BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c88290_g1_i1 len=387 path=[365:0-386]

Length=387
                                                                      Score     E

ref|XP_007027053.1|  Heat shock cognate protein 70-1 isoform 2          146   1e-38   
ref|XP_010041882.1|  PREDICTED: heat shock 70 kDa protein cognate...    135   4e-38   
ref|XP_010456364.1|  PREDICTED: probable mediator of RNA polymera...    135   5e-38   
ref|XP_010423854.1|  PREDICTED: probable mediator of RNA polymera...    138   7e-38   
gb|KDO67651.1|  hypothetical protein CISIN_1g0212721mg                  134   1e-37   
gb|AAC84134.1|  heat shock protein                                      136   1e-37   Cichorium intybus [radicchio]
gb|AAA32820.1|  heat shock protein HSP70-2                              134   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KHG18124.1|  Heat shock cognate 70 kDa                               133   2e-37   
gb|KHG30764.1|  Heat shock cognate 70 kDa                               133   2e-37   
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     144   2e-37   
gb|AFV46216.1|  hypothetical protein                                    137   3e-37   
gb|AAA32819.1|  heat shock protein HSP70-1                              134   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb|EAY81902.1|  hypothetical protein OsI_37074                          132   4e-37   Oryza sativa Indica Group [Indian rice]
gb|EAY89449.1|  hypothetical protein OsI_10981                          132   5e-37   Oryza sativa Indica Group [Indian rice]
emb|CDY02235.1|  BnaA03g39320D                                          135   6e-37   
emb|CAA78036.1|  70-kD heat shock protein                               132   6e-37   Solanum tuberosum [potatoes]
emb|CAA78037.1|  70-Kd heat shock protein                               132   6e-37   Solanum tuberosum [potatoes]
ref|XP_010423867.1|  PREDICTED: heat shock 70 kDa protein 18-like       132   6e-37   
emb|CAA54420.1|  heat shock cognate 70-2                                132   7e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDX89754.1|  BnaC03g46680D                                          136   7e-37   
gb|KDO72893.1|  hypothetical protein CISIN_1g036208mg                   137   9e-37   
emb|CDY36723.1|  BnaC02g31440D                                          134   2e-36   
gb|KFK38606.1|  hypothetical protein AALP_AA3G135800                    137   4e-36   
emb|CDY53148.1|  BnaAnng12070D                                          135   4e-36   
gb|ADB85325.1|  putative heat shock cognate                             130   5e-36   Phyllostachys edulis [kikko-chiku]
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     140   5e-36   
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     140   6e-36   
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    138   1e-35   
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   2e-35   
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    138   2e-35   
emb|CDY16175.1|  BnaA09g29090D                                          133   2e-35   
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       137   2e-35   
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       138   2e-35   
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         138   2e-35   
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       138   2e-35   
ref|XP_001751923.1|  predicted protein                                  138   2e-35   
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     138   2e-35   
ref|XP_001783048.1|  predicted protein                                  138   2e-35   
gb|AIZ68155.1|  heat shock protein 70                                   138   2e-35   
ref|XP_001767839.1|  predicted protein                                  138   2e-35   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    138   2e-35   
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                     137   2e-35   
ref|XP_002312089.1|  heat shock protein 70 cognate                      138   2e-35   Populus trichocarpa [western balsam poplar]
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         138   2e-35   
emb|CDP09040.1|  unnamed protein product                                138   2e-35   
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    138   2e-35   
gb|AAB42159.1|  Hsc70                                                   138   2e-35   Solanum lycopersicum
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     138   2e-35   
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   2e-35   
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   2e-35   
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   2e-35   
ref|XP_002316294.1|  heat shock protein 70                              138   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    138   2e-35   
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   2e-35   
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   2e-35   
ref|XP_002312090.1|  heat shock protein 70 cognate                      138   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_002527736.1|  heat shock protein, putative                       138   2e-35   Ricinus communis
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         138   3e-35   
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     138   3e-35   Vitis vinifera
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     137   3e-35   
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             138   3e-35   
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    138   3e-35   
ref|XP_002311161.1|  heat shock protein 70                              138   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    138   3e-35   
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     138   3e-35   
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    138   3e-35   
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             137   3e-35   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    137   3e-35   
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     138   3e-35   
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    139   3e-35   
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    138   3e-35   
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        138   3e-35   
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    138   3e-35   
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             138   3e-35   
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    138   3e-35   
gb|EPS68565.1|  hypothetical protein M569_06198                         138   3e-35   
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       138   3e-35   
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             138   3e-35   
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     138   3e-35   
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    138   3e-35   
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     138   3e-35   
gb|ACR38891.1|  heat shock protein 70                                   138   3e-35   Apopellia endiviifolia (species B)
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    138   3e-35   
gb|ADZ46371.1|  HSP70                                                   138   3e-35   
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     138   3e-35   Vitis vinifera
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             137   3e-35   
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    137   3e-35   
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   3e-35   
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         137   3e-35   
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       137   3e-35   
gb|AGR45355.1|  HSP70                                                   137   3e-35   
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    138   3e-35   
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   3e-35   
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    137   3e-35   
