BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c87935_g1_i1 len=936 path=[914:0-935]

Length=936
                                                                      Score     E

ref|XP_004147499.1|  PREDICTED: ribonuclease MC-like                    116   3e-27   
dbj|BAH22122.1|  S-RNase                                                114   2e-26   Prunus yedoensis [Cheju native flowering cherry]
ref|XP_008443402.1|  PREDICTED: ribonuclease MC-like                    114   3e-26   
dbj|BAI77869.1|  S23-RNase                                              112   1e-25   Prunus dulcis [sweet almond]
gb|AAP92435.1|  S-RNase                                                 111   2e-25   Prunus avium [gean]
gb|ABV02077.1|  S-locus S-RNase S24                                     111   2e-25   Prunus spinosa [blackthorn]
gb|ABV02076.1|  S-locus S-RNase S19                                     109   7e-25   Prunus spinosa [blackthorn]
gb|AAT69245.1|  S2-RNase protein                                        110   7e-25   Prunus armeniaca
gb|ABY82413.1|  self-incompatibility associated ribonuclease            110   8e-25   Prunus pseudocerasus [Chinese sour cherry]
gb|AAT69248.1|  S4-RNase protein                                        109   1e-24   Prunus armeniaca
dbj|BAG74776.1|  S3-RNase                                               108   2e-24   Prunus mume [ume]
gb|ABD49101.1|  S13-RNase                                               108   3e-24   Prunus avium [gean]
gb|AAZ06135.1|  S-RNase                                                 108   4e-24   Prunus dulcis [sweet almond]
gb|ABF61823.1|  Sh-RNase                                                107   6e-24   Prunus salicina [Japanese plum]
dbj|BAJ41469.1|  S-ribonuclease 4                                       107   6e-24   
emb|CAC27789.1|  RNase S6                                               106   1e-23   Prunus avium [gean]
gb|ABY82415.1|  self-incompatibility associated ribonuclease            106   2e-23   Prunus pseudocerasus [Chinese sour cherry]
dbj|BAA36388.1|  S6-RNase                                               105   2e-23   Prunus avium [gean]
dbj|BAA83480.1|  S4-RNase                                               105   3e-23   Prunus avium [gean]
dbj|BAC56116.1|  S7-RNase                                               105   3e-23   Prunus mume [ume]
gb|ABR19609.1|  S22-RNase                                               105   3e-23   Prunus avium [gean]
gb|ADZ48267.1|  S-locus-associated ribonuclease                         105   4e-23   
gb|ABV02074.1|  S-locus S-RNase S15                                     105   4e-23   Prunus spinosa [blackthorn]
gb|ABA26546.1|  S-RNase                                                 105   5e-23   Prunus dulcis [sweet almond]
gb|ABY82414.1|  self-incompatibility associated ribonuclease            104   7e-23   Prunus pseudocerasus [Chinese sour cherry]
gb|ABE27180.1|  S-locus S-RNase c                                       104   7e-23   Prunus armeniaca
gb|AAX62734.1|  self-incompatibility associated ribonuclease            103   8e-23   Prunus dulcis [sweet almond]
gb|ABW08114.1|  S26-RNase                                               104   8e-23   Prunus cerasus [pie cherry]
gb|ABY65900.1|  S-RNase                                                 103   9e-23   Prunus pseudocerasus [Chinese sour cherry]
gb|ABJ97522.1|  S-RNase                                                 104   9e-23   Prunus webbii
gb|ABG76213.1|  S-RNase                                                 103   9e-23   Prunus spinosa [blackthorn]
gb|ABB40578.1|  ribonuclease S26-RNase                                  103   1e-22   Prunus cerasus [pie cherry]
gb|ACJ22520.1|  S7-2 RNase                                              103   1e-22   Prunus spinosa [blackthorn]
gb|ADZ74126.1|  self-incompatibility associated ribonuclease S8         103   2e-22   
gb|ABG76217.1|  S-RNase                                                 102   2e-22   Prunus spinosa [blackthorn]
gb|ADZ48269.1|  S-locus-associated ribonuclease                         103   2e-22   
dbj|BAA34664.1|  Sc-RNase                                               103   2e-22   Prunus dulcis [sweet almond]
gb|ABF61820.1|  Sf-RNase                                                103   2e-22   Prunus salicina [Japanese plum]
dbj|BAF42766.1|  Sb-RNase                                               103   2e-22   Prunus salicina [Japanese plum]
gb|ABW74347.1|  S34-RNase                                               103   2e-22   Prunus cerasus [pie cherry]
ref|XP_011070992.1|  PREDICTED: extracellular ribonuclease LE-like      103   3e-22   
gb|ABV02075.1|  S-locus S-RNase S16                                     103   3e-22   Prunus spinosa [blackthorn]
gb|ABF61822.1|  S8-RNase                                                102   3e-22   Prunus salicina [Japanese plum]
gb|AGH17535.1|  S48-RNase                                               101   3e-22   
gb|ABL86027.1|  S-RNase                                                 102   3e-22   Prunus tenella [dwarf Russian almond]
dbj|BAF91153.1|  S-ribonuclease                                         101   3e-22   Prunus mume [ume]
gb|AFI24537.1|  self-incompatibility associated ribonuclease S4         102   3e-22   
ref|XP_007151480.1|  hypothetical protein PHAVU_004G050200g             102   4e-22   
gb|ABA26545.1|  S-RNase                                                 102   5e-22   Prunus dulcis [sweet almond]
gb|AAF82612.2|AF157008_1  self-incompatibility associated ribonuc...    102   5e-22   Prunus dulcis [sweet almond]
gb|AAP92437.1|  S-RNase                                                 102   5e-22   Prunus avium [gean]
dbj|BAJ41467.1|  S-ribonuclease 3                                       102   5e-22   
dbj|BAC56115.1|  S1-RNase                                               102   5e-22   Prunus mume [ume]
dbj|BAA83479.1|  S1-RNase                                               102   5e-22   Prunus avium [gean]
gb|ABV72004.1|  S16-RNase                                               102   5e-22   Prunus mume [ume]
dbj|BAA10891.1|  ribonuclease (RNase LC1)                               102   5e-22   Luffa aegyptiaca [dishcloth gourd]
dbj|BAF91848.1|  Se-RNase                                               102   6e-22   Prunus salicina [Japanese plum]
dbj|BAA36387.1|  S2-RNase                                               101   6e-22   Prunus avium [gean]
gb|ACU25553.1|  self-incompatibility associated ribonuclease S2         102   6e-22   
dbj|BAC56114.1|  Sf-RNase                                               101   7e-22   Prunus mume [ume]
gb|ABL86035.1|  S-RNase                                                 100   7e-22   Prunus tenella [dwarf Russian almond]
dbj|BAA95158.1|  Sb-RNase                                               101   8e-22   Prunus salicina [Japanese plum]
gb|ADD71779.1|  S38-RNase                                               100   8e-22   Prunus armeniaca
gb|ADZ48270.1|  S-locus-associated ribonuclease                         101   8e-22   
dbj|BAF56249.1|  S-RNase                                                100   9e-22   Prunus speciosa [Oshima cherry]
gb|ADZ74121.1|  self-incompatibility associated ribonuclease S1         101   1e-21   
emb|CAC27785.1|  RNase S2                                               101   1e-21   Prunus avium [gean]
gb|ADZ48268.1|  S-locus-associated ribonuclease                         101   1e-21   
gb|AHJ59550.1|  S locus S-RNase 52                                      101   1e-21   
gb|ABY65899.1|  S-RNase                                                 100   1e-21   Prunus pseudocerasus [Chinese sour cherry]
gb|AAP33485.1|  incompatibility S-RNase                               99.8    1e-21   Prunus armeniaca
dbj|BAA36389.1|  S3-RNase                                               100   1e-21   Prunus avium [gean]
gb|EAZ04800.1|  hypothetical protein OsI_26973                          101   1e-21   Oryza sativa Indica Group [Indian rice]
gb|EFA82171.1|  ribonuclease T2                                         100   1e-21   Polysphondylium pallidum PN500
gb|ABJ97523.1|  S-RNase                                                 100   2e-21   Prunus webbii
gb|ABA26543.1|  S-RNase                                                 100   2e-21   Prunus dulcis [sweet almond]
dbj|BAF56244.1|  S-RNase                                              99.4    2e-21   Prunus speciosa [Oshima cherry]
dbj|BAF56250.1|  S-RNase                                              98.6    3e-21   Prunus speciosa [Oshima cherry]
gb|ABY82412.1|  self-incompatibility associated ribonuclease            100   3e-21   Prunus pseudocerasus [Chinese sour cherry]
gb|ABW08113.1|  S7-RNase                                                100   3e-21   Prunus avium [gean]
gb|ABQ51155.1|  S16-RNase                                             99.4    3e-21   Prunus armeniaca
gb|ABF61821.1|  S7-RNase                                              99.8    3e-21   Prunus salicina [Japanese plum]
ref|XP_002892796.1|  ribonuclease T2 family protein                     100   3e-21   
dbj|BAC20937.1|  Sd-RNase                                             99.8    3e-21   Prunus salicina [Japanese plum]
gb|AAK58579.1|AF267512_1  Si-RNase                                    98.6    3e-21   Prunus dulcis [sweet almond]
dbj|BAK19919.1|  self-incompatibility associated ribonuclease         98.6    4e-21   
ref|XP_006303725.1|  hypothetical protein CARUB_v10011861mg           99.8    4e-21   
gb|AAW26577.1|  SJCHGC05678 protein                                   99.8    4e-21   Schistosoma japonicum
ref|XP_640939.1|  ribonuclease T2                                     99.8    4e-21   Dictyostelium discoideum AX4
gb|ABL86031.1|  S-RNase                                               98.6    4e-21   Prunus tenella [dwarf Russian almond]
dbj|BAN14352.1|  S-like ribonuclease                                  99.8    4e-21   
gb|AAZ91366.1|  S7 S-RNase                                            97.8    5e-21   Prunus webbii
dbj|BAA10892.1|  ribonuclease (RNase LC2)                             99.0    5e-21   Luffa aegyptiaca [dishcloth gourd]
gb|ABG76215.1|  S-RNase                                               99.0    5e-21   Prunus spinosa [blackthorn]
dbj|BAN14351.1|  S-like ribonuclease                                  99.4    6e-21   
dbj|GAM22940.1|  hypothetical protein SAMD00019534_061150             99.0    6e-21   
gb|ADD20973.1|  S35-RNase                                             97.8    6e-21   Prunus armeniaca
emb|CAM84220.1|  ribonuclease                                         97.8    8e-21   Prunus webbii
gb|ABW71898.1|  ribonuclease S6                                       97.8    8e-21   Prunus avium [gean]
ref|XP_010495851.1|  PREDICTED: ribonuclease 3-like                   99.0    8e-21   
ref|XP_009103113.1|  PREDICTED: ribonuclease 3                        98.6    8e-21   
dbj|BAF03593.1|  S-like RNase                                         98.6    9e-21   Fagopyrum homotropicum
ref|XP_009117923.1|  PREDICTED: ribonuclease 3-like                   98.6    9e-21   
ref|NP_563941.1|  ribonuclease T2                                     98.6    9e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CAZ68890.1|  S-ribonuclease                                       97.8    9e-21   
ref|XP_010258337.1|  PREDICTED: ribonuclease 1-like                   99.0    1e-20   
ref|XP_010477807.1|  PREDICTED: ribonuclease 3                        98.2    1e-20   
ref|XP_002512930.1|  ribonuclease t2, putative                        99.0    1e-20   Ricinus communis
ref|XP_004505385.1|  PREDICTED: ribonuclease S-7-like                 98.2    1e-20   
emb|CDY20583.1|  BnaC07g12500D                                        98.2    1e-20   
dbj|BAF56256.1|  S-RNase                                              96.7    1e-20   Prunus speciosa [Oshima cherry]
ref|XP_006415967.1|  hypothetical protein EUTSA_v10008717mg           97.8    1e-20   
gb|AAP92436.1|  S-RNase                                               98.2    2e-20   Prunus avium [gean]
ref|XP_004367303.1|  ribonuclease T2                                  98.2    2e-20   
dbj|BAF03591.1|  S-like RNase                                         97.8    2e-20   Fagopyrum esculentum
gb|AFI24539.1|  self-incompatibility associated ribonuclease S6       97.1    2e-20   
ref|XP_006305515.1|  hypothetical protein CARUB_v10009986mg           98.6    2e-20   
gb|KDP41205.1|  hypothetical protein JCGZ_15612                       97.4    2e-20   
dbj|BAF03592.1|  S-like RNase                                         97.4    2e-20   Fagopyrum esculentum
ref|NP_564264.1|  ribonuclease 3                                      97.4    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495841.1|  PREDICTED: ribonuclease 3-like                   97.1    3e-20   
gb|AAZ91359.1|  S1 S-RNase                                            96.7    3e-20   Prunus webbii
gb|ABV72002.1|  S14-RNase                                             97.4    3e-20   Prunus mume [ume]
dbj|BAF56261.1|  S-RNase                                              95.9    3e-20   Prunus speciosa [Oshima cherry]
gb|ACG50929.1|  S2-RNase                                              96.3    3e-20   Prunus simonii [apricot plum]
gb|KFK44585.1|  hypothetical protein AALP_AA1G277900                  96.7    4e-20   
dbj|BAC20680.1|  putative aleurone ribonuclease                       97.4    4e-20   Oryza sativa Japonica Group [Japonica rice]
dbj|BAH22709.1|  S-like ribonuclease                                  96.7    4e-20   Dionaea muscipula
dbj|BAE16663.1|  ribonuclease                                         96.7    4e-20   Drosera adelae
gb|ABL86037.1|  S-RNase                                               95.5    4e-20   Prunus tenella [dwarf Russian almond]
ref|XP_010498993.1|  PREDICTED: ribonuclease 3-like                   96.7    5e-20   
ref|XP_008389464.1|  PREDICTED: ribonuclease 3-like                   96.7    5e-20   
ref|XP_003517990.1|  PREDICTED: ribonuclease 3-like                   96.7    5e-20   
gb|AAC49325.1|  ribonuclease                                          96.7    5e-20   Zinnia violacea [garden zinnia]
gb|AHH02661.1|  RNase-like major storage protein                      96.7    5e-20   
gb|ABW04806.1|  S-RNase                                               95.1    6e-20   Prunus dulcis [sweet almond]
ref|XP_010458911.1|  PREDICTED: ribonuclease 3-like                   96.3    7e-20   
dbj|BAF56251.1|  S-RNase                                              94.7    7e-20   Prunus speciosa [Oshima cherry]
dbj|BAF91151.1|  S-ribonuclease                                       95.1    7e-20   Prunus mume [ume]
gb|ABW04807.1|  S-RNase                                               94.7    8e-20   Prunus dulcis [sweet almond]
dbj|BAB55855.1|  S-RNase                                              95.1    8e-20   Prunus mume [ume]
ref|XP_002890631.1|  hypothetical protein ARALYDRAFT_472718           95.9    8e-20   
gb|ADZ48271.1|  S-locus-associated ribonuclease                       95.9    9e-20   
gb|AEI69725.1|  ribonuclease S24 precursor                            95.1    9e-20   
emb|CAN90138.1|  self-incompatibility ribonuclease                    94.7    9e-20   Prunus domestica
pdb|1BK7|A  Chain A, Ribonuclease Mc1 From The Seeds Of Bitter Gourd  94.7    1e-19   
gb|AAL59323.2|  RNase                                                 94.0    1e-19   Prunus dulcis [sweet almond]
dbj|BAF56259.1|  S-RNase                                              94.0    1e-19   Prunus speciosa [Oshima cherry]
emb|CAJ77736.1|  ribonuclease S25 precursor                           94.7    1e-19   Prunus dulcis [sweet almond]
dbj|BAF56275.1|  S-RNase                                              94.0    1e-19   Prunus speciosa [Oshima cherry]
sp|P23540.1|RNMC_MOMCH  RecName: Full=Ribonuclease MC; Short=RNas...  94.7    1e-19   Momordica charantia [balsam pear]
ref|NP_001235183.1|  uncharacterized protein LOC100306447 precursor   95.5    1e-19   
emb|CAN90135.1|  self-incompatibility ribonuclease                    94.0    1e-19   Prunus cerasifera [myrobalan plum]
dbj|BAF56254.1|  S-RNase                                              94.4    1e-19   Prunus speciosa [Oshima cherry]
gb|ABV72003.1|  S15-RNase                                             95.1    1e-19   Prunus mume [ume]
emb|CAJ77735.1|  ribonuclease S24 precursor                           94.4    1e-19   Prunus dulcis [sweet almond]
sp|Q7M456.1|RNOY_CRAGI  RecName: Full=Ribonuclease Oy; Short=RNas...  95.1    1e-19   Crassostrea gigas
gb|ABB17824.1|  Sj-RNase                                              95.9    1e-19   Prunus dulcis [sweet almond]
emb|CAJ77738.1|  ribonuclease S27 precursor                           94.4    2e-19   Prunus dulcis [sweet almond]
emb|CAN90141.1|  self-incompatibility ribonuclease                    93.6    2e-19   Prunus mume [ume]
pdb|1J1G|A  Chain A, Crystal Structure Of The Rnase Mc1 Mutant N7...  94.4    2e-19   
dbj|BAO05319.1|  S-like ribonuclease                                  95.1    2e-19   
ref|XP_008221612.1|  PREDICTED: ribonuclease 3-like                   95.1    2e-19   
ref|XP_010476469.1|  PREDICTED: ribonuclease 3-like isoform X1        94.7    2e-19   
ref|XP_007223919.1|  hypothetical protein PRUPE_ppa011014mg           94.7    2e-19   
gb|ABL86036.1|  S-RNase                                               93.6    2e-19   Prunus tenella [dwarf Russian almond]
ref|XP_009117922.1|  PREDICTED: ribonuclease 3-like                   94.7    2e-19   
gb|AAT69244.1|  S1-RNase protein                                      94.7    2e-19   Prunus armeniaca
pdb|1J1F|A  Chain A, Crystal Structure Of The Rnase Mc1 Mutant N7...  94.0    2e-19   
emb|CAQ51506.1|  self-incompatibility ribonuclease                    93.6    2e-19   Prunus cerasifera [myrobalan plum]
ref|XP_009360332.1|  PREDICTED: ribonuclease 3-like                   94.7    2e-19   
dbj|BAF56283.1|  S-RNase                                              93.2    2e-19   Prunus speciosa [Oshima cherry]
emb|CAZ68892.1|  S-ribonuclease                                       94.0    2e-19   
dbj|BAF91159.1|  S-ribonuclease                                       93.6    2e-19   Prunus mume [ume]
gb|ACU25555.1|  self-incompatibility associated ribonuclease S6       94.7    2e-19   
dbj|BAH22121.1|  S-RNase                                              94.7    2e-19   Prunus yedoensis [Cheju native flowering cherry]
ref|XP_002649213.1|  ribonuclease T2                                  94.7    2e-19   Dictyostelium discoideum AX4
gb|ACV95496.1|  ribonuclease                                          94.4    3e-19   Oryza sativa Japonica Group [Japonica rice]
gb|ABJ97524.1|  S-RNase                                               93.2    3e-19   Prunus webbii
dbj|BAA34663.1|  Sb-RNase                                             94.4    3e-19   Prunus dulcis [sweet almond]
gb|AAZ57492.1|  Sj'-RNase                                             94.4    3e-19   Prunus dulcis [sweet almond]
gb|ABY19369.1|  S5-RNase                                              93.6    3e-19   Prunus webbii
gb|ABW04804.1|  S-RNase                                               92.8    3e-19   Prunus dulcis [sweet almond]
gb|AAZ57491.1|  Sj-RNase                                              94.4    3e-19   Prunus dulcis [sweet almond]
gb|AAL59324.1|AF454003_1  RNase                                       92.8    3e-19   Prunus dulcis [sweet almond]
emb|CDY33761.1|  BnaA09g45670D                                        94.4    3e-19   
gb|AAG09465.1|AF227522_1  S-like ribonuclease                         94.4    3e-19   Prunus dulcis [sweet almond]
dbj|BAB84687.1|  Sa-RNase                                             94.4    3e-19   Prunus cerasus [pie cherry]
dbj|BAF56282.1|  S-RNase                                              93.2    3e-19   Prunus speciosa [Oshima cherry]
dbj|BAF56265.1|  S-RNase                                              92.8    3e-19   Prunus speciosa [Oshima cherry]
emb|CAQ51498.1|  self-incompatibility ribonuclease                    92.8    3e-19   Prunus cerasifera [myrobalan plum]
gb|ABK28493.1|  unknown                                               94.0    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207578.1|  hypothetical protein PRUPE_ppa018459mg           94.0    4e-19   
ref|NP_178399.1|  ribonuclease 1                                      94.0    4e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA95157.1|  Sa-RNase                                             93.6    4e-19   Prunus salicina [Japanese plum]
dbj|BAF56272.1|  S-RNase                                              92.8    4e-19   Prunus speciosa [Oshima cherry]
gb|ABW04805.1|  S-RNase                                               92.8    4e-19   Prunus dulcis [sweet almond]
gb|AAK58580.1|AF267513_1  Sj-RNase                                    92.4    4e-19   Prunus dulcis [sweet almond]
gb|AAP92438.1|  S-RNase                                               94.0    4e-19   Prunus avium [gean]
emb|CDP00340.1|  unnamed protein product                              94.0    4e-19   
emb|CAQ51501.1|  self-incompatibility ribonuclease                    92.4    4e-19   Prunus cerasifera [myrobalan plum]
ref|XP_006438699.1|  hypothetical protein CICLE_v10032674mg           94.0    4e-19   
gb|ABG76219.1|  S-RNase                                               93.2    4e-19   Prunus spinosa [blackthorn]
emb|CAN90136.1|  self-incompatibility ribonuclease                    92.4    4e-19   Prunus domestica
ref|XP_008235627.1|  PREDICTED: ribonuclease S-7-like                 94.0    4e-19   
emb|CAC27788.1|  RNase S5                                             93.6    4e-19   Prunus avium [gean]
gb|ACF93804.1|  S4-RNase                                              92.8    4e-19   Prunus simonii [apricot plum]
gb|ACU25554.1|  self-incompatibility associated ribonuclease S4       94.0    4e-19   
emb|CDP00341.1|  unnamed protein product                              94.0    5e-19   
pdb|1V9H|A  Chain A, Crystal Structure Of The Rnase Mc1 Mutant Y1...  93.2    5e-19   
dbj|BAF42764.1|  Sa-RNase                                             93.6    5e-19   Prunus salicina [Japanese plum]
emb|CAJ77737.1|  ribonuclease S26 precursor                           92.8    5e-19   Prunus dulcis [sweet almond]
gb|AAZ57490.1|  Si-RNase                                              93.2    5e-19   Prunus dulcis [sweet almond]
gb|ABG76209.1|  S-RNase                                               93.2    5e-19   Prunus spinosa [blackthorn]
gb|ABV02073.1|  S-locus S-RNase S1                                    93.6    5e-19   Prunus spinosa [blackthorn]
ref|XP_010462695.1|  PREDICTED: ribonuclease 3-like                   93.2    5e-19   
emb|CAM84228.1|  ribonuclease                                         92.4    6e-19   Prunus webbii
gb|ACD31530.1|  S-RNase                                               92.8    6e-19   Prunus armeniaca
gb|AAM63798.1|  ribonuclease, RNS1                                    93.6    6e-19   Arabidopsis thaliana [mouse-ear cress]
pdb|1UCG|A  Chain A, Crystal Structure Of Ribonuclease Mc1 N71t M...  92.8    6e-19   
emb|CAJ77734.1|  ribonuclease S22 precursor                           92.4    6e-19   Prunus dulcis [sweet almond]
ref|XP_006483150.1|  PREDICTED: extracellular ribonuclease LE-like    93.6    6e-19   
dbj|BAF56273.1|  S-RNase                                              92.0    6e-19   Prunus speciosa [Oshima cherry]
dbj|BAF56279.1|  S-RNase                                              92.0    6e-19   Prunus speciosa [Oshima cherry]
emb|CDX81621.1|  BnaC08g39800D                                        97.1    6e-19   
ref|XP_011070994.1|  PREDICTED: extracellular ribonuclease LE-lik...  93.2    6e-19   
gb|ADZ48272.1|  S-locus-associated ribonuclease                       93.6    6e-19   
gb|ABV71999.1|  S11-RNase                                             93.2    7e-19   Prunus mume [ume]
emb|CDY09344.1|  BnaA02g26660D                                        93.2    7e-19   
ref|XP_010552574.1|  PREDICTED: ribonuclease 3-like                   93.2    7e-19   
gb|AAM76701.1|  RNase                                                 91.7    7e-19   Prunus dulcis [sweet almond]
gb|AAZ57489.1|  Si-RNase                                              92.4    7e-19   Prunus dulcis [sweet almond]
gb|AAG09286.1|AF177923_1  Se-RNase                                    91.7    7e-19   Prunus dulcis [sweet almond]
gb|ABW81472.1|  self-incompatibility S13-RNase                        91.7    7e-19   Prunus dulcis [sweet almond]
ref|XP_009401398.1|  PREDICTED: extracellular ribonuclease LE-like    93.2    8e-19   
gb|ACG50928.1|  S1-RNase                                              92.4    8e-19   Prunus simonii [apricot plum]
dbj|BAF91152.1|  S-ribonuclease                                       92.0    8e-19   Prunus mume [ume]
gb|AAX38607.1|  ribonuclease S6                                       91.7    8e-19   Prunus avium [gean]
emb|CAJ77744.1|  ribonuclease S13 precursor                           91.7    8e-19   Prunus dulcis [sweet almond]
emb|CAE84600.1|  RNase                                                91.7    9e-19   Prunus dulcis [sweet almond]
gb|AAC49326.1|  wounding-induced ribonuclease gene                    92.8    9e-19   Zinnia violacea [garden zinnia]
dbj|BAF56245.1|  S-RNase                                              91.7    9e-19   Prunus speciosa [Oshima cherry]
ref|XP_010939795.1|  PREDICTED: extracellular ribonuclease LE-like    92.8    9e-19   
gb|ABG76211.1|  S-RNase                                               92.4    1e-18   Prunus spinosa [blackthorn]
emb|CAN90134.1|  self-incompatibility ribonuclease                    91.3    1e-18   Prunus cerasifera [myrobalan plum]
gb|ABQ51152.1|  S11-RNase                                             92.0    1e-18   Prunus armeniaca
gb|AIV99935.1|  S-RNase S51                                           91.7    1e-18   
emb|CDX84041.1|  BnaC08g16040D                                        92.8    1e-18   
dbj|BAC20936.1|  Sc-RNase                                             92.4    1e-18   Prunus salicina [Japanese plum]
ref|XP_009110556.1|  PREDICTED: ribonuclease 3-like                   92.4    1e-18   
ref|XP_003613800.1|  LCR-like protein                                 92.8    1e-18   
ref|XP_008339897.1|  PREDICTED: extracellular ribonuclease LE-like    92.4    1e-18   
gb|EMT26752.1|  Ribonuclease 1                                        92.8    1e-18   
ref|XP_009129105.1|  PREDICTED: ribonuclease 1                        92.4    1e-18   
dbj|BAF56255.1|  S-RNase                                              91.3    1e-18   Prunus speciosa [Oshima cherry]
gb|ABW04809.1|  S-RNase                                               91.7    1e-18   Prunus dulcis [sweet almond]
ref|XP_010527911.1|  PREDICTED: ribonuclease 3-like                   92.4    1e-18   
emb|CBD77387.1|  putative relic S-RNase                               92.4    1e-18   
emb|CDP20784.1|  unnamed protein product                              92.0    1e-18   
ref|XP_010265111.1|  PREDICTED: ribonuclease 1-like                   92.4    1e-18   
dbj|BAF91846.1|  Sc-RNase                                             92.4    1e-18   Prunus salicina [Japanese plum]
gb|AAZ91367.1|  S8 S-RNase                                            91.3    1e-18   Prunus webbii
gb|AAZ67033.1|  Sg-RNase                                              91.7    1e-18   Prunus dulcis [sweet almond]
emb|CDY33762.1|  BnaA09g45680D                                        92.0    2e-18   
emb|CDY62181.1|  BnaCnng39460D                                        92.0    2e-18   
ref|XP_010066907.1|  PREDICTED: ribonuclease 1-like                   92.0    2e-18   
gb|ABG76221.1|  S-RNase                                               92.0    2e-18   Prunus spinosa [blackthorn]
gb|AHJ59551.1|  S-RNase 53                                            92.4    2e-18   
dbj|BAF42762.1|  Sk-RNase                                             92.0    2e-18   Prunus dulcis [sweet almond]
emb|CCH50735.1|  S1-RNase                                             92.0    2e-18   
ref|XP_008339896.1|  PREDICTED: extracellular ribonuclease LE-lik...  92.0    2e-18   
ref|XP_010259636.1|  PREDICTED: extracellular ribonuclease LE-like    92.4    2e-18   
ref|XP_010258336.1|  PREDICTED: intracellular ribonuclease LX-like    92.0    2e-18   
gb|ABY78035.1|  S1-RNase                                              90.9    2e-18   Prunus simonii [apricot plum]
ref|XP_009793100.1|  PREDICTED: extracellular ribonuclease LE-like    92.0    2e-18   
ref|XP_008339895.1|  PREDICTED: extracellular ribonuclease LE-lik...  91.7    2e-18   
dbj|BAC20944.1|  Sh-RNase                                             90.9    2e-18   Prunus salicina [Japanese plum]
ref|XP_010476468.1|  PREDICTED: ribonuclease 3-like                   91.7    2e-18   
gb|KDO82931.1|  hypothetical protein CISIN_1g026944mg                 91.7    2e-18   
gb|AAZ91370.1|  S10 S-RNase                                           90.5    2e-18   
ref|XP_004490068.1|  PREDICTED: ribonuclease 3-like                   91.7    2e-18   
dbj|BAC75457.1|  Sj-RNase                                             90.5    2e-18   
gb|AAM22180.1|AF490505_1  RNase                                       90.1    2e-18   
dbj|BAH56561.1|  Sf-RNase                                             91.7    3e-18   
ref|XP_002316136.1|  hypothetical protein POPTR_0010s17580g           91.7    3e-18   
dbj|BAB55854.1|  S-RNase                                              90.5    3e-18   
ref|XP_010269492.1|  PREDICTED: extracellular ribonuclease LE-like    91.7    3e-18   
dbj|BAF91150.1|  S-ribonuclease                                       90.5    3e-18   
gb|AAM22178.1|  RNase                                                 90.1    3e-18   
dbj|BAF56253.1|  S-RNase                                              90.1    3e-18   
ref|XP_006483149.1|  PREDICTED: ribonuclease 3-like                   91.3    3e-18   
ref|XP_006438697.1|  hypothetical protein CICLE_v10032651mg           91.3    3e-18   
ref|XP_011017135.1|  PREDICTED: ribonuclease 1-like                   91.3    3e-18   
ref|XP_002875183.1|  ribonuclease, RNS1                               91.3    3e-18   
ref|XP_008446355.1|  PREDICTED: ribonuclease 1-like                   91.3    4e-18   
emb|CAJ77739.1|  ribonuclease S28 precursor                           90.5    4e-18   
dbj|BAF91157.1|  S-ribonuclease                                       90.1    4e-18   
gb|AAW62238.1|  self-incompatibility S-RNase S9                       89.7    4e-18   
ref|XP_006395743.1|  hypothetical protein EUTSA_v10004863mg           90.9    4e-18   
ref|XP_010425075.1|  PREDICTED: ribonuclease 1                        90.9    4e-18   
gb|AAM22179.1|  RNase                                                 89.7    4e-18   
gb|AAL59322.1|AF454001_1  RNase                                       89.4    4e-18   
dbj|BAF56246.1|  S-RNase                                              89.7    4e-18   
sp|P83618.2|RN28_PANGI  RecName: Full=Ribonuclease-like storage p...  90.9    4e-18   
emb|CAJ77724.1|  ribonuclease S4 precursor                            89.7    5e-18   
ref|XP_009360333.1|  PREDICTED: extracellular ribonuclease LE-like    90.9    5e-18   
ref|XP_002109086.1|  expressed hypothetical protein                   91.3    5e-18   
emb|CAE84599.1|  RNase                                                89.4    5e-18   
dbj|BAC20939.1|  Sb-RNase                                             89.4    5e-18   
gb|AAZ67031.1|  Se-RNase                                              90.1    5e-18   
gb|KHG25338.1|  Extracellular ribonuclease LE                         90.9    5e-18   
gb|AAW47923.1|  S-RNase S9                                            89.7    5e-18   
emb|CAJ77725.1|  ribonuclease S6 precursor                            89.7    5e-18   
gb|AAX38606.1|  ribonuclease S3                                       89.4    5e-18   
emb|CAJ77742.1|  ribonuclease S11 precursor                           89.7    5e-18   
gb|KFK33495.1|  hypothetical protein AALP_AA5G020500                  90.5    6e-18   
emb|CDP00339.1|  unnamed protein product                              90.5    6e-18   
ref|XP_003613789.1|  Ribonuclease T2                                  90.5    6e-18   
dbj|BAF56266.1|  S-RNase                                              89.4    6e-18   
ref|XP_002311302.1|  S2-RNase family protein                          90.5    6e-18   
ref|XP_003637821.1|  S7-RNase                                         90.5    6e-18   
dbj|BAF91156.1|  S-ribonuclease                                       89.7    6e-18   
ref|XP_004970898.1|  PREDICTED: ribonuclease 2-like                   91.3    6e-18   
ref|XP_004155386.1|  PREDICTED: LOW QUALITY PROTEIN: extracellula...  90.5    7e-18   
ref|XP_010502310.1|  PREDICTED: ribonuclease 1-like                   90.5    7e-18   
ref|XP_006291795.1|  hypothetical protein CARUB_v10017969mg           90.5    7e-18   
dbj|BAF56280.1|  S-RNase                                              89.4    7e-18   
emb|CAQ51502.1|  self-incompatibility ribonuclease                    89.4    7e-18   
emb|CAJ77732.1|  ribonuclease S20 precursor                           89.4    7e-18   
ref|XP_003748072.1|  PREDICTED: ribonuclease Oy-like                  90.5    7e-18   
ref|XP_009023387.1|  hypothetical protein HELRODRAFT_185826           90.5    7e-18   
dbj|BAF56276.1|  S-RNase                                              89.0    7e-18   
emb|CAQ51504.1|  self-incompatibility ribonuclease                    89.0    7e-18   
ref|XP_008790973.1|  PREDICTED: extracellular ribonuclease LE-like    90.1    8e-18   
ref|XP_010907396.1|  PREDICTED: extracellular ribonuclease LE-like    90.1    8e-18   
ref|XP_010066908.1|  PREDICTED: ribonuclease 1-like                   90.1    8e-18   
gb|ABS30928.1|  Sc-RNase                                              89.4    8e-18   
gb|KCW64954.1|  hypothetical protein EUGRSUZ_G02498                   89.4    8e-18   
dbj|BAC75458.1|  Sk-RNase                                             89.4    8e-18   
emb|CDM85310.1|  unnamed protein product                              90.9    8e-18   
gb|ABQ51153.1|  S13-RNase                                             89.4    8e-18   
ref|XP_007151500.1|  hypothetical protein PHAVU_004G052000g           89.7    9e-18   
gb|ABO34168.1|  Sc-RNase                                              89.4    9e-18   
gb|AEI69728.1|  ribonuclease S6 precursor                             89.0    9e-18   
dbj|BAF56281.1|  S-RNase                                              88.6    9e-18   
ref|XP_011013416.1|  PREDICTED: LOW QUALITY PROTEIN: ribonuclease 1   89.7    1e-17   
dbj|BAF56277.1|  S-RNase                                              88.6    1e-17   
gb|ABO34167.1|  S8-RNase                                              89.0    1e-17   
gb|AAL35959.2|  RNase                                                 90.1    1e-17   
gb|AAW58933.1|  ribonuclease S1                                       88.6    1e-17   
gb|AAA21135.1|  RNase NE                                              89.7    1e-17   
dbj|BAB55853.1|  S-RNase                                              89.0    1e-17   
emb|CAD29435.1|  S-ribonuclease                                       89.7    1e-17   
dbj|BAJ24883.1|  self-incompatibility associated ribonuclease         89.7    1e-17   
dbj|BAF56258.1|  S-RNase                                              88.6    1e-17   
ref|XP_002275271.1|  PREDICTED: extracellular ribonuclease LE         89.7    1e-17   
ref|XP_004147497.1|  PREDICTED: ribonuclease MC-like                  89.4    1e-17   
ref|XP_004135454.1|  PREDICTED: extracellular ribonuclease LE-like    89.7    1e-17   
dbj|BAC75460.1|  Sm-RNase                                             88.2    1e-17   
gb|AEI69726.1|  ribonuclease S40 precursor                            88.6    1e-17   
dbj|BAC66630.1|  S7-ribonuclease                                      87.8    1e-17   
dbj|BAF56242.1|  S-RNase                                              88.2    1e-17   
dbj|BAC20943.1|  Sf-RNase                                             87.4    1e-17   
dbj|BAG87969.1|  unnamed protein product                              90.1    1e-17   
ref|XP_002432848.1|  Ribonuclease Oy, putative                        90.5    1e-17   
ref|XP_004159644.1|  PREDICTED: ribonuclease MC-like                  89.4    1e-17   
gb|AFJ20694.1|  putative self-incompatibility S-RNase                 87.4    1e-17   
gb|ABY19370.1|  S6-RNase                                              88.6    2e-17   
ref|XP_008389461.1|  PREDICTED: extracellular ribonuclease LE         89.4    2e-17   
ref|XP_009502633.1|  PREDICTED: ribonuclease T2                       89.7    2e-17   
ref|XP_008802596.1|  PREDICTED: extracellular ribonuclease LE-like    89.4    2e-17   
ref|XP_010514069.1|  PREDICTED: ribonuclease 1-like                   89.4    2e-17   
ref|XP_010908763.1|  PREDICTED: ribonuclease 2                        89.7    2e-17   
emb|CAM84222.1|  ribonuclease                                         88.2    2e-17   
dbj|BAC20941.1|  Sd-RNase                                             87.8    2e-17   
ref|XP_007157617.1|  hypothetical protein PHAVU_002G084600g           89.4    2e-17   
gb|KHG28210.1|  Ribonuclease 3 -like protein                          89.0    2e-17   
ref|XP_008245498.1|  PREDICTED: ribonuclease MC-like                  89.4    2e-17   
dbj|BAF56252.1|  S-RNase                                              87.8    2e-17   
ref|XP_009358930.1|  PREDICTED: ribonuclease 2                        89.7    2e-17   
ref|XP_003613795.1|  LCR-like protein                                 89.0    2e-17   
gb|AFK35006.1|  unknown                                               89.7    2e-17   
gb|ABN09749.1|  Ribonuclease T2; Thioredoxin domain 2; Thioredoxi...  90.5    2e-17   
gb|EYU28760.1|  hypothetical protein MIMGU_mgv1a013386mg              88.6    2e-17   
gb|ABO34169.1|  S9-RNase                                              88.2    2e-17   
gb|AAZ15103.1|  S-RNase                                               89.0    2e-17   
ref|XP_002522442.1|  ribonuclease t2, putative                        88.6    2e-17   
ref|XP_010066906.1|  PREDICTED: ribonuclease 3-like                   88.6    2e-17   
ref|XP_010683173.1|  PREDICTED: ribonuclease 1-like                   88.6    2e-17   
gb|ABY19368.1|  S3-RNase                                              88.2    2e-17   
ref|XP_010679023.1|  PREDICTED: ribonuclease 2                        89.4    3e-17   
ref|XP_010527909.1|  PREDICTED: ribonuclease 1                        88.6    3e-17   
gb|KDP41204.1|  hypothetical protein JCGZ_15611                       88.6    3e-17   
ref|XP_003594130.1|  Protein disulfide-isomerase A6                   90.5    3e-17   
gb|AFK41755.1|  unknown                                               88.6    3e-17   
dbj|BAF91158.1|  S-ribonuclease                                       87.4    3e-17   
gb|ACG36234.1|  ribonuclease 2 precursor                              89.0    3e-17   
emb|CAC41959.1|  S3-RNase                                             88.2    3e-17   
gb|ABQ51154.1|  S15-RNase                                             87.4    3e-17   
gb|ABL86026.1|  S-RNase                                               87.0    3e-17   
ref|XP_008783985.1|  PREDICTED: extracellular ribonuclease LE-like    88.2    4e-17   
ref|XP_009793099.1|  PREDICTED: intracellular ribonuclease LX-like    88.2    4e-17   
ref|XP_007158650.1|  hypothetical protein PHAVU_002G170800g           88.6    4e-17   
dbj|BAF56243.1|  S-RNase                                              87.0    4e-17   
sp|Q38716.1|RNS2_ANTHI  RecName: Full=Ribonuclease S-2; AltName: ...  88.2    4e-17   
gb|AFK33515.1|  unknown                                               88.2    4e-17   
gb|AFJ20691.1|  putative self-incompatibility S-RNase                 86.3    4e-17   
ref|XP_004297298.1|  PREDICTED: ribonuclease 3-like                   88.2    4e-17   
dbj|BAF56269.1|  S-RNase                                              86.7    5e-17   
ref|XP_002321228.1|  hypothetical protein POPTR_0014s17280g           88.2    5e-17   
ref|XP_009626196.1|  PREDICTED: extracellular ribonuclease LE-like    87.8    5e-17   
gb|AAG36878.1|AF250864_1  S9-RNase                                    86.3    5e-17   
ref|XP_006827258.1|  hypothetical protein AMTR_s00010p00262550        87.8    5e-17   
dbj|BAF56257.1|  S-RNase                                              86.7    6e-17   
gb|AAK58577.1|  Sh-RNase                                              86.7    6e-17   
pdb|1IYB|A  Chain A, Crystal Structure Of The Nicotiana Glutinosa...  87.0    6e-17   
ref|XP_003743957.1|  PREDICTED: ribonuclease DdI-like                 88.2    6e-17   
gb|ABS30926.1|  Sc-RNase                                              86.7    6e-17   
gb|AFJ20693.1|  putative self-incompatibility S-RNase                 85.5    6e-17   
gb|ABW04811.1|  S-RNase                                               86.7    6e-17   
ref|XP_007147306.1|  hypothetical protein PHAVU_006G112900g           87.0    6e-17   
gb|ABW04810.1|  S-RNase                                               86.7    7e-17   
gb|ABB92551.1|  SRNase precursor                                      86.7    7e-17   
dbj|BAJ13374.1|  St-RNase                                             86.3    7e-17   
ref|XP_011006741.1|  PREDICTED: ribonuclease 2                        87.8    7e-17   
dbj|BAO05320.1|  S-like ribonuclease                                  87.4    7e-17   
gb|AFJ20695.1|  putative self-incompatibility S-RNase                 85.5    7e-17   
emb|CAM84223.1|  ribonuclease                                         86.7    7e-17   
gb|ABV72000.1|  S12-RNase                                             85.5    7e-17   
ref|XP_007151642.1|  hypothetical protein PHAVU_004G064100g           87.0    8e-17   
gb|ABK92675.1|  unknown                                               87.8    8e-17   
ref|XP_008788242.1|  PREDICTED: ribonuclease 2                        87.8    8e-17   
gb|ABW71897.1|  ribonuclease S5                                       86.7    8e-17   
ref|XP_009626195.1|  PREDICTED: intracellular ribonuclease LX-like    87.4    8e-17   
emb|CAC33020.1|  S2-RNase                                             87.4    9e-17   
gb|ABL86024.1|  S-RNase                                               85.9    9e-17   
gb|AAL59321.1|AF454000_1  RNase                                       86.3    9e-17   
gb|KHG28209.1|  Ribonuclease 1 -like protein                          87.0    9e-17   
gb|ADZ76512.1|  S-locus associated ribonuclease                       87.0    1e-16   
gb|ABB92555.1|  SRNase precursor                                      85.9    1e-16   
ref|XP_008123006.1|  PREDICTED: ribonuclease T2                       87.4    1e-16   
ref|XP_007157616.1|  hypothetical protein PHAVU_002G084500g           86.7    1e-16   
gb|AAO33409.1|  S-RNase                                               85.5    1e-16   
gb|AFJ20688.1|  putative self-incompatibility S-RNase                 84.7    1e-16   
dbj|BAI70445.1|  S8-RNase                                             86.7    1e-16   
ref|XP_006431731.1|  hypothetical protein CICLE_v10003503mg           86.7    1e-16   
dbj|BAC77613.1|  ribonuclease NW                                      86.7    1e-16   
ref|XP_010937158.1|  PREDICTED: extracellular ribonuclease LE-like    86.7    1e-16   
gb|AFJ20696.1|  putative self-incompatibility S-RNase                 84.7    1e-16   
emb|CAN90133.1|  self-incompatibility ribonuclease                    85.5    1e-16   
emb|CAQ51507.1|  self-incompatibility ribonuclease                    85.9    1e-16   
ref|XP_006494374.1|  PREDICTED: ribonuclease 1-like                   86.7    1e-16   
gb|AFJ20684.1|  putative self-incompatibility S-RNase                 84.7    1e-16   
gb|ABD98450.1|  self-incompatibility ribonuclease                     85.5    1e-16   
gb|AAO33408.1|  S-RNase                                               85.1    1e-16   
ref|XP_009802563.1|  PREDICTED: ribonuclease 3-like                   86.7    1e-16   
dbj|BAF56263.1|  S-RNase                                              85.1    1e-16   
dbj|BAF56278.1|  S-RNase                                              85.5    1e-16   
ref|XP_008382535.1|  PREDICTED: ribonuclease 2-like                   87.0    1e-16   
ref|XP_006657993.1|  PREDICTED: ribonuclease 1-like                   86.7    2e-16   
dbj|BAF56264.1|  S-RNase                                              85.1    2e-16   
gb|ABB92550.1|  SRNase precursor                                      85.1    2e-16   
gb|ABY19371.1|  S7-RNase                                              84.7    2e-16   
ref|NP_001131376.1|  uncharacterized protein LOC100192701 precursor   87.0    2e-16   
gb|AAS01727.1|  S-like RNase                                          86.3    2e-16   
dbj|BAF56285.1|  S-RNase                                              85.1    2e-16   
ref|XP_003613791.1|  Ribonuclease T2                                  86.3    2e-16   
dbj|BAC20945.1|  Si-RNase                                             85.1    2e-16   
ref|XP_003517989.1|  PREDICTED: ribonuclease 1-like                   86.3    2e-16   
gb|ABJ97525.1|  S-RNase                                               84.7    2e-16   
gb|KHN12205.1|  Ribonuclease 1                                        86.3    2e-16   
ref|XP_011070993.1|  PREDICTED: extracellular ribonuclease LE-lik...  86.3    2e-16   
gb|AAT72309.1|  S63-RNase                                             85.1    2e-16   
gb|ABG36934.1|  S-RNase                                               84.7    2e-16   
ref|XP_006577070.1|  PREDICTED: ribonuclease S-7-like                 85.9    2e-16   
emb|CAQ51499.1|  self-incompatibility ribonuclease                    84.7    2e-16   
gb|AAZ91362.1|  S3 S-RNase                                            85.1    2e-16   
gb|ABY19367.1|  S10-RNase                                             85.5    2e-16   
gb|ABL86023.1|  S-RNase                                               84.7    2e-16   
ref|XP_002522443.1|  ribonuclease t2, putative                        85.9    2e-16   
gb|ABY82410.1|  self-incompatibility associated ribonuclease          84.3    2e-16   
emb|CAJ77743.1|  ribonuclease S12 precursor                           85.1    2e-16   
gb|AFI24536.1|  self-incompatibility associated ribonuclease S3       85.5    2e-16   
ref|XP_003746238.1|  PREDICTED: ribonuclease DdI-like                 86.3    2e-16   
gb|EYU46083.1|  hypothetical protein MIMGU_mgv1a011196mg              86.3    2e-16   
dbj|BAF56274.1|  S-RNase                                              84.7    2e-16   
ref|XP_009395805.1|  PREDICTED: ribonuclease 3-like                   85.9    2e-16   
emb|CDP16771.1|  unnamed protein product                              85.9    3e-16   
gb|AAB58718.1|  aleurone ribonuclease                                 85.9    3e-16   
dbj|BAJ95948.1|  predicted protein                                    86.3    3e-16   
gb|ABS30927.1|  Sc-RNase                                              84.7    3e-16   
pdb|1VCZ|A  Chain A, Crystal Structure Of The Rnase Nt In Complex...  85.5    3e-16   
gb|AFJ20699.1|  putative self-incompatibility S-RNase                 84.0    3e-16   
gb|EYU46082.1|  hypothetical protein MIMGU_mgv1a011196mg              86.3    3e-16   
gb|KDO53823.1|  hypothetical protein CISIN_1g042583mg                 85.1    3e-16   
sp|Q38717.1|RNS4_ANTHI  RecName: Full=Ribonuclease S-4; AltName: ...  85.5    3e-16   
gb|ACG50930.1|  S3-RNase                                              84.7    3e-16   
ref|XP_010683178.1|  PREDICTED: ribonuclease 1-like                   85.5    3e-16   
emb|CAM84221.1|  ribonuclease                                         84.3    4e-16   
ref|NP_001238449.1|  uncharacterized protein LOC100305644 precursor   85.1    4e-16   



