MASQYFTAAPVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESIS  964
             ++S+YFT  P       M   + Q+ V  +          QV V+D G+Q    E ES  
Sbjct  245   LSSEYFTTTP------EMKALSQQSAVEAAAAAASGNYVPQVIVQDSGMQDHAFETESAP  298

Query  965   SH------GNETHNYQSSHVD  1009
             +H      G E H   S+  D
Sbjct  299   THHQQKAEGQENHAIHSNTTD  319



>ref|XP_008796647.1| PREDICTED: uncharacterized protein LOC103712049 [Phoenix dactylifera]
Length=441

 Score =   215 bits (548),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 178/413 (43%), Positives = 235/413 (57%), Gaps = 36/413 (9%)
 Frame = +2

Query  104   PVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQP  283
             PVLS+I+KR+RAL+KK NRI QME+S ++GK LNKEQEE LR+KPAV A IDELEK+R P
Sbjct  14    PVLSLISKRLRALRKKHNRIIQMEESQAQGKPLNKEQEELLRSKPAVTALIDELEKLRSP  73

Query  284   LSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLYFG  463
             L AA+ +E+S             P  +     EP               +ED+L LLYFG
Sbjct  74    LVAALHDELSRCPSPPPQDPPTPPPLA--VAAEPNDK-----------AVEDILALLYFG  120

Query  464   SMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllisRS  643
              +FD++  Q+ FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+ SR 
Sbjct  121   CLFDIRP-QSEFTSMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDAISALGSLVTSRQ  178

Query  644   ANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA-----  808
             A S + HKNAL  C++HAKLWLQ S QPI    +VTYAGLR KL+KIMAS YFT      
Sbjct  179   AYSGVSHKNALLGCVQHAKLWLQKSDQPIHSGESVTYAGLREKLNKIMASDYFTTTPEMK  238

Query  809   APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISSHGNETH-  985
             APV + AA    G + A     +    +        E     +Q KE+E       E H 
Sbjct  239   APVDVAAAV---GKFSATSQVQISETTMVASPSAQTEGSPTHHQHKEDEQQDFQATEVHP  295

Query  986   NYQSSHVDQLHQGEVGEE-----DLSALPTETEAVQAEV-EGVQGDHHKDVKEQQNIPrr  1147
             N+QS+ VD+  + +  +      D+++ P E + ++A+V E +Q D   + K++Q+I   
Sbjct  296   NHQSTPVDEPPKMDEADTLNPSGDIASAPQEQQKLEADVEEQIQRD--PEPKDRQHI--S  351

Query  1148  syhnnyrggrggvgrrgysngrggggrsrgvggAYQNGRSHYSDQPSNYVPRN  1306
                   + G    G        G GGR RG GGAYQNGRS Y +    Y PRN
Sbjct  352   RRGYPSQRGGSRGGGGRRGYPNGRGGRGRGGGGAYQNGRSQYYE--PGYYPRN  402



>ref|NP_001168582.1| uncharacterized protein LOC100382366 [Zea mays]
 gb|ACN28756.1| unknown [Zea mays]
 tpg|DAA50732.1| TPA: hypothetical protein ZEAMMB73_804328 [Zea mays]
Length=452

 Score =   213 bits (542),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 141/353 (40%), Positives = 201/353 (57%), Gaps = 43/353 (12%)
 Frame = +2

Query  98    DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
             DGPVLSV++KR+RAL+KK NRI+QME+SL+ GKTLN+EQEE LR+KP V A IDELE++R
Sbjct  29    DGPVLSVVSKRLRALRKKYNRITQMEESLAAGKTLNREQEEVLRSKPVVAALIDELERLR  88

Query  278   QPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  457
              PL++A+ EE+S        +A  + + S                      ++DLL L+Y
Sbjct  89    PPLASALAEELSSRPAPAPSAASSSDSDSS---------------------VQDLLALVY  127

Query  458   FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  637
             FGS+FDVK  Q+ F  ++ +RE ERSSCL+YDY+ DD    L       + +L S   + 
Sbjct  128   FGSLFDVKQ-QSDFVSLVYTRELERSSCLTYDYVGDDPEDSLAETDLNAVSALASLAALR  186

Query  638   RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA---  808
               A + + H++ALQ C  HA+LWL  + +PI PDS +TYAG+R KLD+IMAS YFTA   
Sbjct  187   PPAAAGVSHRDALQACAHHARLWLCRADEPIHPDSTITYAGVRAKLDRIMASGYFTAQLE  246

Query  809   --APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISSHGNET  982
                P+ L AA  ++GA    V ES+       +              +E +++  H NE 
Sbjct  247   MRTPLDLAAAVASFGAGGVQVQESMVVSPQAPEAV------------EESQAVEGHKNEK  294

Query  983   HNYQSSHVDQLH---QGEVGEEDLSALPTETEAVQAEVEGVQGDHHKDVKEQQ  1132
              + Q++ +   H     E  E+++   PT+ E   AE E  Q     DVK+Q+
Sbjct  295   EDSQATEIYNDHPVVDSEHVEDEVLVHPTD-EVPPAETEQEQETFDADVKDQE  346



>ref|XP_009396953.1| PREDICTED: uncharacterized protein LOC103981916 [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 134/283 (47%), Positives = 182/283 (64%), Gaps = 24/283 (8%)
 Frame = +2

Query  62   LSMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPA  241
            ++ +  EV    DGPVLS+++KR+RAL+KK NRI QME+SL++GK LNKEQEE LR+KPA
Sbjct  2    MASSGAEVVAAGDGPVLSLMSKRLRALRKKYNRILQMEESLAQGKPLNKEQEEVLRSKPA  61

Query  242  VLAGIDELEKIRQPLSAAVEEEISLSVQRHQVSAL------ETPAPSEESGKEPEGDVEN  403
            +   IDE EK+RQPL+ A++EE++ +      S        ET  P+  S  + E D   
Sbjct  62   IAVLIDEYEKLRQPLAVALQEELARTAASPPPSFPPPAVQEETHVPAAASAVKEEPD---  118

Query  404  KGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl  583
                   + + D+L LLYFG +FDVK  Q+ F   ML+R HER  CL+YDY+  DD+I+L
Sbjct  119  -------LAVRDILTLLYFGCLFDVKP-QSEFAATMLTRTHERGCCLTYDYV-TDDAIEL  169

Query  584  lgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGL  763
            LGE DLD +S L  L+ SR   S + HKNAL+ C++HAK WL ++ QP+   +++TYA L
Sbjct  170  LGERDLDAISALGSLVTSRPVYSGVSHKNALEACLQHAKHWLSSADQPLLTGTSITYAEL  229

Query  764  RLKLDKIMASQYFTA-----APVGLQAAAMNYG-AYQAPVHES  874
            R KL+KI+AS YFT      AP  + AA   YG A Q P+ ES
Sbjct  230  REKLNKILASDYFTTTPEMKAPGDVAAAVGKYGVACQVPISES  272



>ref|XP_002466649.1| hypothetical protein SORBIDRAFT_01g011640 [Sorghum bicolor]
 gb|EER93647.1| hypothetical protein SORBIDRAFT_01g011640 [Sorghum bicolor]
Length=465

 Score =   210 bits (535),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 164/264 (62%), Gaps = 22/264 (8%)
 Frame = +2

Query  98   DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
            DGPVLSV++KR+RAL+KK NRI+QME+SL+ GKTLN+EQEE LR+KP V A IDELE++R
Sbjct  29   DGPVLSVVSKRLRALRKKYNRITQMEESLAAGKTLNREQEEVLRSKPVVAALIDELERLR  88

Query  278  QPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  457
             PL++AV EE+S         A                       SD    ++DLL L+Y
Sbjct  89   PPLASAVAEELSSRPAPAPAPAPAA----------------AASSSDSDSSVQDLLALIY  132

Query  458  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  637
            FGS+FDVK  Q+ F  ++ + E ERSSC++YDY+ DD    L       + +L S     
Sbjct  133  FGSLFDVKQ-QSDFVSLVYASELERSSCITYDYVGDDPEDSLAETDLNAVSALASLAASR  191