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          138   3e-35   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    137   3e-35   
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    137   3e-35   
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   3e-35   
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   3e-35   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    137   3e-35   
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   3e-35   
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   3e-35   
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    137   3e-35   
gb|EPS60056.1|  heat shock protein 70                                   137   4e-35   
gb|ACB70177.1|  70 kDa heat shock protein                               137   4e-35   Capparis spinosa [caper]
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                137   4e-35   
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    137   4e-35   
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     137   4e-35   
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     137   4e-35   
ref|XP_002891955.1|  early-responsive to dehydration 2                  137   4e-35   
ref|NP_176036.1|  heat shock protein ERD2                               137   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   5e-35   
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     137   5e-35   Vitis vinifera
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...    136   5e-35   
emb|CCD74508.1|  early-responsive to dehydration 2                      137   5e-35   
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     137   6e-35   
emb|CDY31804.1|  BnaC01g27600D                                          135   6e-35   
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     137   6e-35   Vigna radiata [mung bean]
gb|AEK70336.1|  heat shock protein 70                                   137   6e-35   
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   6e-35   
gb|AIU34470.1|  putative heat shock protein                             137   6e-35   
emb|CAA83548.1|  PsHSC71.0                                              137   6e-35   Pisum sativum [garden pea]
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    138   6e-35   
gb|AFA51946.1|  heat shock protein 70                                   137   6e-35   
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             137   6e-35   
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       137   6e-35   Cucurbita maxima [Boston marrow]
ref|XP_003621869.1|  Heat shock protein                                 137   7e-35   
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             137   7e-35   
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             137   7e-35   
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   7e-35   
gb|AIA22210.1|  heat shock protein 70                                   137   7e-35   
gb|AAV97978.1|  heat shock protein hsp70                                137   7e-35   Saussurea medusa
gb|AAV98051.1|  heat shock protein 70                                   137   7e-35   Medicago sativa [alfalfa]
ref|XP_006378714.1|  heat shock protein 70 cognate                      137   7e-35   
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    137   7e-35   
ref|XP_003621886.1|  Heat shock protein                                 137   7e-35   
gb|EAY89450.1|  hypothetical protein OsI_10982                          135   7e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001119156.1|  heat shock cognate protein 70-1                    135   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KHG09207.1|  Heat shock 70 kDa 1 -like protein                       135   7e-35   
gb|AAA62445.1|  heat shock protein                                      137   7e-35   Spinacia oleracea
ref|XP_002873055.1|  predicted protein                                  137   7e-35   
gb|AAM48131.1|AF509336_1  heat shock protein 70                         137   7e-35   Saussurea medusa
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   7e-35   
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             137   7e-35   
gb|ACJ11745.1|  heat shock protein 70                                   137   7e-35   Gossypium hirsutum [American cotton]
ref|WP_039310754.1|  molecular chaperone DnaK                           137   7e-35   
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    137   7e-35   
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                137   7e-35   
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   7e-35   
ref|NP_195869.1|  heat shock protein 70                                 137   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85522.1|  unknown                                                 137   7e-35   Medicago truncatula
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     137   7e-35   
ref|NP_187864.1|  heat shock protein 70-4                               137   8e-35   Arabidopsis thaliana [mouse-ear cress]
gb|ABD32895.1|  Heat shock protein Hsp70                                137   8e-35   Medicago truncatula
gb|ACJ11742.1|  heat shock protein 70                                   137   8e-35   Gossypium hirsutum [American cotton]
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                137   8e-35   
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     136   8e-35   
ref|XP_001759874.1|  predicted protein                                  136   8e-35   
emb|CDY50531.1|  BnaA01g30490D                                          136   8e-35   
ref|NP_187555.1|  heat shock protein 70-3                               136   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    137   8e-35   
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    136   8e-35   
emb|CDP00073.1|  unnamed protein product                                136   8e-35   
emb|CAA05547.1|  heat shock protein 70                                  136   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    136   8e-35   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    136   8e-35   
emb|CDY00784.1|  BnaC03g37680D                                          136   8e-35   
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             136   8e-35   
dbj|BAJ34054.1|  unnamed protein product                                136   8e-35   
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     136   8e-35   
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             136   8e-35   
gb|AGL07711.1|  heat shock protein 70                                   136   8e-35   
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    136   8e-35   
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             136   8e-35   
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    136   8e-35   
emb|CDX73815.1|  BnaA03g32320D                                          136   9e-35   
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        136   9e-35   
emb|CDX85038.1|  BnaC05g20170D                                          132   9e-35   
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                136   9e-35   
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       135   9e-35   
ref|XP_007009369.1|  Heat shock protein 70                              136   9e-35   
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    136   9e-35   
ref|XP_002528432.1|  heat shock protein, putative                       136   1e-34   Ricinus communis
gb|EAY81899.1|  hypothetical protein OsI_37065                          134   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   1e-34   
emb|CCA29120.1|  heat shock protein 70 isoform 1                        136   1e-34   
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   1e-34   
emb|CAB72130.1|  heat shock protein 70                                  136   1e-34   Cucumis sativus [cucumbers]
dbj|BAJ86014.1|  predicted protein                                      136   1e-34   