>ref|XP_004147499.1| PREDICTED: ribonuclease MC-like [Cucumis sativus]
 ref|XP_004159646.1| PREDICTED: ribonuclease MC-like [Cucumis sativus]
 gb|KGN59560.1| hypothetical protein Csa_3G825050 [Cucumis sativus]
Length=217

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 98/195 (50%), Gaps = 10/195 (5%)
 Frame = +3

Query  333  RTWGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS----SGPAYVDGLI  500
            +T+  F+    WPP  C      C+  +    FTIHGLWPQ   +S    +G  + D   
Sbjct  26   QTFDDFWFVQQWPPAVCTLQSGRCV-GRGTRSFTIHGLWPQKGGRSVTNCTGNQF-DFTK  83

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
               L + L++ W N+    N+ FW HEWNKHG  S S   E  YF+ AI +    ++ ++
Sbjct  84   IAHLENDLNVVWPNVVTGNNKFFWGHEWNKHGICSESKFDEAKYFQTAINMRHGIDLLSV  143

Query  681  LANYGILPSDNSPT---TLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L   G+ P+  S        ++S  FG  PI+ C+K  N   + +TEI +C+D   + LI
Sbjct  144  LRTGGVGPNGASKAKQRVETAISSHFGKDPILRCKKASNGQVL-LTEIVMCFDDDGVTLI  202

Query  852  SCTQAQLSCGTQPIY  896
            +C +A+ +C    I+
Sbjct  203  NCNKARSNCAGSFIF  217



>dbj|BAH22122.1| S-RNase [Prunus yedoensis]
 dbj|BAH22124.1| S-RNase [Prunus yedoensis]
Length=223

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 90/176 (51%), Gaps = 12/176 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  C      C   +  ++FTIHGLWP        P+      + DG ++ +LR +L 
Sbjct  37   WPPTNCRVRSKPCSKPRPLQNFTIHGLWPSNYSNPRAPSNCNGSRFNDGKLSPELRAKLK  96

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG  S  +L ++ YFER+  ++++ N+T IL N  I+P 
Sbjct  97   ISWPDVENGNDTKFWEGEWNKHGTCSEGMLNQIQYFERSYAMWMSYNITEILKNASIVPH  156

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
                      +A +  A G TP++ C+   N+N   + E+  CY+  A   I C +
Sbjct  157  PTKTWKYSDIVAPIQTATGRTPLLRCK--WNNNNQLLHEVVFCYEYKAKKQIDCNR  210



>ref|XP_008443402.1| PREDICTED: ribonuclease MC-like [Cucumis melo]
Length=216

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 99/195 (51%), Gaps = 10/195 (5%)
 Frame = +3

Query  333  RTWGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS----SGPAYVDGLI  500
            +T+ +F+    WPP  C      C+  +    FTIHGLWPQ   +S    SG ++ D   
Sbjct  25   QTFDNFWFVQQWPPAICTLQSGRCV-GRGTRSFTIHGLWPQKGGRSVTNCSGNSF-DFTK  82

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
               L   L++ W N+    N+ FW HEWNKHG  S S   +  YF+ AI +  + ++ ++
Sbjct  83   IAHLESDLNVVWPNVVTGNNKFFWGHEWNKHGICSESKFDQAKYFQTAINMRHSIDLLSV  142

Query  681  LANYGILPSDNSPT---TLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L   GI+P+  S        ++S  F   PI+ C+   N   + +TEI +C+D   + LI
Sbjct  143  LRTGGIVPNGASKAKQRVETAISSHFAKDPILRCKTASNGQVL-LTEIVICFDDDGVTLI  201

Query  852  SCTQAQLSCGTQPIY  896
            +C +A+ +C    I+
Sbjct  202  NCNKARSNCARSFIF  216



>dbj|BAI77869.1| S23-RNase [Prunus dulcis]
Length=224

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 96/185 (52%), Gaps = 14/185 (8%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPN-KMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQDLRDRL  524
            WPP  C        PN +  + FTIHGLWP          + +GP +    ++  +R +L
Sbjct  37   WPPTNCRVRIKRPCPNPRPLQYFTIHGLWPSNYSNPTKPSKCTGPKFDARKVSPKMRIKL  96

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++L+ N+T IL N  I+P
Sbjct  97   KISWPDVESGNDTRFWEGEWNKHGTCSRERLNQMQYFERSHDMWLSYNITEILKNASIVP  156

Query  705  SDNSP----TTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQL  872
            +          ++ +  A GSTP++ C++ +  NT+ + E+  CY+  A+  I C +   
Sbjct  157  NATQKWSYSDIISPIKAATGSTPLLRCKQAK--NTLLLHEVVFCYEYDALKQIDCNRTA-  213

Query  873  SCGTQ  887
             CG Q
Sbjct  214  GCGNQ  218



>gb|AAP92435.1| S-RNase [Prunus avium]
Length=222

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 92/184 (50%), Gaps = 12/184 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDRLDI  530
            WPP  CI +   C  ++  + FTIHGLWP        P+   G     +++  LR +L  
Sbjct  37   WPPATCIRSNKPCSKHRPLQIFTIHGLWPSNYSNPRMPSNCTGPQFKRILSPQLRSKLQT  96

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E   +  FWE EWNKHG  S   L ++ YFER+  + ++ N+T IL N  I+P  
Sbjct  97   SWPDVESGNDTKFWESEWNKHGTCSKETLNQMQYFERSYAMXMSYNITEILKNASIVPHP  156

Query  711  NS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQLSC  878
                     +A +  A   TP++ C++ +  NT+ + E   CY+ +A+  I C +    C
Sbjct  157  TQTWKYSDIVAPIKAATKRTPLLRCKQDK--NTVLLHEXVFCYEYNALKQIDCNRTS-GC  213

Query  879  GTQP  890
              QP
Sbjct  214  QNQP  217



>gb|ABV02077.1| S-locus S-RNase S24 [Prunus spinosa]
Length=208

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 94/190 (49%), Gaps = 13/190 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------  509
            F     WPP  CI +   C  ++  + FTIHGLWP    Q + P+   G + +D      
Sbjct  12   FQFVQQWPPATCIRSKKSCSKHRPLQIFTIHGLWPSNYSQPTRPSNCAGSLYEDRKVYPQ  71

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR  L   W ++E   +  FWE EWNKHG+ S   L ++ YFER+  +++A N+T IL +
Sbjct  72   LRSDLKRSWPDVESGNDIQFWESEWNKHGRCSEQTLKQMQYFERSHDMWMAYNITKILKD  131

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCR--KGRNSNTMYITEIRLCYDASAINLI  851
              I+PS          ++ +  A   TP++ C+      + +  + E+ LCY   AI LI
Sbjct  132  AQIVPSATQTWKYSDIVSPIKTAILRTPLLRCKPDPAHPNTSQLLHEVVLCYGYRAIKLI  191

Query  852  SCTQAQLSCG  881
             C +    CG
Sbjct  192  DCNRT-AGCG  200



>gb|ABV02076.1| S-locus S-RNase S19 [Prunus spinosa]
Length=188

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 92/177 (52%), Gaps = 12/177 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQDLRDRLD  527
            WPP  C  +   C  ++  + FTIHGLWP       T     GP + +  +   LR +L 
Sbjct  2    WPPVTCRFSRKPCYKHQPLQIFTIHGLWPSNYSNPTTPSNCVGPRFNESKLPPQLRSKLK  61

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            + W ++E   N  FWE EW KHG  S   L ++ YFER+ +++ + N+T IL N  I+P 
Sbjct  62   MSWPDVESGNNTNFWEGEWRKHGTCSKQTLNQIQYFERSYEMWHSHNITKILKNASIVPH  121

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQA  866
                      ++++  A  +TP++ C+  +  NT ++ E+ LCY+ +A+  I C + 
Sbjct  122  PTQTWKYSDIVSAIKTATQTTPLLRCKWDK--NTQWLHEVVLCYEYNALKQIDCNRT  176



>gb|AAT69245.1| S2-RNase protein [Prunus armeniaca]
Length=226

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 91/187 (49%), Gaps = 11/187 (6%)
 Frame = +3

Query  336  TWGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------L  497
            T+  F     WPP  C      C   ++ ++FTIHGLWP      + P+  +G       
Sbjct  27   TYDYFQFVQQWPPTTCGVRGKPCSKPRLLQNFTIHGLWPSNYSNPTMPSNCNGSKFEARK  86

Query  498  INQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
            +   LR  L I W ++E   +  FWE EWNKHG  S  +L ++ YFER+  ++ + N+T 
Sbjct  87   VYPQLRSDLKISWPDVESGNDTKFWEGEWNKHGTCSEQILNQMQYFERSHAMWTSYNITK  146

Query  678  ILANYGILPSDNSP----TTLASVSQAFGSTPIVVCRKGRN-SNTMYITEIRLCYDASAI  842
            IL N  I+PS          L+ +  A G TP++ CR      N  ++ E+  CY  +A+
Sbjct  147  ILKNASIVPSAKQKWKYSDILSPIKTATGRTPLLRCRTDPALRNVQFLHEVVFCYGYNAL  206

Query  843  NLISCTQ  863
              I C +
Sbjct  207  KQIDCNR  213



>gb|ABY82413.1| self-incompatibility associated ribonuclease [Prunus pseudocerasus]
Length=227

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 87/176 (49%), Gaps = 10/176 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRLD  527
            WPP  C      C   +  ++FTIHGLWP      + P+   G       +   LR +L 
Sbjct  39   WPPTNCRVRKRPCSKPRPLQNFTIHGLWPSNYSNPTMPSKCTGSQFKKENVYPQLRSKLK  98

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG+ S   L +V YF+R+  ++ + NVT IL N  I+P 
Sbjct  99   ISWPDVESGNDTRFWESEWNKHGRCSEQTLNQVKYFQRSHAMWRSHNVTEILRNASIVPH  158

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
                 T    ++ +  A   TP++ C++   +NT  + E+  CYD  A   I C +
Sbjct  159  PTQTWTYSDIVSPIKAATKRTPLLRCKRDPTTNTELLHEVVFCYDYKAKIQIDCNR  214



>gb|AAT69248.1| S4-RNase protein [Prunus armeniaca]
 gb|ADZ73655.1| S-locus associated ribonuclease [Prunus armeniaca]
Length=231

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 94/181 (52%), Gaps = 15/181 (8%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  CI +   C  ++  ++FTIHGLWP      + P+      + +  ++  L  +L 
Sbjct  37   WPPATCIRSKKPCSKHRALQNFTIHGLWPSNYSNPTRPSNCVGSHFNESKLSPQLISKLR  96

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHGK S   L ++ YFER+  ++++ N+T IL N  I+P 
Sbjct  97   ISWPDVESGNDTQFWEGEWNKHGKCSQEKLNQMQYFERSHDMWMSYNITDILKNASIVPH  156

Query  708  DNSPTTLASVSQAFGS----TPIVVCRK----GRNS-NTMYITEIRLCYDASAINLISCT  860
                 T + +  A  S    TP+V C++     +N+ N+  + E+  CY+  A   I C 
Sbjct  157  PTQTWTYSDIVSAIKSKTQRTPLVRCKRDPAPNKNAPNSQLLHEVVFCYEYKAKKQIDCN  216

Query  861  Q  863
            +
Sbjct  217  R  217



>dbj|BAG74776.1| S3-RNase [Prunus mume]
Length=223

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 91/191 (48%), Gaps = 13/191 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQD  509
            F     WPP  C A    C   +  ++FTIHGLWP      + P+   G       +   
Sbjct  31   FQFVQQWPPTNCRARRRPCSKPRPLQNFTIHGLWPSNYSNPTMPSNCKGSQFEARKVYPQ  90

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            L+  L I W ++E   +  FWE EWNKHG+ S   L  + YFER+  ++ + N+T IL N
Sbjct  91   LQSNLKIAWPDVESGNDTRFWEGEWNKHGRCSEQTLNLMQYFERSYGMWKSYNITEILKN  150

Query  690  YGILPSDNSPTTLAS----VSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISC  857
              I+P      T A     +  A   TP++ CR+ +  NT ++ E+  CY+  A+  I C
Sbjct  151  ASIVPHPTQTWTYADIVSPIKTATKRTPLLRCRQDK--NTQWLHEVVFCYEYHALKQIDC  208

Query  858  TQAQLSCGTQP  890
             +    C  QP
Sbjct  209  NRT-AGCQNQP  218



>gb|ABD49101.1| S13-RNase [Prunus avium]
Length=225

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 90/176 (51%), Gaps = 10/176 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWP------QTTQQSSGPAYVDGLINQDLRDRLD  527
            WPP  C  +      ++  + FTIHGLWP      +     +G  + D  +  DLR  L 
Sbjct  37   WPPTTCRLSSKPSHQHRPFQRFTIHGLWPSNYSNPRKPSNCNGSQFDDRKVYPDLRSDLK  96

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHGK S   L +  YFER+  ++++ N+T +L N  I+P+
Sbjct  97   RSWPDVEGGNDTKFWEGEWNKHGKCSEQTLNQFQYFERSHDMWMSYNITEVLKNASIVPN  156

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
                      ++ +  A G TP++ C++   +NT  + E+  CY+ +A+  I C +
Sbjct  157  AKQRWKYSDIVSPIKGATGRTPLLRCKRDPATNTELLHEVVFCYEYNALKQIDCNR  212



>gb|AAZ06135.1| S-RNase [Prunus dulcis]
Length=227

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 88/178 (49%), Gaps = 12/178 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRLD  527
            WPP  C  +      ++  + FTIHGLWP         +  +GL      ++  LR +L 
Sbjct  37   WPPTTCRLSSKPSNQHRPLQRFTIHGLWPSNYSNPRKSSNCNGLQFDARKVSPRLRSKLK  96

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W N+E D +  FWEHEWNKHG  S   L +  +FER+  ++++ N+T IL N  I+PS
Sbjct  97   ISWPNVESDNDTKFWEHEWNKHGTCSQETLNQTQFFERSHDMWMSYNITNILKNASIVPS  156

Query  708  DNSPTTLASVSQ----AFGSTPIVVCRK--GRNSNTMYITEIRLCYDASAINLISCTQ  863
                   + +      A   TP + C++     +N+  + E+ +CYD  A   I C +
Sbjct  157  ATQKWKYSDIESPIKTATQRTPFLRCKRDPSHPNNSQLLHEVVICYDYKAKKQIDCNR  214



>gb|ABF61823.1| Sh-RNase [Prunus salicina]
Length=218

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 94/189 (50%), Gaps = 17/189 (9%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------LRDRLD  527
            WPP  C        P  + + FTIHGLWP      + P+  +G    D      LR +L 
Sbjct  26   WPPTNCKIRKKCSKPRPL-QMFTIHGLWPSNHSNPTTPSNCNGAQFDDRKVYPRLRSKLK  84

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG+ S   L ++ YFER+ +++   N+T IL N  I+PS
Sbjct  85   ISWPDVENGNDTKFWEGEWNKHGRCSEQTLNQMQYFERSYEIWNLFNITNILKNASIVPS  144

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKG-----RNSNTMYITEIRLCYDASAINLISCT  860
                 T    ++++      TP++ CR+         N+  + E+ LCY  +A+ LI C+
Sbjct  145  ATQTWTYSDIVSNIKAVTQRTPLLRCRRNPAYNKSGPNSQLLHEVVLCYGYNALKLIDCS  204

Query  861  QAQLSCGTQ  887
            +    CG Q
Sbjct  205  RTP-GCGNQ  212



>dbj|BAJ41469.1| S-ribonuclease 4 [Prunus persica]
Length=225

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 92/184 (50%), Gaps = 11/184 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C  +      ++  + FTIHGLWP      + P+  +G       +   LR +L 
Sbjct  37   WPPTTCRLSSKSSNQHRPLQRFTIHGLWPSNYSNPTKPSNCNGSRFNFTKVYPQLRTKLK  96

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L ++ YFE +  ++ + N+T IL N  I+PS
Sbjct  97   KSWPDVESGNDTKFWESEWNKHGTCSEQTLNQMQYFEVSHDMWRSYNITEILKNASIIPS  156

Query  708  DNSP----TTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQLS  875
                      +A +  A   TP++ C++ + +  +++ E+  CY+ +A+  I C +   +
Sbjct  157  ATKKWSYSDIVAPIKAATKRTPLLRCKQEKKTQLLHLHEVVFCYEYNALKQIDCNRTS-A  215

Query  876  CGTQ  887
            CG Q
Sbjct  216  CGNQ  219



>emb|CAC27789.1| RNase S6 [Prunus avium]
Length=223

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 94/190 (49%), Gaps = 17/190 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDR  521
            WPP  C   I  P  C   +  + FTIHGLWP        P+   G     +++  LR +
Sbjct  37   WPPTNCRVRIKRP--CSSPRPLQYFTIHGLWPSNYSNPRMPSNCTGPQFKRILSPQLRSK  94

Query  522  LDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGIL  701
            L   W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++++ N+T IL N  I+
Sbjct  95   LQTSWPDVESGNDTKFWESEWNKHGTCSKETLNQMQYFERSYAMWMSYNITEILKNASIV  154

Query  702  PSDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQ  869
            P           +A +  A   TP++ C++ +  NT+ + E+  CY+ +A+  I C +  
Sbjct  155  PHPTQTWKYSDIVAPIKAATKRTPLLRCKQDK--NTVLLHEVVFCYEYNALKQIDCNRTS  212

Query  870  LSCGTQPIYL  899
              C  QP  L
Sbjct  213  -GCQIQPAIL  221



>gb|ABY82415.1| self-incompatibility associated ribonuclease [Prunus pseudocerasus]
Length=226

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 91/184 (49%), Gaps = 11/184 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C  +       +  + FTIHGLWP        P+   G       +   LR +L 
Sbjct  38   WPPTTCRFSSKPSNQQRRLQIFTIHGLWPSNYSNPRMPSNCTGSQFNFTKVYPQLRSKLK  97

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L ++ YFER+ +++   N+T IL N  I+PS
Sbjct  98   KSWPDVESGNDTKFWESEWNKHGTCSEEKLNQMQYFERSHEMWNFHNITKILENASIVPS  157

Query  708  DNSPTTLASVSQAFG----STPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQLS  875
                 + + +  A      +TP + C++ + +  +++ E+ LCY+ +A+  I C +   +
Sbjct  158  ATQKWSYSDIVSAIKARTQTTPSLRCKRDKKTQLLHLHEVVLCYEYNALKQIDCNRT-AT  216

Query  876  CGTQ  887
            CG Q
Sbjct  217  CGNQ  220



>dbj|BAA36388.1| S6-RNase [Prunus avium]
 gb|AAT72120.1| S6-RNase [Prunus avium]
Length=223

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 93/187 (50%), Gaps = 17/187 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDR  521
            WPP  C   I  P  C   +  + FTIHGLWP        P+   G     +++  LR +
Sbjct  37   WPPTNCRVRIKRP--CSSPRPLQYFTIHGLWPSNYSNPRMPSNCTGPQFKRILSPQLRSK  94

Query  522  LDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGIL  701
            L   W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++++ N+T IL N  I+
Sbjct  95   LQTSWPDVESGNDTKFWESEWNKHGTCSKETLNQMQYFERSYAMWMSYNITEILKNASIV  154

Query  702  PSDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQ  869
            P           +A +  A   TP++ C++ +  NT+ + E+  CY+ +A+  I C +  
Sbjct  155  PHPTQTWKYSDIVAPIKAATKRTPLLRCKQDK--NTVLLHEVVFCYEYNALKQIDCNRTS  212

Query  870  LSCGTQP  890
              C  QP
Sbjct  213  -GCQNQP  218



>dbj|BAA83480.1| S4-RNase [Prunus avium]
Length=223

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 90/174 (52%), Gaps = 12/174 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-LIN-----QDLRDRLD  527
            WPP  C      C   +  ++FTIHGLWP        P+   G L N       LR  L 
Sbjct  37   WPPTNCRVRNKPCTKPRPLQNFTIHGLWPSNYSNPRMPSKCTGSLFNFRKVYPQLRSDLK  96

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG+ S + L ++ YFER+  ++++ N+T IL N  I+PS
Sbjct  97   ISWPDVESGNDTRFWESEWNKHGRCSEASLNQMQYFERSHAMWISYNITEILKNASIVPS  156

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISC  857
                 T    ++ + +A   TP++ C+  +++  ++  E+  CY+  A+  I C
Sbjct  157  ATKNWTYSDIVSPIKRATKRTPLLRCKYDKSTQLLH--EVVFCYEYDALKQIDC  208



>dbj|BAC56116.1| S7-RNase [Prunus mume]
 dbj|BAF91155.1| S-ribonuclease [Prunus mume]
Length=226

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 91/184 (49%), Gaps = 11/184 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C  +       +  + FTIHGLWP        P+   G       +   LR +L 
Sbjct  38   WPPTTCRFSSKPSNQQRRLQIFTIHGLWPSNYSNPRMPSNCTGSQFNFTKVYPQLRSKLK  97

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L ++ YFER+ +++   N+T IL N  I+PS
Sbjct  98   KSWPDVESGNDTRFWESEWNKHGTCSEEKLNQMQYFERSHEMWNFHNITKILENASIVPS  157

Query  708  DNSPTTLASVSQAFG----STPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQLS  875
                 + + +  A      +TP + C++ + +  +++ E+ LCY+ +A+  I C +   +
Sbjct  158  ATQKWSYSDIVSAIKARTQTTPSLRCKRDKKTQLLHLHEVVLCYEYNALKQIDCNRT-AT  216

Query  876  CGTQ  887
            CG Q
Sbjct  217  CGNQ  220



>gb|ABR19609.1| S22-RNase [Prunus avium]
Length=226

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 87/177 (49%), Gaps = 11/177 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRLD  527
            WPP  CI +   C  ++  + FTIHGLWP        P+   G       +   LR  L 
Sbjct  37   WPPATCIRSNKPCSKHRPLQIFTIHGLWPSNYSNPKMPSTCTGARFNFTKVYPQLRKDLK  96

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T IL N  I+P 
Sbjct  97   KSWPDVESGNDTKFWEGEWNKHGTCSEQTLNQMQYFERSHAMWTSFNITKILKNASIVPH  156

Query  708  DNSPTT----LASVSQAFGSTPIVVCR-KGRNSNTMYITEIRLCYDASAINLISCTQ  863
                 T    ++ +  A G TP++ C+   +  N+  + E+  CY+ +A+  I C +
Sbjct  157  PTQTWTYSDIVSPIKAATGRTPLLRCKGDPKQPNSQLLHEVVFCYEFNALKQIDCNR  213



>gb|ADZ48267.1| S-locus-associated ribonuclease [Prunus pseudocerasus]
Length=225

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 95/187 (51%), Gaps = 17/187 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+   G       ++  LR 
Sbjct  37   WPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTKPSNCAGSQFNFTKVSPQLRS  94

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
             L   W ++E   +  FWE EWNKHG+ S   L ++ YF+R+  ++ + N+T IL N  I
Sbjct  95   ILKTSWPDVESGNDTKFWEGEWNKHGRCSEQTLNQMQYFQRSFAMWRSYNITNILKNASI  154

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQA  866
            +PS     T    ++ +  A  +TP++ C++ +N NT  + E+ LC D +AI  I C + 
Sbjct  155  VPSATQTWTYSDIVSPIKAATQTTPLLRCKRDKN-NTQLLHEVVLCLDYNAIKQIDCNRT  213

Query  867  QLSCGTQ  887
               CG +
Sbjct  214  -AGCGNK  219



>gb|ABV02074.1| S-locus S-RNase S15 [Prunus spinosa]
Length=204

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 90/183 (49%), Gaps = 12/183 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQD  509
            F     WPP  C        P  + ++FTIHGLWP        P+   G       +   
Sbjct  10   FQFVQQWPPTNCRVRSKCSKPRPL-QNFTIHGLWPSNYSNPKKPSNCAGSRFNFTKMYPQ  68

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR  L + W ++E   +  FWE EWNKHGK S  +L ++ YFER+ +++ + N+T IL N
Sbjct  69   LRSELKMSWPDVESGNDTKFWEDEWNKHGKCSEGMLNQMQYFERSHEMWDSYNITEILKN  128

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCRKG-RNSNTMYITEIRLCYDASAINLIS  854
              I+PS          ++ +  A   TP + C++   +SN  ++ E+  CY+ +A+  I 
Sbjct  129  ASIVPSAKQIWKYSDIVSPIKAATHRTPALRCKRDPAHSNIQWLHEVVFCYEYNALKQID  188

Query  855  CTQ  863
            C +
Sbjct  189  CNR  191



>gb|ABA26546.1| S-RNase [Prunus dulcis]
Length=227

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 91/192 (47%), Gaps = 14/192 (7%)
 Frame = +3

Query  366  WPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRL  524
            WPP  C   N   C   +  ++FTIHGLWP      + P+      + +  ++  LR +L
Sbjct  37   WPPTNCRFRNKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCIGSQFNESKLSPKLRSKL  96

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L +  YF R++  +   N+T IL N  I+P
Sbjct  97   KISWPDVESGNDTKFWEGEWNKHGTCSQDTLNQTQYFARSLAFWNIRNITEILKNASIVP  156

Query  705  SDNS----PTTLASVSQAFGSTPIVVCRK--GRNSNTMYITEIRLCYDASAINLISCTQA  866
                       ++ +      TP++ C+      +N   + E+  CY+ +A+ LI C + 
Sbjct  157  HPTQTWKYSDIVSPIKAVTQRTPLLRCKSDPAHPNNPQLLHEVVFCYEFNALKLIDCNRT  216

Query  867  QLSCGTQPIYLK  902
               CG QPI  +
Sbjct  217  S-RCGNQPISFQ  227



>gb|ABY82414.1| self-incompatibility associated ribonuclease [Prunus pseudocerasus]
 gb|ADZ74122.1| self-incompatibility associated ribonuclease S5 [Prunus pseudocerasus]
Length=227

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 90/192 (47%), Gaps = 14/192 (7%)
 Frame = +3

Query  366  WPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRL  524
            WPP  C   N   C   +  ++FTIHGLWP      + P+      + +  ++  LR +L
Sbjct  37   WPPTNCRFRNKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCIGSQFNESKLSPKLRSKL  96

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L +  YF R+   +   N+T IL N  ILP
Sbjct  97   KISWPDVESGNDTKFWEGEWNKHGTCSQDTLNQTQYFARSHAFWNIRNITEILKNASILP  156

Query  705  SDNS----PTTLASVSQAFGSTPIVVCRK--GRNSNTMYITEIRLCYDASAINLISCTQA  866
                       ++ +      TP++ C+      +N   + E+  CY+ +A+ LI C + 
Sbjct  157  HPTQTWKYSDIVSPIKAVTHRTPLLRCKSDPAHPNNPQLLHEVVFCYEFNALKLIDCNRT  216

Query  867  QLSCGTQPIYLK  902
               CG QPI  +
Sbjct  217  S-RCGNQPISFQ  227



>gb|ABE27180.1| S-locus S-RNase c [Prunus armeniaca]
Length=226

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 91/189 (48%), Gaps = 11/189 (6%)
 Frame = +3

Query  333  RTWGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDG  494
            R++  F     WPP  C      C   +  + FTIHGLWP      + P+      + D 
Sbjct  26   RSYVYFQFVQQWPPTTCRVRWKPCSKPRPLQIFTIHGLWPSNYSNPTMPSNCTGSQFNDR  85

Query  495  LINQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
             +   LR +L   W N+E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T
Sbjct  86   KVYPQLRSKLKRSWPNVESGNDTKFWEGEWNKHGTCSEQTLNQMQYFERSHAMWYSHNIT  145