Query  638  RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA---  808
              A + + H++ALQ C  HA+LWL+ + +PI PDS VTYAG+R KLD+IMAS Y+TA   
Sbjct  192  PPAAAGVSHRDALQACAHHARLWLRRADEPIHPDSTVTYAGVRAKLDRIMASGYYTAQLE  251

Query  809  --APVGLQAAAMNYGAYQAPVHES  874
               P+ L AA  ++GA  A + ES
Sbjct  252  MRPPLDLAAAVASFGAGGAQMQES  275



>ref|XP_003561154.1| PREDICTED: uncharacterized protein LOC100834871 [Brachypodium 
distachyon]
Length=472

 Score =   208 bits (529),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 159/254 (63%), Gaps = 19/254 (7%)
 Frame = +2

Query  95   SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  274
            +DGPVLSV+ KR+RAL+KK NRISQME+S++ GKTLN+EQ+E LR+KP V A I+ELE+I
Sbjct  24   NDGPVLSVVTKRLRALRKKQNRISQMEESVAAGKTLNQEQKEVLRSKPIVAAVIEELERI  83

Query  275  RQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  454
            R PLS+A+ EE+S             PAPS      P  D  +         I+DLL L+
Sbjct  84   RAPLSSALAEELST-----------IPAPS----AAPATDAGSSSSG-SDSSIQDLLALV  127

Query  455  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  634
            YFGS+FDVK  Q+ F   M++R HERS C++YDY+ DD +  L       + ++ +    
Sbjct  128  YFGSLFDVKP-QSEFVTTMVARTHERSCCITYDYVTDDAAELLAESDLDAVATVAALAAA  186

Query  635  sRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAP  814
              S    + H++ALQ C  HA+LWL  + +PI  DS+VTYA +R KLD+IMAS Y+TA  
Sbjct  187  RPSKAVGVTHRDALQACAHHARLWLSRADEPISADSSVTYAAVRAKLDRIMASDYYTAQT  246

Query  815  --VGLQAAAMNYGA  850
                +  A  +YGA
Sbjct  247  EMSDMAVAVGSYGA  260



>ref|XP_004982143.1| PREDICTED: glycine, alanine and asparagine-rich protein-like 
[Setaria italica]
Length=460

 Score =   191 bits (485),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 151/240 (63%), Gaps = 15/240 (6%)
 Frame = +2

Query  95   SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  274
            +DGPVLSV++KR+RAL+KK NRI+QME+SL+ GK LN EQEE LR+K  V+A I+ELE++
Sbjct  21   TDGPVLSVVSKRLRALRKKYNRITQMEESLAAGKKLNPEQEEVLRSKTVVVAQIEELERL  80

Query  275  RQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  454
            R PL++A+ EE+S         A    A +  S  +                + D L L+
Sbjct  81   RAPLASALAEELSSRPAPAPAPAPAAAAAASSSDSD--------------SSVLDFLPLV  126

Query  455  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  634
            YFGS+FDVK  Q  F   M++R HER+ C++YDY+ DD +  L       + +L S    
Sbjct  127  YFGSLFDVKQ-QGDFVATMVARTHERNCCITYDYVTDDAADLLAETDLDAVSALASLAAS  185

Query  635  sRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAP  814
              ++ + + H++ALQ C  HA+LWL+ + +PI PDS VTYAG+R KL+KIM+  Y+TA P
Sbjct  186  RPASAAGVSHRDALQACAHHARLWLRRADEPIHPDSTVTYAGVREKLEKIMSLDYYTAQP  245



>ref|XP_006573960.1| PREDICTED: uncharacterized protein LOC100816385 [Glycine max]
Length=370

 Score =   185 bits (469),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 164/256 (64%), Gaps = 14/256 (5%)
 Frame = +2

Query  122  NKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQPLSAAVE  301
            N  + AL+K +  +  ++ S      +NKEQEE LR+KP++LA IDEL+K+RQPL+ A+ 
Sbjct  37   NISLDALRKTI--MDAIQGSPKASLNVNKEQEEVLRSKPSILALIDELDKLRQPLATALS  94

Query  302  EEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLYFGSMFDVK  481
            EE+ ++    Q    ET     E+  E  G +E    S   VV+EDLLN LYFGS+FDVK
Sbjct  95   EELQINDTSSQNPHHETEI-ENETLAESSGSIEPNSNSRNDVVVEDLLNFLYFGSLFDVK  153

Query  482  TLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLP  661
            +    F   ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L GLL+SR A+SS  
Sbjct  154  S---DFVSTMLTRTHERGCCLTYDYV-IDDATDLLGEKDLDSISALRGLLVSRPADSSFS  209

Query  662  HKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAP-------VG  820
            HK+ L  C+EHAKLWL  S QPI PD++VTYA LR KL+ IM+S+YFT  P       V 
Sbjct  210  HKSVLHCCVEHAKLWLAKSEQPIRPDADVTYAALREKLNNIMSSEYFTTTPEMKAPVEVA  269

Query  821  LQAAAMNYGAYQAPVH  868
            + AA  NY ++  PVH
Sbjct  270  VAAAGGNYVSFHVPVH  285



>gb|ABR16221.1| unknown [Picea sitchensis]
Length=546

 Score =   184 bits (467),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 162/262 (62%), Gaps = 23/262 (9%)
 Frame = +2

Query  92   VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEK  271
            V DGPVL ++NKR+RALKKK NRI Q+E+S ++GK +NKEQ++ LR+K +V   I+E EK
Sbjct  24   VKDGPVLCLMNKRLRALKKKYNRILQIEESKAQGKVINKEQDDVLRSKASVAVLIEEYEK  83

Query  272  IRQPLSAAVEEEISLSVQRHQVSALETPAPSEESG---------------------KEPE  388
            +RQPL+ AV+EEI+   +        +  P+ E G                      + E
Sbjct  84   LRQPLAVAVKEEIAEKEKELLEENAASKEPTAEDGVVTEETQDTQDSDEVKTSEATPQAE  143

Query  389  GDVENKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdd  568
            GD    G       I +LL +LYF  +FDV T QN F  +M ++ HERSSCLSYDY+  D
Sbjct  144  GDDAKDGVGLSDEAIAELLKILYFAHLFDV-TSQNDFASMMWTKMHERSSCLSYDYV-TD  201

Query  569  dsidllgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNV  748
            D+   L E DLD LSL   L+ SR  N++L HK+ALQ C+ HA+ WL NS +PI  D+ V
Sbjct  202  DATKPLAEEDLDALSLFGSLMTSRPPNATLSHKSALQSCVHHARQWLVNSDKPIHLDNAV  261

Query  749  TYAGLRLKLDKIMASQYFTAAP  814
            +Y+ LR +L++I++S+YFT  P
Sbjct  262  SYSDLRERLNRILSSEYFTMTP  283



>gb|EEC75970.1| hypothetical protein OsI_13079 [Oryza sativa Indica Group]
Length=466

 Score =   182 bits (462),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/240 (46%), Positives = 156/240 (65%), Gaps = 13/240 (5%)
 Frame = +2

Query  95   SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  274
            +DGP LSV++KR+RAL+KK NRI QME+SL+ G+ LNKEQEE LR+KPAV+A IDELE++
Sbjct  24   TDGPTLSVVSKRLRALRKKHNRILQMEESLAGGRKLNKEQEEVLRSKPAVVALIDELERM  83

Query  275  RQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  454
            R PL+AA+ EE+S        +A   PA S  +G                 V+EDLL L+
Sbjct  84   RAPLAAALAEELSSRPAPSSSAAPPPPASSSAAGAA------------DSSVVEDLLALI  131

Query  455  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  634
            YFG++FD+K  Q  F   M++R  ER  C++YDY+ +D +  L       + +L +    
Sbjct  132  YFGTLFDLKP-QTEFVATMVARAQERDCCITYDYVTEDAADLLHQSDLDKVSALAALAAS  190

Query  635  sRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAP  814
              +A   + H++ALQ C +HA+LWL+ + +PI P+S++TYA +R KLDKIMAS Y+TA P
Sbjct  191  RPAAAVGVSHRDALQSCAQHARLWLRRADEPIHPESSITYAAVRAKLDKIMASDYYTAQP  250



>emb|CDM83736.1| unnamed protein product [Triticum aestivum]
Length=664

 Score =   185 bits (469),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 160/258 (62%), Gaps = 32/258 (12%)
 Frame = +2

