BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c87895_g1_i1 len=1250 path=[1228:0-1249]

Length=1250
                                                                      Score     E

ref|XP_009764906.1|  PREDICTED: probable xyloglucan endotransgluc...    493   4e-170   
gb|AIL30514.1|  xyloglucan endotransglucosylase-hydrolase XTH5          487   4e-168   
ref|XP_009608904.1|  PREDICTED: probable xyloglucan endotransgluc...    484   4e-167   
ref|XP_006354588.1|  PREDICTED: probable xyloglucan endotransgluc...    484   8e-167   
ref|NP_001234470.1|  xyloglucan endotransglucosylase-hydrolase XT...    479   7e-165   
ref|XP_011093429.1|  PREDICTED: probable xyloglucan endotransgluc...    473   2e-162   
ref|XP_011086421.1|  PREDICTED: probable xyloglucan endotransgluc...    472   5e-162   
gb|EYU40279.1|  hypothetical protein MIMGU_mgv1a009338mg                464   4e-159   
gb|ACD03224.1|  xyloglucan endotransglucosylase/hydrolase 14            463   1e-158   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010276803.1|  PREDICTED: probable xyloglucan endotransgluc...    458   1e-156   
ref|XP_010663022.1|  PREDICTED: probable xyloglucan endotransgluc...    447   2e-152   
ref|XP_003516952.1|  PREDICTED: probable xyloglucan endotransgluc...    447   2e-152   
gb|KHN04842.1|  Putative xyloglucan endotransglucosylase/hydrolas...    446   5e-152   
ref|XP_010261561.1|  PREDICTED: probable xyloglucan endotransgluc...    446   5e-152   
ref|XP_004163204.1|  PREDICTED: probable xyloglucan endotransgluc...    446   5e-152   
ref|XP_008466018.1|  PREDICTED: probable xyloglucan endotransgluc...    444   4e-151   
ref|XP_004136205.1|  PREDICTED: probable xyloglucan endotransgluc...    444   6e-151   
gb|AFK40626.1|  unknown                                                 441   9e-150   
ref|XP_010519083.1|  PREDICTED: probable xyloglucan endotransgluc...    439   2e-149   
ref|XP_002518990.1|  Xyloglucan endotransglucosylase/hydrolase pr...    439   3e-149   Ricinus communis
ref|XP_007158243.1|  hypothetical protein PHAVU_002G136200g             439   4e-149   
ref|XP_010053644.1|  PREDICTED: probable xyloglucan endotransgluc...    439   5e-149   
ref|XP_007040721.1|  Xyloglucan endotransglucosylase/hydrolase pr...    439   5e-149   
gb|KHG00933.1|  putative xyloglucan endotransglucosylase/hydrolas...    438   1e-148   
ref|XP_010055251.1|  PREDICTED: probable xyloglucan endotransgluc...    438   2e-148   
ref|XP_003612793.1|  Xyloglucan endotransglucosylase/hydrolase          437   3e-148   
ref|XP_007210518.1|  hypothetical protein PRUPE_ppa007685mg             437   3e-148   
ref|XP_010088654.1|  putative xyloglucan endotransglucosylase/hyd...    437   3e-148   
ref|XP_004512469.1|  PREDICTED: probable xyloglucan endotransgluc...    435   2e-147   
ref|XP_008373536.1|  PREDICTED: probable xyloglucan endotransgluc...    434   5e-147   
gb|KDP30712.1|  hypothetical protein JCGZ_15540                         432   2e-146   
ref|NP_001242723.1|  uncharacterized protein LOC100800720 precursor     432   4e-146   
ref|XP_009373460.1|  PREDICTED: probable xyloglucan endotransgluc...    431   7e-146   
emb|CDP09316.1|  unnamed protein product                                428   1e-145   
ref|XP_008341063.1|  PREDICTED: probable xyloglucan endotransgluc...    430   2e-145   
ref|XP_009348482.1|  PREDICTED: probable xyloglucan endotransgluc...    430   2e-145   
ref|XP_008238168.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    429   4e-145   
ref|XP_010677382.1|  PREDICTED: probable xyloglucan endotransgluc...    429   5e-145   
ref|XP_011018473.1|  PREDICTED: probable xyloglucan endotransgluc...    428   8e-145   
ref|XP_009344136.1|  PREDICTED: probable xyloglucan endotransgluc...    428   1e-144   
ref|XP_006368348.1|  xyloglucan endotransglycosylase 2 family pro...    426   4e-144   
ref|XP_006415244.1|  hypothetical protein EUTSA_v10008109mg             422   1e-142   
gb|KFK44960.1|  hypothetical protein AALP_AA1G325900                    420   8e-142   
emb|CDY29941.1|  BnaC05g28950D                                          420   1e-141   
gb|EPS67980.1|  xyloglucan endotransglucosylase/hydrolase 14            418   2e-141   
ref|XP_006303176.1|  hypothetical protein CARUB_v10009628mg             419   3e-141   
emb|CDY35550.1|  BnaA05g16360D                                          418   5e-141   
ref|XP_009107996.1|  PREDICTED: probable xyloglucan endotransgluc...    418   7e-141   
ref|NP_174496.1|  probable xyloglucan endotransglucosylase/hydrol...    418   8e-141   Arabidopsis thaliana [mouse-ear cress]
gb|ABM91070.1|  xyloglucan endotransglycosylase/hydrolase precurs...    417   1e-140   Populus tremula x Populus tremuloides
gb|AAB18365.1|  xyloglucan endotransglycosylase-related protein         417   1e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478638.1|  PREDICTED: probable xyloglucan endotransgluc...    417   2e-140   
ref|XP_010499761.1|  PREDICTED: probable xyloglucan endotransgluc...    416   3e-140   
emb|CDY60254.1|  BnaCnng35910D                                          416   4e-140   
ref|XP_002304356.2|  hypothetical protein POPTR_0003s09590g             416   5e-140   Populus trichocarpa [western balsam poplar]
gb|AAM67311.1|  endoxyloglucan transferase, putative                    415   1e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890971.1|  hypothetical protein ARALYDRAFT_473398             414   3e-139   
ref|XP_004300192.1|  PREDICTED: probable xyloglucan endotransgluc...    413   6e-139   
gb|KEH27691.1|  xyloglucan endotransglucosylase/hydrolase family ...    409   1e-137   
gb|EPS64838.1|  xyloglucan endotransglucosylase/hydrolase 14            409   1e-137   
ref|XP_008800080.1|  PREDICTED: probable xyloglucan endotransgluc...    407   1e-136   
ref|XP_009384131.1|  PREDICTED: probable xyloglucan endotransgluc...    404   1e-135   
ref|XP_010933426.1|  PREDICTED: probable xyloglucan endotransgluc...    403   4e-135   
ref|XP_010434473.1|  PREDICTED: probable xyloglucan endotransgluc...    404   5e-135   
ref|XP_010439782.1|  PREDICTED: probable xyloglucan endotransgluc...    400   1e-133   
ref|XP_006432690.1|  hypothetical protein CICLE_v10001649mg             400   2e-133   
ref|XP_010449431.1|  PREDICTED: probable xyloglucan endotransgluc...    400   2e-133   
ref|XP_010919979.1|  PREDICTED: probable xyloglucan endotransgluc...    397   6e-133   
emb|CDX78912.1|  BnaA01g09790D                                          397   8e-133   
ref|XP_008802555.1|  PREDICTED: probable xyloglucan endotransgluc...    397   1e-132   
ref|XP_009132429.1|  PREDICTED: probable xyloglucan endotransgluc...    397   1e-132   
emb|CDP11680.1|  unnamed protein product                                397   1e-132   
ref|XP_011070344.1|  PREDICTED: probable xyloglucan endotransgluc...    397   2e-132   
ref|XP_009386254.1|  PREDICTED: probable xyloglucan endotransgluc...    396   3e-132   
ref|XP_004954728.1|  PREDICTED: probable xyloglucan endotransgluc...    396   4e-132   
gb|AFR46573.1|  xyloglucan endotransglucosylase/hydrolase 4             396   4e-132   
ref|XP_009136983.1|  PREDICTED: probable xyloglucan endotransgluc...    395   9e-132   
gb|KDO57189.1|  hypothetical protein CISIN_1g018153mg                   395   9e-132   
emb|CDX99402.1|  BnaC01g11500D                                          394   1e-131   
ref|XP_009401243.1|  PREDICTED: probable xyloglucan endotransgluc...    394   2e-131   
ref|XP_009804856.1|  PREDICTED: probable xyloglucan endotransgluc...    394   2e-131   
emb|CDY01577.1|  BnaC07g35670D                                          394   2e-131   
ref|XP_004245964.1|  PREDICTED: probable xyloglucan endotransgluc...    393   9e-131   
ref|XP_006352933.1|  PREDICTED: probable xyloglucan endotransgluc...    393   3e-130   
gb|EYU45258.1|  hypothetical protein MIMGU_mgv1a008549mg                392   3e-130   
ref|XP_006285076.1|  hypothetical protein CARUB_v10006389mg             390   9e-130   
dbj|BAO02542.1|  endo-(1,4)-beta-D-glucanase ortholog                   389   9e-130   
emb|CAA16756.1|  xyloglucan endo-transglycosylase-like protein          388   3e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867966.1|  predicted protein                                  388   4e-129   
ref|XP_009413224.1|  PREDICTED: probable xyloglucan endotransgluc...    387   5e-129   
ref|XP_009607215.1|  PREDICTED: probable xyloglucan endotransgluc...    388   1e-128   
ref|NP_193634.1|  probable xyloglucan endotransglucosylase/hydrol...    386   3e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397822.1|  PREDICTED: probable xyloglucan endotransgluc...    384   9e-128   
ref|XP_010943419.1|  PREDICTED: probable xyloglucan endotransgluc...    383   3e-127   
gb|KHN25980.1|  Putative xyloglucan endotransglucosylase/hydrolas...    383   4e-127   
ref|XP_003524850.1|  PREDICTED: probable xyloglucan endotransgluc...    382   1e-126   
gb|EAZ21594.1|  hypothetical protein OsJ_05221                          380   3e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009417372.1|  PREDICTED: probable xyloglucan endotransgluc...    384   3e-126   