Query  675  TILANYGILPSDNSPTTLASVSQAFGS----TPIVVCRKG-RNSNTMYITEIRLCYDASA  839
             IL +  I+P        + +  A  +    TP++ C++     N+ ++ E+ LCY+  A
Sbjct  146  NILKSASIVPHPTQTWKYSDIVSAIKTDTQRTPLLRCKRDPAQPNSQFLHEVVLCYEYDA  205

Query  840  INLISCTQA  866
            + LI C + 
Sbjct  206  LKLIDCNRT  214



>gb|AAX62734.1| self-incompatibility associated ribonuclease [Prunus dulcis]
Length=193

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 88/177 (50%), Gaps = 11/177 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-LINQ-----DLRDRLD  527
            WPP  CI +   C  +     FTIHGLWP      + P+   G L N+      LR +L 
Sbjct  4    WPPTTCIRSRKPCSKHLPLPIFTIHGLWPSNYSNPTMPSNCIGSLFNESKLYPKLRSKLK  63

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG+ S  +L ++ YFER+  ++ + N+T IL N  I+P+
Sbjct  64   ISWPDVESGNDTQFWEGEWNKHGRCSKEMLNQMQYFERSHAMWNSHNITNILENAQIVPN  123

Query  708  DNSP----TTLASVSQAFGSTPIVVCRKG-RNSNTMYITEIRLCYDASAINLISCTQ  863
                      L  +  A   TP++ C+     SN+  + E+  CY+  A   I C +
Sbjct  124  ATRKWKYSDILTPIKAATKRTPLLRCKPDPAQSNSQLLHEVVFCYEYKAKKQIDCNR  180



>gb|ABW08114.1| S26-RNase [Prunus cerasus]
Length=226

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 91/184 (49%), Gaps = 12/184 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WP   CI       P  + + FTIHGLWP      + P+   G       +   +R +L 
Sbjct  39   WPTTTCILRKKCSQPRPL-QIFTIHGLWPSNYSNPTRPSNCIGSQFNFTKVYPHMRTKLK  97

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N++ IL N  I+PS
Sbjct  98   RAWPDVESGNDTKFWEGEWNKHGTCSEERLNQMQYFERSYAMWRSFNISEILKNASIVPS  157

Query  708  DNSP----TTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQLS  875
                      +A +  A   TP++ C++ + +  +++ E+  CY+ +A+  I C +   +
Sbjct  158  ATQKWSYSDIVAPIKAATKRTPLLRCKQDKKTQLLHLHEVVFCYEYNALKQIDCNRTS-A  216

Query  876  CGTQ  887
            CG Q
Sbjct  217  CGNQ  220



>gb|ABY65900.1| S-RNase [Prunus pseudocerasus]
Length=208

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 90/188 (48%), Gaps = 17/188 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------  509
            F     WPP  C      C   +  + FTIHGLWP      + P+  +GL  +D      
Sbjct  9    FQFVQQWPPTNCKVRGKPCSKPRPLQYFTIHGLWPSNYSNPTMPSNCNGLKFEDRKVYPQ  68

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L   W ++E   +  FWE EWNKHG  S  +L ++ YFER+ +++ + N+T IL N
Sbjct  69   LRSKLKRSWPDVESGNDTKFWESEWNKHGTCSEQILNQIQYFERSHEMWNSFNITHILKN  128

Query  690  YGILPSDNSPTTLASVSQAFGS----TPIVVCR------KGRNSNTMYITEIRLCYDASA  839
              I+PS       + +  A  +    TP + C+      KG+ + T  + E+  CY   A
Sbjct  129  ASIVPSATQTWKYSDIVSAIKAVTKRTPALRCKNNPTQPKGQ-AKTQLLHEVVFCYGYRA  187

Query  840  INLISCTQ  863
            +  I C Q
Sbjct  188  LKQIDCNQ  195



>gb|ABJ97522.1| S-RNase [Prunus webbii]
Length=239

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 96/189 (51%), Gaps = 23/189 (12%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C      C   +  + FTIHGLWP      + P+  +G       +   L+ +L 
Sbjct  38   WPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNYSNPTMPSNCNGSQFEAKKVYPRLQSKLK  97

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG  S+ +L ++ YFER+ +++ + N+T IL N  I+PS
Sbjct  98   ISWPDVESGNDTNFWEREWNKHGTCSSRILNQMQYFERSYEMWRSYNITNILKNASIVPS  157

Query  708  DNSPTTLASVSQAFGS----TPIVVCR------KGR-------NSNTMYITEIRLCYDAS  836
                 T + +     +    TP++ C+      KG+        +N+ ++ E+ LC+D +
Sbjct  158  ATQTWTYSDIVSPIKAVTQRTPLLRCKSHPTKPKGQAKSQPTSQANSQFLHEVVLCFDYN  217

Query  837  AINLISCTQ  863
            A+ LI C +
Sbjct  218  ALILIDCNR  226



>gb|ABG76213.1| S-RNase [Prunus spinosa]
Length=190

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 89/177 (50%), Gaps = 12/177 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRLD  527
            WPP  C A P  C   +  ++FTIHGLWP      + P+  +G       +   LR ++ 
Sbjct  2    WPPTSCRA-PKKCSKPRPLQNFTIHGLWPSNYSNPTMPSNCNGTKFKIQNLYPYLRSKMK  60

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG  S  +L  + YF R+  ++ + N+T IL N  I+P 
Sbjct  61   IAWPDVESGNDTRFWEREWNKHGTCSERILNLMQYFRRSFAMWKSHNITEILKNASIVPH  120

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKG-RNSNTMYITEIRLCYDASAINLISCTQ  863
                 T    ++ +  A   TP++ C++     N  ++ E+  CY+ +A+  I C +
Sbjct  121  PTQTWTYSDIVSPIKAATKRTPLLRCKRDPAQPNMQWLHEVVFCYEYNALKQIDCNR  177



>gb|ABB40578.1| ribonuclease S26-RNase [Prunus cerasus]
Length=215

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 91/184 (49%), Gaps = 12/184 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WP   CI       P  + + FTIHGLWP      + P+   G       +   +R +L 
Sbjct  28   WPTTTCILRKKCSQPRPL-QIFTIHGLWPSNYSNPTRPSNCIGSQFNFTKVYPHMRTKLK  86

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N++ IL N  I+PS
Sbjct  87   RAWPDVESGNDTQFWEGEWNKHGTCSEERLNQMQYFERSYAMWRSFNISEILKNASIVPS  146

Query  708  DNSP----TTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQLS  875
                      +A +  A   TP++ C++ + +  +++ E+  CY+ +A+  I C +   +
Sbjct  147  ATQKWSYSDIVAPIKAATKRTPLLRCKQDKKTQLLHLHEVVFCYEYNALKQIDCNRTS-A  205

Query  876  CGTQ  887
            CG Q
Sbjct  206  CGNQ  209



>gb|ACJ22520.1| S7-2 RNase [Prunus spinosa]
Length=199

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 90/183 (49%), Gaps = 12/183 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQD  509
            F     WPP  C A P  C   +  ++FTIHGLWP      + P+  +G       +   
Sbjct  5    FQFVQQWPPTSCRA-PKKCSKPRPLQNFTIHGLWPSNYSNPTMPSNCNGTKFKIQNLYPY  63

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR ++ I W ++E   +  FWE EWNKHG  S  +L  + YF R+  ++ + N+T IL N
Sbjct  64   LRSKMKIAWPDVESGNDTRFWEREWNKHGTCSERILNLMQYFRRSFAMWKSHNITEILKN  123

Query  690  YGILPSDNSPTT----LASVSQAFGSTPIVVCRKG-RNSNTMYITEIRLCYDASAINLIS  854
              I+P      T    ++ +  A   TP++ C++     N  ++ E+  CY+ +A+  I 
Sbjct  124  ASIVPHPTQTWTYSDIVSPIKAATKRTPLLRCKRDPAQPNMQWLHEVVFCYEYNALKQID  183

Query  855  CTQ  863
            C +
Sbjct  184  CNR  186



>gb|ADZ74126.1| self-incompatibility associated ribonuclease S8 [Prunus pseudocerasus]
Length=234

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 90/188 (48%), Gaps = 17/188 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQD  509
            F     WPP  CI +   C  ++  + FTIHGLWP        P+      + +  +   
Sbjct  35   FQFVQQWPPATCIRSTKPCSKHRPLQIFTIHGLWPSNYSNPKMPSNCVGSQFNESKLYPQ  94

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR RL   W ++E   +  FWE EWNKHG  S  +L ++ YFER+ +++ + N+T IL N
Sbjct  95   LRSRLKRSWPDVESGNDTKFWEGEWNKHGTCSEQILDQIQYFERSHEMWNSFNITHILKN  154

Query  690  YGILPSDNSPTTLASVSQAFGS----TPIVVCR------KGRNSNTMYITEIRLCYDASA  839
              I+PS       + +  A  +    TP + C+      KG+ + T  + E+  CY   A
Sbjct  155  ASIVPSATQTWKYSDIVSAIKAVTKRTPALRCKSNPTQPKGQ-AKTQLLHEVVFCYGYRA  213

Query  840  INLISCTQ  863
            +  I C Q
Sbjct  214  LKQIDCNQ  221



>gb|ABG76217.1| S-RNase [Prunus spinosa]
Length=188

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 88/178 (49%), Gaps = 14/178 (8%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-------LINQDLRDRL  524
            WPP  C  +     P  + + FTIHGLWP      + P+   G        I  +L+ +L
Sbjct  2    WPPTNCKVHTKCSKPRPL-QIFTIHGLWPSNHSNPTKPSNCAGSVFERLVCIPPELQTKL  60

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S  +L ++ YFER+  ++++ N+T IL N  I+P
Sbjct  61   KISWPDVESGNDTLFWEKEWNKHGTCSEGMLNQMQYFERSYAMWMSYNITEILKNASIVP  120

Query  705  SDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQA  866
                       ++ +  A   TP++ C+  +N+  ++  E+  CY+  A   I C + 
Sbjct  121  HATQTWKYSDIVSPIKTATKRTPLLRCKNDKNTQLLH--EVVFCYEYKAKKQIDCNRT  176



>gb|ADZ48269.1| S-locus-associated ribonuclease [Prunus pseudocerasus]
Length=221

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 90/174 (52%), Gaps = 10/174 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG----LINQDLRDRLDIY  533
            WPP  C  +      ++  ++FTIHGLWP      + P+  +G    ++   L  +L I 
Sbjct  37   WPPTTCRLSSKPRYKHRPLQNFTIHGLWPSNYSNPTKPSNCNGSQFKILPPQLISKLKIS  96

Query  534  WSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSDN  713
            W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T IL N  I+PS  
Sbjct  97   WPDVESGNDTKFWEGEWNKHGTCSEQTLNQLQYFERSYSMWKSYNITEILKNASIIPSAT  156

Query  714  S----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
                    ++++  A   TP++ C+  +N+  ++  E+  CY  +AI  I C +
Sbjct  157  QTWKYSDIVSAIKTATKRTPLLRCKWDKNTQLLH--EVVFCYGYNAIKQIDCNR  208



>dbj|BAA34664.1| Sc-RNase [Prunus dulcis]
 dbj|BAC65203.1| Sc-RNase [Prunus dulcis]
 gb|AAL35960.2| RNase [Prunus dulcis]
Length=223

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 89/177 (50%), Gaps = 13/177 (7%)
 Frame = +3

Query  366  WPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRL  524
            WPP  C +     C   +  + FTIHGLWP      + P+  +G       +  ++R  L
Sbjct  37   WPPTNCRVRMKRPCSNPRPLQYFTIHGLWPSNFSNPTKPSNCNGTKFDARKVYPEMRSDL  96

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L +  YFER+ +++++ N+T IL N  I+P
Sbjct  97   KISWPDVESGNDTKFWEDEWNKHGTCSEQTLNQFQYFERSHEMWMSYNITEILKNASIVP  156

Query  705  SDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
                  T    ++ +  A G TP++ C+   ++NT  + E+  CY   AI  I C +
Sbjct  157  HPAKTWTYSDIVSPIKAATGRTPLLRCK--YDNNTQLLHEVVFCYGYKAIKQIDCNR  211



>gb|ABF61820.1| Sf-RNase [Prunus salicina]
Length=215

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 87/179 (49%), Gaps = 12/179 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  CI +   C  ++    FTIHGLWP        P+   G       ++ +L+ +L 
Sbjct  26   WPPATCIRSNKPCTKHRPLPIFTIHGLWPSNYSNPRMPSNCRGSLFETRKLSPELQSKLK  85

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W N+E D +   WEHEWNKHG+ S   L +  YF+R+  ++ + N+T IL N  I+P+
Sbjct  86   RAWPNVETDNDTKLWEHEWNKHGRCSEGTLNQTQYFQRSYSMWRSHNITEILRNASIVPN  145

Query  708  DNS----PTTLASVSQAFGSTPIVVCR--KGRNSNTMYITEIRLCYDASAINLISCTQA  866
                      ++ +  A   TP++ C+      + +  + E+  CY+  A+  I C + 
Sbjct  146  AKQTWKYSDIVSPIQTATKRTPVLRCKPDPAHPNISQLLHEVVFCYEYDALKQIDCNRT  204



>dbj|BAF42766.1| Sb-RNase [Prunus salicina]
Length=221

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 90/174 (52%), Gaps = 10/174 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG----LINQDLRDRLDIY  533
            WPP  C  +      ++  ++FTIHGLWP      + P+  +G    ++   L  +L I 
Sbjct  37   WPPTTCRLSSKPRYKHRPLQNFTIHGLWPSNYSNPTKPSNCNGSQFKILPPQLISKLKIS  96

Query  534  WSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSDN  713
            W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T IL N  I+PS  
Sbjct  97   WPDVESGNDTRFWEGEWNKHGTCSEQTLNQLQYFERSYSMWKSYNITEILKNASIIPSAT  156

Query  714  S----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
                    ++++  A   TP++ C+  +N+  ++  E+  CY  +AI  I C +
Sbjct  157  QTWKYSDIVSAIKTATKRTPLLRCKWDKNTQLLH--EVVFCYGYNAIKQIDCNR  208



>gb|ABW74347.1| S34-RNase [Prunus cerasus]
Length=226

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 89/179 (50%), Gaps = 15/179 (8%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRD  518
            WPP  C   I  P  C   +  ++FTIHGLWP      + P+      Y D  +   LR 
Sbjct  37   WPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKYEDRKVYPKLRS  94

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++L+ N+T IL N  I
Sbjct  95   KLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFEVSHDMWLSYNITEILRNASI  154

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
            +P      T    ++ +  A   TP++ C+    +NT  + E+  CY  +A+  I C +
Sbjct  155  VPHPTRTWTYSDIVSPIKAATKRTPLLRCKTDTATNTELLHEVVFCYGYNALKQIDCNR  213



>ref|XP_011070992.1| PREDICTED: extracellular ribonuclease LE-like [Sesamum indicum]
Length=245

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 87/194 (45%), Gaps = 13/194 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQS-----SGPAYVDGLINQ  506
            FY    WP  YC    A C P   K   +FTIHGLWP     S     +  +  +     
Sbjct  48   FYFVQQWPGSYCDTRKACCYPTTGKPAANFTIHGLWPNYNNGSYPSNCNPNSPYNATKIS  107

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL  ++++ W  L    N    FW HEW KHG  S S+L +  YFE A+ +    N+  +
Sbjct  108  DLLGKMEVDWPTLACPTNGGTRFWTHEWEKHGTCSESVLDQHSYFEAALNIKNKVNLLKV  167

Query  681  LANYGILPSDN---SPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L + GI P+D     P    ++    G TP + C    + N   I EI LC DAS  +LI
Sbjct  168  LEDAGIQPNDQFYREPQIREAIKAGIGYTPAITCNTDSSKNRQ-ILEIYLCVDASGKDLI  226

Query  852  SCTQAQLSCGTQPI  893
             C +    C   P+
Sbjct  227  ECPKFPTRCKKPPL  240



>gb|ABV02075.1| S-locus S-RNase S16 [Prunus spinosa]
Length=227

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 89/192 (46%), Gaps = 14/192 (7%)
 Frame = +3

Query  366  WPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRL  524
            WPP  C   N   C   +  ++FTIHGLWP      + P+      + +  ++  LR +L
Sbjct  37   WPPTNCRFRNKRPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCIGSQFNESKLSPKLRSKL  96

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L +  YF R    +   N+T IL N  I+P
Sbjct  97   KISWPDVESGNDTKFWEGEWNKHGTCSQDTLNQTQYFARCHAFWNIRNITEILKNASIVP  156

Query  705  SDNS----PTTLASVSQAFGSTPIVVCRK--GRNSNTMYITEIRLCYDASAINLISCTQA  866
                       ++ +      TP++ C+      +N   + E+  CY+ +A+ LI C + 
Sbjct  157  HPTQTWKYSDIVSPIKAVTHRTPLLRCKSDPAHPNNPQLLHEVVFCYEFNALKLIDCNRT  216

Query  867  QLSCGTQPIYLK  902
               CG QPI  +
Sbjct  217  S-RCGNQPISFQ  227



>gb|ABF61822.1| S8-RNase [Prunus salicina]
Length=213

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 95/177 (54%), Gaps = 15/177 (8%)
 Frame = +3

Query  366  WPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRL  524
            WPP  C +  P+  + ++  ++FTIHGLWP      + P+   G       ++  L+ +L
Sbjct  28   WPPTTCRLKRPS--IKHRPLQNFTIHGLWPSNYSNPTMPSNCRGSQFDARNLSPRLQSKL  85

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
               W ++E   +  FWE EWNKHGK S   L ++ YFER+ +++ + N+T IL N  I+P
Sbjct  86   KRSWPDVESSNDTRFWEGEWNKHGKCSEQTLNQMQYFERSHEMWSSFNITEILKNASIVP  145

Query  705  SDNSPTTLAS----VSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
                  T A+    +  A   TP++ C++  ++NT  + E+  CY+ +A+  I C +
Sbjct  146  HPTQTWTYAAIVSPIKAATKRTPVLRCKQ--HNNTQLLHEVVFCYEYNALKQIDCNR  200



>gb|AGH17535.1| S48-RNase, partial [Prunus dulcis]
Length=184

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 80/156 (51%), Gaps = 10/156 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRLD  527
            WPP  C  +      ++  + FTIHGLWP         +  +GL      ++  LR +L 
Sbjct  27   WPPTTCRLSSKPSNQHRPLQRFTIHGLWPSNYSNPRKSSNCNGLQFDARKVSPRLRSKLK  86

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W N+ERD +  FWEHEWNKHG  S   L +  +FER+  ++++ N+  IL N  ILP 
Sbjct  87   ISWPNVERDNDTKFWEHEWNKHGTCSQETLNQTQFFERSHDMWMSYNIREILKNASILPH  146

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
                 T    ++ +  A G TP++ C+   N+  ++
Sbjct  147  PAKTWTYSDIVSPIKAATGRTPLLRCKYDNNTQLLH  182



>gb|ABL86027.1| S-RNase [Prunus tenella]
 gb|ABL86028.1| S8-RNase [Prunus tenella]
Length=208

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 89/186 (48%), Gaps = 15/186 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLI  500
            F     WPP  C   I  P  C   +  ++FTIHGLWP      + P+      Y D  +
Sbjct  13   FQFVQQWPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKYEDRKV  70

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
               LR +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++++ N+T I
Sbjct  71   YPKLRSKLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFEISHDMWVSYNITEI  130

Query  681  LANYGILPSDNSP----TTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            L N  I+P           ++ +  A   TP++ C+    +NT  + E+  CY+  A+  
Sbjct  131  LKNASIVPHPTQKWSYSDIVSPIKTATKRTPLLRCKTDPATNTELLHEVVFCYEYHALKQ  190

Query  849  ISCTQA  866
            I C + 
Sbjct  191  IDCNRT  196



>dbj|BAF91153.1| S-ribonuclease [Prunus mume]
Length=186

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 82/160 (51%), Gaps = 10/160 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  C  +      ++  + FTIHGLWP      + P+      Y D  +   LR +L 
Sbjct  26   WPPTTCKLSSRPSCKHRPLQIFTIHGLWPSNYSNPTRPSNCIGSKYNDSKLYPKLRSKLK  85

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W N+E D +  FWE EWNKHG  S   L ++ YFER+  ++L+ N+T IL N  I+PS
Sbjct  86   RSWPNVETDNDTKFWEGEWNKHGTCSEETLNQMQYFERSHNMWLSHNITHILKNASIVPS  145

Query  708  DNSP----TTLASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
                      ++++  A   TP++ C++   +NT  + E+
Sbjct  146  AKQKWSYSDIVSAIKTATKRTPVLRCKRDPATNTELLHEV  185



>gb|AFI24537.1| self-incompatibility associated ribonuclease S4, partial [Prunus 
virginiana]
Length=217

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 92/187 (49%), Gaps = 17/187 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDR  521
            WPP  C   I  P  C   +  + FTIHGLWP        P+   G     +++  LR +
Sbjct  31   WPPTNCRVRIKRP--CSSPRPLQYFTIHGLWPSNYSNPRMPSNCTGPQFKRILSPQLRSK  88

Query  522  LDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGIL  701
            L   W ++E   +  FWE EWNK G  S   L ++ YFER+  ++++ N+T IL N  I+
Sbjct  89   LQTSWPDVESGNDTKFWESEWNKDGTCSKETLNQMQYFERSYAMWMSYNITEILKNASIV  148

Query  702  PSDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQ  869
            P           +A +  A   TP++ C++ +  NT+ + E+  CY+ +A+  I C +  
Sbjct  149  PHPTQTWKYSDVVAPIKAATKRTPLLRCKQDK--NTVLLHEVVFCYEYNALKQIDCNRTS  206

Query  870  LSCGTQP  890
              C  QP
Sbjct  207  -GCQNQP  212



>ref|XP_007151480.1| hypothetical protein PHAVU_004G050200g [Phaseolus vulgaris]
 gb|ESW23474.1| hypothetical protein PHAVU_004G050200g [Phaseolus vulgaris]
Length=215

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 90/179 (50%), Gaps = 14/179 (8%)
 Frame = +3

Query  354  LSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQT-------TQQSSGPAYVDGLINQDL  512
            +S FWP G C  NP  C+  K+ E+FTIHGLWP         TQQ   P+ V  L   + 
Sbjct  26   ISQFWPRGLCHRNPL-CVKPKLLEEFTIHGLWPSNWKGPPSCTQQKFNPSLVRFLFLNN-  83

Query  513  RDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANY  692
               L   W +   + +  FW +EW KHG  SN  L + D+F  +I +Y   N+T IL N 
Sbjct  84   NAHLQQVWPSYYANGDVKFWAYEWEKHGTCSN--LQQFDFFTLSIDIYERNNLTDILKNA  141

Query  693  GILPSDNSPTTLAS--VSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAI-NLISCT  860
            GI+      T + S  + +A    P ++C+    S    +TEIR+C D S I   I+C+
Sbjct  142  GIVNGKTYNTNIISLAIGRALHVEPQLICKSTSKSTVSILTEIRICLDKSRIPQYINCS  200



>gb|ABA26545.1| S-RNase [Prunus dulcis]
Length=225

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 87/182 (48%), Gaps = 12/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQD  509
            F     WPP  C      C   +  ++FTIHGLWP       T  + +G  +    +   
Sbjct  31   FQFVQQWPPTNCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTTPSKCTGSRFKKENVYPQ  90

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR ++ I W ++E   +  FWE EWNKHG  S   L +V YF+R+  ++ + NVT IL N
Sbjct  91   LRSKMKISWPDVESGNDTRFWESEWNKHGTCSEDTLNQVQYFQRSHAMWRSHNVTEILRN  150

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISC  857
              I+P           ++ +  A   TP++ C+  +   T  + E+  CY+ +A+  I C
Sbjct  151  ASIVPHPTQTWSYSDIVSPIKTATKRTPLLRCKYDK--KTQLLHEVVFCYEYNALKQIDC  208

Query  858  TQ  863
             +
Sbjct  209  NR  210



>gb|AAF82612.2|AF157008_1 self-incompatibility associated ribonuclease [Prunus dulcis]
Length=221

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 88/176 (50%), Gaps = 12/176 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQ-----TTQQSSGPAYVDGLINQDLRDRLDI  530
            WPP  C        P  ++  FTIHGLWP      T    +G  + D  ++  LR++L  
Sbjct  37   WPPTNCRVRTKCSKPRPLQY-FTIHGLWPSNYSNPTPSNCNGSKFDDRNVSPQLRNKLKR  95

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E   +  FWE EWNKHG  S   L +  YFER+  ++ + N+T IL N  I+PS 
Sbjct  96   SWPDVESGNDTKFWEGEWNKHGICSEQTLNQFQYFERSQDMWKSHNITEILKNASIVPSA  155

Query  711  NS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQA  866
                     ++ + +A   TPI+ C++ +   T  + E+  CY+ +A+  I C + 
Sbjct  156  TQNWRYSDIVSPIKRATKRTPILRCKQDK--KTQLLHEVVFCYEYNALKQIDCNRT  209



>gb|AAP92437.1| S-RNase [Prunus avium]
Length=224

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 94/187 (50%), Gaps = 18/187 (10%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G       +   LR 
Sbjct  37   WPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTMPSNCNGTQFKMQNLFPYLRS  94

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            RL + W ++E   +  FWE EWNKHG  S  +L  + YF+R+  ++ + N+T IL N  I
Sbjct  95   RLKMSWPDVESGNDTKFWEGEWNKHGTCSERILNIMQYFQRSQAMWKSHNITEILKNASI  154

Query  699  LPSDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQA  866
            +P           ++ +  A G TP++ C++ +++  ++  E+  CYD +AI  I C + 
Sbjct  155  VPHPTQTWKYSDIVSPIKSATGRTPLLRCKQDKSTQLLH--EVVFCYDYNAIKQIDCNRT  212

Query  867  QLSCGTQ  887
               CG Q
Sbjct  213  -AGCGKQ  218



>dbj|BAJ41467.1| S-ribonuclease 3 [Prunus persica]
Length=228

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 88/179 (49%), Gaps = 15/179 (8%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------LRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G   +D      LR 
Sbjct  39   WPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSKFEDRKVYPKLRA  96

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L   W ++E   +  FWE EWNKHG  S   L ++ YFER+   +   N+T IL N  I
Sbjct  97   KLKKSWPDVESGNDTRFWEGEWNKHGTCSEQTLNQMQYFERSHAFWNMRNITEILKNASI  156

Query  699  LPSDNSPTTLASVSQAFGS----TPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
            +PS     + A +     +    TP++ C+    +NT  + E+  CY+ +A+ LI C +
Sbjct  157  VPSATQTWSYADIVSPIKAVTQKTPLLRCKSNPATNTELLHEVVFCYEYNALKLIDCNR  215



>dbj|BAC56115.1| S1-RNase [Prunus mume]
 dbj|BAF91149.1| S-ribonuclease [Prunus mume]
Length=224

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 89/174 (51%), Gaps = 13/174 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  C      C   +  + FTIHGLWP      + P+      + + +++  LR +L 
Sbjct  39   WPPTTCRVR-GKCSNPRPIQIFTIHGLWPSNYSNPTTPSNCIGSQFKESMVSPRLRSKLK  97

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W N+E   +  FWE EWNKHG+ S   L +  YFER+ +++   N+T IL N  I+P 
Sbjct  98   RSWPNVEGSNDTRFWEGEWNKHGRCSQQTLNQYQYFERSHEMWHFHNITNILKNASIVPH  157

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISC  857
                 T    ++++     +TP+V C++ + +  ++  E+ LC++  A+  I C
Sbjct  158  PTQTWTYSDIVSTIKAVTQTTPLVRCKQHKKTQLLH--EVVLCFEYKALKQIDC  209



>dbj|BAA83479.1| S1-RNase [Prunus avium]
 emb|CAC27784.1| RNase S1 [Prunus avium]
Length=226

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 89/186 (48%), Gaps = 15/186 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLI  500
            F     WPP  C   I  P  C   +  ++FTIHGLWP      + P+      Y D  +
Sbjct  31   FQFVQQWPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKYEDRKV  88

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
               LR +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++++ N+T I
Sbjct  89   YPKLRSKLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFEISHDMWVSYNITEI  148

Query  681  LANYGILPSDNSP----TTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            L N  I+P           ++ +  A   TP++ C+    +NT  + E+  CY+  A+  
Sbjct  149  LKNASIVPHPTQKWSYSDIVSPIKTATKRTPLLRCKTDPATNTELLHEVVFCYEYHALKQ  208

Query  849  ISCTQA  866
            I C + 
Sbjct  209  IDCNRT  214



>gb|ABV72004.1| S16-RNase [Prunus mume]
Length=227

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 90/180 (50%), Gaps = 14/180 (8%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDRLDI  530
            WPP  C  +      ++  + FTIHGLWP        P+  +G     +++  LR +L I
Sbjct  35   WPPTTCRLSSKPSNQHRPLQRFTIHGLWPSNYSNPRKPSNCNGSRFKGIVSPKLRSKLKI  94

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++ER  +  FWE EWNKHG  S   + ++ YFER+ +++   N+T  L N  I+PS 
Sbjct  95   AWPDVERGNDTKFWEGEWNKHGTCSEQTINQMQYFERSYEMWNFRNITEALKNASIVPSA  154

Query  711  NSPTT----LASVSQAFGSTPIVVCRK-----GRNSNTMYITEIRLCYDASAINLISCTQ  863
                T    ++++  A  +TP + C+           T  + E+ LCY+ +A+  I C +
Sbjct  155  TQTWTYSDIVSAIKTATKTTPSLRCKPDPAQIKSGPKTQLLLEVVLCYEYNALKQIDCNR  214



>dbj|BAA10891.1| ribonuclease (RNase LC1) [Luffa aegyptiaca]
Length=214

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 96/196 (49%), Gaps = 13/196 (7%)
 Frame = +3

Query  333  RTWGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS----SGPAYVDGLI  500
            +T+ SF++   WPP  C      C+   ++  FTIHG+WPQ    S     GP + D   
Sbjct  24   QTFDSFWMVQHWPPAVCSFQQGRCVGQGLRS-FTIHGVWPQKGGTSVINCPGPTF-DFTK  81

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
               L   L++ W N+    N+ FW HEWNKHG  S S   +  YF+ AI +  + ++ + 
Sbjct  82   ISHLESTLNVDWPNVITGNNKWFWGHEWNKHGICSVSKFDQQAYFQMAINMRNSIDLLSA  141

Query  681  LANYGILPSDNSPT---TLASVSQAFGSTPIVVCR-KGRNSNTMYITEIRLCYDASAINL  848
            L   G++P+  S       +++    G  P++ CR  GR S  +   EI +C+D   + L
Sbjct  142  LRVGGVVPNGRSKARQRVQSAIRAQLGKEPVLRCRGTGRQSRLL---EIVMCFDDDGVTL  198

Query  849  ISCTQAQLSCGTQPIY  896
            I+C  A  +C    I+
Sbjct  199  INCNPANSNCPNSFIF  214



>dbj|BAF91848.1| Se-RNase [Prunus salicina]
Length=239

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 93/196 (47%), Gaps = 24/196 (12%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  C        P  + + FTIHGLWP      + P+      + D  ++  LR +L 
Sbjct  39   WPPTNCKVRTKCSNPRPL-QIFTIHGLWPSNYSNPTMPSNCNGSKFEDRKVSPQLRSKLK  97

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T IL N  I+PS
Sbjct  98   RSWPDVESGNDTKFWEGEWNKHGTCSEQTLNQMQYFERSHSMWYSFNITEILRNASIVPS  157

Query  708  DNSPTTLASVSQAFGS----TPIVVCR------------KGRNSNTMYITEIRLCYDASA  839
                 T + +  A  +    TP++ C+                +N++ + E+ LCY  +A
Sbjct  158  ATQTWTYSDIVSAIKTATQRTPLLRCKPQPKTKSQTKSQPKSQANSLLLHEVVLCYGYNA  217

Query  840  INLISCTQAQLSCGTQ  887
            + LI C +    CG Q
Sbjct  218  LKLIDCNRTS-GCGNQ  232



>dbj|BAA36387.1| S2-RNase [Prunus avium]
Length=208

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 95/194 (49%), Gaps = 18/194 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LI  500
            F     WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G       +
Sbjct  15   FQFVQQWPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDGRKV  72

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            +  LR +L   W ++E   +  FWE EWNKHG+ S   L ++ YFER+  ++ + N+T I
Sbjct  73   SPQLRAKLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFERSQNMWRSYNITEI  132

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            L N  I+P      T    ++ + +A   TP++ C++ +   T  + E+  CY+ +A+  
Sbjct  133  LRNASIVPHPTQTWTYSDIVSPIKKATKRTPLLRCKQDK--KTQLLHEVVFCYEYNALKQ  190

Query  849  ISCTQAQLSCGTQP  890
            I C +    C  QP
Sbjct  191  IDCNRT-AGCQNQP  203



>gb|ACU25553.1| self-incompatibility associated ribonuclease S2 [Prunus pseudocerasus]
Length=225

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 90/182 (49%), Gaps = 12/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------  509
            F     WPP  C      C   +  + FTIHGLWP      + P+  +GL  +D      
Sbjct  31   FQFVQQWPPTNCKVRGKPCSKPRPLQYFTIHGLWPSNYSNPTMPSNCNGLKFEDRKVYPQ  90

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++ + N+T IL N
Sbjct  91   LRSKLKRSWPDVESGNDTKFWESEWNKHGRCSEQTLNQMQYFEGSHDMWKSFNITNILKN  150

Query  690  YGILPSDN---SPTTLAS-VSQAFGSTPIVVCRK--GRNSNTMYITEIRLCYDASAINLI  851
              I+P+     S + +AS +  A   TP++ C++     +    + E+  CYD +AI  I
Sbjct  151  ASIIPNATQTWSYSDIASPIKAATKRTPLLRCKRDPKHPNKPQLLHEVVFCYDYNAIKQI  210

Query  852  SC  857
             C
Sbjct  211  DC  212



>dbj|BAC56114.1| Sf-RNase [Prunus mume]
Length=221

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 87/185 (47%), Gaps = 15/185 (8%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRLD  527
            WPP  C      C   +  + FTIHGLWP      + P+   GL      +   L+  L 
Sbjct  37   WPPTNCKFR--KCSKPRPLQRFTIHGLWPSNYSNPTRPSNCTGLQFEARKVYPQLQSDLK  94

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHGK S   L +  YFER+  ++ + N+T IL N  I+P 
Sbjct  95   ISWPDVESGNDTKFWEDEWNKHGKCSEQTLNQRQYFERSHAMWTSFNITEILKNASIVPH  154

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQLS  875
                      +A +  A   TP++ C+  + +  ++  E+  CY+  A   I C +    
Sbjct  155  PKKTWSYSDIVAPIKTATERTPLLRCKLDKKTQLLH--EVVFCYEYKAKKQIDCNRT-AG  211

Query  876  CGTQP  890
            CG QP
Sbjct  212  CGHQP  216



>gb|ABL86035.1| S-RNase [Prunus tenella]
Length=178

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 80/154 (52%), Gaps = 10/154 (6%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQD  509
            F     WPP  CI +   C  ++  ++FTIHGLWP      + P+      + +  ++  
Sbjct  13   FQFVQQWPPATCIRSKKPCSKHRALQNFTIHGLWPSNYSNPTRPSNCVGSHFNESKLSPQ  72

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            L  +L I W ++E   +  FWE EWNKHGK S   L ++ YFER+  ++++ N+T IL N
Sbjct  73   LISKLRISWPDVESGNDTQFWEGEWNKHGKCSQEKLNQMQYFERSHDMWMSYNITDILRN  132

Query  690  YGILPSDNSPTTLASVSQAFGS----TPIVVCRK  779
              I+P      T + +  A  S    TP+V C++
Sbjct  133  ASIVPHPTQTWTYSDIVSAIKSKTQRTPLVRCKR  166



>dbj|BAA95158.1| Sb-RNase [Prunus salicina]
Length=203

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 90/175 (51%), Gaps = 10/175 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG----LINQDLRDRLDIY  533
            WPP  C  +      ++  ++FTIHGLWP      + P+  +G    ++   L  +L I 
Sbjct  19   WPPTTCRLSSKPRYKHRPLQNFTIHGLWPSNYSNPTKPSNCNGSQFKILPPQLISKLKIS  78

Query  534  WSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSDN  713
            W ++E   +  FWE EWNKHG  S   L ++ YFE++  ++ + N+T IL N  I+PS  
Sbjct  79   WPDVESGNDTRFWEGEWNKHGTCSEQTLNQLQYFEQSYSMWKSYNITEILKNASIIPSAT  138

Query  714  S----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQA  866
                    ++++  A   TP++ C+  +N+  ++  E+  CY  +AI  I C + 
Sbjct  139  QTWKYSDIVSAIKTATKRTPLLRCKWDKNTQLLH--EVVFCYGYNAIKQIDCNRT  191



>gb|ADD71779.1| S38-RNase [Prunus armeniaca]
Length=169

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 79/148 (53%), Gaps = 10/148 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  CI +   C  ++  ++FTIHGLWP      + P+      + +  ++  L  +L 
Sbjct  3    WPPATCIRSKKPCSKHRALQNFTIHGLWPSNYSNPTRPSNCVGSHFNESKLSPQLISKLR  62

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHGK S   L ++ YFER+  ++++ N+T IL N  I+P 
Sbjct  63   ISWPDVESGNDTQFWEGEWNKHGKCSQEKLNQMQYFERSHDMWMSYNITDILKNASIVPH  122

Query  708  DNSPTTLASVSQAFGS----TPIVVCRK  779
                 T + +  A  S    TP+V C++
Sbjct  123  PTQTWTYSDIVSAIKSKTQRTPLVRCKR  150



>gb|ADZ48270.1| S-locus-associated ribonuclease [Prunus speciosa]
Length=226

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 89/179 (50%), Gaps = 15/179 (8%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P    G       +   LR 
Sbjct  37   WPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTMPNKCTGSKFNFTKVFPYLRS  94

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
             L   W ++E   +  FWE EWNKHG  S+ +L ++ YF+R+  ++ + N+T IL N  I
Sbjct  95   NLKKSWPDVESGNDTKFWEGEWNKHGTCSSRILNQMQYFQRSHAMWKSHNITEILKNASI  154

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
            +PS     T    +A +  A   TP++ C+    +NT  + E+  CY+ +A+ LI C +
Sbjct  155  VPSATQTWTYSDIVAPIKTATKRTPVLRCKSDPATNTELLHEVVFCYEYNALKLIDCNR  213