Query  83   VSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDE  262
            +S++ +GPVLSV++KR+R L+KK NRI+QME+S++ GK LN+EQ+E + +KP + A IDE
Sbjct  411  ISEIKEGPVLSVVSKRLRVLRKKQNRIAQMEESVAAGKMLNQEQKELMHSKPVIAALIDE  470

Query  263  LEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG--VVIE  436
            LE++R PLS ++ +E+S             PAP+              G S  G  + ++
Sbjct  471  LERLRVPLSTSLTKELS-----------TVPAPA-------------AGSSSFGSDLSVQ  506

Query  437  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  616
            DLL L+YFGS+F VK+  N F   M++R+HERSSC+++ Y+ DD +  L+      + ++
Sbjct  507  DLLALIYFGSLFYVKS-PNEFIATMVARKHERSSCITHGYVWDDTADLLVENDLDAVSAV  565

Query  617  lsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQ  796
             +      ++   + H +ALQ C  HA+LWL  +  PI P S+VTYA +R KLD+IMAS 
Sbjct  566  AALAAARPASAVGVSHHDALQACAHHARLWLTRADAPIHPGSSVTYAAVRSKLDRIMASD  625

Query  797  YFTAAPVGLQAAAMNYGA  850
            Y+TA      A A N+GA
Sbjct  626  YYTA-----PAVAGNHGA  638



>ref|XP_001771935.1| predicted protein [Physcomitrella patens]
 gb|EDQ63196.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 169/258 (66%), Gaps = 23/258 (9%)
 Frame = +2

Query  98   DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
            DGPVL++++KR+RALKKK NRI Q+E++  +GKT+NKEQE+ L+TK A+ A IDE EK+R
Sbjct  20   DGPVLTMMSKRLRALKKKYNRILQIEENKRQGKTVNKEQEDVLKTKIAIAALIDEYEKLR  79

Query  278  QPLSAAVEEEISLSVQRHQVSALETPAPSE------ESGKEPEGDVENKG----------  409
            QPL +AV+EE++   +    + LE     E      +S KE   +VE +           
Sbjct  80   QPLISAVKEEVAEREKELLAATLERKQEEESSQDVTDSEKEKLTEVEKESFVRVSESVVP  139

Query  410  ---ESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsid  580
                S+G V   DLL LLYF  +FDV++ Q     +M +R HERSSCLSYD++  DDS  
Sbjct  140  ENVFSEGDV--SDLLKLLYFSHLFDVRS-QGEAPSLMWTRVHERSSCLSYDFV-TDDSTT  195

Query  581  llgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAG  760
             L E+DLD LSL   +L SR  N +L H++ALQ+CIEHA+ WL+NS   I+ DS+ +Y+ 
Sbjct  196  PLIEADLDALSLFGSMLTSRPPNETLSHRDALQRCIEHARQWLRNSDLAIQLDSHTSYSR  255

Query  761  LRLKLDKIMASQYFTAAP  814
            LR +L++I++S+YFT  P
Sbjct  256  LRERLNRILSSEYFTMTP  273



>ref|NP_001050943.1| Os03g0688200 [Oryza sativa Japonica Group]
 gb|AAT81716.1| putative glycine rich protein [Oryza sativa Japonica Group]
 gb|AAT85066.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF98269.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12857.1| Os03g0688200 [Oryza sativa Japonica Group]
Length=466

 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 155/240 (65%), Gaps = 13/240 (5%)
 Frame = +2

Query  95   SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  274
            +DGP LSV++KR+RAL+KK NRI QME+SL+ G+ LNKEQE  LR+KPAV+A IDELE++
Sbjct  24   TDGPTLSVVSKRLRALRKKHNRILQMEESLAGGRKLNKEQEGVLRSKPAVVALIDELERM  83

Query  275  RQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  454
            R PL+AA+ EE+S        +A   PA S  +G                 V+EDLL L+
Sbjct  84   RAPLAAALAEELSSRPAPSSSAAPPPPASSSAAGAA------------DSSVVEDLLALI  131

Query  455  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  634
            YFG++FD+K  Q  F   M++R  ER  C++YDY+ +D +  L       + +L +    
Sbjct  132  YFGTLFDLKP-QTEFVATMVARAQERDCCITYDYVTEDAADLLHQSDLDKVSALAALAAS  190

Query  635  sRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAP  814
              +A   + H++ALQ C +HA+LWL+ + +PI P+S++TYA +R KLDKIMAS Y+TA P
Sbjct  191  RPAAAVGVSHRDALQSCAQHARLWLRRADEPIHPESSITYAAVRAKLDKIMASDYYTAQP  250



>gb|EMT18822.1| hypothetical protein F775_06861 [Aegilops tauschii]
Length=869

 Score =   181 bits (460),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 151/244 (62%), Gaps = 27/244 (11%)
 Frame = +2

Query  83   VSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDE  262
            +S+  +GP LSV++KR+RAL+KK +RI++ME+S++ GK LN++Q+E + +KP + A I+E
Sbjct  396  ISETKEGPALSVVSKRLRALRKKQDRIARMEESVAAGKVLNQDQKEVMHSKPTIAALINE  455

Query  263  LEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG--VVIE  436
            LE++R PLS A+ +E+S             PAP+              G S  G  + I+
Sbjct  456  LERLRVPLSTALTKELS-----------TVPAPA-------------AGSSSFGSDLSIQ  491

Query  437  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  616
            DLL L+YFGS+F VK+  + F   M++R+HERSSC++Y Y+ DD    L       + ++
Sbjct  492  DLLALVYFGSLFYVKS-PDEFITTMVARKHERSSCITYGYVWDDTVDLLTENDLDAVSAV  550

Query  617  lsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQ  796
             +      ++   + H +ALQ C  HA+LWL  +  PI P S+VTYA +R KLD+IMAS 
Sbjct  551  AALATARPASAVGVSHHDALQACAHHARLWLTRANAPIHPGSSVTYAAVRSKLDRIMASD  610

Query  797  YFTA  808
            Y+TA
Sbjct  611  YYTA  614



>gb|EMS56397.1| hypothetical protein TRIUR3_34734 [Triticum urartu]
Length=591

 Score =   176 bits (447),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 149/244 (61%), Gaps = 27/244 (11%)
 Frame = +2

Query  83   VSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDE  262
            +S+  +G  LSV++KR+RAL+KK +RI+QME+S++ GK LN++Q+E + +KP + A IDE
Sbjct  341  ISETKEGLALSVVSKRLRALRKKQDRIAQMEESVAAGKVLNQDQKEVMHSKPTIAALIDE  400

Query  263  LEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG--VVIE  436
            LE++R PLS A+ +E+S             PAP+              G S  G  + I+
Sbjct  401  LERLRVPLSTALTKELS-----------TVPAPA-------------AGSSSFGSDLSIQ  436

Query  437  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  616
            DLL L+YFGS+F VK+  + F   M++R+HERSSC++Y Y+ DD    L       + ++
Sbjct  437  DLLALVYFGSLFYVKS-PDEFITTMVARKHERSSCITYGYVWDDTVDLLTENDLDAVSAV  495

Query  617  lsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQ  796
             +      ++   + H +ALQ C  HA+LWL  +  PI P S++TYA +R KLD+IMAS 
Sbjct  496  AALATARPASAVGVSHHDALQACAHHARLWLTRADVPIHPGSSITYAAVRSKLDRIMASD  555

Query  797  YFTA  808
            Y+ A
Sbjct  556  YYMA  559



>gb|EAZ28187.1| hypothetical protein OsJ_12160 [Oryza sativa Japonica Group]
Length=468

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 155/242 (64%), Gaps = 15/242 (6%)
 Frame = +2

Query  95   SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  274
            +DGP LSV++KR+RAL+KK NRI QME+SL+ G+ LNKEQE  LR+KPAV+A IDELE++
Sbjct  24   TDGPTLSVVSKRLRALRKKHNRILQMEESLAGGRKLNKEQEGVLRSKPAVVALIDELERM  83

Query  275  RQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  454
            R PL+AA+ EE+S        +A   PA S  +G                 V+EDLL L+
Sbjct  84   RAPLAAALAEELSSRPAPSSSAAPPPPASSSAAGAA------------DSSVVEDLLALI  131