ref|XP_011081425.1|  PREDICTED: probable xyloglucan endotransgluc...    380   4e-126   
ref|NP_001045764.1|  Os02g0127800                                       380   7e-126   Oryza sativa Japonica Group [Japonica rice]
gb|ACU19067.1|  unknown                                                 379   1e-125   Glycine max [soybeans]
ref|XP_004504585.1|  PREDICTED: probable xyloglucan endotransgluc...    379   1e-125   
ref|XP_010105548.1|  putative xyloglucan endotransglucosylase/hyd...    379   2e-125   
gb|AGV54504.1|  xyloglucan endotransglucosylase/hydrolase protein...    378   3e-125   
ref|XP_002451458.1|  hypothetical protein SORBIDRAFT_04g002290          379   4e-125   Sorghum bicolor [broomcorn]
gb|AGZ15408.1|  xyloglucan endotransglucosylase/hydrolase protein 28    377   4e-125   
ref|XP_003638758.1|  Xyloglucan endotransglycosylase/hydrolase          375   2e-124   
ref|XP_009399416.1|  PREDICTED: probable xyloglucan endotransgluc...    375   2e-124   
ref|XP_007158788.1|  hypothetical protein PHAVU_002G182000g             375   3e-124   
ref|XP_007222502.1|  hypothetical protein PRUPE_ppa008275mg             375   4e-124   
ref|XP_007153190.1|  hypothetical protein PHAVU_003G014400g             375   4e-124   
ref|XP_006385680.1|  xyloglucan endotransglycosylase 2 family pro...    372   4e-124   
ref|XP_010911228.1|  PREDICTED: probable xyloglucan endotransgluc...    375   5e-124   
ref|XP_003531138.1|  PREDICTED: probable xyloglucan endotransgluc...    374   7e-124   
gb|KHN28876.1|  Putative xyloglucan endotransglucosylase/hydrolas...    374   7e-124   
ref|XP_002285140.1|  PREDICTED: probable xyloglucan endotransgluc...    372   6e-123   Vitis vinifera
ref|XP_009390348.1|  PREDICTED: probable xyloglucan endotransgluc...    372   8e-123   
ref|XP_002527547.1|  Xyloglucan endotransglucosylase/hydrolase pr...    372   8e-123   Ricinus communis
gb|KDO60844.1|  hypothetical protein CISIN_1g019909mg                   371   1e-122   
gb|KEH40692.1|  xyloglucan endotransglucosylase/hydrolase family ...    371   1e-122   
ref|XP_010043929.1|  PREDICTED: probable xyloglucan endotransgluc...    371   1e-122   
ref|XP_009390870.1|  PREDICTED: probable xyloglucan endotransgluc...    371   1e-122   
ref|XP_011070536.1|  PREDICTED: probable xyloglucan endotransgluc...    370   2e-122   
ref|XP_006448095.1|  hypothetical protein CICLE_v10015872mg             370   3e-122   
ref|NP_001146328.1|  uncharacterized protein LOC100279904 precursor     370   3e-122   Zea mays [maize]
gb|AFW66656.1|  hypothetical protein ZEAMMB73_269375                    370   3e-122   
ref|XP_009621666.1|  PREDICTED: probable xyloglucan endotransgluc...    369   7e-122   
gb|KHN25480.1|  Putative xyloglucan endotransglucosylase/hydrolas...    369   8e-122   
ref|XP_008220940.1|  PREDICTED: probable xyloglucan endotransgluc...    369   9e-122   
ref|XP_003529235.1|  PREDICTED: probable xyloglucan endotransgluc...    369   1e-121   
ref|XP_004513237.1|  PREDICTED: probable xyloglucan endotransgluc...    369   1e-121   
ref|XP_006469297.1|  PREDICTED: probable xyloglucan endotransgluc...    369   1e-121   
emb|CAN74084.1|  hypothetical protein VITISV_018042                     368   2e-121   Vitis vinifera
ref|XP_003555818.1|  PREDICTED: probable xyloglucan endotransgluc...    368   2e-121   
ref|XP_009389336.1|  PREDICTED: probable xyloglucan endotransgluc...    368   3e-121   
ref|XP_004514368.1|  PREDICTED: probable xyloglucan endotransgluc...    368   3e-121   
ref|XP_002315842.1|  xyloglucan endotransglycosylase family protein     368   3e-121   Populus trichocarpa [western balsam poplar]
ref|XP_009390346.1|  PREDICTED: probable xyloglucan endotransgluc...    367   3e-121   
ref|XP_009397821.1|  PREDICTED: probable xyloglucan endotransgluc...    369   3e-121   
ref|XP_009351584.1|  PREDICTED: probable xyloglucan endotransgluc...    367   4e-121   
ref|XP_007045473.1|  Xyloglucan endotransglucosylase/hydrolase 28       366   2e-120   
ref|XP_004228752.1|  PREDICTED: probable xyloglucan endotransgluc...    365   2e-120   
ref|XP_009763784.1|  PREDICTED: probable xyloglucan endotransgluc...    365   2e-120   
ref|XP_009380067.1|  PREDICTED: probable xyloglucan endotransgluc...    366   2e-120   
ref|XP_008798384.1|  PREDICTED: probable xyloglucan endotransgluc...    365   3e-120   
ref|XP_010527818.1|  PREDICTED: probable xyloglucan endotransgluc...    365   3e-120   
ref|XP_008365814.1|  PREDICTED: probable xyloglucan endotransgluc...    365   3e-120   
ref|XP_006364060.1|  PREDICTED: probable xyloglucan endotransgluc...    363   9e-120   
ref|XP_010674965.1|  PREDICTED: probable xyloglucan endotransgluc...    363   1e-119   
gb|KDP38168.1|  hypothetical protein JCGZ_04811                         363   1e-119   
emb|CDP20286.1|  unnamed protein product                                363   1e-119   
gb|ACD03223.1|  xyloglucan endotransglucosylase/hydrolase 13            363   1e-119   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010554388.1|  PREDICTED: probable xyloglucan endotransgluc...    363   2e-119   
ref|XP_011021731.1|  PREDICTED: probable xyloglucan endotransgluc...    363   2e-119   
gb|EMT08504.1|  Putative xyloglucan endotransglucosylase/hydrolas...    362   2e-119   
ref|XP_008389143.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    362   3e-119   
ref|XP_010271176.1|  PREDICTED: probable xyloglucan endotransgluc...    362   3e-119   
gb|ABM91072.1|  xyloglucan endotransglycosylase/hydrolase precurs...    362   7e-119   Populus tremula [European aspen]
ref|XP_008795338.1|  PREDICTED: probable xyloglucan endotransgluc...    360   2e-118   
emb|CDP05491.1|  unnamed protein product                                361   2e-118   
ref|XP_004980998.1|  PREDICTED: probable xyloglucan endotransgluc...    361   2e-118   
ref|XP_009621345.1|  PREDICTED: probable xyloglucan endotransgluc...    360   3e-118   
gb|KFK33417.1|  hypothetical protein AALP_AA5G010000                    360   3e-118   
ref|XP_010553506.1|  PREDICTED: probable xyloglucan endotransgluc...    359   6e-118   
ref|XP_009405165.1|  PREDICTED: probable xyloglucan endotransgluc...    359   7e-118   
ref|XP_010539209.1|  PREDICTED: probable xyloglucan endotransgluc...    358   7e-118   
ref|XP_004142294.1|  PREDICTED: probable xyloglucan endotransgluc...    359   7e-118   
ref|XP_002311545.1|  xyloglucan endotransglycosylase family protein     359   8e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011024575.1|  PREDICTED: probable xyloglucan endotransgluc...    358   1e-117   
ref|XP_003570869.1|  PREDICTED: probable xyloglucan endotransgluc...    358   2e-117   
ref|XP_010066550.1|  PREDICTED: probable xyloglucan endotransgluc...    357   3e-117   
ref|XP_008466948.1|  PREDICTED: probable xyloglucan endotransgluc...    357   3e-117   
ref|XP_004156140.1|  PREDICTED: probable xyloglucan endotransgluc...    357   3e-117   
ref|XP_009117879.1|  PREDICTED: probable xyloglucan endotransgluc...    357   3e-117   
ref|XP_004162296.1|  PREDICTED: probable xyloglucan endotransgluc...    357   3e-117   
ref|XP_009777519.1|  PREDICTED: probable xyloglucan endotransgluc...    357   4e-117   
ref|XP_002875095.1|  endoxyloglucan transferase                         357   6e-117   
ref|XP_010906322.1|  PREDICTED: probable xyloglucan endotransgluc...    357   7e-117   
ref|XP_006395846.1|  hypothetical protein EUTSA_v10004560mg             355   1e-116   
gb|ABK92940.1|  unknown                                                 356   1e-116   Populus trichocarpa [western balsam poplar]
gb|EYU43720.1|  hypothetical protein MIMGU_mgv1a0191281mg               353   2e-116   
ref|XP_004142816.1|  PREDICTED: probable xyloglucan endotransgluc...    355   2e-116   
ref|XP_006305074.1|  hypothetical protein CARUB_v10009442mg             357   2e-116   
ref|XP_010496847.1|  PREDICTED: probable xyloglucan endotransgluc...    355   2e-116   
ref|XP_002892825.1|  hypothetical protein ARALYDRAFT_471659             355   2e-116   
gb|AAK30204.1|AF349963_1  endoxyloglucan transferase                    355   3e-116   Daucus carota [carrots]
emb|CDY33745.1|  BnaA09g45510D                                          354   3e-116   
ref|XP_008454733.1|  PREDICTED: probable xyloglucan endotransgluc...    355   3e-116   
ref|XP_006849428.1|  hypothetical protein AMTR_s00024p00025540          354   3e-116   
ref|XP_006291465.1|  hypothetical protein CARUB_v10017602mg             354   5e-116   
ref|XP_004297402.1|  PREDICTED: probable xyloglucan endotransgluc...    354   5e-116   
emb|CDX81665.1|  BnaC08g39360D                                          353   7e-116   
ref|XP_009414788.1|  PREDICTED: probable xyloglucan endotransgluc...    354   7e-116   
gb|EAY87162.1|  hypothetical protein OsI_08563                          354   1e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_006355045.1|  PREDICTED: probable xyloglucan endotransgluc...    353   1e-115   
ref|XP_006416979.1|  hypothetical protein EUTSA_v10008160mg             353   2e-115   
ref|XP_010458984.1|  PREDICTED: probable xyloglucan endotransgluc...    353   2e-115   