>dbj|BAF56249.1| S-RNase [Prunus speciosa]
Length=169

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 81/166 (49%), Gaps = 10/166 (6%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQD  509
            F     WPP  C      C   +  ++FTIHGLWP      + P+   G       +   
Sbjct  2    FQFVQQWPPTNCRVRKRPCSKPRPLQNFTIHGLWPSNYSNPTMPSKCTGSQFKKENVYPQ  61

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L I W ++E   +  FWE EWNKHG+ S   L +V YF+R+  ++ + NVT IL N
Sbjct  62   LRSKLKISWPDVESGNDTRFWESEWNKHGRCSEQTLSQVKYFQRSHAMWRSHNVTEILRN  121

Query  690  YGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
              I+P      T    ++ +  A   TP++ C++   +NT  + E+
Sbjct  122  ASIVPHPTQTWTYSDIVSPIKAATKRTPLLRCKRDPTTNTELLHEV  167



>gb|ADZ74121.1| self-incompatibility associated ribonuclease S1 [Prunus pseudocerasus]
Length=226

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 95/194 (49%), Gaps = 18/194 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LI  500
            F     WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G       +
Sbjct  33   FQFVQQWPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDTRKV  90

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            +  +R +L   W ++E   +  FW+ EWNKHG  S   L ++ YFER+  ++L+ N+T I
Sbjct  91   SPKMRIKLKKSWPDVESGNDTRFWKDEWNKHGTCSEERLNQMQYFERSHDMWLSYNITEI  150

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            L N  I+P      T    ++ +  A G TP + C++ + +  ++  E+  CY+ +A+  
Sbjct  151  LKNASIVPHPTQTWTYSDIVSPIKTATGRTPTLRCKQDKKTQLLH--EVVFCYEYNALKQ  208

Query  849  ISCTQAQLSCGTQP  890
            I C +    C  QP
Sbjct  209  IDCNRT-AGCQNQP  221



>emb|CAC27785.1| RNase S2 [Prunus avium]
Length=226

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 95/188 (51%), Gaps = 18/188 (10%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G       ++  LR 
Sbjct  39   WPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDGRKVSPQLRA  96

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L   W ++E   +  FWE EWNKHG+ S   L ++ YFER+  ++ + N+T IL N  I
Sbjct  97   KLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFERSQNMWRSYNITEILRNASI  156

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQA  866
            +P      T    ++ + +A   TP++ C++ + +  ++  E+  CY+ +A+  I C + 
Sbjct  157  VPHPTQTWTYSDIVSPIKKATKRTPLLRCKQDKKTQLLH--EVVFCYEYNALKQIDCNRT  214

Query  867  QLSCGTQP  890
               C  QP
Sbjct  215  -AGCQNQP  221



>gb|ADZ48268.1| S-locus-associated ribonuclease [Prunus pseudocerasus]
Length=223

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 87/177 (49%), Gaps = 12/177 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------LRDRLD  527
            WPP  C      C   +  ++FTIHGLWP      + P+  +G    D      LR +L 
Sbjct  37   WPPTNCRVRKIPCSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKFDDRKVYPQLRSKLK  96

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L +++YFE +  ++ + N+T IL N  I+P 
Sbjct  97   RSWPDVESGNDTKFWEGEWNKHGTCSEQTLNQMEYFEVSHDMWRSHNITEILKNASIVPH  156

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQA  866
                      ++ +  A   TP++ C+  +N+  ++  E+  CY+ +A+  I C + 
Sbjct  157  PTKTWSYSDIVSPIKAATKRTPLLRCKYDKNTQLLH--EVVFCYEYNALKQIDCNRT  211



>gb|AHJ59550.1| S locus S-RNase 52 [Prunus armeniaca]
Length=226

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 90/175 (51%), Gaps = 9/175 (5%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL----INQDLRDRLDIY  533
            WPP  C  +      ++  ++FTIHGLWP        P+   G     ++  L+ +L I 
Sbjct  39   WPPITCRFSRKPSHKHRPLQNFTIHGLWPSNYSNPWKPSNCTGTQFKQLSPQLQSKLKIS  98

Query  534  WSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSDN  713
            W ++E   +  FWE EWNKHG  S   L ++ YF+R+  ++ + N+T IL N  I+P   
Sbjct  99   WPDVEGGNDTRFWEMEWNKHGTCSEESLNQMQYFQRSFAMWRSHNITEILKNASIVPHPT  158

Query  714  S----PTTLASVSQAFGSTPIVVCRKGR-NSNTMYITEIRLCYDASAINLISCTQ  863
                    ++ + +A   TP++ C++ + + N  ++ E+  CY+ +A+  I C +
Sbjct  159  KTWKYSDIVSPIQKAIKRTPLLRCKRDKAHPNVQWLHEVVFCYEFNALKQIDCNR  213



>gb|ABY65899.1| S-RNase [Prunus pseudocerasus]
Length=224

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 95/194 (49%), Gaps = 18/194 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LI  500
            F     WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G       +
Sbjct  31   FQFVQQWPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDTRKV  88

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            +  +R +L   W ++E   +  FW+ EWNKHG  S   L ++ YFER+  ++L+ N+T I
Sbjct  89   SPKMRIKLKKSWPDVESGNDTRFWKDEWNKHGTCSEERLNQMQYFERSHDMWLSYNITEI  148

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            L N  I+P      T    ++ +  A G TP + C++ + +  ++  E+  CY+ +A+  
Sbjct  149  LKNASIVPHPTQTWTYSDIVSPIKTATGRTPTLRCKQDKKTQLLH--EVVFCYEYNALKQ  206

Query  849  ISCTQAQLSCGTQP  890
            I C +    C  QP
Sbjct  207  IDCNRT-AGCQNQP  219



>gb|AAP33485.1| incompatibility S-RNase [Prunus armeniaca]
Length=168

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 78/148 (53%), Gaps = 10/148 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  CI +   C  ++  ++FTIHGLWP      + P+   G       ++  L  +L 
Sbjct  4    WPPATCIRSKKPCSKHRALQNFTIHGLWPSNYSNPTRPSNCVGSHFNGSKLSPQLISKLR  63

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHGK S   L ++ YFER+  ++++ N+T IL N  I+P 
Sbjct  64   ISWPDVESGNDTQFWEGEWNKHGKCSQEKLNQMQYFERSHDMWMSYNITDILKNASIVPH  123

Query  708  DNSPTTLASVSQAFGS----TPIVVCRK  779
                 T + +  A  S    TP+V C++
Sbjct  124  PTQTWTYSDIVSAIKSKTQRTPLVRCKR  151



>dbj|BAA36389.1| S3-RNase [Prunus avium]
 emb|CAC27786.1| RNase S3 [Prunus avium]
 gb|AAT72119.1| S3-RNase [Prunus avium]
Length=229

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 88/179 (49%), Gaps = 14/179 (8%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C        P  + ++FTIHGLWP      + P+  +G      L++  ++ +L 
Sbjct  39   WPPTTCRVQKKCSKPRPL-QNFTIHGLWPSNYSNPTMPSNCNGSRFKKELLSPRMQSKLK  97

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W N+    +  FWE EWNKHG  S   L +V YFE + +++ + N+T IL N  I+P 
Sbjct  98   ISWPNVVSSNDTKFWESEWNKHGTCSEQTLNQVQYFEISHEMWNSFNITDILKNASIVPH  157

Query  708  DNSPTTLASVSQAFGS----TPIVVCRKG---RNSNTMYITEIRLCYDASAINLISCTQ  863
                   + +  A  S    TP++ C+      N+NT  + E+  CY  +AI  I C +
Sbjct  158  PTQTWKYSDIVSAIQSKTQRTPLLRCKTDPAHPNANTQLLHEVVFCYGYNAIKQIDCNR  216



>gb|EAZ04800.1| hypothetical protein OsI_26973 [Oryza sativa Indica Group]
Length=260

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 89/184 (48%), Gaps = 18/184 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYV---------DGLI  500
             YL+  WP  YC  +     P      FTIHGLWP   +   G  ++         D   
Sbjct  30   MYLAQQWPDSYCSTHKCLVKPPP-PSHFTIHGLWPSYNKLIDGKMWLEDCNKEDPLDPTQ  88

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
             QDL  +LD  W +L++  N  FW HEW KHG  SN  LG+  YFE A+ L   TN+T I
Sbjct  89   IQDLEKQLDQKWPSLKQ-TNLEFWSHEWKKHGTCSN--LGQHAYFEAALALERLTNLTKI  145

Query  681  LANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            LA+ G+ PSD    T   +S A     G      C K +  +T+ ++E+R C D     L
Sbjct  146  LADGGVGPSDVKTYTFREISDALARGTGFRTYFKCSKNKAGDTL-LSEVRQCVDRYGEKL  204

Query  849  ISCT  860
            I+CT
Sbjct  205  INCT  208



>gb|EFA82171.1| ribonuclease T2 [Polysphondylium pallidum PN500]
Length=224

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 106/194 (55%), Gaps = 23/194 (12%)
 Frame = +3

Query  342  GSFYLSLF---WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS-----SGPAYVDGL  497
            G F   LF   W   YC      C+ +K +E FTIHGLWP+ +  S      GP++    
Sbjct  32   GQFDFYLFVQQWIYSYC--GQQTCIASKEREAFTIHGLWPENSDGSYPSFCKGPSFSSSA  89

Query  498  INQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEV----DYFERAIQLYLAT  665
            I QDL ++L+  W +L   PN  FW HEW+KHG  S  L G +    DYF   +++Y A 
Sbjct  90   I-QDLMNQLNYDWPSL-TGPNTDFWTHEWSKHGTCS--LTGPITNIHDYFAAGLKVYNAY  145

Query  666  NVTTILANYGILPSDNSPTTLASVSQA----FGSTPIVVCRKGRNSNT-MYITEIRLCYD  830
            N+++ LA++GI+PS+    ++ S++ A     G+TP++ C+ G+ S   + IT+     D
Sbjct  146  NISSSLADHGIVPSNTQSYSITSITNALINSLGNTPLLQCQNGQLSTVALCITKDLELMD  205

Query  831  ASAINLISCTQAQL  872
              A++  SC+ + +
Sbjct  206  CPALDGWSCSGSTI  219



>gb|ABJ97523.1| S-RNase [Prunus webbii]
Length=231

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 90/182 (49%), Gaps = 17/182 (9%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  CI +   C   +    FTIHGLWP        P+  +G       ++  LR +L 
Sbjct  38   WPPATCIRSTKPCSKQRSLPIFTIHGLWPSNYSNPKTPSNCNGSQFDAIKLSPRLRSKLK  97

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHGK S   L ++ YFER+ ++++  N+T IL N  I+P 
Sbjct  98   RSWPDVESGNDEGFWEGEWNKHGKCSEQTLNQMQYFERSHEMWIFHNITKILKNASIVPH  157

Query  708  DNSP---TTLASVSQAFG-STPIVVCR------KGRNSNTMYITEIRLCYDASAINLISC  857
                   T + S  +A   +TP++ C+      KG+    + + E+ LC +  A+  I C
Sbjct  158  PTKTWKYTDIVSAIKALTRTTPLLRCKRNPAQVKGQPQFQL-LHEVVLCLEYKALKQIDC  216

Query  858  TQ  863
             +
Sbjct  217  NR  218



>gb|ABA26543.1| S-RNase [Prunus dulcis]
Length=222

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 88/176 (50%), Gaps = 13/176 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C        P  + + FTIHGLWP      + P+  +G       ++  LR++L 
Sbjct  37   WPPTNCRVRTKCSNPRPL-QVFTIHGLWPSNYSNPTMPSNCNGSQFDARKVSPQLRNKLK  95

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L +  YFER+  ++ + N+T IL N  I+PS
Sbjct  96   RSWPDVESGNDTKFWEGEWNKHGTCSEQTLNQFQYFERSQDMWRSYNITEILKNASIVPS  155

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
                 T    +A +  A   TP++ C+  + +  ++  E+  CY+ +A+  I C +
Sbjct  156  ATQSWTYSDIVAPIKTATKRTPLLRCKYDKKTQLLH--EVVFCYEYNALKQIDCNR  209



>dbj|BAF56244.1| S-RNase [Prunus speciosa]
Length=168

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 82/165 (50%), Gaps = 9/165 (5%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDL  512
            F     WPP  C      C   +  + FTIHGLWP      + P+  +G     +++ DL
Sbjct  2    FQFVQQWPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNHSNPTMPSNCNGTQFKRILSPDL  61

Query  513  RDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANY  692
            R  L   W ++E   +  FWE EWNKHGK S   L ++ YF+R+ +++ A N+T IL N 
Sbjct  62   RSDLTRSWPDVESGDDTKFWEGEWNKHGKCSEQTLNQMQYFQRSHEMWYAFNITKILKNA  121

Query  693  GILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
             I+P      T    +A +  A   TP++ C+  + +  + + E+
Sbjct  122  SIVPHATQTWTYSDIVAPIKTATKRTPLLRCKYDKKTQLLLLHEV  166



>dbj|BAF56250.1| S-RNase [Prunus speciosa]
Length=165

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 84/158 (53%), Gaps = 10/158 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQ----DLRDRLDIY  533
            WPP  CI +     P  + + FTIHGLWP      + P+   G + +    +L+ +L I 
Sbjct  8    WPPTNCIVHTKCSKPRPL-QIFTIHGLWPSNYSNPTKPSNCAGSVFERLPPELQTKLKIS  66

Query  534  WSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSDN  713
            W ++E   +  FWE EWNKHG  S  +L ++ YFER+  ++++ N+T IL N  I+PS  
Sbjct  67   WPDVESGNDTLFWEKEWNKHGTCSEGMLNQMQYFERSYAMWMSYNITEILKNASIVPSAT  126

Query  714  S----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
                    ++ +  A   TP++ C++ +  NT  + E+
Sbjct  127  QTWKYSDIVSPIKTATKRTPVLRCKRDKK-NTQLLHEV  163



>gb|ABY82412.1| self-incompatibility associated ribonuclease [Prunus pseudocerasus]
Length=226

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 95/194 (49%), Gaps = 18/194 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LI  500
            F     WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G       +
Sbjct  33   FQFVQQWPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFDTRKV  90

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            +  +R +L   W ++E   +  FW+ EWNKHG  S   L ++ YFER+  ++L+ N+T I
Sbjct  91   SPKMRIKLKKSWPDVESGNDTRFWKDEWNKHGTCSVERLNQMQYFERSHDMWLSYNITEI  150

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            L N  I+P      T    ++ +  A G TP + C++ + +  ++  E+  CY+ +A+  
Sbjct  151  LKNASIVPHPTQTWTYSDIVSPIKTATGRTPTLRCKQDKKTQLLH--EVVFCYEYNALKQ  208

Query  849  ISCTQAQLSCGTQP  890
            I C +    C  QP
Sbjct  209  IDCNRT-AGCQNQP  221



>gb|ABW08113.1| S7-RNase [Prunus avium]
Length=224

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 92/179 (51%), Gaps = 17/179 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+   G       +   +R 
Sbjct  37   WPPTNCRVRIKQP--CSNPRPLQYFTIHGLWPSNYSNPTMPSNCIGSQFEWRKLYPHMRS  94

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L I W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T IL N  I
Sbjct  95   KLKISWPDVESGNDTKFWEGEWNKHGTCSVEKLNQMQYFERSYAMWRSYNITKILQNASI  154

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
            +PS     T    ++ +  A G TP++ C++ + +  ++  E+ LC+D +A+  I C +
Sbjct  155  VPSTTRTWTYSDIVSPIKAATGRTPLLRCKQDKKTQLLH--EVVLCFDYNALIHIDCNR  211



>gb|ABQ51155.1| S16-RNase [Prunus armeniaca]
Length=186

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 80/156 (51%), Gaps = 10/156 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  C      C   +  ++FTI GLWP        P+      + DG ++ +LR +L 
Sbjct  27   WPPTNCRVRSKPCSKPRPLQNFTIPGLWPSNYSNPRAPSNCNGSRFNDGKLSPELRAKLK  86

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG  S  +L ++ YFER+  ++++ N+T IL N  I+P 
Sbjct  87   ISWPDVESGNDTKFWEGEWNKHGTCSEGMLNQMQYFERSYAMWMSYNITEILKNASIVPH  146

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMY  803
                      +A +  A G TP++ C+   N+  ++
Sbjct  147  PTKTWKYSDIVAPIQTATGRTPLLRCKWNYNNQLLH  182



>gb|ABF61821.1| S7-RNase [Prunus salicina]
Length=217

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 89/179 (50%), Gaps = 15/179 (8%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+   G       +   LR 
Sbjct  28   WPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTKPSNCAGSQFNFTKVFPYLRS  85

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L I W ++E   +  FWE EWNKHG  S  +L ++ YF+R+  ++ + N+T IL N  I
Sbjct  86   KLKISWPDVESGNDTKFWEGEWNKHGTCSERILNQMQYFQRSQAMWKSHNITEILKNASI  145

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
            +P      T    +A +  A   TP++ C+  + +  +++ E+  CY  +A+  I C +
Sbjct  146  VPHPTQTWTYADIVAPIKTATKRTPLLRCKWDKKNQLLHLHEVVFCYGYNALKHIDCNR  204



>ref|XP_002892796.1| ribonuclease T2 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69055.1| ribonuclease T2 family protein [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 81/182 (45%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQS-----SGPAYVDGLINQ  506
            FYL L WP  YC    A C P   K   DF IHGLWP     S        +  D     
Sbjct  29   FYLVLQWPGAYCDTKRACCYPTSGKPAADFGIHGLWPNYNGGSWPSNCDPDSQFDRSQIS  88

Query  507  DLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N  F  WEHEW KHG  S S++ + DYFE A++L    N+  I
Sbjct  89   DLVSSLKKNWPTLSCPSNEGFKFWEHEWEKHGTCSESVMDQHDYFENALKLKEKANLLQI  148

Query  681  LANYGILPSDN--SPTTLA-SVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D   S T +  ++    G TP + C K    N   + +I +C D S    I
Sbjct  149  LTNSGINPDDGFYSLTKITNAIKNGIGFTPGIECNKDPERNDQ-LHQIYICVDTSGTEFI  207

Query  852  SC  857
             C
Sbjct  208  EC  209



>dbj|BAC20937.1| Sd-RNase [Prunus salicina]
Length=207

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 86/182 (47%), Gaps = 12/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQD  509
            F     WPP  C      C   +  ++FTIHGLWP      + P+   G       +   
Sbjct  13   FQFVQQWPPTNCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTMPSKCTGSRFKKENVYPQ  72

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR ++ I W ++    +  FWE EWNKHG  S   L +V YF+R+  ++ + NVT IL N
Sbjct  73   LRSKMKISWPDVGSGNDTRFWESEWNKHGTCSEGTLNQVQYFQRSHAMWRSHNVTEILRN  132

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISC  857
              I+P           ++ +  A   TP++ C+  + +  ++  E+  CY+ +A+  I C
Sbjct  133  ASIVPHPTQTWSYSDIVSPIKTATKRTPLIRCKYDKKTQLLH--EVVFCYEYNALKQIDC  190

Query  858  TQ  863
             +
Sbjct  191  NR  192



>gb|AAK58579.1|AF267512_1 Si-RNase [Prunus dulcis]
Length=165

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 83/157 (53%), Gaps = 11/157 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPN-KMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQDLRDRL  524
            WPP  C        PN +  + FTIHGLWP          + +GP +    ++  +R +L
Sbjct  6    WPPTNCRVRIKRPCPNPRPLQYFTIHGLWPSNYSNPTKPSKCTGPKFDARKVSPKMRIKL  65

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++L+ N+T IL N  I+P
Sbjct  66   KISWPDVESGNDTRFWEGEWNKHGTCSRERLNQMQYFERSHDMWLSYNITEILKNASIVP  125

Query  705  SDNSP----TTLASVSQAFGSTPIVVCRKGRNSNTMY  803
            +          ++ +  A GSTP++ C++ +N+  ++
Sbjct  126  NATQKWSYSDIISPIKAATGSTPLLRCKQAKNTQLLH  162



>dbj|BAK19919.1| self-incompatibility associated ribonuclease [Prunus mira]
Length=178

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 78/148 (53%), Gaps = 10/148 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  CI +   C  ++  ++FTIHGLWP      + P+      + +  ++  L  +L 
Sbjct  26   WPPATCIRSKKPCSKHRAFQNFTIHGLWPSNYSNPTRPSNCVGSHFNESKLSPQLISKLR  85

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHGK S   L ++ YFER+  ++++ N+T IL N  I+P 
Sbjct  86   ISWPDVESGNDTQFWEGEWNKHGKCSQEKLNQMQYFERSHDMWMSYNITDILKNASIVPH  145

Query  708  DNSPTTLASVSQAFG----STPIVVCRK  779
                 T + +  A       TP+V C++
Sbjct  146  PTQTWTYSDIVSAIKRKTQRTPLVRCKR  173



>ref|XP_006303725.1| hypothetical protein CARUB_v10011861mg [Capsella rubella]
 gb|EOA36623.1| hypothetical protein CARUB_v10011861mg [Capsella rubella]
Length=226

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 81/183 (44%), Gaps = 15/183 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQS-----SGPAYVDGLINQ  506
            FYL + WP  YC    A C P   K   DF IHGLWP     S        +  D    +
Sbjct  29   FYLVVQWPGAYCDTKRACCYPTSGKPDADFGIHGLWPNYKDGSWPSNCDPDSQFDRTQIE  88

Query  507  DLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   +   W  L    N  F  WEHEW KHG  S S++ + +YFE A++L    N+  I
Sbjct  89   DLVSSMKKNWPTLSCPSNEGFEFWEHEWEKHGTCSESVMDQHEYFENALKLKDKANLLQI  148

Query  681  LANYGILPSDN----SPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            L N GI P D     S  T A +    G TP + C K    N   + +I LC D S    
Sbjct  149  LTNSGINPDDGFYGLSEITKA-IKDGIGFTPGIQCNKDPERNAQ-LYQIYLCVDTSGTEF  206

Query  849  ISC  857
            I C
Sbjct  207  IEC  209



>gb|AAW26577.1| SJCHGC05678 protein [Schistosoma japonicum]
Length=234

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 94/187 (50%), Gaps = 17/187 (9%)
 Frame = +3

Query  339  WGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWP-----QTTQQSSGPAYVDGLIN  503
            W  F  +L WPP +C        P     DFTIHGLWP     +     S  +  D    
Sbjct  28   WNYFVFTLTWPPTFCSYKKCKLPPGL--NDFTIHGLWPSIWPGKQPTNCSAHSRFDIHRL  85

Query  504  QDLRDRLDIYWSNLERDPN-RAFWEHEWNKHGK--ISNSLL-GEVDYFERAIQLYLATNV  671
            Q +R++LD  W+NL    N   FWEHEW KHG+  I N L+  E++YF  A++L    N+
Sbjct  86   QSIRNKLDYTWANLLNYENPTPFWEHEWYKHGQCGIENVLIRNELNYFNTAVELKEKLNL  145

Query  672  TTILANYGILPSDN----SPTTLASVSQAFGSTPIVVCRKGRNSNTM-YITEIRLCYDAS  836
             T L +YGI P+++        L  + QA+  + +V C+  R  + +  + EIR C++  
Sbjct  146  LTQLKSYGIQPNNSVVIEKSHFLNVLKQAYNVSAVVKCKSKRRKDKLTKLAEIRFCFNVK  205

Query  837  AINLISC  857
             + LI C
Sbjct  206  -LQLIDC  211



>ref|XP_640939.1| ribonuclease T2 [Dictyostelium discoideum AX4]
 sp|Q7M438.3|RNDI_DICDI RecName: Full=Ribonuclease DdI; Short=RNase DdI; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL66943.1| ribonuclease T2 [Dictyostelium discoideum AX4]
Length=223

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 97/190 (51%), Gaps = 24/190 (13%)
 Frame = +3

Query  342  GSFYLSLF---WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS-----SGPAYVDGL  497
            G F   LF   W   YC  +   C+ NK +E FTIHGLWP+ +  S     SGP++    
Sbjct  30   GDFDFYLFVQQWIYSYC--DSQTCIQNKEREAFTIHGLWPENSDGSYPSFCSGPSFNVNA  87

Query  498  INQDLRDRLDIYWSNLERDPNRAFWEHEWNKHG--KISNSLLGEVDYFERAIQLYLATNV  671
            I QDL D+L+  W +L   PN  FW HE++KHG   I+  +    DYF   I+LY   N+
Sbjct  88   I-QDLEDQLNFDWPSL-TGPNTDFWTHEFSKHGTCSITGPITDIHDYFATGIKLYTEFNI  145

Query  672  TTILANYGILPSDNSPTTLASVSQA----FGSTPIVVCRKGRNSNTMYITEIRLCYDASA  839
            T  L +  I PSD++      ++ A    FG  P + C  G+      ++ + +C D ++
Sbjct  146  TAALESENIYPSDSNTYKPVDITNAITTHFGGKPGIQCSSGQ------LSTVAVCIDKNS  199

Query  840  INLISCTQAQ  869
            ++++ C   Q
Sbjct  200  LSIMDCPDLQ  209



>gb|ABL86031.1| S-RNase [Prunus tenella]
Length=175

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQD  509
            F     WPP  C  +      ++  + FTIHGLWP        P+  +GL      ++  
Sbjct  13   FQFVQQWPPTTCRLSSKPSNQHRPLQRFTIHGLWPSNYSNPRKPSNCNGLQFDARKVSPR  72

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L + W N+E D +  FWEHEWNKHG  S   L +  +FER+  ++++ N+T IL N
Sbjct  73   LRSKLKMSWPNVESDNDTKFWEHEWNKHGTCSQETLNQTQFFERSHDMWMSYNITNILKN  132

Query  690  YGILPSDNSPTTLASVSQ----AFGSTPIVVCRK  779
              I+PS       + +      A   TP + C++
Sbjct  133  ASIVPSATQKWKYSDIESPIKTATQRTPFLRCKR  166



>dbj|BAN14352.1| S-like ribonuclease [Cephalotus follicularis]
Length=227

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 89/184 (48%), Gaps = 15/184 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQSSGPAYVD--GLINQ---  506
            FY    WP  YC  +   C P   K   DF IHGLWP      S P+  D     NQ   
Sbjct  29   FYFVQQWPGSYCDTSQGCCYPPTGKPASDFGIHGLWPNNND-GSYPSNCDPNNPFNQSEV  87

Query  507  -DLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
             DL   L+  W +L        +FW HEW+KHG  S S+L E DYF+ A+ L   TN+  
Sbjct  88   SDLMSSLETNWPSLACPSSDGISFWTHEWDKHGTCSESVLDEHDYFQAALNLKSKTNLLQ  147

Query  678  ILANYGILP---SDNSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
             LA+ GI P   S N    + +++Q+ G TP + C    + N   + ++ +C D S  NL
Sbjct  148  ALASAGINPNGESYNLSDIINAINQSDGFTPSIECNDDESGNNQ-LYQVYMCVDTSGSNL  206

Query  849  ISCT  860
            I C+
Sbjct  207  IECS  210



>gb|AAZ91366.1| S7 S-RNase, partial [Prunus webbii]
Length=163

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (50%), Gaps = 9/159 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDRLDI  530
            WPP  C      C   +  + FTIHGLWP      + P+  +G     +++  LR +L I
Sbjct  4    WPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNYSNPTKPSNCNGPQFKPILSPRLRSKLKI  63

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E   +  FWE EWNKHG  S   L +  YF+R+  ++ + N+T IL N  I+PS 
Sbjct  64   SWPDVESGNDTKFWEAEWNKHGTCSEQTLNQFQYFDRSYAMWRSYNITEILKNATIVPSP  123

Query  711  NS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
                     ++ +  A   TP++ CRK    N+  + E+
Sbjct  124  TQTWKYSDIVSPIKTATKRTPLLRCRKDPAQNSQLLHEV  162



>dbj|BAA10892.1| ribonuclease (RNase LC2) [Luffa aegyptiaca]
Length=214

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 89/198 (45%), Gaps = 18/198 (9%)
 Frame = +3

Query  333  RTWGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYV-------D  491
            +T+  F+    WPP  C      C        F IHGLWPQ      GP  V       D
Sbjct  25   QTFDHFFFVQQWPPTTCQQQQKPCF-QPPPATFKIHGLWPQ-----KGPNSVVYCNKNFD  78

Query  492  GLINQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNV  671
                  L ++LD+ W ++    N  FWEHEWNKHG  S S   +  YF+ AI +    N+
Sbjct  79   RTQISSLENQLDVVWPDVVTGNNTGFWEHEWNKHGSCSESQFNQTLYFQTAINMMNKVNL  138

Query  672  TTILANYGILPSD--NSPTTLASVSQA-FGSTPIVVCRKGRNSNTMYITEIRLCYDASAI  842
               L   GI   +   S  T+  V  A FG+ P + C+K       ++ EI +C+    +
Sbjct  139  LKALGKGGITSDERTKSSQTMQKVLLAQFGNQPFLRCKKV--GQQFWLLEIVMCFKDDGV  196

Query  843  NLISCTQAQLSCGTQPIY  896
             +I+C  +++SC    I+
Sbjct  197  TMINCQPSKVSCPPNFIF  214



>gb|ABG76215.1| S-RNase [Prunus spinosa]
Length=208

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 89/181 (49%), Gaps = 14/181 (8%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA-----YVDGLINQDLRDRLDI  530
            WPP  C  +      ++  + FTIHGLWP        P+        G+++  LR +L  
Sbjct  16   WPPTTCRLSSKPSNQHRPLQIFTIHGLWPSNYSNPRLPSNCIGSQFKGILSPQLRSKLKT  75

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++++ N+T +L N  I+PS 
Sbjct  76   SWPDVEGGNDTKFWEGEWNKHGTCSEHTLNQMQYFERSYAMWMSYNITGVLKNASIVPSA  135

Query  711  NSPTT----LASVSQAFGSTPIVVCRK--GRNS---NTMYITEIRLCYDASAINLISCTQ  863
                T    ++++  A   TP++ C++   RN    N   + E+  CY+  A   I C +
Sbjct  136  TQTWTYSDIVSAIKTATQRTPLLRCKRDPARNKSLPNYQLLHEVVFCYEYKAKKQIDCNR  195

Query  864  A  866
             
Sbjct  196  T  196



>dbj|BAN14351.1| S-like ribonuclease [Cephalotus follicularis]
Length=227

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 89/184 (48%), Gaps = 15/184 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQSSGPAYVD--GLINQ---  506
            FY    WP  YC  +   C P   K   DF IHGLWP      S P+  D     NQ   
Sbjct  29   FYFVQQWPGSYCDTSQGCCYPPTGKPASDFGIHGLWPNNND-GSYPSNCDPNNPFNQSEV  87

Query  507  -DLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
             DL   L+  W +L        +FW HEW+KHG  S S+L E DYF+ A+ L   TN+  
Sbjct  88   SDLMSSLETNWPSLACPSSDGISFWTHEWDKHGTCSESVLDEHDYFQAALNLKNKTNLLQ  147

Query  678  ILANYGILP---SDNSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
             LA+ GI P   S N    + +++Q+ G TP + C    + N   + ++ +C D S  NL
Sbjct  148  ALASAGINPNGESYNLSDIINAINQSDGFTPSIECNDDESGNNQ-LYQVYMCVDTSGSNL  206

Query  849  ISCT  860
            I C+
Sbjct  207  IECS  210



>dbj|GAM22940.1| hypothetical protein SAMD00019534_061150, partial [Acytostelium 
subglobosum LB1]
Length=214

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 88/171 (51%), Gaps = 20/171 (12%)
 Frame = +3

Query  378  YCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL---INQ--DLRDRLDIYWSN  542
            Y   +   CLP K +E FTIHGLWP      S P++  G    +++  D+  +LD  W +
Sbjct  36   YSFCDTQSCLPGKEREAFTIHGLWPN-NNDGSYPSFCKGQPFDVDEIADIEPQLDTIWPS  94

Query  543  LERDPNRAFWEHEWNKHG--KISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSDN-  713
            L   PN  FW HEW+KHG   I+  L    DYF   + +Y   N+T  LA + ILPSDN 
Sbjct  95   L-TGPNPDFWAHEWSKHGTCSITGPLADLHDYFFATVHIYQTYNITGGLAQFNILPSDNA  153

Query  714  ---SPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISC  857
               +P+ + ++S+ FG TP++ C   R      +  +  C     + L+SC
Sbjct  154  TYSAPSVVDALSKQFGVTPLIQCTGNR------LVTVAFCL-TKDLKLMSC  197



>gb|ADD20973.1| S35-RNase [Prunus armeniaca]
Length=167

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 79/153 (52%), Gaps = 10/153 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  CI +   C  ++  + FTIHGLWP      + P+      + +  +   LR +L 
Sbjct  6    WPPATCIRSTKPCSKHRPLQIFTIHGLWPSNYSNPTMPSNCVGSPFNESRLPPQLRSKLK  65

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHGK S   + ++ YFER+ +++ + N+T IL N  I+P 
Sbjct  66   ISWPDVESGNDTKFWEGEWNKHGKCSEQTINQIQYFERSYEMWHSHNITKILKNASIVPH  125

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSN  794
                      ++++ +   +TP++ C+     N
Sbjct  126  PTQTWKYSDMVSAIKKVTQTTPLLRCKPDPTKN  158



>emb|CAM84220.1| ribonuclease [Prunus webbii]
Length=186

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (50%), Gaps = 9/159 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDRLDI  530
            WPP  C      C   +  + FTIHGLWP      + P+  +G     +++  LR +L I
Sbjct  27   WPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNYSNPTKPSNCNGPQFKPILSPRLRSKLKI  86

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E   +  FWE EWNKHG  S   L +  YF+R+  ++ + N+T IL N  I+PS 
Sbjct  87   SWPDVESGNDTKFWEAEWNKHGTCSEQTLNQFQYFDRSYAMWRSYNITEILKNATIVPSP  146

Query  711  NS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
                     ++ +  A   TP++ CRK    N+  + E+
Sbjct  147  TQTWKYSDIVSPIKTATKRTPLLRCRKDPAQNSQLLHEV  185



>gb|ABW71898.1| ribonuclease S6 [Prunus avium]
Length=188

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 84/166 (51%), Gaps = 16/166 (10%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDR  521
            WPP  C   I  P  C   +  + FTIHGLWP        P+   G     +++  LR +
Sbjct  27   WPPTNCRVRIKRP--CSSPRPLQYFTIHGLWPSNYSNPRMPSNCTGPQFKRILSPQLRSK  84

Query  522  LDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGIL  701
            L   W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++++ N+T IL N  I+
Sbjct  85   LQTSWPDVESGNDTKFWESEWNKHGTCSKETLNQMQYFERSYAMWMSYNITEILKNASIV  144

Query  702  PSDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCY  827
            P           +A +  A   TP++ C++ +  NT+ + E+ LCY
Sbjct  145  PHPTQTWKYSDIVAPIKAATKRTPLLRCKQDK--NTVLLHEVVLCY  188



>ref|XP_010495851.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=226

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 84/183 (46%), Gaps = 15/183 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQSSGPAYVDGLIN------  503
            FYL + WP  YC    + C P   K + DF IHGLWP   +  S P+  D          
Sbjct  29   FYLVVQWPGAYCDTKRSCCYPTSGKPEADFGIHGLWP-NYKDGSWPSNCDPDSQFGRSQI  87

Query  504  QDLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
            +DL  R+   W  L    N  F  WEHEW KHG  S S++ + +YFE A++L    N+  
Sbjct  88   EDLLSRMKKNWPTLSCPSNEGFNFWEHEWEKHGTCSESVMDQHEYFENALKLKDKANLLQ  147

Query  678  ILANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            IL N GI P D   +      ++    G TP + C K    N   + +I +C D S    
Sbjct  148  ILTNSGINPDDEFYDLNKITNAIKDGIGFTPGLECNKDPERNAQ-LYQIYICVDTSGTEF  206

Query  849  ISC  857
            I C
Sbjct  207  IEC  209



>ref|XP_009103113.1| PREDICTED: ribonuclease 3 [Brassica rapa]
 emb|CDY40267.1| BnaA07g09330D [Brassica napus]
Length=222

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 82/182 (45%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTT-----QQSSGPAYVDGLINQ  506
            FY  + WP  YC +  + C P   K   DF IHGLWP        Q  +  +  D L   
Sbjct  25   FYFVVQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSTFDELRVS  84

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N    FW HEW KHG  + S L + DYFE  ++L    N+   
Sbjct  85   DLMSNLQREWPTLSCPSNDGVHFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLHA  144

Query  681  LANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D          ++ +A G  P + C K  + N+  + +I LC D SA N I
Sbjct  145  LTNAGIKPDDKFYEIKDIERAIKEAIGFAPGIECNKDSSHNSQ-LYQIYLCVDTSASNFI  203

Query  852  SC  857
            +C
Sbjct  204  NC  205



>dbj|BAF03593.1| S-like RNase [Fagopyrum homotropicum]
Length=225

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 91/196 (46%), Gaps = 20/196 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQ-------TTQQSSGPAYVDGLI  500
            FY  L WP  YC A  A C P   K   DF IHGLWP        +   SS P     + 
Sbjct  28   FYFVLQWPGAYCDARKACCFPTTGKPDADFGIHGLWPNYNDGTYPSNCDSSNPFERSKI-  86

Query  501  NQDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
              DL  R+   W  L        AFW HEW KHG  S S+L +  YF+ ++ L    N  
Sbjct  87   -SDLVTRMQSEWPTLACPSGDGTAFWTHEWEKHGTCSESVLDQHAYFKSSLDLKDQINAL  145

Query  675  TILANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDASAI  842
              L   GI P+D S  TL ++  A     G TP V C + ++ N+  + ++  C D+S++
Sbjct  146  EALTKAGIEPNDES-YTLENIKDALKEGTGFTPFVECNRDQSGNSQ-LYQLYFCVDSSSV  203

Query  843  NLISC-TQAQLSCGTQ  887
            +LI C    +  CG Q
Sbjct  204  SLIDCPIYPRGKCGPQ  219



>ref|XP_009117923.1| PREDICTED: ribonuclease 3-like [Brassica rapa]
Length=227

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 83/189 (44%), Gaps = 13/189 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQS----SGPA-YVDGLINQ  506
            FYL+L WP  YC    A C P   K   DF IHGLWP     S      P+   D     
Sbjct  30   FYLALQWPGAYCDTKRACCYPTTGKPAADFGIHGLWPNYNNGSYPSNCDPSNEFDPSEIS  89

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N    FWEHEW KHG  S S++ +  YFE+ + L    N+  I
Sbjct  90   DLVSTLQTKWPTLSCPSNEGYKFWEHEWEKHGTCSESVMDQHGYFEKTLALRDRINLLQI  149