Query  455  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  634
            YFG++FD+K  Q  F   M++R  ER  C++YDY+ +D +  L       + +L +    
Sbjct  132  YFGTLFDLKP-QTEFVATMVARAQERDCCITYDYVTEDAADLLHQSDLDKVSALAALAAS  190

Query  635  sRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNV--TYAGLRLKLDKIMASQYFTA  808
              +A   + H++ALQ C +HA+LWL+ + +PI P+S++  T+A +R KLDKIMAS Y+TA
Sbjct  191  RPAAAVGVSHRDALQSCAQHARLWLRRADEPIHPESSITCTHAAVRAKLDKIMASDYYTA  250

Query  809  AP  814
             P
Sbjct  251  QP  252



>ref|XP_001761769.1| predicted protein [Physcomitrella patens]
 gb|EDQ73525.1| predicted protein [Physcomitrella patens]
Length=437

 Score =   169 bits (428),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 108/247 (44%), Positives = 160/247 (65%), Gaps = 20/247 (8%)
 Frame = +2

Query  101  GPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQ  280
            GPVL++++KR+RALKKK +RI Q+E++  +GK +NKEQE+ L+ K  + A IDE EK+RQ
Sbjct  25   GPVLTMMSKRLRALKKKYSRILQIEENKRQGKAVNKEQEDVLKAKIGIAALIDEYEKLRQ  84

Query  281  PLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVV---------I  433
            PL  AV+EE++   +    + LE         +  E + E+    + GVV         +
Sbjct  85   PLMIAVKEEVAEREKELLAATLE---------RNQEEESESIVRKNTGVVREDVFSERDV  135

Query  434  EDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldlls  613
             DLL LLYF  +FDV++       ++ +R HERSSCLSYD++  DDS   L ESDLD LS
Sbjct  136  ADLLKLLYFAHLFDVRS-PGEAPSLVWTRVHERSSCLSYDFV-TDDSTTPLIESDLDALS  193

Query  614  llsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMAS  793
                +L SR  N +L H++ALQ+CIEHA+ WL+NS + I+P+++ +Y+ LR +L +I++S
Sbjct  194  FFGSMLTSRPPNETLSHRDALQRCIEHAREWLRNSDRVIQPENHTSYSRLRERLTRILSS  253

Query  794  QYFTAAP  814
            +YFT  P
Sbjct  254  EYFTMTP  260



>ref|XP_002988977.1| hypothetical protein SELMODRAFT_129003 [Selaginella moellendorffii]
 gb|EFJ10006.1| hypothetical protein SELMODRAFT_129003 [Selaginella moellendorffii]
Length=431

 Score =   164 bits (414),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 162/265 (61%), Gaps = 29/265 (11%)
 Frame = +2

Query  68   MAATEVSDV------SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLR  229
            MAA +VS V       DGPVL+++NKR+RALKKK NRI Q+E++  KGK +NKEQE+ L+
Sbjct  1    MAALDVSGVEDSSCGKDGPVLTMMNKRLRALKKKYNRIVQLEEAKEKGKAINKEQEDVLK  60

Query  230  TKPAVLAGIDELEKIRQPLSAAVEEEIS------LSVQRHQVSA---LETPAPSEESGKE  382
            +K  VL  ++E +++RQPL  AV EEI+      ++ +  QVS    +E P  S      
Sbjct  61   SKVQVLTLMEEYDRLRQPLLVAVREEIAEKEKEWIATKEEQVSGNEKIEVPVDS------  114

Query  383  PEGDVENKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMK  562
              G V    E     ++ +L+ LLYF  +FDV++     + +   + HER SCLSYD + 
Sbjct  115  --GSVAGLDEH----LMLELIQLLYFALLFDVQSQGEAHSFMRTVKYHERVSCLSYD-LV  167

Query  563  dddsidllgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDS  742
             DDS   L ++DLD L+    L+ SR  N++L H++ALQ CI HA+ WL NS   I+ + 
Sbjct  168  TDDSTSHLTDADLDALAAFGSLMTSRPPNTTLSHRDALQACIAHARHWLLNSDAIIDANI  227

Query  743  -NVTYAGLRLKLDKIMASQYFTAAP  814
             NVTY  LR +L++I+A++YFT  P
Sbjct  228  LNVTYTELRDRLNRILATEYFTMTP  252



>gb|ABR16471.1| unknown [Picea sitchensis]
Length=539

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 159/280 (57%), Gaps = 43/280 (15%)
 Frame = +2

Query  98   DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
            + PVL ++NKRIRAL+KK NRI Q+E++ S+GK +NKEQEE L +K  +   IDE EK++
Sbjct  23   ESPVLCLLNKRIRALRKKYNRILQIEENKSQGKVINKEQEEVLCSKNGIAVLIDEFEKLK  82

Query  278  QPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPE----GDVENKGESDGGVVIED--  439
            QPLS A+ EE++   +    S L+ P   + S  + E     D E     DGG+  ED  
Sbjct  83   QPLSNALREELAEREREFMDSVLKRPDEDDGSTNDKEYSSANDKEQSFADDGGLNNEDSD  142

Query  440  -----------------------------------LLNLLYFGSMFDVKTLQNHFTEVML  514
                                               LL +LYF  +F+V +  N    +M 
Sbjct  143  EKGIMANGYSEETRKECEESSAMDKEAPDLNAASDLLKILYFAKLFNVCS-PNRLASIMW  201

Query  515  SREHERSSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLPHKNALQKCIEH  694
            ++ HER SCLSYDY+  +DS D L E DLD LS++   + SR  N+++ H +ALQ C+ H
Sbjct  202  TKTHERISCLSYDYV-TEDSTDHLREEDLDALSMVGSFMTSRPPNATISHNDALQICVHH  260

Query  695  AKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAP  814
            A+ WL NS QPI P+SN++Y+ LR +L++I++S+YF   P
Sbjct  261  ARQWLCNSDQPIHPNSNLSYSNLRERLNRILSSEYFITTP  300



>ref|XP_002975088.1| hypothetical protein SELMODRAFT_442638 [Selaginella moellendorffii]
 gb|EFJ23873.1| hypothetical protein SELMODRAFT_442638 [Selaginella moellendorffii]
Length=500

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/308 (38%), Positives = 168/308 (55%), Gaps = 60/308 (19%)
 Frame = +2

Query  68   MAATEVSDV------SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLR  229
            MAA +VS V       DGPVL+++NKR+RALKKK NRI Q+E++  KGK +NKEQE+ L+
Sbjct  1    MAALDVSGVEDSSCGKDGPVLTMMNKRLRALKKKYNRIVQLEEAKEKGKAINKEQEDVLK  60

Query  230  TKPAVLAGIDELEKIRQPLSAAVEEEIS------LSVQRHQVSALETPAPSEESGKEPE-  388
            +K  VL  ++E +++RQPL  AV EEI+      ++ +  QVS + +    EE+  E E 
Sbjct  61   SKVQVLTLMEEYDRLRQPLLVAVREEIAEKEKEWIAAKEEQVSGVASSENLEEARTESEE  120

Query  389  -----------GDVENKGES----------------------------DGGVVIED----  439
                       G+ +N G                              D G V  D    
Sbjct  121  ASNENLENAGSGEADNVGGGGGDPAFAAAATATPAAATEENEKIEVPVDSGSVAVDEHLM  180

Query  440  --LLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldlls  613
              L+ LLYF  +FDV++     + +   + HER SCLSYD +  DDS   L ++DLD L+
Sbjct  181  LELIQLLYFALLFDVQSQGEAHSFMRTVKYHERVSCLSYD-LVTDDSTSHLTDADLDALA  239

Query  614  llsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDS-NVTYAGLRLKLDKIMA  790
                L+ SR  N++L H++ALQ CI HA+ WL NS   I+ +  NVTY  LR +L++I+A
Sbjct  240  AFGSLMTSRPPNTTLSHRDALQACIAHARHWLLNSDAIIDANILNVTYTELRDRLNRILA  299

Query  791  SQYFTAAP  814
            ++YFT  P
Sbjct  300  TEYFTMTP  307



>gb|EMT18821.1| hypothetical protein F775_02142 [Aegilops tauschii]
Length=871

 Score =   155 bits (393),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 159/258 (62%), Gaps = 32/258 (12%)
 Frame = +2