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg             136   1e-34   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       136   1e-34   
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   1e-34   
gb|ACJ11741.1|  heat shock protein 70                                   136   1e-34   Gossypium hirsutum [American cotton]
ref|XP_008371640.1|  PREDICTED: uncharacterized protein LOC103435023    129   1e-34   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  136   1e-34   
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          136   1e-34   
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   1e-34   
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       136   1e-34   
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     136   1e-34   
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   1e-34   
gb|ACD93209.1|  heat shock protein 70                                   136   1e-34   Camellia sinensis [black tea]
gb|AAB88009.1|  heat shock cognate protein HSC70                        136   1e-34   Brassica napus [oilseed rape]
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     136   1e-34   Vitis vinifera
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    136   1e-34   
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    136   1e-34   Petunia x hybrida [garden petunia]
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   1e-34   
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    136   1e-34   
gb|AAA86903.1|  heat shock protein cognate 70                           130   1e-34   Sorghum bicolor [broomcorn]
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   1e-34   
gb|EYU41710.1|  hypothetical protein MIMGU_mgv1a022248mg                134   1e-34   
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       136   1e-34   Cucurbita maxima [Boston marrow]
gb|AAB97316.1|  cytosolic heat shock 70 protein                         136   1e-34   Spinacia oleracea
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             136   1e-34   
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   1e-34   
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             136   1e-34   
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   1e-34   
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       136   1e-34   
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     136   1e-34   
gb|ACJ11740.1|  heat shock protein 70                                   136   1e-34   Gossypium hirsutum [American cotton]
gb|EPS64948.1|  hypothetical protein M569_09829                         135   1e-34   
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    136   1e-34   
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             136   1e-34   
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     136   1e-34   Vigna radiata [mung bean]
dbj|BAP90755.1|  heat shock protein 70                                  135   1e-34   
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    136   1e-34   
ref|XP_002532297.1|  heat shock protein, putative                       135   2e-34   Ricinus communis
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       136   2e-34   
gb|AII99890.1|  heat shock protein                                      137   2e-34   
gb|ACM42161.1|  heat shock protein 70.58                                135   2e-34   Ageratina adenophora
ref|NP_195870.1|  heat shock cognate protein 70-1                       135   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAS09825.1|  heat shock cognate protein 70                           135   2e-34   Eutrema halophilum
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    135   2e-34   
ref|XP_002873056.1|  HSC70-1                                            135   2e-34   
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    135   2e-34   
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             135   2e-34   
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    135   2e-34   
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             135   2e-34   
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       135   2e-34   
emb|CAA52684.1|  heat shock protein 70 cognate                          135   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    135   2e-34   
ref|XP_003625487.1|  Heat shock protein                                 136   2e-34   
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       135   2e-34   
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    135   3e-34   
emb|CAB72129.1|  heat shock protein 70                                  135   3e-34   Cucumis sativus [cucumbers]
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    135   3e-34   
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          135   3e-34   Sorghum bicolor [broomcorn]
emb|CDP09035.1|  unnamed protein product                                135   3e-34   
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    135   3e-34   
ref|NP_001049712.1|  Os03g0276500                                       135   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   3e-34   
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    135   3e-34   
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     135   3e-34   
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   3e-34   
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    135   3e-34   
gb|AAP04522.1|  heat shock protein 70                                   135   3e-34   Nicotiana tabacum [American tobacco]
gb|AAR17080.1|  heat shock protein 70-3                                 135   3e-34   Nicotiana tabacum [American tobacco]
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    135   3e-34   Solanum lycopersicum
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        135   3e-34   
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    135   3e-34   
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                135   3e-34   
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...    134   3e-34   
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     135   3e-34   
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                135   3e-34   
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     135   3e-34   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             135   3e-34   
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   3e-34   
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    135   3e-34   
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   3e-34   
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     135   3e-34   
gb|EAY89457.1|  hypothetical protein OsI_10990                          133   3e-34   
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   3e-34   
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   3e-34   
emb|CCA29121.1|  heat shock protein 70 isoform 2                        135   3e-34   
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   3e-34   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    137   3e-34   
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        135   4e-34   
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   4e-34   
gb|ADD71975.1|  heat shock protein 70                                   135   4e-34   
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   4e-34   
gb|AFU34347.1|  70-kDa heat shock protein                               135   4e-34   
ref|NP_001068540.1|  Os11g0703900                                       135   4e-34   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    135   4e-34   
gb|ABP35942.1|  heat shock protein 70                                   135   4e-34   
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    135   4e-34   
emb|CAA47948.2|  heat shock protein 70                                  134   4e-34   
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    134   4e-34   
ref|XP_002975959.1|  hypothetical protein SELMODRAFT_104343             125   4e-34   
emb|CDY52661.1|  BnaC01g38510D                                          134   4e-34   