Query  681  LANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L + GI P+D          ++ +A G TP++ C +    N   + EI LC D S    +
Sbjct  150  LTDAGIKPNDEFYKLKDIKKAIEKATGFTPVINCNRDPEKNRQ-LHEILLCVDKSGTEFM  208

Query  852  SCTQAQLSC  878
             C      C
Sbjct  209  DCPMPTDRC  217



>ref|NP_563941.1| ribonuclease T2 [Arabidopsis thaliana]
 gb|AAD39308.1|AC007576_31 Very similar to ribonucleases [Arabidopsis thaliana]
 gb|AEE29124.1| ribonuclease T2 [Arabidopsis thaliana]
Length=228

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 79/182 (43%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQS-----SGPAYVDGLINQ  506
            FY  L WP  YC  + A C P   K   DF IHGLWP     S        +  D     
Sbjct  31   FYFVLQWPGAYCDTSRACCYPTSGKPAADFGIHGLWPNYNGGSWPSNCDPDSQFDRSQIS  90

Query  507  DLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N  F  WEHEW KHG  S S++ + +YFE A++L    N+  I
Sbjct  91   DLVSSLKKNWPTLSCPSNEGFNFWEHEWEKHGTCSESVMDQHEYFENALKLKQKANLLQI  150

Query  681  LANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D   N      ++    G TP + C K    N   + +I +C D S    I
Sbjct  151  LKNSGINPDDGFYNLDKITNAIKDGIGFTPGIECNKDPERNAQ-LHQIYICVDTSGTEFI  209

Query  852  SC  857
             C
Sbjct  210  EC  211



>emb|CAZ68890.1| S-ribonuclease, partial [Prunus dulcis]
 emb|CAZ68891.1| S-ribonuclease, partial [Prunus dulcis]
Length=187

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 85/161 (53%), Gaps = 13/161 (8%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPN-KMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQDLRDRL  524
            WPP  C        PN +  + FTIHGLWP          + +GP +    ++  +R +L
Sbjct  27   WPPTNCRVRIKRPCPNPRPLQYFTIHGLWPSNYSNPTKPSKCTGPKFDARKVSPKMRIKL  86

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++L+ N+T IL N  I+P
Sbjct  87   KISWPDVESGNDTRFWEGEWNKHGTCSRERLNQMQYFERSHDMWLSYNITEILKNASIVP  146

Query  705  SDNSP----TTLASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            +          ++ +  A GSTP++ C++ +  NT+ + E+
Sbjct  147  NATQKWSYSDIISPIKAATGSTPLLRCKQAK--NTLLLHEV  185



>ref|XP_010258337.1| PREDICTED: ribonuclease 1-like [Nelumbo nucifera]
Length=248

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 87/189 (46%), Gaps = 16/189 (8%)
 Frame = +3

Query  333  RTWGSFYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTTQQSSGPAYVDGLIN-  503
            R +  FY    WP  YC      C P   K   DF+IHGLWP      S P+  D   N 
Sbjct  24   RDFDFFYFVQQWPGSYCDTRRGCCYPKTGKPAADFSIHGLWPNYND-GSYPSNCDSQQNP  82

Query  504  ------QDLRDRLDIYWSNLERDPNR--AFWEHEWNKHGKISNSLLGEVDYFERAIQLYL  659
                   DL DR+   W +L    N    FW HEWNKHG  S S+L +  YFE A+ L  
Sbjct  83   FDPSEITDLTDRMQRSWPSLACPNNDMLKFWSHEWNKHGTCSESVLDQHGYFETALNLKK  142

Query  660  ATNVTTILANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYD  830
              ++  ILA  GI P  N         ++S+A G TP + C    + N+  + ++ LC D
Sbjct  143  KVDLLQILAEAGINPDGNFYNLRDIKVAISEATGYTPGIECNVDGSGNSQ-LYQVYLCVD  201

Query  831  ASAINLISC  857
             S  +LI C
Sbjct  202  KSGPDLIKC  210



>ref|XP_010477807.1| PREDICTED: ribonuclease 3 [Camelina sativa]
Length=222

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 81/182 (45%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTT-----QQSSGPAYVDGLINQ  506
            FY  L WP  YC +  + C P   K   DF IHGLWP        Q  +  +  D L   
Sbjct  25   FYFVLQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSQFDDLRVS  84

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N    FW HEW KHG  + S L + DYFE  ++L    N+   
Sbjct  85   DLMSELQREWPTLSCPSNDGMKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLHA  144

Query  681  LANYGILPSDN---SPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D          ++ +A G  P + C K  + N+  + ++ LC D SA   I
Sbjct  145  LTNAGIKPDDKFYEMKNIQNAIKEATGFAPDIECNKDSSHNSQ-LYQVYLCVDTSASKFI  203

Query  852  SC  857
            +C
Sbjct  204  NC  205



>ref|XP_002512930.1| ribonuclease t2, putative [Ricinus communis]
 gb|EEF49433.1| ribonuclease t2, putative [Ricinus communis]
Length=257

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 96/191 (50%), Gaps = 17/191 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYC--IANPAGCLPNKMKEDFTIHGLWPQTTQQSSG------PAYVDGLIN  503
            FYL + WPP  C  +  PA C    +  +FT+HGLWP+    SS       P  +  L  
Sbjct  37   FYLVMQWPPATCSGLLAPA-CNRPIISYNFTLHGLWPENNSGSSPAACQSVPFDISKLTK  95

Query  504  QDLRDRLDIYWSNLER-DPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
              + + L+ YW NL     N+ FW+HEW KHG  S   L  VDYF+ +I+L    N+  I
Sbjct  96   AGIINDLNKYWPNLLLGQKNQIFWKHEWQKHGTCSQWDL--VDYFKESIKLAETLNLLKI  153

Query  681  LANYGILPSDNSPTTLASVSQAFGS---TPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L + GI P D+    +  + +AF +    P++ C     S++  + EIRLC +   ++  
Sbjct  154  LESSGIKP-DDQLHRIVDIKKAFKAHQLEPLIKCNTKNKSDSYQLHEIRLCVNKVGMHFE  212

Query  852  SCT-QAQLSCG  881
             C  +A + CG
Sbjct  213  KCQRRADMGCG  223



>ref|XP_004505385.1| PREDICTED: ribonuclease S-7-like [Cicer arietinum]
Length=218

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 90/183 (49%), Gaps = 22/183 (12%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWP--QTTQQSSGPAYVDGLINQ-----  506
            F ++  WPP +C +NP   +P   +  FTIHGLWP  QT+ QSS     D  +       
Sbjct  31   FKMAEQWPPTFCRSNPCPTIP---QGKFTIHGLWPSNQTSLQSSKCVTKDPHLQSFNKAM  87

Query  507  --DLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
               L  +L++ W NL+   N  FW +EWNKHG  S+++  +  YFE A  ++   ++  I
Sbjct  88   ISTLEAQLNLSWPNLKGQSNELFWAYEWNKHGVCSSNMFNQTQYFELAQNIWSRYDIFDI  147

Query  681  LANYGILPSDNS--PT--TLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            L   GI P  N   PT     +++   G+ P + C          + EIR+C D S I  
Sbjct  148  LKQQGISPRTNVWYPTNDIRRAITNHIGAIPQIHCVNNE------LLEIRMCLDQSGIKY  201

Query  849  ISC  857
            ++C
Sbjct  202  MTC  204



>emb|CDY20583.1| BnaC07g12500D [Brassica napus]
Length=222

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 82/182 (45%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTT-----QQSSGPAYVDGLINQ  506
            FY  + WP  YC +  + C P   K   DF IHGLWP        Q  +  +  D L   
Sbjct  25   FYFVVQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSTFDELRVS  84

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N    FW HEW KHG  + S L + DYFE  ++L    N+   
Sbjct  85   DLMSNLRREWPTLSCPSNDGVHFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLHA  144

Query  681  LANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D          ++ +A G  P + C K  + N+  + +I LC D SA N I
Sbjct  145  LTNAGIKPDDKFYEIKDIERAIKEAIGFAPGIECNKDSSHNSQ-LYQIYLCVDTSASNFI  203

Query  852  SC  857
            +C
Sbjct  204  NC  205



>dbj|BAF56256.1| S-RNase [Prunus speciosa]
Length=167

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 81/166 (49%), Gaps = 12/166 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQD  509
            F     WPP  C A    C   +  ++FTIHGLWP      + P+   G       +   
Sbjct  2    FQFVQQWPPTNCRARRRPCSKPRPLQNFTIHGLWPSNYSNPTMPSNCKGSQFEARKVYPQ  61

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            L+  L I W ++E   +  FWE EWNKHG+ S   L ++ YFER+  ++ + N+T IL N
Sbjct  62   LQSNLKIAWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFERSYGMWKSYNITEILKN  121

Query  690  YGILPSDNSPTTLAS----VSQAFGSTPIVVCRKGRNSNTMYITEI  815
              I+P      T A     +  A   TP++ CR+ +  NT ++ E+
Sbjct  122  ASIVPHPTQTWTYADIVSPIKTATKRTPLLRCRQDK--NTQWLHEV  165



>ref|XP_006415967.1| hypothetical protein EUTSA_v10008717mg [Eutrema salsugineum]
 gb|ESQ34320.1| hypothetical protein EUTSA_v10008717mg [Eutrema salsugineum]
Length=222

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 81/182 (45%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTT-----QQSSGPAYVDGLINQ  506
            FY  L WP  YC +    C P   K   DF IHGLWP        Q  +  +  D     
Sbjct  25   FYFVLQWPGAYCDSRQHCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSEFDESRVS  84

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N    FW HEW KHG  + S L + DYFE  ++L    N+  +
Sbjct  85   DLMSNLQKEWPTLSCPSNDGVKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLHV  144

Query  681  LANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D          ++ +A G  P + C K  + N+  + +I LC D SA N I
Sbjct  145  LTNAGIKPDDKFYEINDIEKTIKEAIGFAPGIECNKDSSHNSQ-LYQIYLCVDTSASNFI  203

Query  852  SC  857
            +C
Sbjct  204  NC  205



>gb|AAP92436.1| S-RNase [Prunus avium]
Length=236

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 96/203 (47%), Gaps = 26/203 (13%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLI  500
            F     WPP  C   I  P  C   +  ++FTIHGLWP      + P+      + +  +
Sbjct  31   FQFVQQWPPTNCRVRIKRP--CSNPRPLQNFTIHGLWPSNYSNPTMPSNCAGSEFKERKL  88

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            +  LR +L   W ++E   +  FWE EW+KHGK S   L ++ YF+R+ +++ + N+T I
Sbjct  89   SPKLRSKLKRSWPDVESGNDPRFWEGEWSKHGKCSEQTLNQMQYFQRSHEMWQSFNITEI  148

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNT----------MYITEIR  818
            L N  I+P      T    ++ +     +TP++ C+    S T            + E+ 
Sbjct  149  LRNASIVPHPTQTWTYSDIVSPIKAVTQTTPLLRCKFPPKSQTKSQPKSQATSQLLHEVV  208

Query  819  LCYDASAINLISCTQAQLSCGTQ  887
            LCYD  A+ LI C +    CG Q
Sbjct  209  LCYDYDALRLIDCNRT-AGCGNQ  230



>ref|XP_004367303.1| ribonuclease T2 [Dictyostelium fasciculatum]
 gb|EGG20320.1| ribonuclease T2 [Dictyostelium fasciculatum]
Length=232

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 92/200 (46%), Gaps = 24/200 (12%)
 Frame = +3

Query  342  GSFYLSLF---WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS-----SGPAYVDGL  497
            G F   LF   W   YC      CLP+K++  FTIHGLWP     +      G +Y    
Sbjct  35   GEFDFYLFVTQWIYSYCTQG-QKCLPSKIRSAFTIHGLWPNNNNGTYPSFCKGASYSSSA  93

Query  498  INQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKIS--NSLLGEVDYFERAIQLYLATNV  671
            I QD+   LD  W +L    N  FW+HEW KHG  S    +  + DYF  +I+     N+
Sbjct  94   I-QDILVELDQDWPSLFALNNNDFWDHEWTKHGTCSVVGPITDQYDYFAASIKTLYNHNI  152

Query  672  TTILANYGILPSDNSPTTLASVSQA----FGSTPIVVCRKGRNSNTMYITEIRLCYDASA  839
            T  L    I PSD  P  + S S A    F + P+V C K        I+++ LC D   
Sbjct  153  TLALEESNIYPSDTQPVNIQSFSDAIQHSFNAKPLVQCYKEN------ISQVALCMDKD-  205

Query  840  INLISCTQAQ-LSCGTQPIY  896
            +NLI C  A+  +C +   Y
Sbjct  206  LNLIDCPPAKGFTCQSSSAY  225



>dbj|BAF03591.1| S-like RNase [Fagopyrum esculentum]
Length=225

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 91/196 (46%), Gaps = 20/196 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQ-------TTQQSSGPAYVDGLI  500
            FY  L WP  YC A  A C P   K   DF IHGLWP        +   SS P     + 
Sbjct  28   FYFVLQWPGAYCDARKACCFPTTGKPDADFGIHGLWPNYNDGTYPSNCDSSNPFESSKI-  86

Query  501  NQDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
              DL  R+   W  L        AFW HEW KHG  S S+L +  YF+ ++ L    N  
Sbjct  87   -SDLVTRMQSEWPTLACPSGDGTAFWTHEWEKHGTCSESVLDQHAYFKSSLDLKDQINAL  145

Query  675  TILANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDASAI  842
              L   GI P+D +  TL ++  A     G TP V C + ++ N+  + ++  C D+S++
Sbjct  146  EALTKAGIEPNDET-YTLENIKDALKEGTGFTPFVECNRDQSGNSQ-LYQLYFCVDSSSV  203

Query  843  NLISC-TQAQLSCGTQ  887
            +LI C    +  CG Q
Sbjct  204  SLIDCPIYPRGKCGPQ  219



>gb|AFI24539.1| self-incompatibility associated ribonuclease S6, partial [Prunus 
virginiana]
Length=195

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 79/155 (51%), Gaps = 9/155 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDRLDI  530
            WPP  C      C   +  + FTIHGLWP      + P+  +G     +++ DLR  L  
Sbjct  37   WPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNHSNPTMPSNCNGTQFKRILSPDLRSDLTR  96

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E   +  FWE EWNKHGK S   L ++ YF+R+ +++ A N+T IL N  I+P  
Sbjct  97   SWPDVESGDDTKFWEGEWNKHGKCSEQTLNQMQYFQRSHEMWYAFNITKILKNASIVPHA  156

Query  711  NSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
                T    +A +  A   TP++ C+  + +  ++
Sbjct  157  TQTWTYSDIVAPIKTATKRTPLLRCKYDKKTQLLH  191



>ref|XP_006305515.1| hypothetical protein CARUB_v10009986mg [Capsella rubella]
 gb|EOA38413.1| hypothetical protein CARUB_v10009986mg [Capsella rubella]
Length=275

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 81/182 (45%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTT-----QQSSGPAYVDGLINQ  506
            FY  L WP  YC +  + C P   K   DF IHGLWP        Q  +  +  D L   
Sbjct  78   FYFVLQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSQFDDLRVS  137

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N    FW HEW KHG  + S L + DYFE  ++L    N+   
Sbjct  138  DLMSELQREWPTLSCPSNDGMKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLHA  197

Query  681  LANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D          ++ +A G  P + C K  + N+  + +I LC D SA   I
Sbjct  198  LTNAGIKPDDKFYEIKEIEKTIKEATGFAPGIECNKDSSHNSQ-LYQIYLCVDTSASKFI  256

Query  852  SC  857
            +C
Sbjct  257  NC  258



>gb|KDP41205.1| hypothetical protein JCGZ_15612 [Jatropha curcas]
Length=226

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 85/183 (46%), Gaps = 15/183 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTTQ----QSSGPAYV-DGLINQ  506
            FY    WP  YC    + C P   K   DF IHGLWP         +  P  V D     
Sbjct  29   FYFVQQWPGSYCDTRHSCCYPKTGKPAADFGIHGLWPNYKDGGYPSNCNPDSVFDKSQIS  88

Query  507  DLRDRLDIYWSNLE---RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
            DL  RL+  W  L     D N+ FW HEW KHG  + S L + DYFE A++L    N+  
Sbjct  89   DLVSRLERNWPTLSCPSGDGNK-FWSHEWVKHGTCAESELDQHDYFEAALKLKEKVNLLK  147

Query  678  ILANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            IL + GI P D      T   ++  A G TP + C K  + NT  + +I LC D SA  +
Sbjct  148  ILTDAGIKPDDEFYELETIEEAIKDAIGYTPGLECNKDGSKNTQ-LFQIYLCVDTSASEI  206

Query  849  ISC  857
            I C
Sbjct  207  IEC  209



>dbj|BAF03592.1| S-like RNase [Fagopyrum esculentum]
Length=225

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 91/196 (46%), Gaps = 20/196 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQ-------TTQQSSGPAYVDGLI  500
            FY  L WP  YC A  A C P   K   DF IHGLWP        +   SS P     + 
Sbjct  28   FYFVLQWPGAYCDARKACCFPTTGKPDADFGIHGLWPNYNDGTYPSNCDSSNPFERSKI-  86

Query  501  NQDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
              DL  R+   W  L        AFW HEW KHG  S S+L +  YF+ ++ L    N  
Sbjct  87   -SDLVTRMQSEWPTLACPSGDGTAFWTHEWEKHGTCSESVLDQHAYFKSSLDLKDQINAL  145

Query  675  TILANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDASAI  842
              L   GI P+D +  TL ++  A     G TP V C + ++ N+  + ++  C D+S++
Sbjct  146  EALTKAGIEPNDET-YTLENIKDALKEGTGFTPFVECNRDQSGNSQ-LYQLYFCVDSSSV  203

Query  843  NLISC-TQAQLSCGTQ  887
            +LI C    +  CG Q
Sbjct  204  SLIDCPIYPRGKCGPQ  219



>ref|NP_564264.1| ribonuclease 3 [Arabidopsis thaliana]
 sp|P42815.1|RNS3_ARATH RecName: Full=Ribonuclease 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF87036.1|AC006535_14 T24P13.23 [Arabidopsis thaliana]
 gb|AAC48926.1| ribonuclease [Arabidopsis thaliana]
 gb|AAD14489.1| ribonuclease [Arabidopsis thaliana]
 gb|AAL36200.1| putative ribonuclease, RNS3 [Arabidopsis thaliana]
 gb|AAM51363.1| putative ribonuclease RNS3 [Arabidopsis thaliana]
 gb|AAM67130.1| ribonuclease, RNS3 [Arabidopsis thaliana]
 gb|AEE30746.1| ribonuclease 3 [Arabidopsis thaliana]
Length=222

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 80/182 (44%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTT-----QQSSGPAYVDGLINQ  506
            FY  L WP  YC +  + C P   K   DF IHGLWP        Q  +  +  D L   
Sbjct  25   FYFVLQWPGAYCDSRHSCCYPQTGKPAADFGIHGLWPNYKTGGWPQNCNPDSRFDDLRVS  84

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N    FW HEW KHG  + S L + DYFE  ++L    N+   
Sbjct  85   DLMSDLQREWPTLSCPSNDGMKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLHA  144

Query  681  LANYGILPSDN---SPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D          ++ Q  G  P + C K  + N+  + +I LC D SA   I
Sbjct  145  LTNAGIKPDDKFYEMKDIENTIKQVVGFAPGIECNKDSSHNSQ-LYQIYLCVDTSASKFI  203

Query  852  SC  857
            +C
Sbjct  204  NC  205



>ref|XP_010495841.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=214

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 82/183 (45%), Gaps = 15/183 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQSSGPAYVDGLIN------  503
            FY  + WP  YC  N + C P   K   DF IHGLWP     SS P+  D          
Sbjct  17   FYFVVQWPGAYCDTNRSCCYPTSGKPAADFGIHGLWPNYNS-SSWPSNCDPDSKFDRSQI  75

Query  504  QDLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
            +DL   +   W  L    N  F  WEHEW KHG  + S + + +YFE A++L    N+  
Sbjct  76   EDLLSSMKNNWPTLSCPSNEGFKFWEHEWEKHGTCAESEMDQHEYFEIALKLKDKANLLQ  135

Query  678  ILANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            ILAN GI P D   +      ++    G  P + C K R  N   + +I +C D S    
Sbjct  136  ILANSGINPDDGFYDLKKITNAIKDGIGFAPGLQCNKDRKHNAQ-LYQIYICVDTSGTEF  194

Query  849  ISC  857
            I C
Sbjct  195  IEC  197



>gb|AAZ91359.1| S1 S-RNase [Prunus webbii]
Length=198

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 76/153 (50%), Gaps = 10/153 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  CI +   C  ++  + FTIHGLWP        P+   G       +   LR++L 
Sbjct  37   WPPTTCIRSKKPCSKHRPLQIFTIHGLWPSNYSNPKRPSNCAGSRFNFTKVYPQLRNKLK  96

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E      FWE EWNKHG  S   L ++ YFER+  ++++ N+T IL N  I+PS
Sbjct  97   ISWPDVEGGNVTKFWEGEWNKHGTCSEERLNQMQYFERSHDMWMSYNITKILKNASIVPS  156

Query  708  DNSPTTLASVSQAFGS----TPIVVCRKGRNSN  794
                 + A +  A  +    TP++ C+     N
Sbjct  157  ATQTWSYADIVSAIKTATKRTPLLCCKPDPQPN  189



>gb|ABV72002.1| S14-RNase [Prunus mume]
Length=234

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 87/187 (47%), Gaps = 21/187 (11%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  CI       P  + ++FTIHGLWP        P+   G       ++  LR +L 
Sbjct  37   WPPTNCILRTKCSKPRPL-QNFTIHGLWPSNYSNPKMPSNCIGSRFNFTKVSPRLRSKLK  95

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG  S   L ++ YF+R+ +++   N+T IL N  I+P 
Sbjct  96   ISWPDVESGNDTKFWEGEWNKHGTCSERTLNQMQYFQRSHEMWNFHNITEILRNASIVPH  155

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSNT----------MYITEIRLCYDASAIN  845
                      ++ +  A   TP++ C+    S T            + E+ LC+D  A+ 
Sbjct  156  ATHTWKYSDIVSPIQTAIKRTPLLRCKPRPKSQTKSQPKSQAMSQLLHEVVLCFDYDALV  215

Query  846  LISCTQA  866
            +I C + 
Sbjct  216  IIDCNRT  222



>dbj|BAF56261.1| S-RNase [Prunus speciosa]
Length=174

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 78/154 (51%), Gaps = 10/154 (6%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQD  509
            F     WPP  CI +   C  ++    FTIHGLWP        P+  +G       ++  
Sbjct  2    FQFVQQWPPATCIRSTKPCSKHRSLPIFTIHGLWPSNYSNPKTPSNCNGSQFDAIKLSPR  61

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L   W ++E   +  FWE EWNKHGK S   L ++ YFER+ ++++  N+T IL N
Sbjct  62   LRSKLKRSWPDVESGNDEGFWEGEWNKHGKCSEQTLNQMQYFERSHEMWIFHNITKILKN  121

Query  690  YGILPSDNSP---TTLASVSQAF-GSTPIVVCRK  779
              I+P        T + S  +A   +TP++ C++
Sbjct  122  ASIVPHPTKTWKYTDIVSAIKALTQTTPLLRCKR  155



>gb|ACG50929.1| S2-RNase [Prunus simonii]
Length=190

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 77/157 (49%), Gaps = 10/157 (6%)
 Frame = +3

Query  336  TWGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------L  497
            T+  F     WPP  C      C   ++ ++FTIHGLW       + P+  +G       
Sbjct  18   TYDYFQFVQQWPPTTCGVRGKPCSKPRLLQNFTIHGLWSSNYSNPTMPSNCNGSKFEARK  77

Query  498  INQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
            +   LR  L I W ++E   +  FWE EWNKHG  S  +L ++ YFER+  ++ + N+T 
Sbjct  78   VYPQLRSDLKISWPDVESGNDTKFWEGEWNKHGTCSEQILNQMQYFERSHAMWTSYNITK  137

Query  678  ILANYGILPSDNSP----TTLASVSQAFGSTPIVVCR  776
            IL N  I+PS          L+ +  A G TP++ CR
Sbjct  138  ILKNASIVPSAKQKWKYSDILSPIKTATGRTPLLRCR  174



>gb|KFK44585.1| hypothetical protein AALP_AA1G277900 [Arabis alpina]
Length=222

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 85/183 (46%), Gaps = 15/183 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTTQ----QSSGP--AYVDGLIN  503
            FY  L WP  YC +  + C P   K   DF IHGLWP        Q+  P   +V+  ++
Sbjct  25   FYFVLQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSRFVESRVS  84

Query  504  QDLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
             DL   L   W  L    N    FW HEW KHG  + S L + DYFE  ++L    N+  
Sbjct  85   -DLMSNLQREWPTLSCPSNDGVNFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLH  143

Query  678  ILANYGILPSDNSPTTL---ASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
             L N GI P D    T     ++ +A G  P + C K  + N+  + +I LC D SA   
Sbjct  144  ALINAGIKPDDKFYETKDIEKTIQEAIGFAPGIECNKDSSHNSQ-LYQIYLCVDTSASKF  202

Query  849  ISC  857
            I+C
Sbjct  203  INC  205



>dbj|BAC20680.1| putative aleurone ribonuclease [Oryza sativa Japonica Group]
 gb|EAZ40762.1| hypothetical protein OsJ_25235 [Oryza sativa Japonica Group]
Length=260

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 88/184 (48%), Gaps = 18/184 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYV---------DGLI  500
             YL+  WP  YC  +     P      FTIHGLWP   +   G  ++         D   
Sbjct  30   MYLAQQWPDSYCSTHKCLVKPPP-PSHFTIHGLWPSYNKLIDGKMWLEDCNKEDPLDPTQ  88

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
             QDL  +LD  W +L++  N  FW  EW KHG  SN  LG+  YFE A+ L   TN+T I
Sbjct  89   IQDLEKQLDQKWPSLKQ-TNLEFWSLEWKKHGTCSN--LGQHAYFEAALALERLTNLTKI  145

Query  681  LANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            LA+ G+ PSD    T   +S A     G      C K +  +T+ ++E+R C D     L
Sbjct  146  LADGGVGPSDVKTYTFREISDALARGTGFRTYFKCSKNKAGDTL-LSEVRQCVDRYGEKL  204

Query  849  ISCT  860
            I+CT
Sbjct  205  INCT  208



>dbj|BAH22709.1| S-like ribonuclease [Dionaea muscipula]
Length=225

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 90/188 (48%), Gaps = 18/188 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQ-------TTQQSSGPAYVDGLI  500
            FY    WP  YC  + + C P   K   DF IHGLWP        +   SS P   D   
Sbjct  27   FYFVQQWPGSYCDTSQSCCYPTTGKPASDFGIHGLWPNYNSGSYPSNCDSSNP--FDPSQ  84

Query  501  NQDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
             QDL  ++   W +L        +FW HEWNKHG  S S+L E  YF+ A+ L  ++N+ 
Sbjct  85   IQDLLSQMQTEWPSLSCPSSDGTSFWTHEWNKHGTCSESVLNEHAYFQAALSLKNSSNLL  144

Query  675  TILANYGILPSDNS---PTTLASVSQAFGS-TPIVVCRKGRNSNTMYITEIRLCYDASAI  842
              LAN GI P+ NS      LA++ QA G     + C   +N N+  + ++ +C + S  
Sbjct  145  QTLANAGITPNGNSYNLSDVLAAMKQATGGYDAYIQCNTDQNGNSQ-LYQVYMCVNTSGQ  203

Query  843  NLISCTQA  866
            + I C  A
Sbjct  204  SFIECPVA  211



>dbj|BAE16663.1| ribonuclease [Drosera adelae]
 dbj|BAE44977.1| ribonuclease [Drosera adelae]
Length=227

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 82/187 (44%), Gaps = 17/187 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQ-------TTQQSSGPAYVDGLI  500
            FY    WP  YC  +   C P   K   DF IHGLWP        +   SS P   D   
Sbjct  30   FYFVQQWPGAYCDTSRGCCNPTSGKPPSDFGIHGLWPNYNSGGYPSNCDSSNP--FDPSQ  87

Query  501  NQDLRDRLDIYWSNL--ERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
             QDL  +L   W +L        +FW HEWNKHG  S S+L E  YF  A+ L    N  
Sbjct  88   IQDLLSQLQTQWPSLTCPSSDGTSFWTHEWNKHGTCSESVLTEHAYFAAALNLKSQANTL  147

Query  675  TILANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAIN  845
              L N GI P++   N    LA++ Q  G    V C    N N+  + +I +C D +  N
Sbjct  148  ASLTNAGITPNNSFYNLSDVLAAIKQGTGHDAYVQCNTDENGNSQ-LYQIYICVDTTGAN  206

Query  846  LISCTQA  866
             I C  A
Sbjct  207  FIECPVA  213



>gb|ABL86037.1| S-RNase [Prunus tenella]
Length=175

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 75/153 (49%), Gaps = 10/153 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQD  509
            F     WPP  CI +   C  ++    FTIHGLWP        P+   G       ++ +
Sbjct  13   FQFVQQWPPATCIRSNKPCTKHRPLPIFTIHGLWPSNYSNPRMPSNCRGSLFETRKLSPE  72

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            L+ +L   W N+E D +   WEHEWNKHG+ S   L +  YF+R+  ++ + N+T IL N
Sbjct  73   LQSKLKRAWPNVETDNDTKLWEHEWNKHGRCSEGTLNQTQYFQRSYSMWRSHNITEILRN  132

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCR  776
              I+P+          ++ +  A   TP++ C+
Sbjct  133  ASIVPNAKQTWKYSDIVSPIQTATKRTPVLRCK  165



>ref|XP_010498993.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=222

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 82/182 (45%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTT-----QQSSGPAYVDGLINQ  506
            FY  L WP  YC +  + C P   K   DF IHGLWP        Q  +  +  D L   
Sbjct  25   FYFVLQWPGAYCDSRHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSQFDDLRVS  84

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N    FW HEW KHG  + S L + DYFE  ++L    N+   
Sbjct  85   DLMIDLQREWPTLSCPSNDGMKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLFHA  144

Query  681  LANYGILPSDN---SPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D          ++ +A G +P + C K  + N+  + ++ LC D SA   I
Sbjct  145  LTNAGIKPDDKFYEMKNIQNAIKEATGFSPGIECNKDSSHNSQ-LYQVYLCVDTSASKFI  203

Query  852  SC  857
            +C
Sbjct  204  NC  205



>ref|XP_008389464.1| PREDICTED: ribonuclease 3-like [Malus domestica]
Length=227

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 86/182 (47%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQ----QSSGPAYV-DGLINQ  506
            FY    WP  YC      C P   K   DF IHGLWP         +  P  V D     
Sbjct  30   FYFVQQWPGAYCDTKHTCCYPKSGKPTADFGIHGLWPNYKDGGYPSNCDPDSVFDKSQIS  89

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            +L   L+  W +L    +    FW HEW KHG  S S L + +YFE A++L    N+  I
Sbjct  90   ELMTSLNKNWPSLSCPSSNGYRFWSHEWEKHGTCSESELDQKEYFEAALKLREKVNLLQI  149

Query  681  LANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI+P+D   N  + + ++ +  G TP + C K    N+  + ++ LC D S  ++I
Sbjct  150  LKNAGIVPNDELYNLESIVEAIKEGVGHTPGIECNKDSAGNSQ-LYQVYLCVDTSGQDII  208

Query  852  SC  857
            +C
Sbjct  209  AC  210



>ref|XP_003517990.1| PREDICTED: ribonuclease 3-like [Glycine max]
 gb|KHN01231.1| Ribonuclease 3 [Glycine soja]
Length=226

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 94/196 (48%), Gaps = 20/196 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTTQQSSGPAYVDGLINQDLRDR  521
            FY    WP  YC    + C P   K   DF+IHGLWP      S P+  D     D    
Sbjct  29   FYFVQQWPGAYCDTKQSCCYPKTGKPSADFSIHGLWPNYND-GSWPSNCDPDSVFDKSQI  87

Query  522  LDIYWSNLERD-PNRA--------FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
             D+  SN+E+D P+ +        FW HEW KHG  + S L + +YFE  ++L    N+ 
Sbjct  88   SDLI-SNMEKDWPSLSCPSSNGMRFWSHEWEKHGTCAESELDQREYFETTLKLKQKVNLL  146

Query  675  TILANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDASAI  842
             IL N GI P D+   TL S+S+A     G TP + C +    N+  + ++ +C D S  
Sbjct  147  RILKNAGIEP-DDGFYTLESISEAIKEGTGFTPGIECNRDSARNSQ-LYQVYMCVDTSGS  204

Query  843  NLISCTQAQLS-CGTQ  887
            NLI C     S CG Q
Sbjct  205  NLIECPVLPRSKCGEQ  220



>gb|AAC49325.1| ribonuclease [Zinnia violacea]
Length=239

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 85/189 (45%), Gaps = 16/189 (8%)
 Frame = +3

Query  333  RTWGSFYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQS------SGPAYV  488
            + +  FY    WP  YC +    C P   K  EDF+IHGLWP     +      S   + 
Sbjct  26   KEFDFFYFVQQWPGSYCDSRRGCCYPKTGKPAEDFSIHGLWPNYVDGTYPSNCDSSNQFD  85

Query  489  DGLINQDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLA  662
            D  ++ +L   L ++W  L         FW HEW KHG  + S+  E  YFE A+ L   
Sbjct  86   DSKVS-NLESELQVHWPTLACPSGDGLKFWRHEWEKHGTCAESIFDERGYFEAALSLKKK  144

Query  663  TNVTTILANYGILPSDNSPTTL----ASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYD  830
             N+   L N GI P+D    TL     +++QA G  P + C    +S    + ++  C D
Sbjct  145  ANLLNALENAGIRPADGKFHTLDQIKDAITQAVGYEPYIECNVD-SSGYHQLYQVYQCVD  203

Query  831  ASAINLISC  857
             SA N I C
Sbjct  204  RSASNFIKC  212



>gb|AHH02661.1| RNase-like major storage protein [Panax notoginseng]
Length=238

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 91/182 (50%), Gaps = 12/182 (7%)
 Frame = +3

Query  339  WGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL---INQ-  506
            W  F L L WP G+C  N   C    +   FTIHGL+P   + + G  Y DG    +N  
Sbjct  29   WAMFALRLQWPAGFCEVN-NDCDTKSLLNTFTIHGLYPYNAKMAPG-LYCDGTAFDVNSV  86

Query  507  -DLRDRLDIYWSNLERD-PNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
             D +  + + W + E +  ++ FWEHEW KHG+ S +LL + DYF  A+    A ++  +
Sbjct  87   SDFQAEMHLAWPSHETNTEDKQFWEHEWKKHGRCSEALLKQTDYFRTALAFRKAFDIIGL  146

Query  681  LANYGILPSDN--SPTTLA-SVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L   GI P+++   P  +  ++ +   + P +   K  NS  + +T+I LC +  A   +
Sbjct  147  LNQEGIYPNNDLYRPKMIKEAIKKHLNAVPEIDFTKNENSEYV-LTDINLCVNQQATRFV  205

Query  852  SC  857
             C
Sbjct  206  DC  207



>gb|ABW04806.1| S-RNase [Prunus dulcis]
Length=169

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 12/167 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQD  509
            F     WPP  C    + C   +  ++FTIHGLWP        P+   G       +   
Sbjct  2    FQFVQQWPPTNCRVR-SKCTKPRPLQNFTIHGLWPSNYSNPKKPSNCAGSRFNFTKMYPQ  60

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR  L + W ++E   +  FWE EWNKHGK S  +L ++ YFER+ +++ + NVT IL N
Sbjct  61   LRSELKMSWPDVESGNDTKFWEDEWNKHGKCSEGMLNQMQYFERSHEMWDSYNVTEILKN  120

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCRKG-RNSNTMYITEI  815
              I+PS          ++ +  A   TP++ C++   +SN  ++ E+
Sbjct  121  ASIVPSAKQIWKYSDIVSPIKAATHRTPVLRCKRDPAHSNIQWLHEV  167



>ref|XP_010458911.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=226

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 83/183 (45%), Gaps = 15/183 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQSSGPAYVDGLIN------  503
            FYL + WP  YC    + C P   K + DF IHGLWP   +  S P+  D          
Sbjct  29   FYLVVQWPGAYCDTKRSCCYPTSGKPEADFGIHGLWP-NYKDGSWPSNCDPDSQFDRSQI  87

Query  504  QDLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
            +DL   +   W  L    N  F  WEHEW KHG  S S++ + +YFE A++L    N+  
Sbjct  88   EDLLSSMKKNWPTLSCPSNEGFNFWEHEWEKHGTCSESVMDQHEYFENALKLKDKANLLQ  147

Query  678  ILANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            IL N GI P D   +      ++    G TP + C K    N   + +I +C D S    
Sbjct  148  ILTNSGINPDDGFYDLNKITNAIKDGIGFTPGLQCNKDPERNAQ-LYQIYICVDTSGTEF  206

Query  849  ISC  857
            I C
Sbjct  207  IEC  209



>dbj|BAF56251.1| S-RNase [Prunus speciosa]
Length=170

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 81/167 (49%), Gaps = 11/167 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSS------GPAYVDGLINQD  509
            F     WPP  CI +   C  +     FTIHGLWP      +      GP + +  +   
Sbjct  2    FQFVQQWPPATCIRSRKPCSKHLPLPIFTIHGLWPSNYSNPTMPSNCIGPLFNESKLCPK  61

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L I W ++E   +  FWE EWNKHG+ S  +L ++ YFER+  ++ + N+T IL N
Sbjct  62   LRSKLKISWPDVESGNDTQFWEGEWNKHGRCSKEMLNQMQYFERSHAMWNSHNITNILEN  121

Query  690  YGILPSDNSP----TTLASVSQAFGSTPIVVCRKG-RNSNTMYITEI  815
              I+P+          L  +  A   TP++ C+     SN+  + E+
Sbjct  122  AQIVPNATRKWKYLDILTPIKAATKRTPLLRCKPDPAQSNSQLLHEV  168



>dbj|BAF91151.1| S-ribonuclease [Prunus mume]
Length=182

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 77/156 (49%), Gaps = 10/156 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C A    C   +  ++FTIHGLWP      + P+   G       +   L+  L 
Sbjct  24   WPPTNCRARRRPCSKPRPLQNFTIHGLWPSNYSNPTMPSNCKGSQFEARKVYPQLQSNLK  83