Query  83   VSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDE  262
            V ++ +GPVLSV+++R+R L++K NRI+QME+S++ GK L +EQ+E + +KP + A IDE
Sbjct  426  VFEIKEGPVLSVVSRRLRVLRRKQNRIAQMEESVAAGKMLYQEQKELMHSKPVIAALIDE  485

Query  263  LEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG--VVIE  436
            LE++R PLS A+ +E++       VSA   PA                G S  G  + I+
Sbjct  486  LERLRVPLSTALTKELT------TVSA---PA---------------AGSSSFGSDLSIQ  521

Query  437  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  616
            DLL L+YFGS+F VK+  N F   M++R+HERSSC+++ Y+ DD    L+  +   + ++
Sbjct  522  DLLALIYFGSLFHVKS-PNEFIATMVARKHERSSCITHGYVWDDTVDLLVENALDAVSAV  580

Query  617  lsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQ  796
             +      S+   + H +ALQ C  HA+LWL  +  PI P S+VTYA +R KLD+IMAS 
Sbjct  581  AALAAACPSSADGVSHHDALQACAHHARLWLTRADAPIHPGSSVTYAAVRSKLDRIMASD  640

Query  797  YFTAAPVGLQAAAMNYGA  850
            Y+TA      A A N+GA
Sbjct  641  YYTAP-----AVAGNHGA  653



>gb|KFK44624.1| hypothetical protein AALP_AA1G282900 [Arabis alpina]
Length=331

 Score =   144 bits (362),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 113/149 (76%), Gaps = 8/149 (5%)
 Frame = +2

Query  431  IEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldll  610
            +EDL+NLLYFGS+FDVK+ QN FT VM++R HER  CL+YDY+  DDS + LG+ DLD +
Sbjct  32   LEDLVNLLYFGSLFDVKS-QNDFTSVMVTRTHERGCCLTYDYV-TDDSTEFLGDRDLDSI  89

Query  611  sllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMA  790
            S L  L++SR  +S+L H+NAL++CIEHAKLWL NS QPIE + NV+YA LR KL KIMA
Sbjct  90   SQLWSLMVSRPMDSNLSHRNALERCIEHAKLWLANSDQPIESNCNVSYAALREKLKKIMA  149

Query  791  SQYFTA-----APVGLQAAAM-NYGAYQA  859
            S YFTA     APV + AAA  NYG++Q 
Sbjct  150  SDYFTATPEMKAPVEVAAAAAGNYGSFQV  178



>gb|KHN01223.1| Abietadienol/abietadienal oxidase [Glycine soja]
Length=293

 Score =   140 bits (354),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 127/210 (60%), Gaps = 8/210 (4%)
 Frame = +2

Query  122  NKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQPLSAAVE  301
            N  + AL+K +  +  ++ S      +NKEQEE LR+KP++LA IDEL+K+RQPL+ A+ 
Sbjct  37   NISLDALRKII--MDAIQGSPKASLNVNKEQEEVLRSKPSILALIDELDKLRQPLATALS  94

Query  302  EEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLYFGSMFDVK  481
            EE+ ++    Q    ET     E+  E  G +E    S   VV+EDLLN LYFGS+FDVK
Sbjct  95   EELQINGTSSQNPHHETET-ENETLAESSGSIEPNSNSRNDVVVEDLLNFLYFGSLFDVK  153

Query  482  TLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLP  661
            +    F   ML+R HER  CL+YDY+ DD +  L  +    + +L   L++    +SS  
Sbjct  154  S---DFVSTMLTRTHERGCCLTYDYVTDDATDLLGEKDLDSISALRGLLVLW-PVDSSFS  209

Query  662  HKNALQKCIEHAKLWLQNSTQPIEPDSNVT  751
            HKN L +C+EHAKLWL  S + + PD++VT
Sbjct  210  HKNVLHRCVEHAKLWLAKS-ELLVPDADVT  238



>ref|XP_006651701.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A1, A2/B1 
homolog, partial [Oryza brachyantha]
Length=360

 Score =   124 bits (311),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 93/144 (65%), Gaps = 6/144 (4%)
 Frame = +2

Query  431  IEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldll  610
            +EDLL L+YFG++FDVK   + F   M++R HER  CL+YDY+ D+ +  L+      + 
Sbjct  14   VEDLLRLVYFGTLFDVKP-HDEFVATMVARTHERQGCLTYDYVTDEAADILVEPDLDMVS  72

Query  611  sllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMA  790
            +L +      +A   + H++ALQ C +HA+LWL+ + +PI P+S++TYA +R KLDKIMA
Sbjct  73   ALAALAASRPAAAVGVSHRDALQACAQHARLWLRRADEPIHPESSITYAAVRAKLDKIMA  132

Query  791  SQYFTAAP-----VGLQAAAMNYG  847
            S Y+TA P     V L AA  +YG
Sbjct  133  SDYYTAQPEMGASVDLSAAVGSYG  156



>emb|CDP22197.1| unnamed protein product, partial [Coffea canephora]
Length=294

 Score =   120 bits (302),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 110/263 (42%), Positives = 150/263 (57%), Gaps = 21/263 (8%)
 Frame = +2

Query  527   ERSSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLW  706
             ER  CL+Y  + D ++ +++ E DL L+S+L  LLISR  N +L H+NALQ C++HA+LW
Sbjct  17    ERERCLAYTNVNDSNAREVVSEMDLTLISMLGSLLISRPVNWTLSHQNALQLCVKHARLW  76

Query  707   LQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTA-----APVGLQAAAMNYGAYQAPVHE  871
             L  S QPI  +  +TY+GLR KL+KIMAS YFT      APV + AAA +YG++Q P H 
Sbjct  77    LAKSDQPIGSNPYLTYSGLREKLNKIMASDYFTTTPEMKAPVEVAAAAGSYGSFQVPAHG  136

Query  872   SvppvdvpvqvqvhvEDIGVQYQQKEEESISSHGNETHNYQSSHVDQLHQGEVGEEDLSA  1051
             S         + V VE   VQYQQKEEE+ ++  +E+++ Q S  ++ HQGE   E+ S 
Sbjct  137   S--------VMPVQVEGSVVQYQQKEEETANAEEDESYDNQLSPAEEFHQGET--ENYSE  186

Query  1052  LPTETEAVQAEVEGVQGDHHKDVKEQQNIPrrsyhnnyrggrggvgrrgysngrggggrs  1231
             LP + E    + + +Q     + KEQ   PRRSY N   G   G   R       GG   
Sbjct  187   LPVQNEPTTHQAQNLQ---EYEPKEQNYAPRRSYPNYRGGRTVGASGRRGYANGRGGRGR  243

Query  1232  rgvggAYQNGRSHYSDQPSNYVP  1300
              G     QNGR+ + DQP  Y P
Sbjct  244   GGAY---QNGRNQHYDQPGTYYP  263



>gb|EMS62622.1| hypothetical protein TRIUR3_18305 [Triticum urartu]
Length=572

 Score =   124 bits (311),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 103/161 (64%), Gaps = 27/161 (17%)
 Frame = +2

Query  83   VSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDE  262
            +S+  +G  LSV +KR+RAL+KK +RI+QME+S++ GK LN++Q+E + +KP + A IDE
Sbjct  388  ISETKEGLALSVASKRLRALRKKQDRIAQMEESVASGKVLNQDQKEVMHSKPTIAALIDE  447

Query  263  LEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG--VVIE  436
            LE++R PLS A+ +E+S             PAP+              G S  G  + I+
Sbjct  448  LERLRVPLSTALTKELS-----------TVPAPA-------------AGSSSFGSDLSIQ  483

Query  437  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYM  559
            DLL L+YFGS+F VK+  + F   M++R+HERSSC++Y Y+
Sbjct  484  DLLALVYFGSLFYVKS-PDEFITTMVARKHERSSCITYGYV  523



>gb|KHN01162.1| hypothetical protein glysoja_008064 [Glycine soja]
Length=285

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 120/269 (45%), Positives = 156/269 (58%), Gaps = 25/269 (9%)
 Frame = +2

Query  509   MLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLPHKNALQKCI  688
             ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L GLL+SR A+SS  HKNALQ+C+
Sbjct  1     MLTRTHERGCCLTYDYV-TDDATDLLGEKDLDSISALRGLLVSRPADSSFSHKNALQRCL  59