ref|XP_010424960.1|  PREDICTED: probable xyloglucan endotransgluc...    353   2e-115   
ref|NP_001047814.1|  Os02g0696500                                       353   2e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010513916.1|  PREDICTED: probable xyloglucan endotransgluc...    352   2e-115   
gb|ADE42489.1|  xyloglucan endotransglucosylase/hydrolase 2             352   3e-115   
ref|XP_010476541.1|  PREDICTED: probable xyloglucan endotransgluc...    352   3e-115   
gb|KFK43745.1|  hypothetical protein AALP_AA1G167300                    352   3e-115   
gb|ADE42491.1|  xyloglucan endotransglucosylase/hydrolase 2             348   2e-114   
gb|AFR46578.1|  xyloglucan endotransglucosylase/hydrolase 9             347   5e-114   
ref|NP_172925.1|  probable xyloglucan endotransglucosylase/hydrol...    349   6e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004297401.1|  PREDICTED: probable xyloglucan endotransgluc...    348   2e-113   
ref|XP_009409244.1|  PREDICTED: probable xyloglucan endotransgluc...    347   3e-113   
gb|KDO60845.1|  hypothetical protein CISIN_1g019909mg                   347   4e-113   
ref|NP_001049503.1|  Os03g0239000                                       347   6e-113   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89191.1|  hypothetical protein OsI_10687                          346   7e-113   Oryza sativa Indica Group [Indian rice]
ref|XP_004236920.1|  PREDICTED: probable xyloglucan endotransgluc...    346   9e-113   
emb|CDY03100.1|  BnaC07g21270D                                          346   1e-112   
emb|CDY17630.1|  BnaA06g34490D                                          345   1e-112   
ref|XP_010496455.1|  PREDICTED: probable xyloglucan endotransgluc...    345   1e-112   
dbj|BAJ92690.1|  predicted protein                                      345   2e-112   
gb|KDO60846.1|  hypothetical protein CISIN_1g019909mg                   344   2e-112   
ref|XP_009101303.1|  PREDICTED: probable xyloglucan endotransgluc...    344   3e-112   
gb|EPS65144.1|  hypothetical protein M569_09632                         348   3e-112   
emb|CDY70985.1|  BnaAnng35740D                                          344   4e-112   
gb|KEH20811.1|  xyloglucan endotransglucosylase/hydrolase family ...    343   4e-112   
ref|XP_009129188.1|  PREDICTED: probable xyloglucan endotransgluc...    342   2e-111   
ref|XP_006854072.1|  hypothetical protein AMTR_s00048p00113910          341   2e-111   
dbj|BAA88668.1|  ETAG-A3                                                341   4e-111   Solanum lycopersicum
dbj|BAK07675.1|  predicted protein                                      341   6e-111   
gb|ACN35866.1|  unknown                                                 341   9e-111   Zea mays [maize]
ref|NP_001130874.1|  hypothetical protein precursor                     341   1e-110   Zea mays [maize]
gb|AAD45125.1|AF163821_1  endoxyloglucan transferase                    340   1e-110   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178294.1|  endoxyloglucan transferase A3                         340   1e-110   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63050.1|  putative xyloglucan-specific glucanase                  340   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145277.1|  PREDICTED: probable xyloglucan endotransgluc...    337   3e-110   
ref|XP_002465580.1|  hypothetical protein SORBIDRAFT_01g041510          339   4e-110   Sorghum bicolor [broomcorn]
ref|XP_002454441.1|  hypothetical protein SORBIDRAFT_04g031050          338   2e-109   Sorghum bicolor [broomcorn]
ref|XP_004953564.1|  PREDICTED: probable xyloglucan endotransgluc...    337   3e-109   
gb|AGT17403.1|  hypothetical protein SHCRBa_230_N09_R_40                336   5e-109   
ref|XP_003561836.1|  PREDICTED: probable xyloglucan endotransgluc...    335   1e-108   
ref|NP_001051939.1|  Os03g0854600                                       335   4e-108   Oryza sativa Japonica Group [Japonica rice]
gb|EAY92640.1|  hypothetical protein OsI_14384                          335   4e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_006650922.1|  PREDICTED: probable xyloglucan endotransgluc...    332   4e-107   
ref|XP_004985060.1|  PREDICTED: probable xyloglucan endotransgluc...    331   5e-107   
ref|XP_003572846.1|  PREDICTED: probable xyloglucan endotransgluc...    332   5e-107   
gb|ACF80442.1|  unknown                                                 330   7e-107   Zea mays [maize]
ref|XP_002529962.1|  Xyloglucan endotransglucosylase/hydrolase pr...    328   2e-106   Ricinus communis
gb|AFW72906.1|  hypothetical protein ZEAMMB73_758929                    328   4e-106   
emb|CDY09410.1|  BnaA02g26000D                                          326   5e-105   
gb|ABK24235.1|  unknown                                                 327   6e-105   Picea sitchensis
gb|ABK23681.1|  unknown                                                 325   2e-104   Picea sitchensis
ref|XP_009414090.1|  PREDICTED: probable xyloglucan endotransgluc...    325   2e-104   
ref|XP_008652681.1|  PREDICTED: probable xyloglucan endotransgluc...    324   3e-104   
ref|XP_009417676.1|  PREDICTED: probable xyloglucan endotransgluc...    324   5e-104   
ref|XP_002462345.1|  hypothetical protein SORBIDRAFT_02g024120          322   3e-103   Sorghum bicolor [broomcorn]
gb|EPS58974.1|  xyloglucan endotransglucosylase/hydrolase 14            319   6e-103   
ref|XP_003576504.1|  PREDICTED: probable xyloglucan endotransgluc...    320   1e-102   
dbj|BAK04928.1|  predicted protein                                      317   2e-101   
ref|XP_006651207.1|  PREDICTED: probable xyloglucan endotransgluc...    315   4e-101   
ref|XP_006648953.1|  PREDICTED: probable xyloglucan endotransgluc...    313   4e-101   
ref|XP_004956750.1|  PREDICTED: probable xyloglucan endotransgluc...    315   1e-100   
dbj|BAJ85889.1|  predicted protein                                      315   3e-100   
dbj|BAJ85343.1|  predicted protein                                      315   3e-100   
gb|EMS66374.1|  putative xyloglucan endotransglucosylase/hydrolas...    314   4e-100   
ref|XP_009413225.1|  PREDICTED: probable xyloglucan endotransgluc...    305   2e-97    
gb|EAZ09009.1|  hypothetical protein OsI_31270                          306   3e-97    Oryza sativa Indica Group [Indian rice]
gb|AGT17107.1|  xyloglucan endotransglucosylase/hydrolase protein       306   3e-97    
gb|EPS58610.1|  xyloglucan endotransglucosylase/hydrolase 13            304   5e-97    
gb|AFW63466.1|  hypothetical protein ZEAMMB73_807632                    309   3e-96    
gb|EAY79636.1|  hypothetical protein OsI_34780                          302   1e-95    Oryza sativa Indica Group [Indian rice]
ref|NP_001065491.1|  Os10g0577500                                       301   1e-95    Oryza sativa Japonica Group [Japonica rice]
gb|EMT10260.1|  Putative xyloglucan endotransglucosylase/hydrolas...    303   1e-95    
ref|XP_011000931.1|  PREDICTED: probable xyloglucan endotransgluc...    300   2e-95    
dbj|BAJ95159.1|  predicted protein                                      300   5e-95    
gb|ACS13756.1|  xyloglucan xyloglucosyl transferase                     300   5e-95    Hordeum vulgare [barley]
gb|KDO86570.1|  hypothetical protein CISIN_1g036126mg                   295   9e-94    
ref|XP_006491484.1|  PREDICTED: probable xyloglucan endotransgluc...    295   9e-94    
ref|XP_004983539.1|  PREDICTED: probable xyloglucan endotransgluc...    297   1e-93    
gb|EMT09688.1|  Putative xyloglucan endotransglucosylase/hydrolas...    295   5e-93    
ref|XP_006662147.1|  PREDICTED: probable xyloglucan endotransgluc...    294   6e-93    
ref|XP_011093008.1|  PREDICTED: probable xyloglucan endotransgluc...    294   7e-93    
gb|AAL34939.1|AC079037_12  Putative xyloglucan endo-transglycosylase    293   1e-92    Oryza sativa [red rice]
ref|XP_010506905.1|  PREDICTED: probable xyloglucan endotransgluc...    294   3e-92    
gb|EAY77529.1|  hypothetical protein OsI_32570                          292   5e-92    
ref|XP_002263411.1|  PREDICTED: probable xyloglucan endotransgluc...    291   8e-92    
ref|XP_006448094.1|  hypothetical protein CICLE_v10015872mg             288   2e-91    
gb|EAZ44637.1|  hypothetical protein OsJ_29257                          290   3e-91    
ref|XP_002463490.1|  hypothetical protein SORBIDRAFT_01g000710          290   5e-91    
gb|KDO60847.1|  hypothetical protein CISIN_1g019909mg                   286   8e-91    
ref|XP_008658729.1|  PREDICTED: probable xyloglucan endotransgluc...    290   8e-91    
ref|XP_006444767.1|  hypothetical protein CICLE_v10024263mg             287   9e-91    
ref|XP_010271956.1|  PREDICTED: probable xyloglucan endotransgluc...    287   3e-90    
ref|XP_003572123.1|  PREDICTED: probable xyloglucan endotransgluc...    287   5e-90    
gb|ABM68546.1|  xyloglucan endotransglycosylase                         282   7e-90    
gb|ABA54988.1|  xyloglucan endotransglycosylase hydrolase               286   1e-89    
ref|XP_002464870.1|  hypothetical protein SORBIDRAFT_01g027960          287   1e-89    