emb|CAA27293.1|  unnamed protein product                                124   5e-34   
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    134   5e-34   
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    134   5e-34   
ref|XP_001785822.1|  predicted protein                                  134   5e-34   
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                134   5e-34   
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...    133   5e-34   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                134   5e-34   
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          134   5e-34   
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           134   6e-34   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    134   6e-34   
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g             134   6e-34   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    134   6e-34   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             134   7e-34   
ref|XP_001767221.1|  predicted protein                                  134   7e-34   
gb|ABX76301.1|  heat shock protein 70                                   134   7e-34   
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    134   8e-34   
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             134   8e-34   
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    134   8e-34   
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    134   9e-34   
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     134   9e-34   
gb|EAY98319.1|  hypothetical protein OsI_20227                          132   1e-33   
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     133   1e-33   
dbj|BAJ91305.1|  predicted protein                                      133   1e-33   
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     135   1e-33   
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     133   1e-33   
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     133   1e-33   
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     133   1e-33   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    133   1e-33   
gb|ACJ54890.1|  heat shock protein 70                                   133   1e-33   
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             133   1e-33   
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    133   1e-33   
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    133   1e-33   
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             133   1e-33   
ref|XP_008649291.1|  PREDICTED: heat shock 70 kDa protein 18-like...    124   2e-33   
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       133   2e-33   
ref|XP_008649290.1|  PREDICTED: heat shock 70 kDa protein 18-like...    124   2e-33   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    134   2e-33   
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    133   2e-33   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    133   2e-33   
gb|KCW74480.1|  hypothetical protein EUGRSUZ_E03189                     132   2e-33   
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             132   2e-33   
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          132   2e-33   
dbj|BAA04848.1|  HSP70                                                  132   3e-33   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    132   3e-33   
gb|EEC71767.1|  hypothetical protein OsI_04375                          130   3e-33   
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        132   3e-33   
ref|XP_008458071.1|  PREDICTED: heat shock cognate 70 kDa protein...    126   3e-33   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          132   3e-33   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    132   4e-33   
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          132   4e-33   
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    132   4e-33   
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    132   4e-33   
gb|ABR18415.1|  unknown                                                 132   4e-33   
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    132   4e-33   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    132   4e-33   
ref|NP_001055754.1|  Os05g0460000                                       132   5e-33   
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    132   5e-33   
gb|AAB99745.1|  HSP70                                                   132   5e-33   
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     132   5e-33   
dbj|BAK00257.1|  predicted protein                                      132   5e-33   
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    131   5e-33   
pir||PC1156  dnaK-type molecular chaperone (clone pMON9508) - mai...    121   5e-33
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    131   6e-33   
gb|EEC76425.1|  hypothetical protein OsI_14101                          130   6e-33   
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       131   6e-33   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    132   6e-33   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    131   6e-33   
dbj|BAK02194.1|  predicted protein                                      131   8e-33   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       131   8e-33   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    131   8e-33   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       131   1e-32   
ref|XP_001781229.1|  predicted protein                                  131   1e-32   
ref|NP_001044757.1|  Os01g0840100                                       131   1e-32   
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    130   1e-32   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       130   1e-32   
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       130   1e-32   
gb|AIU40169.1|  heat shock protein 70                                   130   2e-32   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    129   2e-32   
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    129   2e-32   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          130   2e-32   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    130   2e-32   
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    130   2e-32   
ref|NP_001051724.1|  Os03g0821100                                       130   2e-32   
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    130   2e-32   
dbj|BAK07857.1|  predicted protein                                      130   3e-32   
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     130   3e-32   
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       129   5e-32   
emb|CAA78034.1|  70-kD heat shock protein                               119   5e-32   
gb|KHN13890.1|  Heat shock cognate 70 kDa protein 2                     129   6e-32   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    129   6e-32   
ref|XP_004292135.1|  PREDICTED: heat shock cognate 70 kDa protein...    127   7e-32   
gb|KDP44978.1|  hypothetical protein JCGZ_01478                         127   7e-32   
gb|KDP44977.1|  hypothetical protein JCGZ_01477                         127   7e-32   
gb|ACD45076.1|  heat-shock protein 70                                   128   7e-32   
ref|NP_001183165.1|  uncharacterized protein LOC100501536               128   9e-32   
gb|EMD49224.1|  heat shock protein hsp70A2, putative                    120   2e-31   
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  127   2e-31   
emb|CDO98244.1|  unnamed protein product                                127   2e-31   
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             127   2e-31   
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             127   2e-31   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   127   3e-31   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             127   3e-31   