Query  689   EHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAP-------VGLQAAAMNYG  847
             EHA+LWL  S QPIEPD++VTYA LR KL+KIM+S+YF   P       V   AA  NY 
Sbjct  60    EHARLWLTKSEQPIEPDTDVTYAALREKLNKIMSSEYFITTPEMKAPVEVAAAAAGGNYV  119

Query  848   AYQAPVHESvppvdvpvqvqvhvEDIGVQYQQKEEESISSHGNETHNYQSSHVDQLHQGE  1027
             ++  PVH SV PV+V   V         Q Q+K+E + +  G+ +    S H  +L + E
Sbjct  120   SFHVPVHGSVVPVEVEQPV--------FQSQEKDEGTANFQGHGSEEDLSDHEGELQKDE  171

Query  1028  VGEEDLSALPT---ETEAVQAEVEGVQGDHHKDVKEQQNIPrrsyhnnyrggrggvgrrg  1198
             V  E+   + +   E    QA+VE  + D   + K+QQ+ P       Y+  RGG G  G
Sbjct  172   VEAENAGEVVSAQHEQANQQADVEYNERD--VEAKDQQSYP----RRGYQNHRGGRGGGG  225

Query  1199  ysngrggggrsrgvggAYQNGRSHYSDQP  1285
                   G G   G  G YQNGR+ Y DQP
Sbjct  226   RRGYSNGRGGRSGGRGGYQNGRNQYYDQP  254



>gb|EEE59723.1| hypothetical protein OsJ_12161 [Oryza sativa Japonica Group]
Length=258

 Score =   111 bits (277),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 81/130 (62%), Gaps = 1/130 (1%)
 Frame = +2

Query  425  VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  604
            VV ED     YFG++FD K  Q  F   M++R  ER  C++YDY+ +D +  L       
Sbjct  70   VVFEDFSRSFYFGTLFDFKP-QTEFVATMVARAQERDCCITYDYVTEDAADLLHQSDLDK  128

Query  605  llsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKI  784
            + +L +   +  +A   + H++ALQ C +HA+LWL+ + +PI P+S++TYA +R KLDKI
Sbjct  129  VSALAALAALGPAAAVGVSHRDALQSCAQHARLWLRRADEPIHPESSITYAAVRAKLDKI  188

Query  785  MASQYFTAAP  814
            MAS Y+TA P
Sbjct  189  MASDYYTAQP  198


 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQE  217
            +DGP LSV++KR+RAL+KK NRI QME+SL+ G+ LNKEQE
Sbjct  24   TDGPTLSVVSKRLRALRKKHNRILQMEESLAGGRKLNKEQE  64



>gb|KHN28715.1| hypothetical protein glysoja_025449 [Glycine soja]
Length=201

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 58/86 (67%), Gaps = 7/86 (8%)
 Frame = +2

Query  638  RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAP-  814
            R A+SS  HKNAL +C+EHAKLWL  S QPI PD++VTYA LR KL+KIM+S+YFT  P 
Sbjct  89   RPADSSFSHKNALHRCVEHAKLWLAKSEQPIGPDADVTYAALREKLNKIMSSEYFTTTPE  148

Query  815  ------VGLQAAAMNYGAYQAPVHES  874
                  V   AA  NY ++  PVH S
Sbjct  149  MKAPVEVAAAAAGGNYVSFHVPVHGS  174



>ref|XP_002883544.1| hypothetical protein ARALYDRAFT_479980 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59803.1| hypothetical protein ARALYDRAFT_479980 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 7/83 (8%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA E      GP+L++I+KR+R L+KK NRI+ ME+S+S+GKTLNKEQEETLR+KP V 
Sbjct  1    MAAVE------GPILALISKRLRTLRKKYNRITDMEESISQGKTLNKEQEETLRSKPIVT  54

Query  248  AGIDELEKIRQPLSAAVEEEISL  316
            A IDEL  +R P   +V EEI+L
Sbjct  55   ALIDELINLRIP-PPSVAEEINL  76



>ref|XP_005652064.1| hypothetical protein COCSUDRAFT_64270 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27520.1| hypothetical protein COCSUDRAFT_64270 [Coccomyxa subellipsoidea 
C-169]
Length=535

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 89/270 (33%), Positives = 137/270 (51%), Gaps = 41/270 (15%)
 Frame = +2

Query  98   DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
            +GPVL+VI KR+RA  KKL R+ ++E + + GKTLN +QEE LR K  VL  I+ELE++ 
Sbjct  33   EGPVLTVITKRLRAANKKLKRVEEIESARAAGKTLNADQEEVLRGKAKVLGTIEELERLT  92

Query  278  QPLSAAVEEEISLSVQRHQVSALETPAPS---EESGKEPEGDVENK--------------  406
              L  A++EE S S++    SA E  A +   +E+  + +   E K              
Sbjct  93   PLLKEALQEERS-SLEAAAQSAAEKFARAVAEQEAASKIDALEEAKAATERSAAAAQAEA  151

Query  407  ------------GESDGGV--VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCL  544
                          S  GV   +  LL L+YF  +F       H        + ERS+C 
Sbjct  152  AEAKQQLAELQAAPSGEGVDSAVTRLLQLIYFAMLFLDDGSHQH--------QSERSACR  203

Query  545  SYDYMKdddsidllgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQNSTQ  724
            SYDY  + +   +L  +DL L+S L  L+I RS N +L H+++L  C E A  +L+ S +
Sbjct  204  SYDYDDEGNPDAVLSSNDLTLISQLGQLIIQRSPNQTLCHQDSLAHCKELATKFLERSEE  263

Query  725  PIEPDSNVTYAGLRLKLDKIMASQYFTAAP  814
             + P  N + A +  +L+++++  Y T  P
Sbjct  264  -LLPLLNTSAAYVAERLERVLSLGYITVVP  292



>ref|NP_189112.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB01218.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76936.1| uncharacterized protein AT3G24690 [Arabidopsis thaliana]
Length=158

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 25/131 (19%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA E      G + ++I+KR+R L+KK NRI+ ME+S+S+GKTLNKEQE+TLR+KP V 
Sbjct  1    MAAVE------GQISALISKRLRTLRKKYNRITDMEESISQGKTLNKEQEDTLRSKPIVS  54

Query  248  AGIDELEKIR-QPLSAAVEEEIS----------LSVQRHQVSALETPAPSEESGKEPEGD  394
            A IDEL K+R  P SAA+ EE S          LS  R +V        +EE     + D
Sbjct  55   ALIDELVKLRIPPPSAAISEETSPPAKNKKQQKLSHARKEV--------AEEENVTAKTD  106

Query  395  VENKGESDGGV  427
            +E+   SD G+
Sbjct  107  IEDCKISDDGI  117



>ref|XP_010488577.1| PREDICTED: uncharacterized protein LOC104766398 [Camelina sativa]
Length=152

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 61/84 (73%), Gaps = 7/84 (8%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAATE      GPV+++I+KR+RA +KK N+I  +E+S+S+GKTLNK+Q E LR+KP V 
Sbjct  1    MAATE------GPVVALISKRLRAHRKKYNKIVGLEESISQGKTLNKDQVEILRSKPIVT  54

Query  248  AGIDELEKIR-QPLSAAVEEEISL  316
            A IDEL K+R  P S  V EE S+
Sbjct  55   ALIDELLKLRIPPPSDVVPEETSV  78



>ref|XP_010466896.1| PREDICTED: uncharacterized protein LOC104747029 [Camelina sativa]
Length=156

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 61/84 (73%), Gaps = 7/84 (8%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAATE      GPV+++I+KR+RA +KK N+I  +E+S+S+GKTLNK+Q E LR+KP V 
Sbjct  1    MAATE------GPVVALISKRLRAHRKKYNKIVGLEESISQGKTLNKDQVEILRSKPIVT  54

Query  248  AGIDELEKIR-QPLSAAVEEEISL  316
            A IDEL K+R  P S  V EE S+
Sbjct  55   ALIDELLKLRIPPPSDVVPEETSV  78



>ref|XP_010513678.1| PREDICTED: uncharacterized protein LOC104789722 [Camelina sativa]
Length=152