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG+ S   L  + YFER+  ++ + N+T IL N  I+P 
Sbjct  84   IAWPDVESGNDTRFWEGEWNKHGRCSEQTLNLMQYFERSYGMWKSYNITEILKNASIVPH  143

Query  708  DNSPTTLAS----VSQAFGSTPIVVCRKGRNSNTMY  803
                 T A     +  A   TP++ CR+ +N+  ++
Sbjct  144  PTQTWTYADIVSPIKTATKRTPLLRCRQDKNTQLLH  179



>gb|ABW04807.1| S-RNase [Prunus dulcis]
 gb|AIV99937.1| S-RNase S31-1, partial [Prunus dulcis]
Length=174

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 76/160 (48%), Gaps = 11/160 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQ  506
            F     WPP  C + N   C   +  + FTIHGLWP      + P+      Y D  +  
Sbjct  1    FQFVQQWPPTNCRVRNKRPCSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQYDDRKVYP  60

Query  507  DLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILA  686
            DLR  L   W ++E   +  FWE EWNKHG  S   L +  YFER+  ++++ N+T +L 
Sbjct  61   DLRSDLKRSWPDVESGNDTKFWEGEWNKHGTCSEQTLNQFQYFERSHDMWMSKNITEVLK  120

Query  687  NYGILPSDNS----PTTLASVSQAFGSTPIVVCRKGRNSN  794
            N  I+PS          +A +  A G TP++ C+     N
Sbjct  121  NASIVPSAKQRWKYSDIVAPIKTATGRTPLLRCKPDPTQN  160



>dbj|BAB55855.1| S-RNase [Prunus mume]
Length=181

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 77/156 (49%), Gaps = 10/156 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C A    C   +  ++FTIHGLWP      + P+   G       +   L+  L 
Sbjct  24   WPPTNCRARRRPCSKPRPLQNFTIHGLWPSNYSNPTMPSNCKGSQFEARKVYPQLQSNLK  83

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG+ S   L  + YFER+  ++ + N+T IL N  I+P 
Sbjct  84   IAWPDVESGNDTRFWEGEWNKHGRCSEQTLNLMQYFERSYGMWKSYNITEILKNASIVPH  143

Query  708  DNSPTTLAS----VSQAFGSTPIVVCRKGRNSNTMY  803
                 T A     +  A   TP++ CR+ +N+  ++
Sbjct  144  PTQTWTYADIVSPIKTATKRTPLLRCRQDKNTQLLH  179



>ref|XP_002890631.1| hypothetical protein ARALYDRAFT_472718 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66890.1| hypothetical protein ARALYDRAFT_472718 [Arabidopsis lyrata subsp. 
lyrata]
Length=222

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 81/182 (45%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTT-----QQSSGPAYVDGLINQ  506
            FY  L WP  YC +  + C P   K   DF IHGLWP        Q  +  +  D L   
Sbjct  25   FYFVLQWPGAYCDSIHSCCYPKTGKPAADFGIHGLWPNYKTGGWPQNCNPDSQFDDLRVS  84

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL + L   W  L    N    FW HEW KHG  + S L + DYFE  ++L    N+   
Sbjct  85   DLMNDLQREWPTLSCPSNDGMKFWTHEWEKHGTCAESELDQHDYFEAGLKLKQKANLLHA  144

Query  681  LANYGILPSDN---SPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D          ++ +  G  P + C K  + N+  + +I LC D SA   I
Sbjct  145  LTNAGIKPDDKFYEMKDIENTIKEVVGFAPGIECNKDSSHNSQ-LYQIYLCVDTSASKFI  203

Query  852  SC  857
            +C
Sbjct  204  NC  205



>gb|ADZ48271.1| S-locus-associated ribonuclease [Prunus speciosa]
Length=227

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 85/178 (48%), Gaps = 12/178 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  C      C   +  + FTIHGLWP      + P+      + +G +   LR  L 
Sbjct  37   WPPTNCKVRGKPCSKPRPLQIFTIHGLWPSNYSNPTRPSNCIGSLFEEGKLYPQLRLNLK  96

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FW  EWNKHG+ S   L +  YFER+  ++ + N+T IL N  I+P+
Sbjct  97   RSWPDVESGNDTKFWSGEWNKHGRCSEQTLNQRQYFERSHAMWNSYNITNILENAQIVPN  156

Query  708  DNS----PTTLASVSQAFGSTPIVVCRK--GRNSNTMYITEIRLCYDASAINLISCTQ  863
                      ++ +  A G TP++ C+    +++N  ++ E+  CY   A   I C +
Sbjct  157  ATQTWKYSDIVSPIKTATGRTPLLRCKSDPKKSNNYQFLHEVVFCYGYRAKKQIDCNR  214



>gb|AEI69725.1| ribonuclease S24 precursor [Prunus dulcis]
Length=189

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 85/173 (49%), Gaps = 15/173 (9%)
 Frame = +3

Query  336  TWGSFYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWP------QTTQQSSGPAYV  488
            ++G F     WPP  C   I  P  C   +  ++FTIHGLWP      +     +G  Y 
Sbjct  17   SYGYFQFVQQWPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNYSNPRKPSNCNGAKYE  74

Query  489  DGLINQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATN  668
            D  +   LR +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++L+ N
Sbjct  75   DRKVYPKLRSKLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFEVSHDMWLSYN  134

Query  669  VTTILANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            +T IL N  I+P      T    ++ +  A   TP++ C+    +NT  I E+
Sbjct  135  ITEILRNASIVPHPTQTWTYSDVVSPIKAATKRTPLIRCKIDTATNTELIHEV  187



>emb|CAN90138.1| self-incompatibility ribonuclease [Prunus domestica]
Length=186

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 80/156 (51%), Gaps = 10/156 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-LIN-----QDLRDRLD  527
            WPP  C      C   +  ++FTIHGLWP        P+   G L N       LR  L 
Sbjct  27   WPPTNCRVRNKPCTKPRPLQNFTIHGLWPSNYSNPRMPSKCTGSLFNFRKVYPQLRSDLK  86

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG+ S   L ++ YFER+  ++++ N+T IL N  I+PS
Sbjct  87   ISWPDVESGNDTRFWESEWNKHGRCSEDSLNQMQYFERSHAMWISYNITEILKNASIVPS  146

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
                 T    ++ + +A   TP++ C+  +++  ++
Sbjct  147  ATQNWTYSDIVSPIKRATKRTPLLRCKYDKSTQLLH  182



>pdb|1BK7|A Chain A, Ribonuclease Mc1 From The Seeds Of Bitter Gourd
 pdb|1UCA|A Chain A, Crystal Structure Of The Ribonuclease Mc1 From Bitter 
Gourd Seeds Complexed With 2'-Ump
 pdb|1UCC|A Chain A, Crystal Structure Of The Ribonuclease Mc1 From Bitter 
Gourd Seeds Complexed With 3'-Ump.
 pdb|1UCD|A Chain A, Crystal Structure Of Ribonuclease Mc1 From Bitter Gourd 
Seeds Complexed With 5'-Ump
Length=190

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 86/191 (45%), Gaps = 10/191 (5%)
 Frame = +3

Query  345  SFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS----SGPAYVDGLINQDL  512
            SF+    WPP  C    +G  P      FTIHGLWPQ +  S     G  +    I+  L
Sbjct  3    SFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQQSGTSLTNCPGSPFDITKISH-L  61

Query  513  RDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANY  692
            + +L+  W N+ R  N+ FW HEW KHG  S S   +  YF+ A+ +    ++   L  +
Sbjct  62   QSQLNTLWPNVLRANNQQFWSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPH  121

Query  693  GILPSDNSPTTLA---SVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
               P+  + +  A    +   FG  P + CR    +   Y+ ++  C+      LI CT+
Sbjct  122  AAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVQVVACFAQDGSTLIDCTR  181

Query  864  AQLSCGTQPIY  896
               +CG   I+
Sbjct  182  D--TCGANFIF  190



>gb|AAL59323.2| RNase [Prunus dulcis]
Length=162

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 81/158 (51%), Gaps = 12/158 (8%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPN-KMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQDLRDRL  524
            WPP  C        PN +  + FTIHGLWP          + +GP +    ++  +R +L
Sbjct  4    WPPTNCRVRIKRPCPNPRPLQYFTIHGLWPSNYSNPTKPSKCTGPKFDARKVSPKMRIKL  63

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++L+ N+T IL N     
Sbjct  64   KISWPDVESGNDTRFWEGEWNKHGTCSRERLNQMQYFERSHDMWLSYNITEILKNASYRT  123

Query  705  SDNSP-----TTLASVSQAFGSTPIVVCRKGRNSNTMY  803
              NS        ++ +  A GSTP++ C++ +N+  ++
Sbjct  124  KCNSKGGGYSDIISPIKAATGSTPLLRCKQAKNTQLLH  161



>dbj|BAF56259.1| S-RNase [Prunus speciosa]
Length=167

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 82/165 (50%), Gaps = 10/165 (6%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQD  509
            F     WPP  C      C   +  + FTIHGLWP        P+      + +  ++  
Sbjct  2    FQFVQQWPPTNCKIR-TKCSKPRPSQMFTIHGLWPSNYSNPKMPSNCMGSRFNESNLSPK  60

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L   W ++E   +  FWE EWNKHGK S   L ++ YF+R+ +++  +N+T+IL N
Sbjct  61   LRSKLKRSWPDVESGNDTKFWEGEWNKHGKCSEQTLNQMQYFQRSHEMWYTSNITSILKN  120

Query  690  YGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
              I+PS         ++++  A   TP++ C+    +NT  + E+
Sbjct  121  ASIVPSATRWKYSDIVSAIKTATKRTPLLRCKTEAATNTELLHEV  165



>emb|CAJ77736.1| ribonuclease S25 precursor [Prunus dulcis]
Length=188

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 82/161 (51%), Gaps = 12/161 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C    + C   +  ++FTIHGLWP        P+   G       +   LR  L 
Sbjct  27   WPPTNCRVR-SKCTKPRPLQNFTIHGLWPSNYSNPKKPSNCAGSRFNFTKMYPQLRSELK  85

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            + W ++E   +  FWE EWNKHGK S  +L ++ YFER+ +++ + NVT IL N  I+PS
Sbjct  86   MSWPDVESGNDTKFWEDEWNKHGKCSEGMLNQMQYFERSHEMWDSYNVTEILKNASIVPS  145

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKG-RNSNTMYITEI  815
                      ++ +  A   TP++ C++   +SN  ++ E+
Sbjct  146  AKQIWKYSDIVSPIKAATHRTPVLRCKRDPAHSNIQWLHEV  186



>dbj|BAF56275.1| S-RNase [Prunus speciosa]
Length=168

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 83/165 (50%), Gaps = 15/165 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LI  500
            F     WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G       +
Sbjct  2    FQFVQQWPPTNCRVRIKQP--CSNPRPLQYFTIHGLWPSNYSNPTVPSNCNGSKFDARKV  59

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            +  LR++L I W ++E   +  FWE EWNKHG  S   L ++ YFE +  ++L+ N+T I
Sbjct  60   SPQLRNKLKISWPDVESGNDTKFWEGEWNKHGTCSEQTLHQMQYFELSHDMWLSHNITEI  119

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
            L N  ILP      T    L+ +  A   TP++ C++ +N+  ++
Sbjct  120  LKNASILPHPTQTWTYSDILSPIKAATKRTPLLRCKRDKNTQLLH  164



>sp|P23540.1|RNMC_MOMCH RecName: Full=Ribonuclease MC; Short=RNase MC [Momordica charantia]
 gb|AAB19862.1| ribonuclease [Momordica charantia=bitter gourd, seed, Peptide, 
191 aa]
Length=191

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 86/192 (45%), Gaps = 11/192 (6%)
 Frame = +3

Query  345  SFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS-----SGPAYVDGLINQD  509
            SF+    WPP  C    +G  P      FTIHGLWPQ +  S      G  +    I+  
Sbjct  3    SFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQGSGTSLTNCPQGSPFDITKISH-  61

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            L+ +L+  W N+ R  N+ FW HEW KHG  S S   +  YF+ A+ +    ++   L  
Sbjct  62   LQSQLNTLWPNVLRANNQQFWSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRP  121

Query  690  YGILPSDNSPTTLA---SVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCT  860
            +   P+  + +  A    +   FG  P + CR    +   Y+ ++  C+      LI CT
Sbjct  122  HAAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVQVVACFAQDGSTLIDCT  181

Query  861  QAQLSCGTQPIY  896
            +   +CG   I+
Sbjct  182  RD--TCGANFIF  191



>ref|NP_001235183.1| uncharacterized protein LOC100306447 precursor [Glycine max]
 gb|ACU14629.1| unknown [Glycine max]
 gb|KHN12204.1| Ribonuclease 3 [Glycine soja]
Length=226

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 94/196 (48%), Gaps = 20/196 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTTQQSSGPAYVDGLINQDLRDR  521
            FY    WP  YC    + C P   K   DF+IHGLWP   +  S P+  D     D    
Sbjct  29   FYFVQQWPGAYCDTKQSCCYPKTGKPAADFSIHGLWP-NFKDGSWPSNCDPDSVFDKSQI  87

Query  522  LDIYWSNLERD-PNRA--------FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
             D+  SN+E+D P+ +        FW HEW KHG  + S L + +YFE  ++L    N+ 
Sbjct  88   SDLI-SNMEKDWPSLSCPSSNGMRFWSHEWEKHGTCAESELDQREYFETTLKLKQKVNLL  146

Query  675  TILANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDASAI  842
             IL N GI P D+   TL  V++A     G TP + C +    N+  + ++ +C D S  
Sbjct  147  RILKNAGIEP-DDEIYTLERVTEAIKKGTGFTPGIECNRDSARNSQ-LYQVYMCVDTSGS  204

Query  843  NLISCTQAQLS-CGTQ  887
            NLI C     S CG Q
Sbjct  205  NLIECPVLPRSRCGEQ  220



>emb|CAN90135.1| self-incompatibility ribonuclease [Prunus cerasifera]
 emb|CAN90140.1| self-incompatibility ribonuclease [Prunus salicina]
Length=169

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 71/153 (46%), Gaps = 10/153 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQD  509
            F     WPP  C      C   +  + FTIHGLWP            SG  + DG +   
Sbjct  1    FQFVQQWPPTTCRVRKRPCTKPRPLQIFTIHGLWPSNYSNPWKPSNCSGSQFKDGKVYPQ  60

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L   W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T +L N
Sbjct  61   LRSKLKKSWPDVESGNDTKFWEGEWNKHGTCSEEKLNQMQYFERSHNMWRSYNITEVLKN  120

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCR  776
              I+P           ++ +  A G TP + CR
Sbjct  121  ASIVPHPTQTWSYSDIVSPIKTATGRTPTLRCR  153



>dbj|BAF56254.1| S-RNase [Prunus speciosa]
Length=173

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 78/152 (51%), Gaps = 9/152 (6%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDL  512
            F     WPP  C  +      ++  + FTIHGLWP        P+  +G     +++  L
Sbjct  2    FQFVQQWPPTTCRLSSKPSNQHRPLQRFTIHGLWPSNYSNPRKPSNCNGSQFKGIVSPKL  61

Query  513  RDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANY  692
            R +L I W ++ER  +  FWE EWNKHG  S   + ++ YFER+ +++   N+T +L N 
Sbjct  62   RSKLKIAWPDVERGNDTKFWEDEWNKHGTCSEQTINQMQYFERSYEMWNFRNITEVLKNA  121

Query  693  GILPSDNSPTT----LASVSQAFGSTPIVVCR  776
             I+PS     T    ++++  A  +TP + C+
Sbjct  122  SIVPSATQTWTHSDIVSAIKTATKTTPSLRCK  153



>gb|ABV72003.1| S15-RNase [Prunus mume]
Length=222

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 86/176 (49%), Gaps = 13/176 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  C        P  + + FTIHGLWP        P+      + +  +   LR +L 
Sbjct  37   WPPTNCRVRTKCSNPRPL-QYFTIHGLWPSNYSNPKMPSNCIGSQFNESRVYPYLRPKLK  95

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG  S  +L ++ YF+R+  ++ + N++ IL N  I+P 
Sbjct  96   ISWPDVESGNDTKFWEGEWNKHGTCSERILNQMQYFQRSQAMWKSHNISEILKNASIVPH  155

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
                 T    ++ +  A   TP++ C+  + +  +Y  E+  CY  +A+  I C +
Sbjct  156  PTQTWTYSDIVSPIKTATKKTPLLRCKYDKKTQLLY--EVVFCYGYNALKHIDCNR  209



>emb|CAJ77735.1| ribonuclease S24 precursor [Prunus dulcis]
Length=189

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 86/173 (50%), Gaps = 15/173 (9%)
 Frame = +3

Query  336  TWGSFYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQ  506
            ++G F     WPP  C   I  P  C   +  ++FTIHGLWP      + P+  +G   +
Sbjct  17   SYGYFQFVQQWPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGAKYE  74

Query  507  D------LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATN  668
            D      LR +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++L+ N
Sbjct  75   DRKVYPKLRSKLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFEVSHDMWLSYN  134

Query  669  VTTILANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            +T IL N  I+P      T    ++ +  A   TP++ C+    +NT  + E+
Sbjct  135  ITEILRNASIVPHPTQTWTYSDIVSPIKAATKRTPLIRCKIDTATNTELLHEV  187



>sp|Q7M456.1|RNOY_CRAGI RecName: Full=Ribonuclease Oy; Short=RNase Oy [Crassostrea gigas]
Length=213

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 96/201 (48%), Gaps = 17/201 (8%)
 Frame = +3

Query  333  RTWGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQDL  512
            + W  F  +  WP   C  + +  +P+ +   + IHGLWP +  +S GP   +G    D+
Sbjct  1    KDWNYFTFAQQWPIAVCAEHKSCFIPDSVV-GWGIHGLWPSSDTESKGPENCNGSWPFDI  59

Query  513  RD------RLDIYWSNLERDPN-RAFWEHEWNKHGKISNSLLG---EVDYFERAIQLYLA  662
             +       L  YW NL  D    +FWEHEW+KHG  + SL     E+ YF   ++L+  
Sbjct  60   NNVMPLVPELKKYWPNLYPDTKANSFWEHEWSKHGTCATSLPATSNELKYFGMGLKLHAK  119

Query  663  TNVTTILANYGILPSDNSP----TTLASVSQAFGSTPIVVCRKGR-NSNTMYITEIRLCY  827
             N++ IL N GILPS  +      T A+V +  G   ++ C   +  +    + EI +C 
Sbjct  120  YNISRILVNQGILPSKTAGYMINETEAAVKRELGVDAVIECVYDKEKTKKQLLYEISICL  179

Query  828  DASAINLISCTQAQLSCGTQP  890
                  LISC + ++S  T P
Sbjct  180  -TKEFELISCNKKEVSETTCP  199



>gb|ABB17824.1| Sj-RNase [Prunus dulcis]
Length=282

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 95/202 (47%), Gaps = 21/202 (10%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDRLDI  530
            WPP  C  +      ++  ++FTIHGLWP        P+   G     +++  L  +L  
Sbjct  38   WPPTTCRLSTKPSNKHRPLQNFTIHGLWPSNYPNPKMPSNCAGSQFKKILSPKLLTKLKR  97

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E+  +  FWE EWNKHG  S     ++ YF+R+ +++ + N+T IL N  I+PS 
Sbjct  98   SWPDVEKGNDTEFWESEWNKHGTCSEQTFNQMQYFKRSHEMWSSYNITDILKNASIVPSA  157

Query  711  NSPTTLASVSQAFG----STPIVVCR------KGRNS------NTMYITEIRLCYDASAI  842
                T + +  A      +TP++ C+      KG  +          + E+ LCYD +A+
Sbjct  158  TQTWTYSDIVSAIKTVTQTTPLLRCKPYPAQPKGHPAQRKSPPKPQLLHEVVLCYDYNAL  217

Query  843  NLISCTQAQLSCGTQPIYLKTI  908
              I C +       +PI  + I
Sbjct  218  KQIDCNRTAGCHNQKPISFQKI  239



>emb|CAJ77738.1| ribonuclease S27 precursor [Prunus dulcis]
Length=188

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 81/160 (51%), Gaps = 10/160 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-LINQ----DLRDRLDI  530
            WPP  CI +   C  +     FTIHGLWP      + P+   G L N+     LR +L I
Sbjct  27   WPPATCIRSRKPCSKHLPLPIFTIHGLWPSNYSNPTMPSNCIGSLFNESKYPKLRSKLKI  86

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E   +  FWE EWNKHG+ S  +L ++ YFER+  ++ + N+T IL N  I+P+ 
Sbjct  87   SWPDVESGNDTQFWEGEWNKHGRCSKEMLNQMQYFERSHAMWNSHNITNILENAQIVPNA  146

Query  711  NSP----TTLASVSQAFGSTPIVVCRKG-RNSNTMYITEI  815
                     L  +  A   TP++ C+     SN+  + E+
Sbjct  147  TRKWKYSDILTPIKAATKRTPLLRCKPDPAQSNSQLLHEV  186



>emb|CAN90141.1| self-incompatibility ribonuclease [Prunus mume]
Length=167

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 70/147 (48%), Gaps = 10/147 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQDLRDRLD  527
            WPP  C      C   +  + FTIHGLWP            SG  + DG +   LR +L 
Sbjct  5    WPPTTCRVRKRPCTKPRPLQIFTIHGLWPSNYSDPWKPSNCSGSQFKDGKVYPQLRSKLK  64

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T +L N  I+P 
Sbjct  65   KSWPDVESGNDTKFWEGEWNKHGTCSEEKLNQMQYFERSHNMWRSYNITEVLKNASIVPH  124

Query  708  DNS----PTTLASVSQAFGSTPIVVCR  776
                      ++ +  A G TP + CR
Sbjct  125  PTQTWSYSDIVSPIKTATGRTPTLRCR  151



>pdb|1J1G|A Chain A, Crystal Structure Of The Rnase Mc1 Mutant N71s In Complex 
With 5'-Gmp
Length=190

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 86/191 (45%), Gaps = 10/191 (5%)
 Frame = +3

Query  345  SFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS----SGPAYVDGLINQDL  512
            SF+    WPP  C    +G  P      FTIHGLWPQ +  S     G  +    I+  L
Sbjct  3    SFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQQSGTSLTNCPGSPFDITKISH-L  61

Query  513  RDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANY  692
            + +L+  W ++ R  N+ FW HEW KHG  S S   +  YF+ A+ +    ++   L  +
Sbjct  62   QSQLNTLWPSVLRANNQQFWSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPH  121

Query  693  GILPSDNSPTTLA---SVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
               P+  + +  A    +   FG  P + CR    +   Y+ E+  C+      LI CT+
Sbjct  122  AAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVEVVACFAQDGSTLIDCTR  181

Query  864  AQLSCGTQPIY  896
               +CG   I+
Sbjct  182  D--TCGANFIF  190



>dbj|BAO05319.1| S-like ribonuclease [Aldrovanda vesiculosa]
Length=228

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 86/184 (47%), Gaps = 17/184 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQ-------TTQQSSGPAYVDGLI  500
            FY    W   YC  + + C P   +   DF IHGLWP        +   SS P   D   
Sbjct  28   FYFVQQWSGSYCDTSSSCCYPTYGQPPADFGIHGLWPNYNSGSYPSNCDSSNP--FDPSQ  85

Query  501  NQDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
             QDL  ++   W +L        +FW HEW+KHG  S S+L E  YF  A+ L  +TN+ 
Sbjct  86   IQDLLSQMQTEWPSLSCPSSDGTSFWSHEWDKHGTCSESVLNEHSYFAAALSLKNSTNLL  145

Query  675  TILANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAIN  845
              LAN GI P+ NS      LA++ Q       + C   +N N+  I ++ +C D +  N
Sbjct  146  QTLANAGITPNGNSYNLSDILAAIKQGIRYDAAIQCNTDQNGNSQ-IFQVYICVDTTGQN  204

Query  846  LISC  857
            +I C
Sbjct  205  IIEC  208



>ref|XP_008221612.1| PREDICTED: ribonuclease 3-like [Prunus mume]
Length=227

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 91/187 (49%), Gaps = 23/187 (12%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQSSGPAYVDGLINQDLRDR  521
            FY    WP  YC      C P   K   DF IHGLWP   +  S P+  D      + D+
Sbjct  30   FYFVQQWPGAYCDTKHTCCYPKSGKPSADFGIHGLWP-NYKDGSYPSNCD---PDSVFDK  85

Query  522  LDI--YWSNLERD-PNRA--------FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATN  668
             +I    SNLE++ P+ +        FW HEW KHG  S S L + DYFE A++L    N
Sbjct  86   SEISELMSNLEKNWPSLSCPSSNGFRFWSHEWEKHGTCSESELDQKDYFEAALKLKQKVN  145

Query  669  VTTILANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDAS  836
            +  IL   GI+P D+   +L S+ +A     G TP + C K    N+  + ++ LC D S
Sbjct  146  LLQILKTAGIVP-DDGMYSLESIKEAIKEGAGYTPGIECNKDSAGNSQ-LYQVYLCVDTS  203

Query  837  AINLISC  857
              ++I C
Sbjct  204  GQDIIEC  210



>ref|XP_010476469.1| PREDICTED: ribonuclease 3-like isoform X1 [Camelina sativa]
 ref|XP_010476470.1| PREDICTED: ribonuclease 3-like isoform X2 [Camelina sativa]
Length=226

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 82/183 (45%), Gaps = 15/183 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQSSGPAYVDGLIN------  503
            FYL + WP  YC    + C P   K   DF IHGLWP   +  S P+  D          
Sbjct  29   FYLVVQWPGAYCDTKRSCCYPTSGKPDADFGIHGLWP-NYKDGSYPSNCDPDSQFDRSQI  87

Query  504  QDLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
            +DL   +   W  L    N  F  WEHEW KHG  S S++ + DYF+  ++L    N+  
Sbjct  88   EDLLSGMKKNWPTLSCPSNEGFNFWEHEWEKHGTCSESVMDQHDYFKNTLKLKDKANLLQ  147

Query  678  ILANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            IL N GI P D   +      ++    G TP + C K    N+  + +I LC D S    
Sbjct  148  ILTNSGINPDDGFYDLNKITKAIKDGIGFTPGLQCNKDPERNSQ-LYQIYLCVDTSGSEF  206

Query  849  ISC  857
            I C
Sbjct  207  IEC  209



>ref|XP_007223919.1| hypothetical protein PRUPE_ppa011014mg [Prunus persica]
 gb|EMJ25118.1| hypothetical protein PRUPE_ppa011014mg [Prunus persica]
Length=227

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 91/187 (49%), Gaps = 23/187 (12%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQSSGPAYVDGLINQDLRDR  521
            FY    WP  YC      C P   K   DF IHGLWP   +  S P+  D      + D+
Sbjct  30   FYFVQQWPGAYCDTKHTCCYPKSGKPSADFGIHGLWP-NYKDGSYPSNCD---PDSVFDK  85

Query  522  LDI--YWSNLERD-PNRA--------FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATN  668
             +I    SNLE++ P+ +        FW HEW KHG  S S L + DYFE A++L    N
Sbjct  86   SEISELMSNLEKNWPSLSCPSSNGFRFWSHEWEKHGTCSESELDQKDYFEAALKLKQKVN  145

Query  669  VTTILANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDAS  836
            +  IL   GI+P D+   +L S+ +A     G TP + C K    N+  + ++ LC D S
Sbjct  146  LLQILKTAGIVP-DDGMYSLESIKEAIKEGAGYTPGIECNKDSAGNSQ-LYQVYLCVDTS  203

Query  837  AINLISC  857
              ++I C
Sbjct  204  GQDIIEC  210



>gb|ABL86036.1| S-RNase [Prunus tenella]
Length=171

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 75/153 (49%), Gaps = 10/153 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------  509
            F     WPP  C      C  +   + FTIHGLWP        P+   G + +       
Sbjct  6    FQFVQQWPPATCRVRNKPCYKHPPLQIFTIHGLWPSNYSNPKMPSNCSGTLFKKEKVYPK  65

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            +R++L I W ++    +  FWE EWNKHG+ S   L +  YFER+  ++++ N+T IL N
Sbjct  66   MRNKLKIAWPDVVSGNDAEFWEGEWNKHGRCSEQTLNQWQYFERSHDMWMSHNITNILKN  125

Query  690  YGILPSDNSPTT----LASVSQAFGSTPIVVCR  776
              I+PS     T    +A +  A  +TP++ C+
Sbjct  126  ASIVPSATQTWTYSDIVAPIKAAVETTPLLRCK  158



>ref|XP_009117922.1| PREDICTED: ribonuclease 3-like [Brassica rapa]
Length=227

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 77/182 (42%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQS-----SGPAYVDGLINQ  506
            FY  L WP  YC    A C P   K   DF IHGLWP     S        +  D     
Sbjct  30   FYFVLQWPGAYCDTKRACCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPDSEFDPAEIS  89

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   +   W  L    N    FWEHEW KHG  S S++ +  YFE  + L    N+  I
Sbjct  90   DLVSTMQTKWPTLSCPSNNGSKFWEHEWEKHGTCSESVMDQHKYFENTLALRDRVNLLQI  149

Query  681  LANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L + GI P D   +      ++    G TP++ C K  + N+  + EI  C D S    I
Sbjct  150  LQDAGINPDDEFYDLQDIKNAIKDGTGFTPVIHCNKDPDKNSQ-LHEIFFCVDTSGTEFI  208

Query  852  SC  857
             C
Sbjct  209  EC  210



>gb|AAT69244.1| S1-RNase protein [Prunus armeniaca]
Length=229

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 87/187 (47%), Gaps = 16/187 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQD  509
            F     WPP  C        P  + + FTIHGLWP      + P+  +G       ++  
Sbjct  31   FQFVQQWPPTNCRVRTKCSNPRPL-QIFTIHGLWPSNYSNPTMPSNCNGSKFDDRNVSPQ  89

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L   W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T IL N
Sbjct  90   LRAKLKRSWPDVESGNDTRFWEGEWNKHGTCSEQTLNQMQYFERSQNMWRSYNITEILKN  149

Query  690  YGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNT-----MYITEIRLCYDASAI  842
              I+PS     T    ++ +  A   TP++ C+     N        + E+  CY+ +A+
Sbjct  150  ASIVPSATQTWTYSDIVSPIKTATQRTPLLRCKPDPAQNKSAPKPQLLHEVVFCYEYNAL  209

Query  843  NLISCTQ  863
              I C +
Sbjct  210  KQIDCNR  216



>pdb|1J1F|A Chain A, Crystal Structure Of The Rnase Mc1 Mutant N71t In Complex 
With 5'-Gmp
Length=191

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 85/191 (45%), Gaps = 10/191 (5%)
 Frame = +3

Query  345  SFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS----SGPAYVDGLINQDL  512
            SF+    WPP  C    +G  P      FTIHGLWPQ +  S     G  +    I+  L
Sbjct  4    SFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQQSGTSLTNCPGSPFDITKISH-L  62

Query  513  RDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANY  692
            + +L+  W  + R  N+ FW HEW KHG  S S   +  YF+ A+ +    ++   L  +
Sbjct  63   QSQLNTLWPTVLRANNQQFWSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPH  122

Query  693  GILPSDNSPTTLA---SVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
               P+  + +  A    +   FG  P + CR    +   Y+ E+  C+      LI CT+
Sbjct  123  AAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVEVVACFAQDGSTLIDCTR  182

Query  864  AQLSCGTQPIY  896
               +CG   I+
Sbjct  183  D--TCGANFIF  191



>emb|CAQ51506.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=173

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 82/163 (50%), Gaps = 15/163 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G       +   LR 
Sbjct  11   WPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTRPSNCNGSQFDARKVYPRLRS  68

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            RL+  W ++E   +  FWE EWNKHG  S  +L +  YFER+ +++ + N+T IL N  I
Sbjct  69   RLNRSWPDVESGNDTKFWESEWNKHGTCSQRILNQYQYFERSHEMWRSYNITEILKNASI  128

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            +PS     T    +A +  A   TP++ C+    +NT  + E+
Sbjct  129  VPSATQTWTYSDIVAPIKAATKRTPLLRCKTDVATNTELLHEV  171



>ref|XP_009360332.1| PREDICTED: ribonuclease 3-like [Pyrus x bretschneideri]
 dbj|BAA08475.1| ribonuclease [Pyrus pyrifolia]
Length=227

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 84/182 (46%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQ----QSSGPAYV-DGLINQ  506
            FY    WP  YC      C P   K   DF IHGLWP         +  P  V D     
Sbjct  30   FYFVQQWPGAYCDTKHTCCYPKSGKPTADFGIHGLWPNYKDGGYPSNCDPDSVFDKSQIS  89

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            +L   L+  W +L    +    FW HEW KHG  S S L + +YFE A++L    N+  I
Sbjct  90   ELLTSLNKNWPSLSCPSSNGYRFWSHEWEKHGTCSESELDQKEYFEAALKLREKVNLLQI  149

Query  681  LANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI+P+D   N  + + ++    G TP + C K    N+  + +I LC D S  ++I
Sbjct  150  LKNAGIVPNDELYNLESIVEAIKVGVGHTPGIECNKDSAGNSQ-LYQIYLCVDTSGQDII  208

Query  852  SC  857
             C
Sbjct  209  EC  210



>dbj|BAF56283.1| S-RNase [Prunus speciosa]
Length=167

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 80/156 (51%), Gaps = 10/156 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-LIN-----QDLRDRLD  527
            WPP  C      C   +  ++FTIHGLWP        P+   G L N       LR  L 
Sbjct  8    WPPTNCRVRNKPCTKPRPLQNFTIHGLWPSNYSNPRMPSKCTGSLFNFRKVYPQLRSDLK  67

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EW+KHG+ S   L ++ YFER+  ++++ N+T IL N  I+PS
Sbjct  68   ISWPDVESGNDTRFWESEWSKHGRCSEDSLNQMQYFERSHAMWISYNITEILKNASIVPS  127

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
                 T    ++ + +A   TP++ C+  +++  ++
Sbjct  128  ATKNWTYSDIVSPIKRATKRTPLLRCKYDKSTQLLH  163



>emb|CAZ68892.1| S-ribonuclease, partial [Prunus dulcis]
Length=189

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 81/161 (50%), Gaps = 11/161 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-LINQ-----DLRDRLD  527
            WPP  CI +   C  +     FTIHGLWP      + P+   G L N+      LR +L 
Sbjct  27   WPPATCIRSRKPCSKHLPLPIFTIHGLWPSNYSNPTMPSNCIGSLFNESKLYPKLRSKLK  86

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG+ S  +L ++ YFER+  ++ + N+T IL N  I+P+
Sbjct  87   ISWPDVESGNDTQFWEGEWNKHGRCSKEMLNQMQYFERSHAMWNSHNITNILENAQIVPN  146

Query  708  DNSP----TTLASVSQAFGSTPIVVCRKG-RNSNTMYITEI  815
                      L  +  A   TP++ C+     SN+  + E+
Sbjct  147  ATRKWKYSDILTPIKAATKRTPLLRCKPDPAQSNSQLLHEV  187



>dbj|BAF91159.1| S-ribonuclease [Prunus mume]
Length=185

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 70/147 (48%), Gaps = 10/147 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQDLRDRLD  527
            WPP  C      C   +  + FTIHGLWP            SG  + DG +   LR +L 
Sbjct  24   WPPTTCRVRKRPCTKPRPLQIFTIHGLWPSNYSDPWKPSNCSGSQFKDGKVYPQLRSKLK  83

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T +L N  I+P 
Sbjct  84   KSWPDVESGNDTKFWEGEWNKHGTCSEEKLNQMQYFERSHNMWRSYNITEVLKNASIVPH  143

Query  708  DNS----PTTLASVSQAFGSTPIVVCR  776
                      ++ +  A G TP + CR
Sbjct  144  PTQTWSYSDIVSPIKTATGRTPTLRCR  170



>gb|ACU25555.1| self-incompatibility associated ribonuclease S6 [Prunus pseudocerasus]
Length=228

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 89/179 (50%), Gaps = 15/179 (8%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDR  521
            WPP  C   I  P  C   +  + FTIHGLWP      + P+   G     +++  LR  
Sbjct  39   WPPTNCRVHIKQP--CSNPRPLQYFTIHGLWPSNYSNPTIPSNCTGPQFKKILSPQLRSS  96

Query  522  LDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGIL  701
            L   W ++E   +  FW  EWNKHG  S   L ++ YF+R+ Q++ + N+T IL N  I+
Sbjct  97   LMRSWPDVESGNDTRFWAGEWNKHGTCSEQTLNQMQYFDRSHQMWSSFNITKILKNASIV  156

Query  702  PSDNS----PTTLASVSQAFGSTPIVVCRKG-RNSNTMYITEIRLCYDASAINLISCTQ  863
            P           ++ + +   +TP++ C++      + ++ E+ LCY+  A+ LI C +
Sbjct  157  PHPTQTWKYSDIVSPIKKVTQTTPLLRCKRDPAKPKSQFLHEVVLCYEYHALQLIDCNR  215



>dbj|BAH22121.1| S-RNase [Prunus yedoensis]
 dbj|BAH22123.1| S-RNase [Prunus yedoensis]
 dbj|BAH22125.1| S-RNase [Prunus subhirtella]
Length=239

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 90/191 (47%), Gaps = 27/191 (14%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP        P+   G       +   +R 
Sbjct  37   WPPTNCKVRIKQP--CSNPRPLQYFTIHGLWPSNYSNPRMPSNCTGSQFEWRKLYPHMRS  94

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L I W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T IL N  I
Sbjct  95   KLKISWPDVESGNDTKFWEGEWNKHGTCSVEKLNQMQYFERSHAMWRSYNITEILKNASI  154

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRK------------GRNSNTMYITEIRLCYD  830
            LPS     T    ++ + +A   TP++ C+              R + +  + E+ LC+D
Sbjct  155  LPSATQTWTYSDIVSPIQKATKRTPLLRCKSLPQPKSQAKSQPKRQARSQLLHEVVLCFD  214

Query  831  ASAINLISCTQ  863
             +A+  I C +
Sbjct  215  YNALVHIDCNR  225



>ref|XP_002649213.1| ribonuclease T2 [Dictyostelium discoideum AX4]
 gb|EEU04137.1| ribonuclease T2 [Dictyostelium discoideum AX4]
Length=236