ref|XP_002266609.1|  PREDICTED: probable xyloglucan endotransgluc...    286   1e-89    
ref|XP_010463065.1|  PREDICTED: uncharacterized protein LOC104743716    291   2e-89    
gb|EYU30172.1|  hypothetical protein MIMGU_mgv1a012948mg                281   4e-89    
gb|EYU38866.1|  hypothetical protein MIMGU_mgv1a023121mg                284   6e-89    
ref|XP_003559116.1|  PREDICTED: probable xyloglucan endotransgluc...    284   2e-88    
ref|XP_009391747.1|  PREDICTED: probable xyloglucan endotransgluc...    280   2e-87    
ref|XP_010913577.1|  PREDICTED: probable xyloglucan endotransgluc...    279   5e-87    
gb|AFK43337.1|  unknown                                                 277   1e-86    
tpg|DAA46479.1|  TPA: hypothetical protein ZEAMMB73_030943              282   2e-86    
ref|XP_010682574.1|  PREDICTED: probable xyloglucan endotransgluc...    276   1e-85    
gb|EMS64042.1|  putative xyloglucan endotransglucosylase/hydrolas...    273   4e-85    
gb|EMS53881.1|  putative xyloglucan endotransglucosylase/hydrolas...    270   9e-84    
ref|XP_006661197.1|  PREDICTED: probable xyloglucan endotransgluc...    267   1e-83    
ref|XP_006355979.1|  PREDICTED: probable xyloglucan endotransgluc...    268   6e-83    
ref|XP_009623898.1|  PREDICTED: probable xyloglucan endotransgluc...    268   1e-82    
ref|XP_004238674.1|  PREDICTED: probable xyloglucan endotransgluc...    267   2e-82    
ref|XP_009795133.1|  PREDICTED: probable xyloglucan endotransgluc...    267   2e-82    
ref|XP_010044645.1|  PREDICTED: probable xyloglucan endotransgluc...    267   2e-82    
emb|CDP00178.1|  unnamed protein product                                267   3e-82    
ref|XP_011086549.1|  PREDICTED: probable xyloglucan endotransgluc...    266   5e-82    
ref|XP_009804330.1|  PREDICTED: probable xyloglucan endotransgluc...    265   1e-81    
ref|XP_008221789.1|  PREDICTED: probable xyloglucan endotransgluc...    265   1e-81    
ref|XP_010100482.1|  putative xyloglucan endotransglucosylase/hyd...    265   2e-81    
gb|KDP26566.1|  hypothetical protein JCGZ_17724                         265   2e-81    
gb|EMT25808.1|  Putative xyloglucan endotransglucosylase/hydrolas...    262   2e-81    
ref|XP_007153638.1|  hypothetical protein PHAVU_003G052400g             264   3e-81    
ref|XP_004509833.1|  PREDICTED: probable xyloglucan endotransgluc...    263   6e-81    
gb|KHN10598.1|  Putative xyloglucan endotransglucosylase/hydrolas...    263   1e-80    
ref|XP_007223169.1|  hypothetical protein PRUPE_ppa009090mg             262   1e-80    
dbj|BAH20413.1|  AT2G01850                                              260   1e-80    
ref|XP_003552017.2|  PREDICTED: probable xyloglucan endotransgluc...    262   2e-80    
gb|KHN39740.1|  Putative xyloglucan endotransglucosylase/hydrolas...    262   2e-80    
ref|XP_011071081.1|  PREDICTED: probable xyloglucan endotransgluc...    262   2e-80    
ref|XP_008446221.1|  PREDICTED: probable xyloglucan endotransgluc...    259   2e-79    
gb|EYU22485.1|  hypothetical protein MIMGU_mgv1a023829mg                258   3e-79    
ref|XP_010544004.1|  PREDICTED: probable xyloglucan endotransgluc...    259   4e-79    
gb|KEH19982.1|  xyloglucan endotransglucosylase/hydrolase family ...    258   5e-79    
ref|XP_008340024.1|  PREDICTED: probable xyloglucan endotransgluc...    258   6e-79    
gb|AFK40151.1|  unknown                                                 258   7e-79    
ref|XP_006438421.1|  hypothetical protein CICLE_v10032164mg             257   1e-78    
emb|CCH26639.1|  putative xyloglucan endotransglucosylase/hydrolase     256   2e-78    
ref|XP_004170208.1|  PREDICTED: probable xyloglucan endotransgluc...    256   3e-78    
ref|XP_004135238.1|  PREDICTED: probable xyloglucan endotransgluc...    256   5e-78    
ref|XP_002976477.1|  hypothetical protein SELMODRAFT_56624              253   8e-78    
gb|AFK37086.1|  unknown                                                 255   8e-78    
ref|NP_001169148.1|  uncharacterized protein LOC100382994               251   1e-77    
ref|XP_002973430.1|  hypothetical protein SELMODRAFT_56616              252   2e-77    
gb|ACQ85268.1|  xyloglucan endotransglycosylase/hydrolase               249   1e-76    
ref|XP_006417453.1|  hypothetical protein EUTSA_v10008234mg             252   1e-76    
emb|CDY20621.1|  BnaC08g14370D                                          251   2e-76    
emb|CDY20956.1|  BnaA08g25690D                                          252   2e-76    
ref|XP_010491392.1|  PREDICTED: probable xyloglucan endotransgluc...    251   3e-76    
emb|CDY20620.1|  BnaC08g14380D                                          251   3e-76    
ref|XP_010458404.1|  PREDICTED: probable xyloglucan endotransgluc...    251   3e-76    
ref|XP_010475924.1|  PREDICTED: probable xyloglucan endotransgluc...    251   4e-76    
gb|AFR46574.1|  xyloglucan endotransglucosylase/hydrolase 5             250   4e-76    
ref|XP_004297640.1|  PREDICTED: probable xyloglucan endotransgluc...    250   5e-76    
gb|AGT17106.1|  hypothetical protein SHCRBa_133_K20_R_210               249   6e-76    
gb|KHG29510.1|  putative xyloglucan endotransglucosylase/hydrolas...    249   1e-75    
ref|XP_009144434.1|  PREDICTED: probable xyloglucan endotransgluc...    249   1e-75    
gb|KFK43349.1|  hypothetical protein AALP_AA1G114300                    249   1e-75    
ref|XP_007019688.1|  Xyloglucan:xyloglucosyl transferase 33             249   1e-75    
ref|XP_002973138.1|  hypothetical protein SELMODRAFT_232041             247   3e-75    
gb|AAM63851.1|  putative endoxyloglucan transferase                     248   4e-75    
ref|NP_172525.1|  probable xyloglucan endotransglucosylase/hydrol...    248   5e-75    
ref|XP_002892577.1|  hypothetical protein ARALYDRAFT_471170             247   9e-75    
gb|ACQ85267.1|  xyloglucan endotransglycosylase/hydrolase               243   3e-74    
ref|XP_008678981.1|  PREDICTED: probable xyloglucan endotransgluc...    245   4e-74    
ref|XP_011040569.1|  PREDICTED: probable xyloglucan endotransgluc...    245   5e-74    
gb|ACN27223.1|  unknown                                                 243   5e-74    
ref|XP_002981828.1|  hypothetical protein SELMODRAFT_115266             242   7e-74    
gb|ABM91064.1|  xyloglucan endotransglycosylase/hydrolase precurs...    244   9e-74    
ref|XP_011028249.1|  PREDICTED: probable xyloglucan endotransgluc...    240   2e-73    
ref|XP_002982797.1|  hypothetical protein SELMODRAFT_117370             240   3e-73    
ref|XP_002320268.2|  xyloglucan endotransglucosylase/hydrolase pr...    243   4e-73    
ref|XP_006305398.1|  hypothetical protein CARUB_v10009787mg             240   4e-72    
gb|AFK33963.1|  unknown                                                 234   6e-71    
gb|ABK23544.1|  unknown                                                 236   2e-70    
ref|XP_002863180.1|  predicted protein                                  228   1e-67    
gb|ABK28571.1|  unknown                                                 228   2e-67    
ref|NP_189141.1|  xyloglucan endotransglucosylase/hydrolase 3           228   2e-67    
ref|XP_006648273.1|  PREDICTED: probable xyloglucan endotransgluc...    226   3e-67    
ref|XP_010496005.1|  PREDICTED: xyloglucan endotransglucosylase/h...    226   7e-67    
dbj|BAJ93263.1|  predicted protein                                      223   3e-66    
ref|XP_010473997.1|  PREDICTED: xyloglucan endotransglucosylase/h...    228   3e-66    
ref|XP_010450803.1|  PREDICTED: xyloglucan endotransglucosylase/h...    224   3e-66    
ref|XP_002863184.1|  predicted protein                                  223   3e-66    
ref|XP_002863177.1|  hypothetical protein ARALYDRAFT_359039             223   7e-66    
ref|XP_002883570.1|  hypothetical protein ARALYDRAFT_899104             223   8e-66    
ref|XP_010440650.1|  PREDICTED: xyloglucan endotransglucosylase/h...    223   1e-65    
ref|XP_009413141.1|  PREDICTED: probable xyloglucan endotransgluc...    223   1e-65    
gb|AEX07607.1|  xyloglucosyl transferase 3                              222   2e-65    
ref|XP_009418633.1|  PREDICTED: probable xyloglucan endotransgluc...    222   2e-65    
ref|XP_001765152.1|  predicted protein                                  220   3e-65    
ref|NP_193045.1|  xyloglucan endotransglucosylase/hydrolase 2           221   4e-65    
ref|XP_008678978.1|  PREDICTED: uncharacterized protein LOC103653...    226   6e-65    
gb|ADJ67812.1|  xyloglucan endotransglycosylase                         221   6e-65    
gb|AAN62784.1|  Putative cellulase                                      219   8e-65    
ref|XP_010104199.1|  Xyloglucan endotransglucosylase/hydrolase pr...    221   8e-65    
emb|CDX99172.1|  BnaA06g18630D                                          221   9e-65    
ref|NP_193044.2|  xyloglucan endotransglucosylase/hydrolase 1           221   1e-64    
ref|XP_009412280.1|  PREDICTED: probable xyloglucan endotransgluc...    220   1e-64    
emb|CAB45507.1|  endoxyloglucan transferase-like protein                220   1e-64    
gb|EMS54878.1|  putative xyloglucan endotransglucosylase/hydrolas...    218   1e-64    