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 7/85 (8%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAATE      GPV ++I+KR+RA +KK N+I  +E+S+S+GKTLNK+Q E LR+KP V 
Sbjct  1    MAATE------GPVFALISKRLRAHRKKYNKIVGLEESISQGKTLNKDQVEILRSKPIVT  54

Query  248  AGIDELEKIR-QPLSAAVEEEISLS  319
            A IDEL K+R  P S    EE ++S
Sbjct  55   ALIDELLKLRIPPPSGVAPEETTVS  79



>ref|XP_006396698.1| hypothetical protein EUTSA_v10029189mg [Eutrema salsugineum]
 gb|ESQ38151.1| hypothetical protein EUTSA_v10029189mg [Eutrema salsugineum]
Length=166

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = +2

Query  107  VLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR---  277
            VL++I+KR+RAL+KK  RI++ME+S+S+GK LNK+QEE LR+KP V A I+ELEK+R   
Sbjct  9    VLALISKRLRALRKKNKRIAEMEESISQGKILNKDQEEILRSKPIVTALIEELEKLRLPS  68

Query  278  QPLSAAVEEEISLSVQRH  331
             P S AV EEISL  Q+ 
Sbjct  69   PPPSVAVPEEISLPSQKK  86



>emb|CDX94550.1| BnaC09g22860D [Brassica napus]
Length=165

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  107  VLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
            V+++I+KR+RA +K+ NRI++ME+++S+GKTLNKEQEE +R+KP V A I+ELEK+R
Sbjct  9    VMALISKRLRAHRKRYNRITEMEEAVSQGKTLNKEQEEAIRSKPIVTALIEELEKLR  65



>ref|XP_009114578.1| PREDICTED: uncharacterized protein LOC103839843 [Brassica rapa]
 emb|CDY16672.1| BnaA09g20500D [Brassica napus]
Length=161

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  107  VLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  277
            V+++I+KR+RA +K+ NRI++ME+++S+GKTLNKEQ+E +R+KP V A I+ELEK+R
Sbjct  9    VMALISKRLRAHRKRYNRITEMEEAVSQGKTLNKEQQEAIRSKPIVTALIEELEKLR  65



>ref|XP_003613551.1| hypothetical protein MTR_5g037970 [Medicago truncatula]
 gb|AES96509.1| hypothetical protein MTR_5g037970 [Medicago truncatula]
Length=132

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 64/108 (59%), Gaps = 10/108 (9%)
 Frame = +2

Query  224  LRTKPAVLAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVEN  403
            L +  +VLA IDEL K+ + +S+A+ EE+ L+ Q    S  E+   +E S   P G+  N
Sbjct  13   LYSNSSVLALIDELGKLHKSISSALVEELELATQTKNESR-ESETLAENSEPRPSGENSN  71

Query  404  KGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLS  547
                    V+ED+LNLLYFGS+F+VKT QN FT  ML+   ER   +S
Sbjct  72   --------VVEDILNLLYFGSLFEVKT-QNDFTSTMLTMTRERGLLIS  110



>gb|ABA92081.1| hypothetical protein LOC_Os11g11180 [Oryza sativa Japonica Group]
Length=267

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 68/138 (49%), Gaps = 33/138 (24%)
 Frame = +2

Query  146  KKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQPLSAAVEEEISLSVQ  325
            KK N+I QME+SL+ G+ LNKEQE              EL+++  PL+ A+ EE+S    
Sbjct  113  KKHNKILQMEESLTDGRKLNKEQE--------------ELKRMCAPLATALAEELSSRPA  158

Query  326  RHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTE  505
            R   +                    +   S   + IEDLL L+YFGS+FDVK  Q  F  
Sbjct  159  RSPSTV------------------ASSSSSSVDLSIEDLLALIYFGSLFDVKP-QTEFVA  199

Query  506  VMLSREHERSSCLSYDYM  559
             ML R  ER  C ++DY+
Sbjct  200  TMLVRAKERDCCSTFDYV  217


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETL  226
            MAA   ++ +DGP LSV++K + AL+KK N+I QME+ L+ G+ LNKEQ E L
Sbjct  1    MAA--AAEPTDGPTLSVVSKWLHALRKKHNKIIQMEEPLADGRKLNKEQGEDL  51



>gb|KFK37826.1| hypothetical protein AALP_AA3G034300 [Arabis alpina]
Length=151

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 6/65 (9%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAATE      G VL++I+KR+R  +KK NRI++ME+SLS+GKTLNK+QEE LR+KP + 
Sbjct  1    MAATE------GSVLALISKRLRTHRKKQNRIAEMEESLSQGKTLNKDQEEILRSKPIIN  54

Query  248  AGIDE  262
            A I+E
Sbjct  55   ALIEE  59



>gb|KHN36467.1| Abietadienol/abietadienal oxidase [Glycine soja]
Length=136

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +2

Query  506  VMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLPHKNALQKC  685
            +ML++ HER  CL+YDY+  +D+ DLLGE DLD +S L GLL+SR A+SS  HKNAL +C
Sbjct  1    MMLTKTHERGCCLTYDYV-TNDATDLLGEKDLDSISRLRGLLVSRPADSSFSHKNALHRC  59

Query  686  IEHAKLWLQNSTQPIEPDSNVT  751
            +EHAKLWL  S QPI P+++VT
Sbjct  60   VEHAKLWLAKSEQPIGPNADVT  81



>ref|XP_009626346.1| PREDICTED: uncharacterized protein LOC104117072 [Nicotiana tomentosiformis]
Length=134

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 55/98 (56%), Gaps = 11/98 (11%)
 Frame = +2

Query  62   LSMAATEVSDVSDGP-----------VLSVINKRIRALKKKLNRISQMEDSLSKGKTLNK  208
            L     E+++V DGP           V+ V NKR+R L+KKL RI    +  +K +TLNK
Sbjct  9    LKNEGNELNEVEDGPMASNDKEEFKPVMKVTNKRLRILRKKLKRILHSVEFATKRQTLNK  68

Query  209  EQEETLRTKPAVLAGIDELEKIRQPLSAAVEEEISLSV  322
            +QEE L+   ++   I+EL  I + L  A+ EEI L++
Sbjct  69   DQEEALQQIKSIEYAIEELSSIEKDLPGAISEEIQLAM  106



>emb|CCI41035.1| unnamed protein product [Albugo candida]
Length=377

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 15/147 (10%)
 Frame = +2

Query  104  PVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQP  283
            P L  I KR R+ KKKL++I+ +E + + GK LN++Q+E +  KP +   + EL+ +R  
Sbjct  34   PYLDFIQKRKRSYKKKLDKITILEAARADGKVLNEQQKELVSGKPMLERLLLELDMVR--  91

Query  284  LSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV---VIEDLLNLL  454
                 ++ I L   +H +  LE+P   ++   +P     +    D G     IEDLL +L
Sbjct  92   -----DQFIELETDKHPICDLESPRILDKDPIDPPIQTADSTVGDNGDEHHAIEDLLEVL  146

Query  455  -----YFGSMFDVKTLQNHFTEVMLSR  520
                 Y G   ++ T+ +++++V+L +
Sbjct  147  HIVDSYRGLQQNIPTVLDYYSQVLLGK  173



>emb|CCI41034.1| unnamed protein product [Albugo candida]
Length=405

 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 15/147 (10%)
 Frame = +2

Query  104  PVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQP  283
            P L  I KR R+ KKKL++I+ +E + + GK LN++Q+E +  KP +   + EL+ +R  
Sbjct  62   PYLDFIQKRKRSYKKKLDKITILEAARADGKVLNEQQKELVSGKPMLERLLLELDMVR--  119

Query  284  LSAAVEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV---VIEDLLNLL  454
                 ++ I L   +H +  LE+P   ++   +P     +    D G     IEDLL +L
Sbjct  120  -----DQFIELETDKHPICDLESPRILDKDPIDPPIQTADSTVGDNGDEHHAIEDLLEVL  174

Query  455  -----YFGSMFDVKTLQNHFTEVMLSR  520
                 Y G   ++ T+ +++++V+L +
Sbjct  175  HIVDSYRGLQQNIPTVLDYYSQVLLGK  201



>emb|CDY40281.1| BnaA07g09190D [Brassica napus]
Length=199

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 46/90 (51%), Gaps = 18/90 (20%)
 Frame = +2