gb|EGW10857.1|  Heat shock cognate 71 kDa protein                       117   3e-31   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             127   3e-31   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   127   3e-31   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             127   3e-31   
ref|XP_003064239.1|  heat shock protein 70kDa                           127   3e-31   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein-like          127   3e-31   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    127   3e-31   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          127   3e-31   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               127   3e-31   
gb|AAO44919.1|  Hsp70                                                   118   3e-31   
gb|EAW67542.1|  heat shock 70kDa protein 8, isoform CRA_c               117   3e-31   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    126   4e-31   
ref|XP_005667499.1|  PREDICTED: heat shock cognate 71 kDa protein...    117   4e-31   
ref|XP_007023492.1|  Heat shock protein 70B                             126   4e-31   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             126   4e-31   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         126   4e-31   
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like          126   4e-31   
ref|XP_006368489.1|  heat shock protein 70 cognate                      126   5e-31   
ref|XP_006368490.1|  heat shock protein 70 cognate                      126   5e-31   
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     126   5e-31   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             126   5e-31   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             126   6e-31   
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    125   7e-31   
gb|ACC93947.1|  heat-shock protein 70                                   125   7e-31   
emb|CBI36549.3|  unnamed protein product                                121   7e-31   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               125   8e-31   
gb|EMC90781.1|  Heat shock cognate 71 kDa protein                       116   8e-31   
gb|ETK90402.1|  hsp70-like protein                                      118   9e-31   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    125   9e-31   
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2    125   9e-31   
gb|ETI50522.1|  hsp70-like protein                                      118   9e-31   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          125   1e-30   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          125   1e-30   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          125   1e-30   
ref|XP_010321717.1|  PREDICTED: heat shock 70 kDa protein 18-like       116   1e-30   
gb|ENN76737.1|  hypothetical protein YQE_06802                          115   1e-30   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    125   1e-30   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     126   1e-30   
prf||1205208A  heat shock protein hsp70                                 125   1e-30
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          125   1e-30   
ref|XP_008354483.1|  PREDICTED: heat shock cognate 70 kDa protein...    123   1e-30   
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like          125   1e-30   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          125   1e-30   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          125   1e-30   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    125   1e-30   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          125   2e-30   
gb|ETL43818.1|  hsp70-like protein                                      118   2e-30   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               124   2e-30   
ref|XP_003788031.1|  PREDICTED: heat shock cognate 71 kDa protein...    117   2e-30   
dbj|BAM44861.1|  heat shock protein                                     121   2e-30   
ref|XP_002502667.1|  heat shock 70 kDa protein                          124   2e-30   
ref|XP_010787963.1|  PREDICTED: heat shock cognate 71 kDa protein...    117   2e-30   
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    125   3e-30   
gb|ETL96982.1|  hsp70-like protein                                      117   3e-30   
ref|XP_003768981.1|  PREDICTED: heat shock 70 kDa protein 1-like        115   3e-30   
ref|XP_003919076.1|  PREDICTED: heat shock cognate 71 kDa protein...    117   3e-30   
gb|ETO79272.1|  hsp70-like protein                                      115   3e-30   
ref|XP_004255736.1|  heat shock protein, putative                       116   3e-30   
ref|NP_001153992.1|  heat shock cognate 70-kd protein                   117   3e-30   
ref|NP_001140123.1|  Heat shock cognate 71 kDa protein                  116   3e-30   
ref|XP_008931816.1|  PREDICTED: heat shock cognate 71 kDa protein...    118   3e-30   
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     124   4e-30   
gb|AAM94003.1|  heat shock protein 70                                   118   5e-30   
gb|EKG08136.1|  heat shock 70 kDa protein, putative                     117   5e-30   
gb|ETM50132.1|  hsp70-like protein                                      117   6e-30   
ref|XP_008912741.1|  hsp70-like protein                                 118   6e-30   
ref|XP_002512742.1|  heat shock protein, putative                       123   6e-30   
dbj|BAG62134.1|  unnamed protein product                                117   6e-30   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               123   6e-30   
ref|XP_004707724.1|  PREDICTED: heat shock cognate 71 kDa protein...    116   7e-30   
gb|AEY80026.1|  heat shock protein 70                                   123   7e-30   
sp|P25840.2|HSP70_CHLRE  RecName: Full=Heat shock 70 kDa protein        123   8e-30   
ref|XP_001701326.1|  heat shock protein 70A                             123   8e-30   
ref|XP_001421920.1|  Heat Shock Protein 70, cytosolic                   123   8e-30   
gb|ACV52590.1|  heat shock protein 70-like protein                      116   9e-30   
ref|XP_009315967.1|  putative heat shock protein 70                     114   9e-30   
gb|ACJ54702.1|  heat shock protein 70                                   122   1e-29   
gb|KDD74618.1|  heat shock protein Hsp70                                122   1e-29   
gb|ABK25453.1|  unknown                                                 122   1e-29   
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...    122   1e-29   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               122   1e-29   
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               122   1e-29   
ref|XP_008471042.1|  PREDICTED: heat shock 70 kDa protein cognate...    114   1e-29   
ref|XP_004075396.1|  PREDICTED: heat shock cognate 70 kDa protein...    122   1e-29   
emb|CDQ70519.1|  unnamed protein product                                116   1e-29   
emb|CBI31691.3|  unnamed protein product                                120   1e-29   
ref|XP_007013854.1|  Heat shock protein 70B                             122   1e-29   
ref|XP_002947129.1|  heat-shock inducible Hsp70                         122   1e-29   
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein-like          122   1e-29   
gb|KDO67637.1|  hypothetical protein CISIN_1g041815mg                   120   2e-29   
ref|XP_004300725.1|  PREDICTED: heat shock cognate 70 kDa protein...    122   2e-29   
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          122   2e-29   
ref|XP_010063601.1|  PREDICTED: probable mediator of RNA polymera...    121   2e-29   
ref|XP_002512741.1|  heat shock protein, putative                       122   2e-29   
gb|AFP65439.1|  heat shock protein 70KD                                 122   2e-29   
gb|AES65513.2|  animal HSPA9 nucleotide-binding domain protein          123   2e-29   
gb|KHN13881.1|  Heat shock 70 kDa protein 4                             112   2e-29   
ref|XP_003595262.1|  Heat shock protein                                 123   2e-29   
ref|XP_006743453.1|  PREDICTED: heat shock cognate 71 kDa protein       114   2e-29   