ref|NP_001048699.1|  Os03g0108300                                       221   1e-64    
ref|XP_008678979.1|  PREDICTED: uncharacterized protein LOC103653...    224   2e-64    
ref|XP_009398020.1|  PREDICTED: probable xyloglucan endotransgluc...    220   2e-64    
ref|XP_009386049.1|  PREDICTED: probable xyloglucan endotransgluc...    219   2e-64    
ref|XP_009766795.1|  PREDICTED: xyloglucan endotransglucosylase/h...    219   2e-64    
ref|XP_009150317.1|  PREDICTED: probable xyloglucan endotransgluc...    219   3e-64    
ref|XP_010513810.1|  PREDICTED: xyloglucan endotransglucosylase/h...    219   3e-64    
gb|KFK29696.1|  hypothetical protein AALP_AA7G166900                    219   4e-64    
ref|XP_006300154.1|  hypothetical protein CARUB_v10016385mg             219   4e-64    
ref|XP_008678980.1|  PREDICTED: probable xyloglucan endotransgluc...    221   5e-64    
gb|AEK32594.1|  xyloglucan endotransglucosylase/hydrolase               219   5e-64    
gb|KDP32131.1|  hypothetical protein JCGZ_12592                         218   6e-64    
ref|XP_003632454.1|  PREDICTED: putative xyloglucan endotransgluc...    218   7e-64    
ref|XP_011099425.1|  PREDICTED: probable xyloglucan endotransgluc...    218   7e-64    
ref|XP_004983770.1|  PREDICTED: probable xyloglucan endotransgluc...    219   8e-64    
ref|XP_003559007.1|  PREDICTED: probable xyloglucan endotransgluc...    219   8e-64    
emb|CDY31016.1|  BnaC03g55190D                                          218   8e-64    
ref|XP_010677534.1|  PREDICTED: probable xyloglucan endotransgluc...    218   1e-63    
ref|XP_010466925.1|  PREDICTED: xyloglucan endotransglucosylase/h...    218   1e-63    
ref|XP_010488614.1|  PREDICTED: xyloglucan endotransglucosylase/h...    218   1e-63    
gb|AFN71023.1|  xyloglucan endotransglucosylase/hydrolase               218   1e-63    
ref|XP_009382126.1|  PREDICTED: probable xyloglucan endotransgluc...    218   1e-63    
ref|XP_010245633.1|  PREDICTED: probable xyloglucan endotransgluc...    217   1e-63    
gb|AEQ37177.1|  xyloglucan endotransglucosylase/hydrolase               218   1e-63    
ref|XP_009792284.1|  PREDICTED: probable xyloglucan endotransgluc...    217   2e-63    
ref|XP_006443586.1|  hypothetical protein CICLE_v10023425mg             217   2e-63    
ref|XP_009625718.1|  PREDICTED: xyloglucan endotransglucosylase/h...    217   2e-63    
gb|KHG21816.1|  putative xyloglucan endotransglucosylase/hydrolas...    217   3e-63    
ref|XP_006848333.1|  hypothetical protein AMTR_s00013p00167480          214   3e-63    
ref|XP_002521076.1|  Xyloglucan endotransglucosylase/hydrolase pr...    216   5e-63    
ref|XP_009392942.1|  PREDICTED: probable xyloglucan endotransgluc...    216   6e-63    
ref|XP_008237031.1|  PREDICTED: probable xyloglucan endotransgluc...    216   6e-63    
emb|CDP02651.1|  unnamed protein product                                216   6e-63    
gb|ADK92389.1|  xyloglucan endotransglycosylase                         216   8e-63    
ref|XP_006662567.1|  PREDICTED: probable xyloglucan endotransgluc...    216   9e-63    
ref|XP_009394629.1|  PREDICTED: probable xyloglucan endotransgluc...    215   9e-63    
emb|CDY00753.1|  BnaC03g37370D                                          215   1e-62    
ref|XP_004288290.1|  PREDICTED: probable xyloglucan endotransgluc...    215   1e-62    
ref|XP_010550327.1|  PREDICTED: probable xyloglucan endotransgluc...    215   1e-62    
ref|XP_002310324.1|  xyloglucan endotransglycosylase hydrolase 2 ...    215   2e-62    
ref|XP_009390370.1|  PREDICTED: probable xyloglucan endotransgluc...    215   2e-62    
ref|XP_001752695.1|  predicted protein                                  214   2e-62    
ref|NP_001141552.1|  uncharacterized protein LOC100273667 precursor     215   2e-62    
ref|XP_010913492.1|  PREDICTED: putative xyloglucan endotransgluc...    214   2e-62    
gb|EYU44533.1|  hypothetical protein MIMGU_mgv1a011266mg                214   3e-62    
gb|ACB86852.1|  xyloglucan endotransglycosylase                         214   3e-62    
ref|XP_009628114.1|  PREDICTED: probable xyloglucan endotransgluc...    214   3e-62    
ref|XP_010685035.1|  PREDICTED: xyloglucan endotransglucosylase/h...    214   3e-62    
ref|XP_008805707.1|  PREDICTED: probable xyloglucan endotransgluc...    214   3e-62    
ref|XP_009135205.1|  PREDICTED: xyloglucan endotransglucosylase/h...    214   4e-62    
ref|XP_011021810.1|  PREDICTED: probable xyloglucan endotransgluc...    214   5e-62    
ref|XP_010646925.1|  PREDICTED: probable xyloglucan endotransgluc...    213   5e-62    
ref|XP_006284203.1|  hypothetical protein CARUB_v10005358mg             214   5e-62    
ref|XP_010908974.1|  PREDICTED: probable xyloglucan endotransgluc...    213   6e-62    
ref|XP_009102440.1|  PREDICTED: xyloglucan endotransglucosylase/h...    213   7e-62    
ref|XP_007205666.1|  hypothetical protein PRUPE_ppa009472mg             213   7e-62    
gb|KHG03304.1|  putative xyloglucan endotransglucosylase/hydrolas...    213   8e-62    
ref|XP_009135204.1|  PREDICTED: xyloglucan endotransglucosylase/h...    213   1e-61    
ref|XP_008806512.1|  PREDICTED: xyloglucan endotransglucosylase/h...    213   1e-61    
ref|XP_010935831.1|  PREDICTED: probable xyloglucan endotransgluc...    213   1e-61    
ref|XP_009773101.1|  PREDICTED: probable xyloglucan endotransgluc...    212   1e-61    
emb|CDX73839.1|  BnaA03g32080D                                          212   2e-61    
dbj|BAC45131.1|  putative xyloglucan endo-transglycosylase              212   2e-61    
ref|XP_010470043.1|  PREDICTED: putative xyloglucan endotransgluc...    212   2e-61    
ref|XP_009138533.1|  PREDICTED: probable xyloglucan endotransgluc...    212   2e-61    
ref|XP_011073659.1|  PREDICTED: probable xyloglucan endotransgluc...    212   2e-61    
gb|ABC55454.2|  xyloglucan endotransglucosylase/hydrolase 2             211   2e-61    
ref|XP_004487062.1|  PREDICTED: probable xyloglucan endotransgluc...    212   3e-61    
gb|ADO24300.1|  xyloglucan endotransglucosylase/hydrolase               211   3e-61    
ref|NP_001234475.1|  xyloglucan endotransglucosylase-hydrolase XTH7     211   3e-61    
gb|EAY79406.1|  hypothetical protein OsI_34534                          212   3e-61    
ref|XP_004957690.1|  PREDICTED: probable xyloglucan endotransgluc...    212   3e-61    
ref|NP_001065209.2|  Os10g0545500                                       212   3e-61    
ref|XP_010099402.1|  putative xyloglucan endotransglucosylase/hyd...    211   3e-61    
ref|XP_006284228.1|  hypothetical protein CARUB_v10005387mg             211   4e-61    
ref|XP_006291596.1|  hypothetical protein CARUB_v10017750mg             211   4e-61    
ref|XP_010031407.1|  PREDICTED: probable xyloglucan endotransgluc...    211   4e-61    
ref|XP_006418675.1|  hypothetical protein EUTSA_v10002629mg             211   4e-61    
ref|XP_003530856.1|  PREDICTED: xyloglucan endotransglucosylase/h...    211   4e-61    
ref|XP_009415319.1|  PREDICTED: probable xyloglucan endotransgluc...    211   4e-61    
ref|XP_006414974.1|  hypothetical protein EUTSA_v10026812mg             211   4e-61    
gb|AIE54304.1|  xyloglucan endotransglucosylase-hydrolase XTH7          211   4e-61    
tpg|DAA62696.1|  TPA: xyloglucan endotransglucosylase/hydrolase p...    211   5e-61    
ref|XP_002866931.1|  hypothetical protein ARALYDRAFT_490836             211   6e-61    
ref|XP_006363788.1|  PREDICTED: probable xyloglucan endotransgluc...    211   6e-61    
ref|XP_006280895.1|  hypothetical protein CARUB_v10026888mg             211   6e-61    
gb|EAZ03861.1|  hypothetical protein OsI_25995                          211   7e-61    
ref|XP_010463516.1|  PREDICTED: probable xyloglucan endotransgluc...    210   7e-61    
ref|XP_008779033.1|  PREDICTED: probable xyloglucan endotransgluc...    210   7e-61    
ref|XP_002519471.1|  Xyloglucan endotransglucosylase/hydrolase pr...    211   7e-61    
gb|ABK21200.1|  unknown                                                 210   8e-61    
gb|KDP26372.1|  hypothetical protein JCGZ_17530                         210   8e-61    
ref|NP_195494.1|  xyloglucan endotransglucosylase/hydrolase prote...    210   8e-61    
ref|XP_009611598.1|  PREDICTED: probable xyloglucan endotransgluc...    210   8e-61    
gb|ABK22838.1|  unknown                                                 210   8e-61    
ref|XP_002301792.2|  xyloglucan endotransglucosylase/hydrolase pr...    209   8e-61    
ref|XP_006411851.1|  hypothetical protein EUTSA_v10025884mg             210   8e-61    
gb|ADO24304.1|  putative xyloglucan endotransglucosylase/hydrolase      210   9e-61    
ref|XP_011024646.1|  PREDICTED: xyloglucan endotransglucosylase/h...    210   1e-60    
gb|AAM62514.1|  endo-xyloglucan transferase-like protein                210   1e-60    
emb|CDY00754.1|  BnaC03g37380D                                          210   1e-60    
dbj|BAN09212.1|  xyloglucan endotransglucosylase/hydrolase              210   1e-60    
gb|AAP45169.2|  Probable xyloglucan endotransglucosylase/hydrolas...    206   1e-60    
gb|EAZ16868.1|  hypothetical protein OsJ_32344                          210   1e-60    