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 96/194 (49%), Gaps = 26/194 (13%)
 Frame = +3

Query  336  TWGSFYLSLF---WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS-----SGPAYVD  491
            T G F   LF   W   YC  + + C+ NK +E FTIHGLWP     S     +GP++  
Sbjct  35   TPGDFDYYLFVQQWIYSYC--SESKCIENKEREAFTIHGLWPNDRNNSYPAFCTGPSFDL  92

Query  492  GLINQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKIS----NSLLGEVDYFERAIQLYL  659
            G I+ DL D+L++ W +L  D N  FW  E+ KHG  +    + +  E DYF   ++LY 
Sbjct  93   GEIS-DLEDQLNVDWISLTED-NDLFWTSEYKKHGTCAVVAGSPISNEHDYFVAGLKLYT  150

Query  660  ATNVTTILANYGILPSDNSPTTLASVSQA----FGSTPIVVCRKGRNSNTMYITEIRLCY  827
              N+T+ L +  I PSD       S+S A    FG  P++ C   +      ++ I LC 
Sbjct  151  QHNLTSALISENIYPSDQDTYESDSISSAINSQFGGQPVMQCDNNK------LSTIALCI  204

Query  828  DASAINLISCTQAQ  869
            D   ++++ C +  
Sbjct  205  DKKTLSIMDCPEVD  218



>gb|ACV95496.1| ribonuclease [Oryza sativa Japonica Group]
Length=212

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 85/178 (48%), Gaps = 18/178 (10%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYV---------DGLINQDLRD  518
            WP  YC  +     P      FTIHGLWP   +   G  ++         D    QDL  
Sbjct  4    WPDSYCSTHKCLVKPPPPSH-FTIHGLWPSYNKLIDGKMWLEDCNKEDPLDPTQIQDLEK  62

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +LD  W +L++  N  FW  EW KHG  SN  LG+  YFE A+ L   TN+T ILA+ G+
Sbjct  63   QLDQKWPSLKQ-TNLEFWSLEWKKHGTCSN--LGQHAYFEAALALERLTNLTKILADGGV  119

Query  699  LPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCT  860
             PSD    T   +S A     G      C K +  +T+ ++E+R C D     LI+CT
Sbjct  120  GPSDVKTYTFREISDALARGTGFRTYFKCSKNKAGDTL-LSEVRQCVDRYGEKLINCT  176



>gb|ABJ97524.1| S-RNase, partial [Prunus webbii]
Length=165

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 81/161 (50%), Gaps = 11/161 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-LINQ-----DLRDRLD  527
            WPP  CI +   C  +     FTIHGLWP      + P+   G L N+      LR +L 
Sbjct  4    WPPTTCIRSRKPCSKHLPLPIFTIHGLWPSNYSNPTMPSNCIGSLFNESKLYPKLRSKLK  63

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG+ S  +L ++ YFER+  ++ + N+T IL N  I+P+
Sbjct  64   ISWPDVESGNDTQFWEGEWNKHGRCSKEMLNQMQYFERSHAMWNSHNITNILENAQIVPN  123

Query  708  DNSP----TTLASVSQAFGSTPIVVCRKG-RNSNTMYITEI  815
                      L  +  A   TP++ C+     SN+  + E+
Sbjct  124  ATRKWKYSDILTPIKAATKRTPLLRCKPDPAQSNSQLLHEV  164



>dbj|BAA34663.1| Sb-RNase [Prunus dulcis]
 gb|ABA26544.1| S-RNase [Prunus dulcis]
Length=231

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 87/184 (47%), Gaps = 20/184 (11%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G       ++  +R 
Sbjct  37   WPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTKPSNCNGSQFNFTKVSPKMRV  94

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L   W ++E   +  FWE EWNKHG  S   L ++ YFER+ +++ + N+T IL N  I
Sbjct  95   KLKRSWPDVESGNDTRFWEGEWNKHGTCSEGSLNQMQYFERSHEMWYSFNITEILKNASI  154

Query  699  LPSDNS----PTTLASVSQAFGSTPIVVCRKGRNSN-----TMYITEIRLCYDASAINLI  851
            +P           +A +  A   TP++ C+     N     T  + E+  CY+  A+  I
Sbjct  155  VPHPTQTWKYSDIVAPIKTATKRTPVLRCKPDPAQNKSGPKTQLLHEVVFCYEYHALKQI  214

Query  852  SCTQ  863
             C +
Sbjct  215  DCNR  218



>gb|AAZ57492.1| Sj'-RNase [Prunus dulcis]
Length=234

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 93/197 (47%), Gaps = 21/197 (11%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDRLDI  530
            WPP  C  +      ++  ++FTIHGLWP        P+   G     +++  L  +L  
Sbjct  36   WPPTTCRLSTKPSNKHRPLQNFTIHGLWPSNYPNPKMPSNCAGSQFKKILSPKLLTKLKR  95

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E+  +  FWE EWNKHG  S     ++ YF+R+ +++ + N+T IL N  I+PS 
Sbjct  96   SWPDVEKGNDTEFWESEWNKHGTCSEQTFNQMQYFKRSHEMWSSYNITDILKNASIVPSA  155

Query  711  NSPTTLASVSQAFG----STPIVVCR------KGRNS------NTMYITEIRLCYDASAI  842
                T + +  A      +TP++ C+      KG  +          + E+ LCYD +A+
Sbjct  156  TQTWTYSDIVSAIKTVTQTTPLLRCKPYPAQPKGHPAQRKSPPKPQLLHEVVLCYDYNAL  215

Query  843  NLISCTQAQLSCGTQPI  893
              I C +       +PI
Sbjct  216  KQIDCNRTAGCHNQKPI  232



>gb|ABY19369.1| S5-RNase [Prunus webbii]
Length=186

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 80/156 (51%), Gaps = 10/156 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-LIN-----QDLRDRLD  527
            WPP  C      C   +   +FTIHGLWP        P+   G L N       LR  L 
Sbjct  27   WPPTNCRVRNKPCTKPRPLLNFTIHGLWPSNYSNPRMPSKCTGSLFNFRKVYPQLRSDLK  86

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE+EWNKHG+ S   L ++ YFER+  ++++ N+T IL N  I+PS
Sbjct  87   ISWPDVESGNDTRFWENEWNKHGRCSEDSLNQMQYFERSHAMWISYNITEILKNASIVPS  146

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
                 T    ++ + +A   TP++ C+  +++  ++
Sbjct  147  ATQNWTYSDIVSPIKRATKRTPLLRCKYDKSTQLLH  182



>gb|ABW04804.1| S-RNase [Prunus dulcis]
Length=167

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 81/165 (49%), Gaps = 15/165 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------I  500
            F     WPP  C   I  P  C   +  + FTIHGLWP      + P+   G       +
Sbjct  2    FQFVQQWPPTNCRVRIKRP--CSKPRPLQYFTIHGLWPSNFSNPTKPSNCAGSQFDARNL  59

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
               +R +L I W ++E   +  FWE EWNKHGK S   L ++ YFER+  ++++ N+T I
Sbjct  60   APQMRTKLKISWPDVESGNDTKFWEGEWNKHGKCSKDRLNQMQYFERSHDMWMSHNITEI  119

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
            L N  I+P      T    +A +  A   TP++ C+  +N+  ++
Sbjct  120  LKNASIVPHPTQTWTYSDIVAPIKTATKRTPLLRCKWDKNTQLLH  164



>gb|AAZ57491.1| Sj-RNase [Prunus dulcis]
Length=234

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 93/197 (47%), Gaps = 21/197 (11%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDRLDI  530
            WPP  C  +      ++  ++FTIHGLWP        P+   G     +++  L  +L  
Sbjct  36   WPPTTCRLSTKPSNKHRPLQNFTIHGLWPSNYPNPKMPSNCAGSQFKKILSPKLLTKLKR  95

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E+  +  FWE EWNKHG  S     ++ YF+R+ +++ + N+T IL N  I+PS 
Sbjct  96   SWPDVEKGNDTEFWESEWNKHGTCSEQTFNQMQYFKRSHEMWSSYNITDILKNASIVPSA  155

Query  711  NSPTTLASVSQAFG----STPIVVCR------KGRNS------NTMYITEIRLCYDASAI  842
                T + +  A      +TP++ C+      KG  +          + E+ LCYD +A+
Sbjct  156  TQTWTYSDIVSAIKTVTQTTPLLRCKPYPAQPKGHPAQRKSPPKPQLLHEVVLCYDYNAL  215

Query  843  NLISCTQAQLSCGTQPI  893
              I C +       +PI
Sbjct  216  KQIDCNRTAGCHNQKPI  232



>gb|AAL59324.1|AF454003_1 RNase [Prunus dulcis]
Length=165

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 82/163 (50%), Gaps = 15/163 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------LRD  518
            WPP  C   I  P  C   +  ++FTIHGLWP      + P+  +G   +D      LR 
Sbjct  4    WPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGAKYEDRKVYPKLRS  61

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++L+ N+T IL N  I
Sbjct  62   KLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFEVSHDMWLSYNITEILRNASI  121

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            +P      T    ++ +  A   TP++ C+    +NT  + E+
Sbjct  122  VPHPTQTWTYSDIVSPIKAATKRTPLIRCKIDTATNTQLLHEV  164



>emb|CDY33761.1| BnaA09g45670D [Brassica napus]
Length=227

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 76/182 (42%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQS-----SGPAYVDGLINQ  506
            FY  L WP  YC    A C P   K   DF IHGLWP     S        +  D     
Sbjct  30   FYFVLQWPGAYCDTKRACCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPDSEFDPAEIS  89

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   +   W  L    N    FWEHEW KHG  S S++ +  YFE  + L    N+  I
Sbjct  90   DLVSTMQTKWPTLSCPSNNGSKFWEHEWEKHGTCSESVMDQHKYFENTLALRDRVNLLQI  149

Query  681  LANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L + GI P D   +      ++    G TP++ C K    N+  + EI  C D S    I
Sbjct  150  LQDAGINPDDEFYDLQDIKNAIKDGTGFTPVIHCNKDPEKNSQ-LHEIFFCVDTSGTEFI  208

Query  852  SC  857
             C
Sbjct  209  EC  210



>gb|AAG09465.1|AF227522_1 S-like ribonuclease [Prunus dulcis]
Length=227

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 88/184 (48%), Gaps = 17/184 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQSSGPAYVD--GLINQ---  506
            FY    WP  YC      C P   K   DF IHGLWP   +  S P+  D   + ++   
Sbjct  30   FYFVQQWPGAYCDTKQTCCYPKSGKPSADFGIHGLWP-NYKDGSYPSNCDPDSVFDKSEI  88

Query  507  -DLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
             +L   L+  W +L    +  F  W HEW KHG  S S L + DYFE A++L    N+  
Sbjct  89   SELTSNLEKNWPSLTCPSSNGFRFWSHEWEKHGTCSESELDQKDYFEAALKLKQKVNLLQ  148

Query  678  ILANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDASAIN  845
            IL   GI+P D+   +L S+ +A     G TP + C K    N+  + ++ LC D S  +
Sbjct  149  ILKTAGIVP-DDGMYSLESIKEAIKEGAGYTPGIECNKDSAGNSQ-LYQVYLCVDTSGQD  206

Query  846  LISC  857
            +I C
Sbjct  207  IIEC  210



>dbj|BAB84687.1| Sa-RNase [Prunus cerasus]
 gb|ABW17266.1| S36a-RNase [Prunus cerasus]
 gb|ABW17267.1| S36b-RNase [Prunus cerasus]
 gb|ABW17269.1| S36b3-RNase [Prunus cerasus]
Length=237

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 85/188 (45%), Gaps = 22/188 (12%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C  +   C   +  + FTIHGLWP        P+   G       +   LR  L 
Sbjct  39   WPPATCSLSRTPCYKPRPPQIFTIHGLWPSNYSNPKRPSNCRGSLFDSRKVYPQLRLNLK  98

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W N++   +  FWE EWNKHG+ S   L ++ YFER+ +++ + N+T IL    I+P+
Sbjct  99   ISWPNVKSGNDTEFWESEWNKHGRCSEQTLNQMQYFERSDEMWNSYNITEILKKAQIVPN  158

Query  708  DNS----PTTLASVSQAFGSTPIVVCR------KGRNS------NTMYITEIRLCYDASA  839
                      L+ +  A  +TPI+ C+      K + S          + E+  CYD  A
Sbjct  159  ATRTWKYSDILSPIKAATNTTPILRCKPDPAQSKSQPSQPKSPQKPQLLHEVVFCYDYHA  218

Query  840  INLISCTQ  863
               I C +
Sbjct  219  KKQIDCNR  226



>dbj|BAF56282.1| S-RNase [Prunus speciosa]
Length=182

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 75/153 (49%), Gaps = 10/153 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQD  509
            F     WPP  CI +   C  ++  + FTIHGLWP    + + P    G       ++  
Sbjct  2    FQFVQQWPPATCIRSTRPCSKHRPLQIFTIHGLWPSNYSKPTMPGNCVGSEFKMDNLSPK  61

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L I W ++ER  +  FWE EW KHG  S   L +  YF+R+  ++ + N+T IL N
Sbjct  62   LRSKLKISWPDVERSNDTEFWEGEWTKHGTCSEQALNQFQYFQRSDSMWRSHNITEILKN  121

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCR  776
              I+P           ++ + +A   TP++ C+
Sbjct  122  ASIVPHPTQTWSYSDIVSPIKKATKRTPLLRCK  154



>dbj|BAF56265.1| S-RNase [Prunus speciosa]
Length=167

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 77/156 (49%), Gaps = 10/156 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRDRLD  527
            WPP  C      C   +  + FTIHGLWP        P+   G       +   +R +L 
Sbjct  8    WPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNYSNPRRPSNCAGSPFNFTKVYPHMRSKLK  67

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++++ N+T IL N  I+P 
Sbjct  68   ISWPDVESGNDTKFWEGEWNKHGTCSEERLNQMQYFERSHDMWMSYNITEILKNASIVPH  127

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMY  803
                      ++ + +A G TP++ C+  +++  ++
Sbjct  128  PTQTWKYSDIVSPIKKATGRTPLLRCKYDKSTQLLH  163



>emb|CAQ51498.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=167

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 83/165 (50%), Gaps = 15/165 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWP------QTTQQSSGPAYVDGLI  500
            F     WPP  C   I  P  C   +  ++FTIHGLWP      +   + +G  Y    +
Sbjct  1    FQFVQQWPPTNCRVRIKKP--CSNPRPLQNFTIHGLWPSNYSNPKMPSKCTGSQYKKENV  58

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
               L+ +L I W ++E   +  FWE EWNKHG  S   L +V YF+R+  ++ + NVT I
Sbjct  59   YPQLQSKLKISWPDVESGNDTRFWESEWNKHGTCSEQTLNQVKYFQRSHAMWRSHNVTDI  118

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
            L N  I+PS     T    ++ +  A G TP++ C+  +++  ++
Sbjct  119  LKNASIVPSATQTWTYSDIISPIKAATGRTPLLRCKYDKSTQLLH  163



>gb|ABK28493.1| unknown [Arabidopsis thaliana]
Length=231

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 83/185 (45%), Gaps = 19/185 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQ-------TTQQSSGPAYVDGLI  500
            FY    WP  YC      C PN  K   DF IHGLWP        +   +S P   D   
Sbjct  33   FYFVQQWPGSYCDTQKKCCYPNSGKPAADFGIHGLWPNYKDGTYPSNCDASKP--FDSST  90

Query  501  NQDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
              DL   +   W  L        AFWEHEW KHG  S S++ + +YF+ A+ L   TN+ 
Sbjct  91   ISDLLTSMKKSWPTLACPSGSGEAFWEHEWEKHGTCSESVIDQHEYFQTALNLKQKTNLL  150

Query  675  TILANYGILPSDNS---PTTLASVSQAFGSTPIVVC-RKGRNSNTMYITEIRLCYDASAI  842
              L   GI P   S    +   S+ ++ G TP V C R G  ++ +Y  ++ LC D S  
Sbjct  151  GALTKAGINPDGKSYSLESIRDSIKESIGFTPWVECNRDGSGNSQLY--QVYLCVDRSGS  208

Query  843  NLISC  857
             LI C
Sbjct  209  GLIEC  213



>ref|XP_007207578.1| hypothetical protein PRUPE_ppa018459mg [Prunus persica]
 dbj|BAF42770.1| S2-RNase [Prunus persica]
 gb|EMJ08777.1| hypothetical protein PRUPE_ppa018459mg [Prunus persica]
Length=226

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 88/182 (48%), Gaps = 18/182 (10%)
 Frame = +3

Query  366  WPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG--LINQDL----RDRL  524
            WPP  C +     C   +  + FTIHGLWP        P+   G     Q+L    + +L
Sbjct  37   WPPTNCRVRVKRPCSNPRPLQYFTIHGLWPSNYSNPKMPSNCTGSQFKKQNLYPYMQSKL  96

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L  + YF+R+  ++ + N+T IL N  I+P
Sbjct  97   KISWPDVESGNDTKFWEGEWNKHGTCSERTLNLMQYFQRSHAMWKSHNITEILKNASIVP  156

Query  705  SDNSPTTL-------ASVSQAFGSTPIVVCRKGR-NSNTMYITEIRLCYDASAINLISCT  860
                PT         + + +A   TP++ C++    +NT  + E+  CY+  A+ LI C 
Sbjct  157  ---HPTKTWKYSDIESPIKRATKRTPVLRCKRDPVQANTQLLHEVVFCYEYDALKLIDCN  213

Query  861  QA  866
            + 
Sbjct  214  RT  215



>ref|NP_178399.1| ribonuclease 1 [Arabidopsis thaliana]
 sp|P42813.1|RNS1_ARATH RecName: Full=Ribonuclease 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC48925.1| ribonuclease [Arabidopsis thaliana]
 gb|AAC32917.1| ribonuclease, RNS1 [Arabidopsis thaliana]
 gb|AAL62405.1| ribonuclease, RNS1 [Arabidopsis thaliana]
 gb|AAM48029.1| ribonuclease RNS1 [Arabidopsis thaliana]
 gb|ABE65814.1| ribonuclease 1 [Arabidopsis thaliana]
 gb|AEC05652.1| ribonuclease 1 [Arabidopsis thaliana]
Length=230

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 83/185 (45%), Gaps = 19/185 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQ-------TTQQSSGPAYVDGLI  500
            FY    WP  YC      C PN  K   DF IHGLWP        +   +S P   D   
Sbjct  33   FYFVQQWPGSYCDTQKKCCYPNSGKPAADFGIHGLWPNYKDGTYPSNCDASKP--FDSST  90

Query  501  NQDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
              DL   +   W  L        AFWEHEW KHG  S S++ + +YF+ A+ L   TN+ 
Sbjct  91   ISDLLTSMKKSWPTLACPSGSGEAFWEHEWEKHGTCSESVIDQHEYFQTALNLKQKTNLL  150

Query  675  TILANYGILPSDNS---PTTLASVSQAFGSTPIVVC-RKGRNSNTMYITEIRLCYDASAI  842
              L   GI P   S    +   S+ ++ G TP V C R G  ++ +Y  ++ LC D S  
Sbjct  151  GALTKAGINPDGKSYSLESIRDSIKESIGFTPWVECNRDGSGNSQLY--QVYLCVDRSGS  208

Query  843  NLISC  857
             LI C
Sbjct  209  GLIEC  213



>dbj|BAA95157.1| Sa-RNase [Prunus salicina]
Length=208

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 88/182 (48%), Gaps = 18/182 (10%)
 Frame = +3

Query  366  WPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG--LINQDL----RDRL  524
            WPP  C +     C   +  + FTIHGLWP        P+   G     Q+L    + +L
Sbjct  19   WPPTNCRVRVKRPCSNPRPLQYFTIHGLWPSNYSNPRMPSNCTGSQFKKQNLYPYMQSKL  78

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L  + YF+R+  ++ + N+T IL N  I+P
Sbjct  79   KISWPDVESGNDTKFWEGEWNKHGTCSERTLNLMQYFQRSHAMWKSHNITEILKNASIVP  138

Query  705  SDNSPTTL-------ASVSQAFGSTPIVVCRKGR-NSNTMYITEIRLCYDASAINLISCT  860
                PT         + + +A   TP++ C++    +NT  + E+  CY+  A+ LI C 
Sbjct  139  ---HPTQTWKYSDIESPIKRATKRTPVLRCKRDPVQANTQLLHEVVFCYEYDALKLIDCN  195

Query  861  QA  866
            + 
Sbjct  196  RT  197



>dbj|BAF56272.1| S-RNase [Prunus speciosa]
Length=174

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 75/153 (49%), Gaps = 10/153 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQD  509
            F     WPP  CI +   C  ++  + FTIHGLWP        P+      + +  +   
Sbjct  2    FQFVQQWPPATCIRSTKPCSKHRPLQIFTIHGLWPSNYSNPKMPSNCVGSQFNESKLYPQ  61

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR RL   W ++E   +  FWE EWNKHG  S  +L ++ YFER+ +++ + N+T IL N
Sbjct  62   LRSRLKRSWPDVESGNDTKFWEGEWNKHGTCSEQILDQIQYFERSHEMWNSFNITHILKN  121

Query  690  YGILPSDNSPTTLASVSQAFGS----TPIVVCR  776
              I+PS       + +  A  +    TP + C+
Sbjct  122  ASIVPSATQTWKYSDIVSAIKAVTKRTPALRCK  154



>gb|ABW04805.1| S-RNase [Prunus dulcis]
Length=170

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 83/169 (49%), Gaps = 15/169 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD---  509
            F     WPP  C   I  P  C   +  ++FTIHGLWP      + P+  +G   +D   
Sbjct  2    FQFVQQWPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGAKYEDRKV  59

Query  510  ---LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
               LR +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++L+ N+T I
Sbjct  60   YPKLRSKLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFEVSHDMWLSYNITEI  119

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            L N  I+P      T    ++ +  A   TP++ C+    +NT  + E+
Sbjct  120  LRNASIVPHPTQTWTYSDIVSPIKAATKRTPLIRCKIDTATNTELLHEV  168



>gb|AAK58580.1|AF267513_1 Sj-RNase [Prunus dulcis]
Length=165

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 80/159 (50%), Gaps = 15/159 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+   G       +   +R 
Sbjct  6    WPPTNCRVRIKRP--CSKPRPLQYFTIHGLWPSNFSNPTKPSNCAGSQFDARNLAPQMRT  63

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L I W ++E   +  FWE EWNKHGK S   L ++ YFER+  ++++ N+T IL N  I
Sbjct  64   KLKISWPDVESGNDTKFWEGEWNKHGKCSKDRLNQMQYFERSHDMWMSHNITEILKNASI  123

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
            +P      T    +A +  A   TP++ C+  +N+  ++
Sbjct  124  VPHPTQTWTYSDIVAPIKTATKRTPLLRCKWDKNTQLLH  162



>gb|AAP92438.1| S-RNase [Prunus avium]
Length=228

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 91/179 (51%), Gaps = 15/179 (8%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRD  518
            WPP  C   I  P  C   +  +  TIHGLWP      + P+  +GL      ++ +++ 
Sbjct  39   WPPTNCRVRIKRP--CSNPRPLQYSTIHGLWPSNYSNPTKPSNCNGLKFEAKKLSPEMQT  96

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L   W ++E   +  FWE EWNKHGK S   L ++ YFER+  ++ + N+T IL N  I
Sbjct  97   KLKKSWPDVESGNDTKFWEGEWNKHGKCSEQTLNQMQYFERSFAMWKSYNITEILKNASI  156

Query  699  LPSDNSP---TTLASVSQAF-GSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
            +P        + +AS  +A   +TP++ C++   +    + E+ LC D + +  I C +
Sbjct  157  VPHPTQTWKYSDIASPIKAVTKTTPLLRCKRDHPNKPELLHEVVLCLDYNGLIQIDCNR  215



>emb|CDP00340.1| unnamed protein product [Coffea canephora]
Length=231

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 93/194 (48%), Gaps = 19/194 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQS------SGPAYVDGLIN  503
            FYL   WP  YC    + C P   K  EDF+IHGLWP     S       G ++ +  ++
Sbjct  30   FYLVQQWPASYCGTKRSCCYPTTGKPAEDFSIHGLWPNRNDGSWPSNCDEGSSFDESEVS  89

Query  504  QDLRDRLDIYWSNL---ERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
             DL  R+   W +L     D  R FW HEW KHG  + SLL E  YF+ A+ L   +N+ 
Sbjct  90   -DLVKRMQQEWPSLACPSSDGVR-FWSHEWEKHG--TCSLLNEHQYFQTALDLKDKSNLL  145

Query  675  TILANYGILPSD--NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
             +L + GI P    +      ++ Q  G TP + C   +  N   + ++ LC D+SA + 
Sbjct  146  QVLKDAGIRPGKFYSLEKIKEAIQQGVGYTPFIECNVDQGGNRQ-LYQVYLCVDSSASDF  204

Query  849  ISC-TQAQLSCGTQ  887
            I C T     CG++
Sbjct  205  IECPTFPHGRCGSE  218



>emb|CAQ51501.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=167

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 82/165 (50%), Gaps = 15/165 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLI  500
            F     WPP  C   I  P  C   +  ++FTIHGLWP      + P+      Y D  +
Sbjct  1    FQFVQQWPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGSKYEDRKV  58

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
               LR +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++++ N+T I
Sbjct  59   YPKLRSKLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFEISHDMWVSYNITEI  118

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
            L N  I+P      T    L+ +  A   TP++ C++ +N+  ++
Sbjct  119  LKNASIVPHPTKTWTYSDILSPIQAATNRTPLLRCKQDKNTQLLH  163



>ref|XP_006438699.1| hypothetical protein CICLE_v10032674mg [Citrus clementina]
 gb|ESR51939.1| hypothetical protein CICLE_v10032674mg [Citrus clementina]
Length=226

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 89/193 (46%), Gaps = 16/193 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQSSGPAYVD--GLINQ---  506
            FY    WP  YC    + C P   K   DF IHGLWP+  +  S P+  D  G+  +   
Sbjct  29   FYFVQQWPGSYCDTKQSCCYPKSGKPAADFGIHGLWPEY-KDGSYPSNCDPDGVFEKSQI  87

Query  507  -DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
             DL   L   W  L    N    FW HEW KHG  + S L + +YFE A++L    N+  
Sbjct  88   SDLISDLRQNWPTLSCPSNDGTKFWTHEWVKHGTCAESELDQREYFEAALKLKEKANLLQ  147

Query  678  ILANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
             L N GI P D      + +A++ +A G TP + C      N+  + +I +C D SA   
Sbjct  148  ALKNAGIKPDDGFYELESIIAAIKEATGFTPGIECNVDPEHNSQ-LYQIYMCVDTSASEF  206

Query  849  ISC-TQAQLSCGT  884
            I C  Q +  C +
Sbjct  207  IQCPKQPRKKCAS  219



>gb|ABG76219.1| S-RNase [Prunus spinosa]
Length=204

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 87/187 (47%), Gaps = 13/187 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQD  509
            F     WPP  C      C   +  + FTIHGLWP      + P+      + +  ++  
Sbjct  12   FQFVQQWPPTTCRVR-GKCSNPRPIQIFTIHGLWPSNYSNPTMPSNCIGSQFNESRVSPR  70

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L   W N+E   +  FW  EWNKHG+ S   L +V YFER+ +++   N+T IL  
Sbjct  71   LRSKLKRSWPNVEGSNDTRFWAGEWNKHGRCSEQTLNQVQYFERSHEMWHFHNITGILKK  130

Query  690  YGILPSDNSPTTLASVSQAFG----STPIVVCRKGRNSNTMYITEIRLCYDASAINLISC  857
              I+P      T + +  A      +TP++ C+    S  ++  E+ LC + +A+  I C
Sbjct  131  ASIVPHPTQTWTYSDIVSAIKAVTQTTPLLRCKVQAQSQLLH--EVVLCLEYNALKQIDC  188

Query  858  TQAQLSC  878
             +    C
Sbjct  189  NRTAGIC  195



>emb|CAN90136.1| self-incompatibility ribonuclease [Prunus domestica]
Length=169

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 82/167 (49%), Gaps = 11/167 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQ  506
            F     WPP  C +     C   +  ++FTIHGLWP      + P+      Y D  +  
Sbjct  1    FQFVQQWPPTNCRVRLKRPCSKPRPLQNFTIHGLWPSNFSNPTKPSNCNGSKYEDRKVYP  60

Query  507  DLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILA  686
             LR +L   W ++E   +  FWE EWNKHG+ S  +L ++ YFE +  ++L+ N+T IL 
Sbjct  61   KLRSKLKRSWPDVESGNDTRFWEGEWNKHGRCSEQILNQMQYFEVSHDMWLSYNITEILR  120

Query  687  NYGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            N  I+P      T    ++ +  A   TP++ C+    +NT  + E+
Sbjct  121  NASIVPHPTQTWTYSDIVSPIKAATKRTPLLRCKIDTATNTELLHEV  167



>ref|XP_008235627.1| PREDICTED: ribonuclease S-7-like [Prunus mume]
Length=237

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 87/165 (53%), Gaps = 13/165 (8%)
 Frame = +3

Query  369  PPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQ----QSSGPAYVDGLINQDLRDRLDIYW  536
            P  +C+ N   C P      FTIHGLWP          SG  +   ++  DL  RL+  W
Sbjct  48   PSVFCLNN-TDCKP--PPPIFTIHGLWPSNKSGYIGNCSGDNFNISVMTSDLVARLNDSW  104

Query  537  SNLER-DPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP-SD  710
             +L+R   N  FW++E+NKHGK SN L  +  YFE A  L+       + +N+ ILP S 
Sbjct  105  PSLKRSKENLDFWKYEYNKHGKCSNDLFSQTKYFEHAWHLWNKYKAHDLFSNHSILPDSP  164

Query  711  NSPTTLASVSQAF--GSTPIVVCRKGRNSNTMYITEIRLCYDASA  839
            ++ +TL    ++F  G  P++ C+  RN+   Y+ E+R+C+D  A
Sbjct  165  HNYSTLEKAIRSFINGCKPLLRCK--RNATNQYLLEVRICFDKKA  207



>emb|CAC27788.1| RNase S5 [Prunus avium]
Length=226

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 85/178 (48%), Gaps = 13/178 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  C        P  + + FTIHGLWP        P+      + +  +   LR +L 
Sbjct  37   WPPTNCRVRTKCSNPRPL-QYFTIHGLWPSNYSNPKMPSNCIGSQFNESKVYPRLRSKLR  95

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FW  EWNKHG  S  +L +  YFER+ Q++ + N+T IL    I+P+
Sbjct  96   ISWPDVESGNDTKFWGDEWNKHGTCSQRILNQFQYFERSQQMWRSYNITNILKKAQIVPN  155

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNS--NTMYITEIRLCYDASAINLISCTQ  863
                      ++ +  A   TP++ C+    S  N   + E+ LC+D +A+  I C +
Sbjct  156  ATQTWSYSDIVSPIKTATNRTPLLRCKSQPKSQANFQLLHEVVLCFDYNALVHIDCNR  213



>gb|ACF93804.1| S4-RNase [Prunus simonii]
Length=183

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 80/154 (52%), Gaps = 8/154 (5%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG----LINQDLRDRLDIY  533
            WPP  C  +      ++  ++FTIHGLWP      + P+  +G    ++   L  +L I 
Sbjct  26   WPPTTCRLSSKPRYKHRPLQNFTIHGLWPSNYSNPTKPSNCNGSQFKILPPQLISKLKIS  85

Query  534  WSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSDN  713
            W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++ + N+T IL N  I+PS  
Sbjct  86   WPDVESGNDTRFWEGEWNKHGSCSEQTLNQLQYFERSYSMWKSYNITEILKNASIIPSAT  145

Query  714  S----PTTLASVSQAFGSTPIVVCRKGRNSNTMY  803
                    ++++  A   TP++ C+  +N+  ++
Sbjct  146  QTWKYSDIVSAIKTATKRTPLLRCKWDKNTQLLH  179



>gb|ACU25554.1| self-incompatibility associated ribonuclease S4 [Prunus pseudocerasus]
Length=247

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 94/203 (46%), Gaps = 33/203 (16%)
 Frame = +3

Query  348  FYLSLFWPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLI  500
            F     WPP  C   I  P  C   +  + FTIHGLWP      + P+      + +  +
Sbjct  33   FQFVQQWPPTNCRVRIKRP--CSNPRPLQIFTIHGLWPSNYSNPTMPSNCIGSQFNETKL  90

Query  501  NQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            +  LR++L   W N+E   +   WEHEWNKHG  +   L ++ YF+R+  ++   ++T I
Sbjct  91   SPKLRNKLKRSWPNVESGNDTELWEHEWNKHGTCAEQTLNQMQYFQRSHGMWYPHSITEI  150

Query  681  LANYGILPSDNSPTT----LASVSQAFGSTPIVVCR---------KGRNS---------N  794
            L N  I+PS N   T    ++ + +A   TP++ C+         +G  S          
Sbjct  151  LKNASIVPSPNQTWTYSDIVSPIKKAIRRTPLLRCKPVPALPKSQRGPKSQRAQPNSRPQ  210

Query  795  TMYITEIRLCYDASAINLISCTQ  863
            +  + E+  CYD  A+ LI C +
Sbjct  211  SQLLHEVVYCYDYDALKLIDCNR  233



>emb|CDP00341.1| unnamed protein product [Coffea canephora]
Length=236

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 83/183 (45%), Gaps = 15/183 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQSSGPAYVDGLIN------  503
            FY    WP  YC +    C P   K   DF+IHGLWP      S P+  D          
Sbjct  39   FYFVQQWPGSYCDSKQGCCYPITGKPASDFSIHGLWPNYND-GSYPSNCDPQAQFNPSQI  97

Query  504  QDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
             DL  R+   W +L        +FW HEW KHG  S S+L + DYF  A+ L   +N+  
Sbjct  98   SDLTSRMQKDWPSLSCPSSDGLSFWSHEWEKHGTCSESILDQHDYFASALLLKRQSNLLQ  157

Query  678  ILANYGILPSDNSPT---TLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            IL N GI P+    +     A++    G TP + C    + N+  + +I +C D S  NL
Sbjct  158  ILKNAGIQPNGQYYSLDGIKAAIRGGIGHTPYIECNVDPSGNSQ-LYQIYVCVDTSGSNL  216

Query  849  ISC  857
            I C
Sbjct  217  IEC  219



>pdb|1V9H|A Chain A, Crystal Structure Of The Rnase Mc1 Mutant Y101a In Complex 
With 5'-Ump
Length=197

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 85/191 (45%), Gaps = 10/191 (5%)
 Frame = +3

Query  345  SFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS----SGPAYVDGLINQDL  512
            SF+    WPP  C    +G  P      FTIHGLWPQ +  S     G  +    I+  L
Sbjct  10   SFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQQSGTSLTNCPGSPFDITKISH-L  68

Query  513  RDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANY  692
            + +L+  W N+ R  N+ FW HEW KHG  S S   +   F+ A+ +    ++   L  +
Sbjct  69   QSQLNTLWPNVLRANNQQFWSHEWTKHGTCSESTFNQAAAFKLAVDMRNNYDIIGALRPH  128

Query  693  GILPSDNSPTTLA---SVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
               P+  + +  A    +   FG  P + CR    +   Y+ E+  C+      LI CT+
Sbjct  129  AAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVEVVACFAQDGSTLIDCTR  188

Query  864  AQLSCGTQPIY  896
               +CG   I+
Sbjct  189  D--TCGANFIF  197



>dbj|BAF42764.1| Sa-RNase [Prunus salicina]
Length=226

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 88/182 (48%), Gaps = 18/182 (10%)
 Frame = +3

Query  366  WPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG--LINQDL----RDRL  524
            WPP  C +     C   +  + FTIHGLWP        P+   G     Q+L    + +L
Sbjct  37   WPPTNCRVRVKRPCSNPRPLQYFTIHGLWPSNYSNPRMPSNCTGSQFKKQNLYPYMQSKL  96

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L  + YF+R+  ++ + N+T IL N  I+P
Sbjct  97   KISWPDVESGNDTKFWEGEWNKHGTCSERTLNLMQYFQRSHAMWKSHNITEILKNASIVP  156

Query  705  SDNSPTTL-------ASVSQAFGSTPIVVCRKGR-NSNTMYITEIRLCYDASAINLISCT  860
                PT         + + +A   TP++ C++    +NT  + E+  CY+  A+ LI C 
Sbjct  157  ---HPTQTWKYSDIESPIKRATKRTPVLRCKRDPVQANTQLLHEVVFCYEYDALKLIDCN  213

Query  861  QA  866
            + 
Sbjct  214  RT  215



>emb|CAJ77737.1| ribonuclease S26 precursor [Prunus dulcis]
Length=187

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 81/157 (52%), Gaps = 11/157 (7%)
 Frame = +3

Query  366  WPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRL  524
            WPP  C +     C   +  ++FTIHGLWP      + P+  +G       +   +R +L
Sbjct  27   WPPTNCRVRVKRPCSNPRPLQNFTIHGLWPSNYSNPTKPSNCNGTKFDARKVYPHMRSKL  86

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L +  YFER+ +++ + N+T IL N  I+P
Sbjct  87   KISWPDVESGNDTRFWEGEWNKHGTCSEQTLNQFQYFERSHEMWYSFNITEILRNASIVP  146

Query  705  SDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
            +     T    ++ +  A G TP++ C++ + +  ++
Sbjct  147  NATQTWTYSDIVSPIKTATGRTPLLRCKQDKKTQLLH  183



>gb|AAZ57490.1| Si-RNase [Prunus dulcis]
Length=198

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 14/162 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD-----LRDR  521
            WPP  C   I  P  C   +  ++FTIHGLWP      + P+  +G   +D     LR +
Sbjct  37   WPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGAKYEDRKVPKLRSK  94

Query  522  LDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGIL  701
            L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++L+ N+T IL N  I+
Sbjct  95   LKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFEVSHDMWLSYNITEILRNASIV  154

Query  702  PSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            P      T    ++ +  A   TP++ C+    +NT  + E+
Sbjct  155  PHPTQTWTYSDIVSPIKAATKRTPLIRCKIDTATNTELLHEV  196



>gb|ABG76209.1| S-RNase [Prunus spinosa]
Length=203

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 86/183 (47%), Gaps = 13/183 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQD  509
            F     WPP  C        P  + + FTIHGLWP        P+      + +  +   
Sbjct  12   FQFVQQWPPTNCRVRTKCSNPRPL-QYFTIHGLWPSNYSNPKMPSNCIGSQFNESRVYPY  70