Query  638  RSANSSLPHKNALQKCIEHAKLWLQNSTQPIEPDSNVT--------------YAGLRLKL  775
            R  +S L HKNAL++CIEH++LW  NS Q I P+ NV+              +  LR KL
Sbjct  30   RPVDSGLSHKNALERCIEHSRLWQANSDQLIAPNCNVSCKKKDFSSYMFCYGFGLLREKL  89

Query  776  D-KIMASQYFTAAP---VGLQAAAMNYGAY  853
               I  S YFT      V  + A  NYG++
Sbjct  90   KMMITGSNYFTITSEMVVQAEVATANYGSF  119



>gb|KHN23080.1| hypothetical protein glysoja_040901 [Glycine soja]
Length=77

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  170  MEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQPLSAAVEEEISLSVQRHQVSALE  349
            ME+ +++GK LNKE EE L +KP++LA IDEL+K++QPL+ A+ E++ ++    Q    E
Sbjct  1    MEEVVTQGKPLNKEHEEVLCSKPSILALIDELDKLQQPLAIALFEDLQINDTSSQNPCHE  60

Query  350  T  352
            T
Sbjct  61   T  61



>gb|EEE51859.1| hypothetical protein OsJ_33386 [Oryza sativa Japonica Group]
Length=113

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETL  226
            MAA   ++ +DGP LSV++K + AL+KK N+I QME+ L+ G+ LNKEQ E L
Sbjct  1    MAA--AAEPTDGPTLSVVSKWLHALRKKHNKIIQMEEPLADGRKLNKEQGEDL  51



>emb|CCA24791.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=443

 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 85/163 (52%), Gaps = 19/163 (12%)
 Frame = +2

Query  59   PLSMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKP  238
            P+   AT+ +     P L+ I KR R+ KKKL+++  +E + + GK LN++Q+E +  KP
Sbjct  50   PIGSIATDTT-FQQHPYLNFIQKRKRSYKKKLDKVIALESACADGKVLNEQQQELVSGKP  108

Query  239  AVLAGIDELEKIRQPLSAAVEEEISLSV----QRHQVSALETPAPSEESGKEPEGDVENK  406
             +   + EL+ IR     ++E++ S+S+    +  Q  A+E+P  + +S    +G++   
Sbjct  109  MLERLLLELDMIRDQFIESMEDKASMSLPDSERVLQEEAMESPKEAPDSAIPTDGELHAT  168

Query  407  GESDGGVVIEDLLNLLYFGSMF-----DVKTLQNHFTEVMLSR  520
             E         LL +L+    +     ++  + ++ ++V+L R
Sbjct  169  TE---------LLKVLHIVDAYRNLDQEIPAVLDYCSQVLLGR  202



>emb|CCA21941.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=335

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 85/163 (52%), Gaps = 19/163 (12%)
 Frame = +2

Query  59   PLSMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKP  238
            P+   AT+ +     P L+ I KR R+ KKKL+++  +E + + GK LN++Q+E +  KP
Sbjct  50   PIGSIATDTT-FQQHPYLNFIQKRKRSYKKKLDKVIALESACADGKVLNEQQQELVSGKP  108

Query  239  AVLAGIDELEKIRQPLSAAVEEEISLSV----QRHQVSALETPAPSEESGKEPEGDVENK  406
             +   + EL+ IR     ++E++ S+S+    +  Q  A+E+P  + +S    +G++   
Sbjct  109  MLERLLLELDMIRDQFIESMEDKASMSLPDSERVLQEEAMESPKEAPDSAIPTDGELHAT  168

Query  407  GESDGGVVIEDLLNLLYFGSMF-----DVKTLQNHFTEVMLSR  520
             E         LL +L+    +     ++  + ++ ++V+L R
Sbjct  169  TE---------LLKVLHIVDAYRNLDQEIPAVLDYCSQVLLGR  202



>gb|AFW67957.1| hypothetical protein ZEAMMB73_254492, partial [Zea mays]
Length=67

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +2

Query  443  LNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYM  559
            L L+YFGS+FDVK  Q+ F  ++ +RE ERSSCL+YDY+
Sbjct  1    LALVYFGSLFDVKQ-QSDFVSLVYTRELERSSCLTYDYV  38



>gb|EEC67891.1| hypothetical protein OsI_35559 [Oryza sativa Indica Group]
Length=289

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 85/206 (41%), Gaps = 70/206 (34%)
 Frame = +2

Query  68   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  247
            MAA   ++ +DGP LSV++K + AL+KK N+I Q+E+ L+ G+ LNKEQ E L      L
Sbjct  1    MAAA--AEPTDGPTLSVVSKWLHALRKKHNKIIQIEEPLADGRKLNKEQGEDL----LAL  54

Query  248  AGIDELEKIRQPLSAAVEEEISLSVQRHQVSALETPAPSEESGKE--PEGDVENK-----  406
                 L  ++ P +  V   +  + +RH       P   +E  ++  P+G V ++     
Sbjct  55   IYFGSLFDVK-PQTEFVATMLVRAKRRHH------PDVEDEEAQQDPPDGGVAHRREEAE  107

Query  407  -GESDGG---VVIEDLLN------------------------------------------  448
             G   G    VVI  L+N                                          
Sbjct  108  QGAGRGALIQVVIVMLINELKRMCAPLATALAEELSSRPARSPSAVASSSSSSVDLSIED  167

Query  449  ---LLYFGSMFDVKTLQNHFTEVMLS  517
               L+YFGS+FDVK  Q  F   ML 
Sbjct  168  LLALIYFGSLFDVKP-QTEFVATMLC  192



>gb|KFM24336.1| hypothetical protein F751_3054 [Auxenochlorella protothecoides]
Length=412

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 72/293 (25%), Positives = 126/293 (43%), Gaps = 49/293 (17%)
 Frame = +2

Query  104  PVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQP  283
            PVL  + KR+R  +KKL  I +++     GK LN +QE  L +K +++A ++ELE++ + 
Sbjct  23   PVLLALAKRLRNQRKKLRGIDEIQAKADVGKALNADQEAALASKASIVAAVEELERLTKL  82

Query  284  LSAAVEEEISLSVQRHQVSALETPAPS------------EESGKEPEGDVENK-------  406
            L   + EE++ + Q  + +A     PS            E++  +  G +  +       
Sbjct  83   LKEPLAEEVAAARQEGEAAAAARAPPSPTKSDAEWLAEREDAVAKAVGPLRQQLSEAKTN  142

Query  407  ------------------GESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHER  532
                               + +G  ++  L+ LLYF ++ D   LQ+  +       +ER
Sbjct  143  AAADAKAAKLAAAAREAAAKKEGEALVGRLVELLYFATVLDPFALQHDVS------HYER  196

Query  533  SSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLPHKNALQKCIEHAKLWLQ  712
              CL Y       +   L  +D+  +++ + ++ SR  N+ L H  AL    + A   L 
Sbjct  197  HVCLMY----AQQAGIPLTPADITNVAVFARMVSSRVFNTQLSHAEALGLSKDLALKALL  252

Query  713  NSTQPIEPDSNVTYAGLRLKLDKIMASQYFTAAPVGLQAAAMNYGAYQAPVHE  871
            +  +P+  D+  T A L   +  I A  Y    P  LQ  A + G    P HE
Sbjct  253  HPNEPLLGDAT-TGADLAEVVKSIQALDYVALVP-NLQGVAGDAGPAPRPGHE  303



>gb|EPS71996.1| hypothetical protein M569_02765, partial [Genlisea aurea]
Length=81

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 8/82 (10%)
 Frame = +2

Query  755  AGLRLKLDKIMASQYFTA-----APVGLQAAAMNYGAYQAPVHESvppvdvpvqvqvhvE  919
            A LR KL+KIMAS+YF       APV + AAA N+ ++QAPVH S      PV V   VE
Sbjct  1    AYLREKLNKIMASEYFITTPEMKAPVEVVAAAGNFNSFQAPVHSS---AIPPVGVTASVE  57

Query  920  DIGVQYQQKEEESISSHGNETH  985
            +   +YQQ+EE S + + +E +
Sbjct  58   NTHEEYQQQEELSPNFYDDEIN  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4956472883014