>ref|XP_009764906.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nicotiana sylvestris]
Length=343

 Score =   493 bits (1268),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 239/334 (72%), Positives = 279/334 (84%), Gaps = 5/334 (1%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
             FF + F++   AA +V+T PF  GF+ L+GE NIL +T D S++LHLN  +GSGF+SSDL
Sbjct  15    FFHVCFIT-ADAALNVSTIPFSDGFSHLFGEGNILHATDDKSLQLHLNQRTGSGFKSSDL  73

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y+HGFFSAKIKLPSDYTAGIVVAFYTTN D+F KTHDELDFEFLGN++GK WRFQTNMYG
Sbjct  74    YTHGFFSAKIKLPSDYTAGIVVAFYTTNGDLFTKTHDELDFEFLGNIRGKAWRFQTNMYG  133

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGSTSRGREERY LWFDPSKEFHRYSILWT + IIFYIDDVPIRE++RN+AMGGD+P KP
Sbjct  134   NGSTSRGREERYYLWFDPSKEFHRYSILWTIKNIIFYIDDVPIREIVRNDAMGGDYPSKP  193

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             MGLYATIWDASDWATSGG+YK NYKYAPF+A FTDLVL GCA DPL++VV  +P     D
Sbjct  194   MGLYATIWDASDWATSGGKYKTNYKYAPFIAEFTDLVLNGCAMDPLEQVVN-NPSCDEKD  252

Query  359   DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKET  180
             D  EL+ ADF+ +TP+QR AMKRFR K+MYYSYCYDS+RY+VPPPEC ID  E+Q FKET
Sbjct  253   D--ELQKADFSRITPRQRMAMKRFRSKYMYYSYCYDSLRYSVPPPECEIDHVEQQHFKET  310

Query  179   GRLKFEkrhhrrgkrssrSEVFERTNYGSNQDED  78
             GRLKF K  H R  + +RS+V +  N+G NQDE+
Sbjct  311   GRLKFNKHGHHRHAKRTRSQVLDARNHG-NQDEE  343



>gb|AIL30514.1| xyloglucan endotransglucosylase-hydrolase XTH5 [Nicotiana tabacum]
Length=342

 Score =   487 bits (1254),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 238/334 (71%), Positives = 280/334 (84%), Gaps = 6/334 (2%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
             FF + F++   AA +V+T PF  GF+ L+GE NIL +T D S++LHLN  +GSGF+SSDL
Sbjct  15    FFHVCFIT-ADAALNVSTIPFSDGFSHLFGEGNILHATDDKSLQLHLNQRTGSGFKSSDL  73

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y+HGFFSAKIKLPSDYTAGIVVAFYTTN D+F KTHDELDFEFLG+++GK WRFQTNMYG
Sbjct  74    YTHGFFSAKIKLPSDYTAGIVVAFYTTNGDLFTKTHDELDFEFLGSIRGKAWRFQTNMYG  133

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGSTSRGREERY LWFDPSKEFHRYSILWT + IIFYIDDVPIRE++RN+AMGGD+P KP
Sbjct  134   NGSTSRGREERYYLWFDPSKEFHRYSILWTIKNIIFYIDDVPIREIVRNDAMGGDYPSKP  193

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             MGLYATIWDASDWATSGG+YK NYKYAPF+A FTDLVL GCA DPL++VV  +P     D
Sbjct  194   MGLYATIWDASDWATSGGKYKTNYKYAPFIAEFTDLVLNGCAMDPLEQVVN-NPSCDEKD  252

Query  359   DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKET  180
             D  EL+ ADF+ +TP+QR AMKRFR K+MYYSYCYDS+RY+VPPPEC ID  E+Q FKET
Sbjct  253   D--ELQKADFSRITPRQRMAMKRFRSKYMYYSYCYDSLRYSVPPPECEIDPIEQQHFKET  310

Query  179   GRLKFEkrhhrrgkrssrSEVFERTNYGSNQDED  78
             GRLKF  +HH R  + ++S+V +  NYG NQDE+
Sbjct  311   GRLKFN-KHHHRHPKRTKSQVLDARNYG-NQDEE  342



>ref|XP_009608904.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nicotiana tomentosiformis]
Length=339

 Score =   484 bits (1247),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 235/332 (71%), Positives = 277/332 (83%), Gaps = 5/332 (2%)
 Frame = -1

Query  1073  LIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYS  894
              + F  + + A +V+T PF  GF+ L+GE NIL +T D S++LHLN  +GSGF+SSDLY+
Sbjct  13    FLFFHVWFSTALNVSTIPFSDGFSHLFGEGNILHATDDKSLQLHLNQRTGSGFKSSDLYN  72

Query  893   HGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNG  714
             HGFFSAKIKLPSDYTAGIVVAFYTTN D+F +THDELDFEFLGN++GK WRFQTNMYGNG
Sbjct  73    HGFFSAKIKLPSDYTAGIVVAFYTTNGDLFTQTHDELDFEFLGNIRGKAWRFQTNMYGNG  132

Query  713   STSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMG  534
             STSRGREERY LWFDPSKEFHRYSILWTN+ IIFYIDDVPIRE++RN+AMGGD+P KPMG
Sbjct  133   STSRGREERYYLWFDPSKEFHRYSILWTNKNIIFYIDDVPIREIVRNDAMGGDYPSKPMG  192

Query  533   LYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR  354
             LYATIWDASDWATSGG+YK NYKYAPF+A FTDLVL GCA DPL++VV  +P     DD 
Sbjct  193   LYATIWDASDWATSGGKYKTNYKYAPFIAEFTDLVLNGCAMDPLEQVVN-NPSCDEKDD-  250

Query  353   RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGR  174
              EL+ AD + +TP+QR AMKRFR K+MYYSYCYDS+RY+VPPPEC ID  E+Q FKETGR
Sbjct  251   -ELQKADVSRITPRQRMAMKRFRSKYMYYSYCYDSLRYSVPPPECEIDPIEQQHFKETGR  309

Query  173   LKFEkrhhrrgkrssrSEVFERTNYGSNQDED  78
             LKF  +HH R  + ++S+V +  NYG NQDE+
Sbjct  310   LKFN-KHHHRHPKRTKSQVLDARNYG-NQDEE  339



>ref|XP_006354588.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Solanum tuberosum]
Length=342

 Score =   484 bits (1246),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 239/335 (71%), Positives = 282/335 (84%), Gaps = 8/335 (2%)
 Frame = -1

Query  1073  LIAFLSYTAAAF-DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLY  897
             L+ F  +   AF DV+T PF++GF+ L+G+ NIL +  D+S++LHLN  +GSGF+SSDLY
Sbjct  13    LLFFHVWLCRAFNDVSTIPFNKGFSHLFGDGNILHANDDNSLQLHLNQNTGSGFKSSDLY  72

Query  896   SHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGN  717
             +HGFFSAKIKLPSDYTAGIVVAFYTTN DVF+KTHDELDFEFLGN++GK WRFQTNMYGN
Sbjct  73    NHGFFSAKIKLPSDYTAGIVVAFYTTNQDVFKKTHDELDFEFLGNIRGKAWRFQTNMYGN  132

Query  716   GSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPM  537
             GST RGREERY LWFDPSKEFHRYSILWTN+ IIFYIDDVPIRE++RN+AMGGD+P KPM
Sbjct  133   GSTHRGREERYTLWFDPSKEFHRYSILWTNKNIIFYIDDVPIREIVRNDAMGGDYPSKPM  192