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L I W ++E   +  FWE EWNKHG  S  +L ++ YF+R+  ++ + N++ IL N
Sbjct  71   LRPKLKISWPDVESGNDTKFWEGEWNKHGTCSERILNQMQYFQRSQAMWRSHNISEILKN  130

Query  690  YGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISC  857
              I+P      T    ++ +  A   TP++ C+  + +  ++  E+  CY   A+  I C
Sbjct  131  ASIVPHPTQTWTYSDIVSPIKTATKRTPLLRCKYDKKTQLLH--EVVFCYGYKALKHIDC  188

Query  858  TQA  866
             + 
Sbjct  189  NRT  191



>gb|ABV02073.1| S-locus S-RNase S1 [Prunus spinosa]
Length=225

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 88/182 (48%), Gaps = 11/182 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG--LINQDLRDRLDIY--  533
            WPP  C        P  + ++FTIHGLWP      + P+   G     ++L  +L +   
Sbjct  35   WPPTTCRIRKKCSKPRPL-QNFTIHGLWPSNYSNPTMPSKCLGSQFKEENLSPKLLLKLK  93

Query  534  --WSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
              W N+E   +  FWE EW KHG  S   L ++ YF+R+ +++ + N+T IL N  I+PS
Sbjct  94   RSWPNVEGGNDTRFWEGEWKKHGTCSEQTLTQMQYFQRSHEMWNSFNITEILKNASIVPS  153

Query  708  DNSP----TTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQAQLS  875
                       A +  A   TP++ C++   +NT  + E+  CY  +AI  I C +   +
Sbjct  154  ATQKWKYSDIAAPIKTATKRTPLLRCKRDPATNTELLHEVVFCYGYNAIKQIDCNRGYPT  213

Query  876  CG  881
             G
Sbjct  214  AG  215



>ref|XP_010462695.1| PREDICTED: ribonuclease 3-like [Camelina sativa]
Length=201

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 88/199 (44%), Gaps = 17/199 (9%)
 Frame = +3

Query  345  SFYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQSSGPAYVDGLIN-----  503
            S+ +   WP  YC    + C P   K   DF IHGLWP     SS P+  D         
Sbjct  3    SYGICSCWPGAYCDTKSSCCYPTSGKPAADFGIHGLWPNYNS-SSWPSNCDPDSKFDRSQ  61

Query  504  -QDLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
             +DL   +   W  L    N  F  W+HEW KHG  + S++ + +YFE A++L    N+ 
Sbjct  62   IEDLLSSMKKNWPTLSCPSNEGFKFWKHEWEKHGTCAESVMDQHEYFENALKLKEKANLL  121

Query  675  TILANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAIN  845
             IL N GI P D   +      ++    G TP + C K R  N   + +I +C D S   
Sbjct  122  QILTNSGINPDDGFYDLKNITNTIKDGIGYTPGLQCNKDRERN-FQLYQIYICVDTSGTE  180

Query  846  LISCTQAQLSCGTQPIYLK  902
             I C    L  GT P  L+
Sbjct  181  FIEC--PVLPKGTCPSKLQ  197



>emb|CAM84228.1| ribonuclease [Prunus webbii]
Length=183

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 79/154 (51%), Gaps = 8/154 (5%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG----LINQDLRDRLDIY  533
            WPP  C  +      ++  + FTIHGLWP        P+  +G     +   LR++L I 
Sbjct  27   WPPTTCRLSSKPSNQHRPLQRFTIHGLWPSNYSNPRKPSNCNGSRFNKVYPQLRNKLKIS  86

Query  534  WSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSDN  713
            W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++++ N+T IL N  I+P   
Sbjct  87   WPDVEGGNDTKFWEGEWNKHGTCSEERLNQMQYFERSHNMWMSYNITEILKNASIVPHPT  146

Query  714  S----PTTLASVSQAFGSTPIVVCRKGRNSNTMY  803
                    ++ +  A G TP++ C+  +++  ++
Sbjct  147  QTWKYSDIVSPIKTATGRTPLLRCKYDKSTQLLH  180



>gb|ACD31530.1| S-RNase [Prunus armeniaca]
Length=203

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 87/183 (48%), Gaps = 13/183 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQD  509
            F     WPP  C        P  + + FTIHGLWP        P+      + +  +   
Sbjct  12   FQFVQQWPPTNCRVRTKCSNPRPL-QYFTIHGLWPSNYSNPKMPSNCIGSQFNESRVYPY  70

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L I W ++E   +  FWE EWNKHG  S  +L ++ YF+R+  ++ + N++ IL N
Sbjct  71   LRPKLKISWPDVESGNDTKFWEGEWNKHGTCSERILNQMQYFQRSQAMWKSHNISEILKN  130

Query  690  YGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISC  857
              I+P      T    ++ +  A   TP++ C+  + +  ++  E+  CY  +A+  I C
Sbjct  131  ASIVPHPTQTWTYSDIVSPIKTATKRTPLLRCKYDKKTQLLH--EVVFCYGYNALKHIDC  188

Query  858  TQA  866
             + 
Sbjct  189  NRT  191



>gb|AAM63798.1| ribonuclease, RNS1 [Arabidopsis thaliana]
Length=230

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 82/185 (44%), Gaps = 19/185 (10%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQ-------TTQQSSGPAYVDGLI  500
            FY    WP  YC      C PN  K   DF IHGLWP        +    S P   D   
Sbjct  33   FYFVQQWPGSYCDTQKKCCYPNSGKPAADFGIHGLWPNYKDGTYPSNCDDSKP--FDSST  90

Query  501  NQDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
              DL   +   W  L        AFWEHEW KHG  S S++ + +YF+ A+ L   TN+ 
Sbjct  91   ISDLLTSMKKSWPTLACPSGSGEAFWEHEWEKHGTCSESVIDQHEYFQTALNLKQKTNLL  150

Query  675  TILANYGILPSDNS---PTTLASVSQAFGSTPIVVC-RKGRNSNTMYITEIRLCYDASAI  842
              L   GI P   S    +   S+ ++ G TP V C R G  ++ +Y  ++ LC D S  
Sbjct  151  GALTKAGINPDGKSYSLESIRDSIKESIGFTPWVECNRDGSGNSQLY--QVYLCVDRSGS  208

Query  843  NLISC  857
             LI C
Sbjct  209  GLIEC  213



>pdb|1UCG|A Chain A, Crystal Structure Of Ribonuclease Mc1 N71t Mutant
 pdb|1UCG|B Chain B, Crystal Structure Of Ribonuclease Mc1 N71t Mutant
Length=190

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 85/191 (45%), Gaps = 10/191 (5%)
 Frame = +3

Query  345  SFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQS----SGPAYVDGLINQDL  512
            SF+    WPP  C    +G  P      FTIHGLWPQ +  S     G  +    I+  L
Sbjct  3    SFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQQSGTSLTNCPGSPFDITKISH-L  61

Query  513  RDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANY  692
            + +L+  W  + R  N+ FW HEW KHG  S S   +  YF+ A+ +    ++   L  +
Sbjct  62   QSQLNTLWPTVLRANNQQFWSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPH  121

Query  693  GILPSDNSPTTLA---SVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
               P+  + +  A    +   FG  P + CR    +   Y+ ++  C+      LI CT+
Sbjct  122  AAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVQVVACFAQDGSTLIDCTR  181

Query  864  AQLSCGTQPIY  896
               +CG   I+
Sbjct  182  D--TCGANFIF  190



>emb|CAJ77734.1| ribonuclease S22 precursor [Prunus dulcis]
Length=187

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 80/159 (50%), Gaps = 15/159 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+   G       +   +R 
Sbjct  27   WPPTNCRVRIKRP--CSKPRPLQYFTIHGLWPSNFSNPTKPSNCAGSQFDARNLAPQMRT  84

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L I W ++E   +  FWE EWNKHGK S   L ++ YFER+  ++++ N+T IL N  I
Sbjct  85   KLKISWPDVESGNDTKFWEGEWNKHGKCSKDRLNQMQYFERSHDMWMSHNITEILKNASI  144

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
            +P      T    +A +  A   TP++ C+  +N+  ++
Sbjct  145  VPHPTQTWTYSDIVAPIKTATKRTPLLRCKWDKNTQLLH  183



>ref|XP_006483150.1| PREDICTED: extracellular ribonuclease LE-like [Citrus sinensis]
Length=230

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 83/188 (44%), Gaps = 15/188 (8%)
 Frame = +3

Query  333  RTWGSFYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQS-----SGPAYVD  491
            R +  FY  L WP  YC    + C P   K   DF IHGLWP     S        A  D
Sbjct  27   RNFDFFYFVLQWPGSYCDTAKSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPTAPFD  86

Query  492  GLINQDLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLAT  665
                 DLR  +   W  L         FW HEW KHG  S S+L +  YF+ A+ L    
Sbjct  87   QSQISDLRSSMQKNWPTLACPSGNGITFWSHEWEKHGTCSESVLNQHQYFQTALNLKNQI  146

Query  666  NVTTILANYGILPSDNSPTTLASVSQAF----GSTPIVVCRKGRNSNTMYITEIRLCYDA  833
            N+   L   GI+P D S  +L S+  A     G +P + C    + N+  + +I LC D 
Sbjct  147  NLLQALRTAGIVP-DGSSYSLESIKDAIKEASGFSPWIECNVDESGNSQ-LYQIYLCVDT  204

Query  834  SAINLISC  857
            SA N I+C
Sbjct  205  SASNFINC  212



>dbj|BAF56273.1| S-RNase [Prunus speciosa]
Length=170

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 82/163 (50%), Gaps = 15/163 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQDLRD  518
            WPP  C   I  P  C   +  + FTIHGLWP      + P+  +G       +   LR 
Sbjct  8    WPPTNCRVRIKRP--CSNPRPLQYFTIHGLWPSNYSNPTRPSNCNGSQFDARKVYPRLRS  65

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            RL+  W ++E   +  FWE EWNKHG  S  +L +  YFER+ +++ + N+T IL N  I
Sbjct  66   RLNRSWPDVESGNDTKFWESEWNKHGTCSQRILNQYLYFERSHEMWRSYNITEILKNASI  125

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            +PS     T    +A +  A   TP++ C+    +NT  + E+
Sbjct  126  VPSATQTWTYSDIVAPIKAATKRTPLLRCKTDLATNTELLHEV  168



>dbj|BAF56279.1| S-RNase [Prunus speciosa]
Length=173

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 76/155 (49%), Gaps = 11/155 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------  509
            F     WPP  C        P  + + FTIHGLWP      + P+   G  + D      
Sbjct  2    FQFVQQWPPTNCKIRKKCSKPLPL-QMFTIHGLWPSNHSNPTTPSNCSGAQSDDRKVYPR  60

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L I W ++E   +  FWE EWNKHG+ S   L ++ YFER+ +++   N+T IL N
Sbjct  61   LRSKLKISWPDVENGNDTKFWEGEWNKHGRCSEQTLNQMQYFERSYEIWNLFNITNILKN  120

Query  690  YGILPSDNSPTT----LASVSQAFGSTPIVVCRKG  782
              I+PS     T    ++++      TP++ CR+ 
Sbjct  121  ASIVPSATQTWTYSDIVSNIKAVTQRTPLLRCRRN  155



>emb|CDX81621.1| BnaC08g39800D [Brassica napus]
Length=640

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 79/183 (43%), Gaps = 15/183 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQSSGPAYVDGLIN------  503
            FY  L WP  YC    A C P   K   DF IHGLWP   +  S P+  D          
Sbjct  443  FYFVLQWPGAYCDTKRACCYPTSGKPAADFGIHGLWP-NYKDGSYPSNCDPDNEFDPSEI  501

Query  504  QDLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
             DL   L   W  L    N  F  WEHEW KHG  S S++ +  YFE  + L    N+  
Sbjct  502  SDLVSTLQTKWPTLSCPSNEGFKFWEHEWEKHGTCSESVMDQHKYFENTLALRDRVNLLQ  561

Query  678  ILANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            IL   GI P+D          ++ +A G TP++ C K    N+  + EI  C D S    
Sbjct  562  ILTGAGIEPNDEFYKLKDIKKAIKEATGFTPVINCNKDPEKNSQ-LHEIFFCVDTSGTEF  620

Query  849  ISC  857
            I C
Sbjct  621  IEC  623



>ref|XP_011070994.1| PREDICTED: extracellular ribonuclease LE-like isoform X2 [Sesamum 
indicum]
Length=226

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 81/182 (45%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQS-----SGPAYVDGLINQ  506
            FY    WP  YC    + C P   K   +FTIHGLWP     +     +  +  DG    
Sbjct  29   FYFVQQWPGSYCDTKRSCCYPTAGKPAANFTIHGLWPNYNNATYPSNCNKNSPYDGTKVS  88

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL  RL++ W+ L    N    FW HEW KHG  S S+L +  YFE  + +    N+  I
Sbjct  89   DLFSRLEVSWATLACPTNNGTKFWSHEWEKHGTCSESVLDQHSYFEATLNIKDKVNLLHI  148

Query  681  LANYGILPSDN---SPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L   GI P DN         ++    G    V C    + N   + ++ LC DASA +LI
Sbjct  149  LEAAGIRPDDNFYKVEDIKEAIKAGTGYDAAVECNSDPSRNGQ-LFQVYLCVDASAKDLI  207

Query  852  SC  857
             C
Sbjct  208  EC  209



>gb|ADZ48272.1| S-locus-associated ribonuclease [Prunus speciosa]
Length=238

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 87/197 (44%), Gaps = 24/197 (12%)
 Frame = +3

Query  336  TWGSFYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------L  497
            ++  F     WPP  C  +   C   +  + FTIHGLWP        P+   G       
Sbjct  27   SYAYFQFVQQWPPTTCRISNKSCHQQRPLQMFTIHGLWPSNYSNPRKPSSCTGSQFKLEK  86

Query  498  INQDLRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
            +   LR +L I W N+E   +  FWE EWNKHG  S   L +  YF+R+  ++ A N+T 
Sbjct  87   LYPKLRSKLKISWPNVESGNDTKFWESEWNKHGTCSEQTLNQFQYFQRSHGIWNAYNMTN  146

Query  678  ILANYGILPSDNS----PTTLASVSQAFGSTPIVVCR-------------KGRNSNTMYI  806
            IL    I+PS  +       ++ +     +TP++ C+             K R    + +
Sbjct  147  ILKRAQIIPSATNTWKYSDIVSPIKAVTKTTPLLRCKHDPKPLQSHPAQSKSRPKPQL-L  205

Query  807  TEIRLCYDASAINLISC  857
             E+ LC+D  A+  I C
Sbjct  206  HEVVLCFDYDALKQIDC  222



>gb|ABV71999.1| S11-RNase [Prunus mume]
Length=222

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 86/176 (49%), Gaps = 13/176 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRDRLD  527
            WPP  C        P  + + FTIHGLWP        P+      + +  +   LR +L 
Sbjct  37   WPPTNCRVRTKCSNPRPL-QYFTIHGLWPSNYSNPKMPSNCIGSQFNESRVYPYLRPKLK  95

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG  S  +L ++ YF+R+  ++ + N++ IL N  I+P 
Sbjct  96   ISWPDVESGNDTKFWEGEWNKHGTCSERILNQMQYFQRSQAMWKSHNISEILKNASIVPH  155

Query  708  DNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISCTQ  863
                 T    ++ +  A   TP++ C+  + +  ++  E+  CY  +A+  I C +
Sbjct  156  PTQTWTYSDIVSPIKTATKRTPLLRCKYDKKTQLLH--EVVFCYGYNALKHIDCNR  209



>emb|CDY09344.1| BnaA02g26660D [Brassica napus]
Length=232

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 87/195 (45%), Gaps = 18/195 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQSSGPAYVDGL------IN  503
            FY    WP  YC    + C P   K   DF IHGLWP   +  + P+  D          
Sbjct  35   FYFVQQWPGSYCDTQKSCCYPTSGKPAADFGIHGLWP-NYKDGTYPSNCDATKPFDSSTI  93

Query  504  QDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
             DL   +   W  L        AFWEHEW KHG  S S++ + +YF+ ++ L   TN+  
Sbjct  94   SDLVSSMKRNWPTLACPSGSGEAFWEHEWEKHGTCSQSVINQHEYFQTSLGLKQKTNLLG  153

Query  678  ILANYGILPSDNS---PTTLASVSQAFGSTPIVVC-RKGRNSNTMYITEIRLCYDASAIN  845
             L   GI P  NS    +   S+  + G TP + C R G  ++ +Y  ++ LC D SA  
Sbjct  154  ALTKAGINPDGNSYSLESIRGSIKASTGFTPWIECNRDGSGNSQLY--QVYLCVDRSASG  211

Query  846  LISC-TQAQLSCGTQ  887
            LI C       CG Q
Sbjct  212  LIECPVFPHGKCGAQ  226



>ref|XP_010552574.1| PREDICTED: ribonuclease 3-like [Tarenaya hassleriana]
Length=229

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 80/182 (44%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTT-----QQSSGPAYVDGLINQ  506
            FY    WP  YC +  + C P   K   DF IHGLWP        Q  +  +  D     
Sbjct  32   FYFVQQWPGAYCDSRQSCCYPKTGKPAADFGIHGLWPNYKSGGWPQNCNPDSEFDESQIS  91

Query  507  DLRDRLDIYWSNLERDPNRA--FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   +   W  L    N    FW HEW KHG  + S L + DYF  A++L    N+   
Sbjct  92   DLLSNMQTEWPTLSCPSNDGVKFWTHEWTKHGTCAESELDQHDYFHAALKLKQKANLLHA  151

Query  681  LANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L+N GI P+D          ++ +A G TP + C K  + N+  + +I LC D S    I
Sbjct  152  LSNAGIKPNDEFYGLREIKKAIEEAIGFTPGIECNKDSSHNSQ-LYQIYLCVDTSGAEFI  210

Query  852  SC  857
             C
Sbjct  211  EC  212



>gb|AAM76701.1| RNase [Prunus dulcis]
Length=163

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 79/157 (50%), Gaps = 11/157 (7%)
 Frame = +3

Query  366  WPPGYC-IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRL  524
            WPP  C +     C   +  + FTIHGLWP      + P+  +G       +  ++R  L
Sbjct  4    WPPTNCRVRMKRPCSNPRPLQYFTIHGLWPSNFSNPTKPSNCNGTKFDARKVYPEMRSDL  63

Query  525  DIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILP  704
             I W ++E   +  FWE EWNKHG  S   L +  YFER+ +++++ N+T IL N  I+P
Sbjct  64   KISWPDVESGNDTKFWEDEWNKHGTCSEQTLNQFQYFERSHEMWMSYNITEILKNASIVP  123

Query  705  SDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMY  803
                  T    ++ +  A G TP++ C+   N+  ++
Sbjct  124  HPAKTWTYSDIVSPIKAATGRTPLLRCKYDNNTQLLH  160



>gb|AAZ57489.1| Si-RNase [Prunus dulcis]
 gb|AAZ94295.1| Si-RNase [Prunus dulcis]
Length=198

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 82/163 (50%), Gaps = 15/163 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------LRD  518
            WPP  C   I  P  C   +  ++FTIHGLWP      + P+  +G   +D      LR 
Sbjct  36   WPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNYSNPTKPSNCNGAKYEDRKVYPKLRS  93

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++L+ N+T IL N  I
Sbjct  94   KLKRSWPDVESGNDTRFWEGEWNKHGRCSEQTLNQMQYFEVSHDMWLSYNITEILRNASI  153

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            +P      T    ++ +  A   TP++ C+    +NT  + E+
Sbjct  154  VPHPTQTWTYSDIVSPIKAATKRTPLIRCKIDTATNTELLHEV  196



>gb|AAG09286.1|AF177923_1 Se-RNase [Prunus dulcis]
Length=162

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 78/155 (50%), Gaps = 10/155 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQ-----TTQQSSGPAYVDGLINQDLRDRLDI  530
            WPP  C        P  + + FTIHGLWP      T    +G  + D  ++  LR++L  
Sbjct  6    WPPTNCRVRTKCSKPRPL-QYFTIHGLWPSNYSNPTPSNCNGSKFDDRNVSPQLRNKLKR  64

Query  531  YWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPSD  710
             W ++E   +  FWE EWNKHG  S   L +  YFER+  ++ + N+T IL N  I+PS 
Sbjct  65   SWPDVESGNDTKFWEGEWNKHGICSEQTLNQFQYFERSQDMWKSHNITEILKNASIVPSA  124

Query  711  NS----PTTLASVSQAFGSTPIVVCRKGRNSNTMY  803
                     ++ + +A   TPI+ C++ + +  ++
Sbjct  125  TQNWRYSDIVSPIKRATKRTPILRCKQDKKTQLLH  159



>gb|ABW81472.1| self-incompatibility S13-RNase [Prunus dulcis]
Length=165

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 77/162 (48%), Gaps = 10/162 (6%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQD  509
            F     WPP  C      C   +  ++FTIHGLWP       T  + +G  +    +   
Sbjct  1    FQFVQQWPPTNCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTTPSKCTGSRFKKENVYPQ  60

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR ++ I W ++E   +  FWE EWNKHG  S   L +V YF+R+  ++ + NVT IL N
Sbjct  61   LRSKMKISWPDVESGNDTRFWESEWNKHGTCSEDTLNQVQYFQRSHAMWRSHNVTEILRN  120

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMY  803
              I+P           ++ +  A   TP++ C+  + +  ++
Sbjct  121  ASIVPHPTQTWSYSDIVSPIKTATKRTPLLRCKYDKKTQLLH  162



>ref|XP_009401398.1| PREDICTED: extracellular ribonuclease LE-like [Musa acuminata 
subsp. malaccensis]
Length=227

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 88/194 (45%), Gaps = 16/194 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQDLRDR  521
            FY  L WP  YC    + C P   K   DF IHGLWP      S P+  D     D    
Sbjct  30   FYFVLQWPGSYCDTAKSCCYPTSGKPAADFGIHGLWPNYND-GSYPSNCDPNNPYDASKV  88

Query  522  LDIYWSNLERDPNRA--------FWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
             D+  +  ++ P  A        FW HEW KHG  S S+  +  YF+ A++L    +V  
Sbjct  89   RDLLSTMRQKWPTLACPSSDGTQFWTHEWEKHGTCSESVFDQHGYFQAALKLKKQVDVLR  148

Query  678  ILANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            IL + GI P        + ++++S A G TP + C      N+  + ++ LC D SA  L
Sbjct  149  ILQDAGIQPDGGDYSLKSVVSAISDAIGYTPWIECNNDEGGNSQ-LYQVYLCVDTSAAKL  207

Query  849  ISC-TQAQLSCGTQ  887
            I C    +  CG++
Sbjct  208  IECPVLPRKRCGSE  221



>gb|ACG50928.1| S1-RNase [Prunus simonii]
Length=191

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 75/148 (51%), Gaps = 11/148 (7%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQD------LRDRLD  527
            WPP  C        P  + + FTIHGLWP      + P+  +G    D      LR +L 
Sbjct  26   WPPTNCKIRKKCSKPRPL-QMFTIHGLWPSNHSNPTTPSNCNGAQFDDRKVYPRLRSKLK  84

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG+ S   L ++ YFER+ +++   N+T IL N  I+PS
Sbjct  85   ISWPDVENGNDTKFWEGEWNKHGRCSEQTLNQMQYFERSYEIWNLFNITNILKNASIVPS  144

Query  708  DNSPTT----LASVSQAFGSTPIVVCRK  779
                 T    ++++      TP++ CR+
Sbjct  145  ATQTWTYSDIVSNIKAVTQRTPLLRCRR  172



>dbj|BAF91152.1| S-ribonuclease [Prunus mume]
Length=187

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 81/163 (50%), Gaps = 15/163 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQDLRD  518
            WPP  C   I  P  C   +  ++FTIHGLWP      + P+      Y D  +   LR 
Sbjct  26   WPPTNCRVRIKRP--CSKPRPLQNFTIHGLWPSNFSNPTKPSNCNGSKYEDRKVYPKLRS  83

Query  519  RLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGI  698
            +L   W ++E   +  FWE EWNKHG+ S   L ++ YFE +  ++L+ N+T IL N  I
Sbjct  84   KLKRSWPDVESGNDTRFWEDEWNKHGRCSEQTLNQMQYFEVSHDMWLSYNITEILRNASI  143

Query  699  LPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEI  815
            +P      T    ++ +  A   TP++ C+    +NT  + E+
Sbjct  144  VPHPTQTWTYSDIVSPIKAATKRTPLLRCKLDTATNTELLHEV  186



>gb|AAX38607.1| ribonuclease S6 [Prunus avium]
Length=167

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 77/154 (50%), Gaps = 14/154 (9%)
 Frame = +3

Query  366  WPPGYC---IANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG-----LINQDLRDR  521
            WPP  C   I  P  C   +  + FTIHGLWP        P+   G     +++  LR +
Sbjct  8    WPPTNCRVRIKRP--CSSPRPLQYFTIHGLWPSNYSNPRMPSNCTGPQFKRILSPQLRSK  65

Query  522  LDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGIL  701
            L   W ++E   +  FWE EWNKHG  S   L ++ YFER+  ++++ N+T IL N  I+
Sbjct  66   LQTSWPDVESGNDTKFWESEWNKHGTCSKETLNQMQYFERSYAMWMSYNITEILKNASIV  125

Query  702  PSDNS----PTTLASVSQAFGSTPIVVCRKGRNS  791
            P           +A +  A   TP++ C++ +N+
Sbjct  126  PHPTQTWKYSDIVAPIKAATKRTPLLRCKQDKNT  159



>emb|CAJ77744.1| ribonuclease S13 precursor [Prunus dulcis]
 emb|CAJ77731.1| ribonuclease S19 precursor [Prunus dulcis]
Length=166

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 77/162 (48%), Gaps = 10/162 (6%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQD  509
            F     WPP  C      C   +  ++FTIHGLWP       T  + +G  +    +   
Sbjct  1    FQFVQQWPPTNCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTTPSKCTGSRFKKENVYPQ  60

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR ++ I W ++E   +  FWE EWNKHG  S   L +V YF+R+  ++ + NVT IL N
Sbjct  61   LRSKMKISWPDVESGNDTRFWESEWNKHGTCSEDTLNQVQYFQRSHAMWRSHNVTEILRN  120

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMY  803
              I+P           ++ +  A   TP++ C+  + +  ++
Sbjct  121  ASIVPHPTQTWSYSDIVSPIKTATKRTPLLRCKYDKKTQLLH  162



>emb|CAE84600.1| RNase [Prunus dulcis]
Length=162

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 76/156 (49%), Gaps = 10/156 (6%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQ------TTQQSSGPAYVDGLINQDLRDRLD  527
            WPP  C      C   +  ++FTIHGLWP       T  + +G  +    +   LR ++ 
Sbjct  4    WPPTNCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTTPSKCTGSRFKKENVYPQLRSKMK  63

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHG  S   L +V YF+R+  ++ + NVT IL N  I+P 
Sbjct  64   ISWPDVESGNDTRFWESEWNKHGTCSEDTLNQVQYFQRSHAMWRSHNVTEILRNASIVPH  123

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMY  803
                      ++ +  A   TP++ C+  + +  ++
Sbjct  124  PTQTWSYSDIVSPIKTATKRTPLLRCKYDKKTQLLH  159



>gb|AAC49326.1| wounding-induced ribonuclease gene [Zinnia violacea]
Length=229

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 86/194 (44%), Gaps = 18/194 (9%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPN--KMKEDFTIHGLWPQTTQ-------QSSGPAYVDGLI  500
            FYL   WP  YC      C P+  K   DF IHGLWP            SS P   D   
Sbjct  32   FYLVQQWPGSYCDTKQGCCYPSTGKPASDFGIHGLWPNRNDGSYPSNCDSSNP--FDASK  89

Query  501  NQDLRDRLDIYWSNLERDPNR--AFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVT  674
              DL   +   W  L    N   AFW HEW+KHG  S S+L + DYF   + L    N+ 
Sbjct  90   ISDLTSHMQSEWPTLLCPSNNGLAFWGHEWDKHGTCSESVLNQHDYFATTLSLKNEINLL  149

Query  675  TILANYGILPSDNS---PTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAIN  845
              L + GI P+       +   ++ QA G TP V C    + N+  + +I LC D+SA  
Sbjct  150  QALRSAGIQPNGQKYSLSSIKTAIKQASGYTPWVECNNDSSGNSQ-LYQIYLCVDSSASG  208

Query  846  LISC-TQAQLSCGT  884
             I C    + SCG+
Sbjct  209  FIECPVFPKGSCGS  222



>dbj|BAF56245.1| S-RNase [Prunus speciosa]
Length=174

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQD  509
            F     WPP  C      C  ++    FTIHGLWP        P+  +G       ++  
Sbjct  2    FQFVQQWPPTNCRVRNKPCSKHRSLPIFTIHGLWPSNYSNPKTPSNCNGSQFDAIKLSPR  61

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L   W ++E   +  FWE EWNKHGK S   L ++ YFER+ ++++  N+T IL N
Sbjct  62   LRSKLKRSWPDVESGNDEGFWEGEWNKHGKCSEQTLNQMQYFERSHEMWIFHNITKILKN  121

Query  690  YGILPSDNSP---TTLASVSQAF-GSTPIVVCRK  779
              I+P        T + S  +A   +TP++ C++
Sbjct  122  ASIVPHPTKTWKYTDIVSAIKALTQTTPLLRCKR  155



>ref|XP_010939795.1| PREDICTED: extracellular ribonuclease LE-like [Elaeis guineensis]
Length=226

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 83/183 (45%), Gaps = 15/183 (8%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLP--NKMKEDFTIHGLWPQTTQQS------SGPAYVDGLIN  503
            FY    WP  YC    + C P   K   DF IHGLWP     S         +Y +  I 
Sbjct  29   FYFVQQWPGSYCDTAKSCCYPTTGKPAADFGIHGLWPNYNDGSYPSNCDPDNSYDESKI-  87

Query  504  QDLRDRLDIYWSNLE--RDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTT  677
            +DL   +   W  L    D    FW HEW KHG  S S+L E  YFE A+ L    ++  
Sbjct  88   KDLITAMQAEWPTLACPSDDGSKFWSHEWEKHGTCSESILDEHSYFEAALDLKKQVDLLQ  147

Query  678  ILANYGILPSDNSPTTLA---SVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINL  848
            IL + GI P D S +  +   ++  A G TP + C    + NT  + ++ +C D +  +L
Sbjct  148  ILKSAGINPDDGSYSVRSISRAIKDATGFTPGIECNVDESGNTQ-LYQVYICVDTNGKDL  206

Query  849  ISC  857
            I C
Sbjct  207  IEC  209



>gb|ABG76211.1| S-RNase [Prunus spinosa]
Length=203

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 87/183 (48%), Gaps = 13/183 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPA------YVDGLINQD  509
            F     WPP  C        P  + + FTIHGLWP        P+      + +  +   
Sbjct  12   FQFVQQWPPTNCRVRTKCSNPRPL-QYFTIHGLWPSNYSNPKMPSNCIGSQFNESRVYPY  70

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR +L I W ++E   +  FWE EWNKHG  S  +L ++ YF+R+  ++ + N++ IL N
Sbjct  71   LRPKLKISWPDVESGNDTKFWEGEWNKHGTCSERILNQMQYFQRSQAMWGSHNISEILKN  130

Query  690  YGILPSDNSPTT----LASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLISC  857
              I+P      T    ++ +  A   TP++ C+  + +  ++  E+  CY  +A+  I C
Sbjct  131  ASIVPHPTQTWTYSDIVSPIKTATKRTPLLRCKYDKKTQLLH--EVVFCYGYNALKHIDC  188

Query  858  TQA  866
             + 
Sbjct  189  NRT  191



>emb|CAN90134.1| self-incompatibility ribonuclease [Prunus cerasifera]
Length=165

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 75/162 (46%), Gaps = 10/162 (6%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQD  509
            F     WPP  C      C   +  ++FTIHGLWP      + P+   G       +   
Sbjct  1    FQFVQQWPPTSCRVRNKPCSKPRPLQNFTIHGLWPSNYSNPTMPSKCTGSRFKKENVYPQ  60

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            LR ++ I W ++E   +  FWE EWNKHG  S   L +V YF+R+  ++ + NVT IL N
Sbjct  61   LRSKMKISWPDVESGNDTRFWESEWNKHGTCSEGTLNQVQYFQRSHAMWRSHNVTEILRN  120

Query  690  YGILPSDNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMY  803
              I P           ++ +  A   TP++ C+  + +  ++
Sbjct  121  ASIAPHPTQTWSYSDIVSPIKTATKRTPLIRCKYDKKTQLLH  162



>gb|ABQ51152.1| S11-RNase [Prunus armeniaca]
Length=187

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 75/156 (48%), Gaps = 12/156 (8%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGL------INQDLRDRLD  527
            WPP  C      C   +  + FTIHGLWP      S P+   GL      +   L+  L 
Sbjct  30   WPPTNCKFR--KCSKPRPLQRFTIHGLWPSNYSNPSRPSNCTGLQFEARKVYPQLQSDLK  87

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W ++E   +  FWE EWNKHGK S   L +  YFER+  ++ + N+T IL N  I+P 
Sbjct  88   ISWPDVESGNDTKFWEDEWNKHGKCSEQTLNQRQYFERSHAMWTSFNITEILKNASIVPH  147

Query  708  DNS----PTTLASVSQAFGSTPIVVCRKGRNSNTMY  803
                      +A +  A G TP++ C+  + +  ++
Sbjct  148  PKKTWSYSDIVAPIKTATGRTPLLRCKLDKKTQLLH  183



>gb|AIV99935.1| S-RNase S51, partial [Prunus dulcis]
Length=174

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 76/153 (50%), Gaps = 10/153 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDG------LINQD  509
            F     WPP  C      C   +  + FTIHGLWP      + P+  +G       +   
Sbjct  2    FQFVQQWPPTNCRVRNKPCSKPRPLQIFTIHGLWPSNYSNPTMPSNCNGSPFEAKKVYPR  61

Query  510  LRDRLDIYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILAN  689
            L+ +L I W ++E   +  FWE EWNKHG  S+ +L ++ YFER+ +++ + N+T IL N
Sbjct  62   LQSKLKISWPDVESGNDTNFWEREWNKHGTCSSRILNQMQYFERSYEMWRSYNITNILKN  121

Query  690  YGILPSDNSPTTLASVSQAFGS----TPIVVCR  776
              I+PS     T + +     +    TP++ C+
Sbjct  122  ASIVPSATQTWTYSDIVSPIKAVTQRTPLLRCK  154



>emb|CDX84041.1| BnaC08g16040D [Brassica napus]
Length=228

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 79/182 (43%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQTTQQS-----SGPAYVDGLINQ  506
            FYL L WP  YC    + C P   K   DF IHGLWP     S     +  +  D     
Sbjct  31   FYLVLQWPGAYCDTKRSCCYPTSGKPAADFGIHGLWPNYKDGSYPSNCNPDSEFDKSQIT  90

Query  507  DLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N  F  W+HEW KHG  S S++ + +YFE +++L    N+   
Sbjct  91   DLVSSLKKTWPTLACPSNEGFKFWKHEWEKHGTCSESVMDQHEYFENSLKLRDRANLFQA  150

Query  681  LANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D   +      ++    G TP + C K    N   + +I +C D S    I
Sbjct  151  LTNSGIKPDDRFYDLEKIRKAIKDEIGFTPGIECNKDPERNDQ-LHQIYICVDTSGTEFI  209

Query  852  SC  857
             C
Sbjct  210  KC  211



>dbj|BAC20936.1| Sc-RNase [Prunus salicina]
Length=212

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 84/183 (46%), Gaps = 16/183 (9%)
 Frame = +3

Query  366  WPPGYCIANPAGCLPNKMKEDFTIHGLWPQTTQQSSGPAYVDGLINQ------DLRDRLD  527
            WPP  C  +   C   ++ + FTIHGLWP        P+   G + +       L+  L 
Sbjct  21   WPPATCRLSGKSCSKPRL-QIFTIHGLWPSNYSNPKIPSNCKGALFEARKVYPQLQLNLK  79

Query  528  IYWSNLERDPNRAFWEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTILANYGILPS  707
            I W +++      FW+ EWNKHG  S   L ++ YFER+ +++ + N+T IL N  I+P 
Sbjct  80   ISWPDVKSGNETNFWQSEWNKHGTCSERTLNQMQYFERSDEMWNSYNITEILKNASIVPH  139

Query  708  DNSPTTLAS----VSQAFGSTPIVVCRKGRNSN-----TMYITEIRLCYDASAINLISCT  860
                   A     +  A   TP++ C++    N     T  + E+  CYD  A   I C 
Sbjct  140  PTQTWKYADIELPIKTATKRTPVLRCKRDPAQNKTGPKTQLLYEVVFCYDYHAKRQIDCN  199

Query  861  QAQ  869
            + +
Sbjct  200  RTE  202



>ref|XP_009110556.1| PREDICTED: ribonuclease 3-like [Brassica rapa]
 emb|CDX96863.1| BnaA08g24060D [Brassica napus]
Length=228

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 80/182 (44%), Gaps = 13/182 (7%)
 Frame = +3

Query  348  FYLSLFWPPGYCIANPAGCLPNKMK--EDFTIHGLWPQ----TTQQSSGP-AYVDGLINQ  506
            FYL L WP  YC    + C P   K   DF IHGLWP     T   +  P +  D     
Sbjct  31   FYLVLQWPGAYCDTKRSCCYPTSGKPAADFGIHGLWPNYKDGTYPSNCNPDSEFDKSQIT  90

Query  507  DLRDRLDIYWSNLERDPNRAF--WEHEWNKHGKISNSLLGEVDYFERAIQLYLATNVTTI  680
            DL   L   W  L    N  F  W+HEW KHG  S S++ + +YFE +++L    N+   
Sbjct  91   DLVSSLKKTWPTLACPSNEGFKFWKHEWEKHGTCSESVMDQHEYFENSLKLRDRANLLQA  150

Query  681  LANYGILPSD---NSPTTLASVSQAFGSTPIVVCRKGRNSNTMYITEIRLCYDASAINLI  851
            L N GI P D   +      ++    G TP + C K    N   + +I +C D S    I
Sbjct  151  LTNSGIKPDDRFYDLEKIRKAIKDEIGFTPGIECNKDPERNDQ-LHQIYICVDTSGTEFI  209

Query  852  SC  857
             C
Sbjct  210  KC  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1997200541776