>ref|XP_007027053.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY07555.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
Length=457

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  151  LFVFL*LFIERKEEIMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV  330
             F+F  +   ++E++MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV
Sbjct  2    FFIFFFVDTAKEEKVMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV  61

Query  331  AFTDTERLIGDAAKNQVAM  387
             FTDTERLIGDAAKNQVAM
Sbjct  62   GFTDTERLIGDAAKNQVAM  80



>ref|XP_010041882.1| PREDICTED: heat shock 70 kDa protein cognate 1-like, partial 
[Eucalyptus grandis]
Length=83

 Score =   135 bits (339),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010456364.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=115

 Score =   135 bits (341),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010423854.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=190

 Score =   138 bits (347),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KDO67651.1| hypothetical protein CISIN_1g0212721mg, partial [Citrus sinensis]
Length=109

 Score =   134 bits (338),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAC84134.1| heat shock protein [Cichorium intybus]
Length=153

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAA32820.1| heat shock protein HSP70-2, partial [Arabidopsis thaliana]
Length=102

 Score =   134 bits (338),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KHG18124.1| Heat shock cognate 70 kDa [Gossypium arboreum]
Length=77

 Score =   133 bits (335),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KHG30764.1| Heat shock cognate 70 kDa [Gossypium arboreum]
Length=73

 Score =   133 bits (334),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EMS45385.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=762

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 85/116 (73%), Gaps = 2/116 (2%)
 Frame = +1

Query  43   WKSSSSIYNLPHPSRPLHSQIF-RAHSYSTDSLFRIWLFVFL*LFIERKEEIMAGKGEGP  219
            W+  S    LP PS PL   ++     +STD ++  W   F+    + +   MA KG+GP
Sbjct  86   WRVGSISGLLPSPSLPLVKVLYILGIRFSTDDIYPKWQ-TFVKPLKKPEAREMAAKGDGP  144

Query  220  AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  387
            AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  145  AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  200



>gb|AFV46216.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=233

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAA32819.1| heat shock protein HSP70-1, partial [Arabidopsis thaliana]
Length=120

 Score =   134 bits (336),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EAY81902.1| hypothetical protein OsI_37074 [Oryza sativa Indica Group]
Length=85

 Score =   132 bits (333),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EAY89449.1| hypothetical protein OsI_10981 [Oryza sativa Indica Group]
Length=73

 Score =   132 bits (331),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDY02235.1| BnaA03g39320D [Brassica napus]
Length=185

 Score =   135 bits (340),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CAA78036.1| 70-kD heat shock protein [Solanum tuberosum]
Length=71

 Score =   132 bits (331),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CAA78037.1| 70-Kd heat shock protein [Solanum tuberosum]
Length=72

 Score =   132 bits (331),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010423867.1| PREDICTED: heat shock 70 kDa protein 18-like [Camelina sativa]
Length=97

 Score =   132 bits (333),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTP YVAFTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPCYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CAA54420.1| heat shock cognate 70-2 [Arabidopsis thaliana]
Length=98

 Score =   132 bits (333),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGKGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDX89754.1| BnaC03g46680D [Brassica napus]
Length=224

 Score =   136 bits (342),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  40   MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  99

Query  376  QVAM  387
            QVAM
Sbjct  100  QVAM  103



>gb|KDO72893.1| hypothetical protein CISIN_1g036208mg, partial [Citrus sinensis]
Length=279

 Score =   137 bits (345),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDY36723.1| BnaC02g31440D [Brassica napus]
Length=195

 Score =   134 bits (337),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDR+EIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRIEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KFK38606.1| hypothetical protein AALP_AA3G135800 [Arabis alpina]
Length=357

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDY53148.1| BnaAnng12070D [Brassica napus]
Length=256

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ADB85325.1| putative heat shock cognate [Phyllostachys edulis]
Length=93

 Score =   130 bits (326),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/64 (95%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MA KG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAAKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  94   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  153

Query  376  QVAM  387
            QVAM
Sbjct  154  QVAM  157



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  94   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  153

Query  376  QVAM  387
            QVAM
Sbjct  154  QVAM  157



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010495044.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=611

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDY16175.1| BnaA09g29090D [Brassica napus]
Length=257

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +1

Query  199  AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  378
            AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQ
Sbjct  3    AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  62

Query  379  VAM  387
            VAM
Sbjct  63   VAM  65



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_001751923.1| predicted protein [Physcomitrella patens]
 gb|EDQ83358.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_001783048.1| predicted protein [Physcomitrella patens]
 gb|EDQ52117.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_001767839.1| predicted protein [Physcomitrella patens]
 gb|EDQ67353.1| predicted protein [Physcomitrella patens]
Length=649

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010423858.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KCW50223.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=615

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009374678.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=647

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006365705.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KCW50224.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=632

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein-like [Fragaria vesca 
subsp. vesca]
Length=649

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006297174.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
 gb|EOA30072.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
Length=649

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008369876.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Malus domestica]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010446275.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=632

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006349004.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 71/94 (76%), Gaps = 9/94 (10%)
 Frame = +1