Query  536   GLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDD  357
             GLYATIWDASDWATSGG+YK NYKYAPF+A FTDLVL GCA DPL++VV  +P +  CD+
Sbjct  193   GLYATIWDASDWATSGGKYKTNYKYAPFIAEFTDLVLNGCAMDPLEQVV--NPSL--CDE  248

Query  356   RR-ELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKET  180
             +  EL+ ADF+ +T +QR AMKRFR K+MYYSYCYDS+RY+VPPPEC ID  E+Q FKET
Sbjct  249   KDVELQKADFSRITSRQRMAMKRFRAKYMYYSYCYDSLRYSVPPPECEIDPVEQQSFKET  308

Query  179   GRLKF-EkrhhrrgkrssrSEVFERTNYGSNQDED  78
             GRLKF  K H  R  + SRSEV +  NYG N+DE+
Sbjct  309   GRLKFINKHHGHRHPKKSRSEVLDARNYG-NEDEE  342



>ref|NP_001234470.1| xyloglucan endotransglucosylase-hydrolase XTH5 precursor [Solanum 
lycopersicum]
 gb|AAS46240.1| xyloglucan endotransglucosylase-hydrolase XTH5 [Solanum lycopersicum]
Length=337

 Score =   479 bits (1232),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 235/335 (70%), Positives = 280/335 (84%), Gaps = 8/335 (2%)
 Frame = -1

Query  1073  LIAFLSYTAAAF-DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLY  897
             L  F  +   AF DV+T PF++GF+ L+G+ NIL +  D+S++LHLN  +GSGF+SSDLY
Sbjct  8     LFFFHVWFCRAFNDVSTIPFNKGFSHLFGDGNILHANDDNSLQLHLNQNTGSGFKSSDLY  67

Query  896   SHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGN  717
             +HGFFSAKIKLPSDYTAGIVVAFYTTN DVF+KTHDELDFEFLGN+KGK WRFQTNMYGN
Sbjct  68    NHGFFSAKIKLPSDYTAGIVVAFYTTNQDVFKKTHDELDFEFLGNIKGKAWRFQTNMYGN  127

Query  716   GSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPM  537
             GST RGREERY LWFDPSKEFHRYSILWTN+ IIFYIDDVPIRE++RN+AMGGD+P KPM
Sbjct  128   GSTHRGREERYTLWFDPSKEFHRYSILWTNKNIIFYIDDVPIREIVRNDAMGGDYPSKPM  187

Query  536   GLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDD  357
             GLYATIWDASDWATSGG+YK NYKYAPF+A FTDLVL GCA DPL++VV  +P +  CD+
Sbjct  188   GLYATIWDASDWATSGGKYKTNYKYAPFIAEFTDLVLNGCAMDPLEQVV--NPSL--CDE  243

Query  356   RR-ELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKET  180
             +  EL+ +DF+ +T +QR +MKRFR K+MYYSYCYDS+RY+VPPPEC ID  E+Q FKET
Sbjct  244   KDVELQKSDFSRITSRQRMSMKRFRAKYMYYSYCYDSLRYSVPPPECEIDPVEQQHFKET  303

Query  179   GRLKF-EkrhhrrgkrssrSEVFERTNYGSNQDED  78
             GRLKF  K H  R  + ++SEV +   YG N+DE+
Sbjct  304   GRLKFINKHHGHRHPKKTKSEVLDARKYG-NEDEE  337



>ref|XP_011093429.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Sesamum indicum]
Length=339

 Score =   473 bits (1216),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 228/324 (70%), Positives = 264/324 (81%), Gaps = 7/324 (2%)
 Frame = -1

Query  1049  AAAF-DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             AAAF +++ TPF +GF+ L+GESN+  S    SV+LHLN  +GSGF+SSDLYSHGFFSAK
Sbjct  20    AAAFINISATPFTKGFSPLFGESNVFPSADGRSVQLHLNQYTGSGFKSSDLYSHGFFSAK  79

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLPS+YTAGIVVAFYTTN D+F KTHDELDFEFLGN++GK WRFQTNMYGNGSTSRGRE
Sbjct  80    IKLPSNYTAGIVVAFYTTNGDMFRKTHDELDFEFLGNIRGKAWRFQTNMYGNGSTSRGRE  139

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDPSK FHRY+ILWT   IIFYIDDVPIRE++RN+AMG DFP KPM LYATIWD
Sbjct  140   ERYYLWFDPSKHFHRYTILWTTNNIIFYIDDVPIREIVRNDAMGADFPSKPMALYATIWD  199

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR-RELEGA  336
             ASDWATSGG+Y+ NYKYAPFVA FTDLVL GC  DPL+EVV        C DR  EL  +
Sbjct  200   ASDWATSGGKYRANYKYAPFVAEFTDLVLHGCPTDPLEEVVA-----ASCSDRDDELTSS  254

Query  335   DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKFEkr  156
             +FA++TPKQR AMK FR KH+YYSYCYD +RY VPPPECVID  E QQFK TGRLKF+++
Sbjct  255   EFASITPKQRLAMKEFRGKHIYYSYCYDRLRYPVPPPECVIDPTELQQFKNTGRLKFDEK  314

Query  155   hhrrgkrssrSEVFERTNYGSNQD  84
             HH+R  +  + EV    +YG+ +D
Sbjct  315   HHQRRFKKRKGEVLGDKSYGNQED  338



>ref|XP_011086421.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Sesamum indicum]
Length=356

 Score =   472 bits (1215),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 224/331 (68%), Positives = 261/331 (79%), Gaps = 14/331 (4%)
 Frame = -1

Query  1127  QTKSMAVPPYLLHSSAFFLIAFLS--------YTAAAFDVTTTPFDQGFTTLYGESNILR  972
             Q  S+  P  +L    F LI  +S        +  +AF+++T PF  GFT L+GE NI+ 
Sbjct  5     QFHSLQPPMMILMVIIFLLILHVSSSFAAPPRHAPSAFNISTIPFTTGFTPLFGEPNIIP  64

Query  971   STSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTH  792
             S    SV+LHLN  +GSGFRSSDLY+HG FSAKIKLPSDYTAGIVVAFYTTN D+F KTH
Sbjct  65    SADHQSVQLHLNQYTGSGFRSSDLYNHGLFSAKIKLPSDYTAGIVVAFYTTNGDIFRKTH  124

Query  791   DELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIF  612
             DELDFEFLGN++GK WRFQTNMYGNGST+RGREERY LWFDPSKEFH YSILWT + IIF
Sbjct  125   DELDFEFLGNIRGKAWRFQTNMYGNGSTNRGREERYYLWFDPSKEFHTYSILWTTKNIIF  184

Query  611   YIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDL  432
             YIDDVPIRE++RN+AMG DFP KPMGLYATIWDASDWATSGG+Y+ NYKYAPFVA FTDL
Sbjct  185   YIDDVPIREIVRNDAMGADFPSKPMGLYATIWDASDWATSGGKYRANYKYAPFVAEFTDL  244

Query  431   VLRGCAADPLQEVVGEHPGVGGCDDR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCY  255
             +L GC  DPL+EVV        C +R  +L  ADFA++TPKQ+ AMK+FR K+MYYSYCY
Sbjct  245   ILHGCPMDPLEEVVAT-----VCAERDNQLASADFASITPKQKLAMKKFRSKYMYYSYCY  299

Query  254   DSVRYAVPPPECVIDAAERQQFKETGRLKFE  162
             D++RY VP PECV+D  ERQ FK+TGRLKF+
Sbjct  300   DTLRYPVPLPECVVDPVERQLFKDTGRLKFD  330



>gb|EYU40279.1| hypothetical protein MIMGU_mgv1a009338mg [Erythranthe guttata]
Length=345

 Score =   464 bits (1195),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 216/295 (73%), Positives = 245/295 (83%), Gaps = 7/295 (2%)
 Frame = -1

Query  1040  FDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLP  861
             F+++  PF +GF+ L+GE NI+ S  D SV+LHLN  +GSGF+SSDLY+HGFFSAKIKLP
Sbjct  30    FNISNIPFSKGFSPLFGEGNIIHSQDDQSVQLHLNQFTGSGFKSSDLYNHGFFSAKIKLP  89

Query  860   SDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYL  681
             SDYTAGIVVAFYTTN D+F KTHDELDFEFLGN++GK WRFQTNMYGNGST+RGREERY 
Sbjct  90    SDYTAGIVVAFYTTNGDIFRKTHDELDFEFLGNIRGKAWRFQTNMYGNGSTNRGREERYS  149

Query  680   LWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDW  501
             LWFDPSK+FH YSILWT   IIFYIDDVPIRE+ R EAMGGDFP KPMGLYATIWDASDW
Sbjct  150   LWFDPSKDFHSYSILWTTNNIIFYIDDVPIREITRKEAMGGDFPSKPMGLYATIWDASDW  209

Query  500   ATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR--RELEGADFA  327
             ATSGG+YK NYKYAPFVA FTDLVL GCA DPL+EVVG       C +    +L  ADF 
Sbjct  210   ATSGGKYKTNYKYAPFVAEFTDLVLHGCATDPLEEVVGPL-----CSEEIDEQLANADFT  264

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKFE  162
              +TPKQ+ AMK+FR K+MYYSYC+D+VRY VPPPECV D+AER  FKE GR KF+
Sbjct  265   KITPKQKLAMKKFRLKYMYYSYCHDTVRYPVPPPECVFDSAERWLFKENGRPKFD  319



>gb|ACD03224.1| xyloglucan endotransglucosylase/hydrolase 14 [Actinidia deliciosa]
Length=342

 Score =   463 bits (1192),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 212/294 (72%), Positives = 251/294 (85%), Gaps = 4/294 (1%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             A F++ T PF++G+  L+G++N++RS+ D SV L LN  +GSGF+SSDLY+HGFFSAKIK
Sbjct  27    AEFNIATIPFNKGYYPLFGDNNVVRSSDDKSVNLVLNQYTGSGFKSSDLYNHGFFSAKIK  86