Query  106  FRAHSYSTDSLFRIWLFVFL*LFIERKEEIMAGKGEGPAIGIDLGTTYSCVGVWQHDRVE  285
            F + S+S  S F                E MAGKGEGPAIGIDLGTTYSCVGVWQHDRVE
Sbjct  47   FSSSSFSYISFF---------FLSSPHAETMAGKGEGPAIGIDLGTTYSCVGVWQHDRVE  97

Query  286  IIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  387
            IIANDQGNRTTPSYV FTDTERLIGDAAKNQVAM
Sbjct  98   IIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAM  131



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006436017.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
 ref|XP_006486087.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
 gb|ESR49257.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
Length=653

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein-like [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Fragaria vesca subsp. vesca]
Length=647

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ACR38891.1| heat shock protein 70 [Pellia endiviifolia (species B)]
 gb|ACR38900.1| heat shock protein 70 [Pellia endiviifolia (species B)]
Length=651

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006407319.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
 gb|ESQ48772.1| hypothetical protein EUTSA_v10020257mg [Eutrema salsugineum]
Length=650

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Fragaria vesca subsp. vesca]
Length=649

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010423825.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37c [Camelina sativa]
Length=658

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010490742.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=654

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010463615.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006349005.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EPS60056.1| heat shock protein 70 [Genlisea aurea]
Length=653

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EYU33210.1| hypothetical protein MIMGU_mgv1a002616mg [Erythranthe guttata]
Length=653

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSC+GVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCIGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002891955.1| early-responsive to dehydration 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68214.1| early-responsive to dehydration 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=606

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|NP_176036.1| heat shock protein ERD2 [Arabidopsis thaliana]
 sp|Q9C7X7.1|HSP7N_ARATH RecName: Full=Heat shock 70 kDa protein 18; AltName: Full=Heat 
shock protein 70-18; Short=AtHsp70-18; AltName: Full=Heat-shock 
protein 70T-1 [Arabidopsis thaliana]
 gb|AAG51503.1|AC058785_6 heat shock protein, putative [Arabidopsis thaliana]
 gb|ABE65717.1| heat shock cognate 70 kDa protein/HSC70/HSP70 [Arabidopsis thaliana]
 gb|AEE33389.1| heat shock protein ERD2 [Arabidopsis thaliana]
Length=617

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009112006.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=517

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CCD74508.1| early-responsive to dehydration 2 [Arabidopsis halleri subsp. 
halleri]
Length=622

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDY31804.1| BnaC01g27600D [Brassica napus]
Length=417

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CAA83548.1| PsHSC71.0 [Pisum sativum]
Length=647

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010456365.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=931

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010465032.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EAY89450.1| hypothetical protein OsI_10982 [Oryza sativa Indica Group]
Length=438

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|NP_001119156.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 gb|AED90481.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=521

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KHG09207.1| Heat shock 70 kDa 1 -like protein [Gossypium arboreum]
Length=506

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002873055.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49314.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=653

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAM48131.1|AF509336_1 heat shock protein 70 [Saussurea medusa]
Length=647

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002884737.1| heat shock cognate 70 kDa protein 3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60996.1| heat shock cognate 70 kDa protein 3 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|NP_195869.1| heat shock protein 70 [Arabidopsis thaliana]
 sp|P22954.2|MD37D_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 2; 
AltName: Full=Heat shock cognate 70 kDa protein 2; AltName: 
Full=Heat shock cognate protein 70-2; Short=AtHsc70-2; AltName: 
Full=Heat shock protein 70-2; Short=AtHsp70-2 [Arabidopsis 
thaliana]
 emb|CAB85986.1| dnaK-type molecular chaperone hsc70.1-like [Arabidopsis thaliana]
 gb|AAM13151.1| DnaK-type molecular chaperone hsc70.1-like [Arabidopsis thaliana]
 gb|AAP37770.1| At5g02490 [Arabidopsis thaliana]
 dbj|BAE99142.1| dnaK-type molecular chaperone hsc70.1 - like [Arabidopsis thaliana]
 gb|AED90479.1| heat shock protein 70 [Arabidopsis thaliana]
Length=653

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_001759874.1| predicted protein [Physcomitrella patens]
 gb|EDQ75378.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDY50531.1| BnaA01g30490D [Brassica napus]
Length=650

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|NP_187555.1| heat shock protein 70-3 [Arabidopsis thaliana]
 ref|NP_001189847.1| heat shock protein 70-3 [Arabidopsis thaliana]
 sp|O65719.1|HSP7C_ARATH RecName: Full=Heat shock 70 kDa protein 3; AltName: Full=Heat 
shock cognate 70 kDa protein 3; AltName: Full=Heat shock cognate 
protein 70-3; Short=AtHsc70-3; AltName: Full=Heat shock 
protein 70-3; Short=AtHsp70-3 [Arabidopsis thaliana]
 gb|AAF14038.1|AC011436_22 heat-shock protein (At-hsc70-3) [Arabidopsis thaliana]
 gb|AAF23276.1|AC016661_1 heat shock cognate 70kD protein [Arabidopsis thaliana]
 emb|CAA76606.1| At-hsc70-3 [Arabidopsis thaliana]
 gb|AAK92833.1| putative heat-shock protein At-hsc70-3 [Arabidopsis thaliana]
 gb|AAM20310.1| putative heat-shock protein [Arabidopsis thaliana]
 gb|AAM26685.1| At3g09440/F11F8.1 [Arabidopsis thaliana]
 gb|AAN46823.1| At3g09440/F11F8.1 [Arabidopsis thaliana]
 gb|AEE74767.1| heat shock protein 70-3 [Arabidopsis thaliana]
 gb|AEE74768.1| heat shock protein 70-3 [Arabidopsis thaliana]
Length=649

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004156718.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
Length=659

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CAA05547.1| heat shock protein 70 [Arabidopsis thaliana]
Length=650

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010486980.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010484430.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=652

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPS+VAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSFVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDY00784.1| BnaC03g37680D [Brassica napus]
Length=650

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009120551.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=650

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CDX85038.1| BnaC05g20170D [Brassica napus]
Length=263

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/62 (98%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +1

Query  202  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  381
            GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQV
Sbjct  4    GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  63

Query  382  AM  387
            AM
Sbjct  64   AM  65



>gb|EYU19903.1| hypothetical protein MIMGU_mgv1a002628mg [Erythranthe guttata]
Length=652

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KHG00348.1| Heat shock 70 kDa 4 -like protein [Gossypium arboreum]
Length=570

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004307529.1| PREDICTED: heat shock cognate 70 kDa protein-like [Fragaria vesca 
subsp. vesca]
Length=649

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QV M
Sbjct  61   QVTM  64



>dbj|BAJ86014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006424798.1| hypothetical protein CICLE_v10028007mg [Citrus clementina]
 gb|ESR38038.1| hypothetical protein CICLE_v10028007mg [Citrus clementina]
Length=636

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT+TERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTNTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EMT11692.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=651

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_008371640.1| PREDICTED: uncharacterized protein LOC103435023 [Malus domestica]
Length=173

 Score =   129 bits (324),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEII NDQ NRTTPSYVAFTDTE LIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIVNDQSNRTTPSYVAFTDTEMLIGDAAKN  60

Query  376  QVAM  387
            QVA+
Sbjct  61   QVAV  64



>ref|XP_010106444.1| Heat shock cognate 70 kDa protein [Morus notabilis]
 gb|EXC10620.1| Heat shock cognate 70 kDa protein [Morus notabilis]
Length=652

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_003558228.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=651

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009784009.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana sylvestris]
Length=651

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAA86903.1| heat shock protein cognate 70, partial [Sorghum bicolor]
Length=209

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GP+IGIDLGTTYSCVGVWQ DRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPSIGIDLGTTYSCVGVWQRDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009414319.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEI+ANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIVANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EYU41710.1| hypothetical protein MIMGU_mgv1a022248mg, partial [Erythranthe 
guttata]
Length=371

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/64 (95%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_007139236.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
 gb|ESW11230.1| hypothetical protein PHAVU_008G012600g [Phaseolus vulgaris]
Length=647

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_009604213.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana tomentosiformis]
Length=651

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EPS64948.1| hypothetical protein M569_09829, partial [Genlisea aurea]
Length=635

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/65 (97%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +1

Query  193  IMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  372
            +MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  8    LMAVKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  67

Query  373  NQVAM  387
            NQVAM
Sbjct  68   NQVAM  72



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDPERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|EMS65159.1| Heat shock cognate 70 kDa protein [Triticum urartu]
Length=702

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AII99890.1| heat shock protein [Cicer arietinum]
Length=847

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|NP_195870.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 sp|P22953.3|MD37E_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37e; AltName: Full=Heat shock 70 kDa protein 1; 
AltName: Full=Heat shock cognate 70 kDa protein 1; AltName: 
Full=Heat shock cognate protein 70-1; Short=AtHsc70-1; AltName: 
Full=Heat shock protein 70-1; Short=AtHsp70-1; AltName: 
Full=Protein EARLY-RESPONSIVE TO DEHYDRATION 2 [Arabidopsis 
thaliana]
 emb|CAB85987.1| dnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAL09715.1| AT5g02500/T22P11_90 [Arabidopsis thaliana]
 gb|AAM53305.1| DnaK-type molecular chaperone hsc70.1 [Arabidopsis thaliana]
 gb|AAO22583.1| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
 gb|AED90480.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=651

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AAS09825.1| heat shock cognate protein 70 [Eutrema halophilum]
Length=651

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|KFK24738.1| hypothetical protein AALP_AA8G018100 [Arabis alpina]
Length=650

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_002873056.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49315.1| HSC70-1 [Arabidopsis lyrata subsp. lyrata]
Length=650

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010452093.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Camelina sativa]
 ref|XP_010452094.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Camelina sativa]
 ref|XP_010490701.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006287234.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
 gb|EOA20132.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
Length=651

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_010423853.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Camelina sativa]
Length=651

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>ref|XP_006398709.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
 gb|ESQ40162.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
Length=651

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>gb|AGZ15406.1| heat shock cognate 70 kDa protein [Phaseolus vulgaris]
Length=651

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



>emb|CAA52684.1| heat shock protein 70 cognate [Arabidopsis thaliana]
Length=651

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +1

Query  196  MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  375
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  376  QVAM  387
            QVAM
Sbjct  61   QVAM  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 530990727458