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LPSDYTAGIVVAFYT+N D+FEKTHDELDFEFLGN++GK WRFQTN+YGNGSTSRGREER
Sbjct  87    LPSDYTAGIVVAFYTSNGDIFEKTHDELDFEFLGNIRGKRWRFQTNVYGNGSTSRGREER  146

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDPSKEFHRYSILWTN  IIFYID+VPIRE++R+EAMGGDFP KPM LYATIWDAS
Sbjct  147   YYLWFDPSKEFHRYSILWTNSNIIFYIDEVPIREIVRSEAMGGDFPSKPMSLYATIWDAS  206

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFA  327
             +WATSGG+YKVNYKY+PFVA FTDL L GCA DP+QEV+         DD  +L+ AD+A
Sbjct  207   NWATSGGKYKVNYKYSPFVAKFTDLALHGCAVDPIQEVLST--SCSQKDD--QLKSADYA  262

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             ++TPKQR  MK+FRQK+MYYSYCYD +RY +  PECVID  ER+QFK+TGRL F
Sbjct  263   SITPKQRSTMKKFRQKYMYYSYCYDIIRYPIAQPECVIDPVERRQFKDTGRLDF  316



>ref|XP_010276803.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nelumbo nucifera]
Length=341

 Score =   458 bits (1178),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 215/321 (67%), Positives = 267/321 (83%), Gaps = 5/321 (2%)
 Frame = -1

Query  1127  QTKSMAVPPYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVR  948
             + +S ++   L H S F  I+F++  AA F++TT  FD+G+T L+G+ NILRS+   SV 
Sbjct  3     RLRSSSLSRTLTHISFFLCISFVA-AAAGFNLTTIGFDEGYTPLFGDFNILRSSDGKSVS  61

Query  947   LHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFL  768
             L LN  SGSGF SS LY+HGFFSAKIKLPSDYTAG+VVAFYT+NADVFEKTHDELDFEFL
Sbjct  62    LLLNRYSGSGFISSSLYNHGFFSAKIKLPSDYTAGVVVAFYTSNADVFEKTHDELDFEFL  121

Query  767   GNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIR  588
             GNV+GK WRFQTN+YGNGST+RGREERY LWFDP++EFHRYSILWT + IIFY+D+VPIR
Sbjct  122   GNVQGKEWRFQTNVYGNGSTNRGREERYTLWFDPTREFHRYSILWTAKNIIFYVDEVPIR  181

Query  587   EMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAAD  408
             E++R++AMGGD+P KPM LYATIWDAS+WAT+GG+YKVNYKYAPFV+ F+DLVL+GC +D
Sbjct  182   EVVRSDAMGGDYPSKPMALYATIWDASNWATAGGKYKVNYKYAPFVSDFSDLVLQGCQSD  241

Query  407   PLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPP  228
             P+Q    E       D+  ELE A++A +TP++RRAM+ FRQK+MYYSYCYD +RY VPP
Sbjct  242   PIQ----EFSSTICADEDAELERAEYAVITPERRRAMRVFRQKYMYYSYCYDILRYPVPP  297

Query  227   PECVIDAAERQQFKETGRLKF  165
             PECVI  +ER++FK+TGR+KF
Sbjct  298   PECVITPSERRRFKDTGRVKF  318



>ref|XP_010663022.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Vitis vinifera]
 emb|CBI33819.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   447 bits (1151),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 206/296 (70%), Positives = 251/296 (85%), Gaps = 6/296 (2%)
 Frame = -1

Query  1049  AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKI  870
             A++F+++   FDQG+T L+GE N++RS+   SVRL L+  +GSGF S++LY+HGFFSA I
Sbjct  24    ASSFNLSVISFDQGYTHLFGEGNLVRSSDGRSVRLLLDRYTGSGFISANLYNHGFFSANI  83

Query  869   KLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREE  690
             KLPS+YTAG+VVAFYT+N DVFEKTHDELDFEFLGNVKGKPWRFQTN+YGNGSTSRGREE
Sbjct  84    KLPSEYTAGVVVAFYTSNGDVFEKTHDELDFEFLGNVKGKPWRFQTNVYGNGSTSRGREE  143

Query  689   RYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDA  510
             RY LWFDPSKEFHRYSILWT + IIFY+D+VPIRE+IRNEAMGGD+P KPM LYATIWDA
Sbjct  144   RYRLWFDPSKEFHRYSILWTAKNIIFYVDEVPIREVIRNEAMGGDYPSKPMALYATIWDA  203

Query  509   SDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR-RELEGAD  333
             S+WATSGG+YKV+Y YAPFV+ F+D VL GC ADPLQ         GGC D+  ELE  D
Sbjct  204   SNWATSGGKYKVDYNYAPFVSEFSDFVLDGCPADPLQLA-----SAGGCSDKDAELESND  258

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             ++ +TP +R +M++FRQK+MYYSYCYD++RYA P PECVI  +E+++FK+TGRLKF
Sbjct  259   YSAITPLRRISMRKFRQKYMYYSYCYDTLRYATPLPECVIIPSEKRRFKDTGRLKF  314



>ref|XP_003516952.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Glycine max]
Length=347

 Score =   447 bits (1151),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 206/300 (69%), Positives = 250/300 (83%), Gaps = 5/300 (2%)
 Frame = -1

Query  1061  LSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFF  882
              SY  AAFD+ T PF+ G++ L+G+SN++RS   + V+L L+  +GSGF SS +Y +GFF
Sbjct  26    FSYVNAAFDLATIPFNDGYSPLFGDSNVVRSEDGNGVQLRLDRYTGSGFISSSMYQYGFF  85

Query  881   SAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSR  702
             SA+IKLPS+YTAGI VAFYT+N DVFEK+HDELDFEFLGNV GKPWRFQTN+YGNGST R
Sbjct  86    SARIKLPSNYTAGICVAFYTSNGDVFEKSHDELDFEFLGNVAGKPWRFQTNLYGNGSTKR  145

Query  701   GREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYAT  522
             GREERY LWFDP+KEFHRYSILWT + +IFYID+VPIRE++R+E MGGD+P KPM LYAT
Sbjct  146   GREERYRLWFDPTKEFHRYSILWTAKNVIFYIDEVPIREVLRSEEMGGDYPSKPMSLYAT  205

Query  521   IWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRR-EL  345
             IWDAS+WATSGG+YKVNYKYAPFV  F DLVL+GC+ADP+QEV G       C D+  +L
Sbjct  206   IWDASNWATSGGKYKVNYKYAPFVTEFKDLVLKGCSADPIQEVSGTE----SCSDQHADL  261

Query  344   EGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             E  D+A VTP +R AM+RFRQ++MYYSYCYD++RY VP PECVI  +E+Q+FKETGRLKF
Sbjct  262   EAQDYAAVTPMRRLAMQRFRQRYMYYSYCYDTLRYPVPQPECVIVPSEKQRFKETGRLKF  321



>gb|KHN04842.1| Putative xyloglucan endotransglucosylase/hydrolase protein 30 
[Glycine soja]
Length=347

 Score =   446 bits (1148),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 205/300 (68%), Positives = 250/300 (83%), Gaps = 5/300 (2%)
 Frame = -1

Query  1061  LSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFF  882
              SY  AAFD+ T PF+ G++ L+G+SN++RS   + V+L L+  +GSGF SS +Y +GFF
Sbjct  26    FSYVNAAFDLATIPFNDGYSPLFGDSNVVRSEDGNGVQLRLDRYTGSGFISSSMYQYGFF  85

Query  881   SAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSR  702
             SA+IKLPS+YTAGI VAFYT+N DVFEK+HDELDFEFLGNV GKPWRFQTN+YGNGST R
Sbjct  86    SARIKLPSNYTAGICVAFYTSNGDVFEKSHDELDFEFLGNVAGKPWRFQTNLYGNGSTKR  145

Query  701   GREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYAT  522
             GREERY LWFDP+KEFHRYSILWT + +IFYID+VPIRE++++E MGGD+P KPM LYAT
Sbjct  146   GREERYRLWFDPTKEFHRYSILWTAKNVIFYIDEVPIREVLQSEEMGGDYPSKPMSLYAT  205

Query  521   IWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRR-EL  345
             IWDAS+WATSGG+YKVNYKYAPFV  F DLVL+GC+ADP+QEV G       C D+  +L
Sbjct  206   IWDASNWATSGGKYKVNYKYAPFVTEFKDLVLKGCSADPIQEVSGTE----SCSDQHADL  261

Query  344   EGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             E  D+A VTP +R AM+RFRQ++MYYSYCYD++RY VP PECVI  +E+Q+FKETGRLKF
Sbjct  262   EAQDYATVTPMRRLAMQRFRQRYMYYSYCYDTLRYPVPQPECVIVPSEKQRFKETGRLKF  321



>ref|XP_010261561.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nelumbo nucifera]
Length=346

 Score =   446 bits (1148),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 205/306 (67%), Positives = 254/306 (83%), Gaps = 6/306 (2%)
 Frame = -1

Query  1076  FLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLY  897
             F +      A  F+VTT  FD+G++ L+G+SN++RS+   SV L L+  +GSGF SS LY
Sbjct  21    FFLCISCVAATDFNVTTIRFDEGYSPLFGDSNVVRSSDGKSVHLLLDRYTGSGFISSSLY  80

Query  896   SHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGN  717
             +HGFFSAKIKLP+DYTAG+VVAFYT+N DVFEKTHDELDFEFLGN+ GK WRFQTN+YGN
Sbjct  81    NHGFFSAKIKLPADYTAGVVVAFYTSNGDVFEKTHDELDFEFLGNIHGKEWRFQTNVYGN  140

Query  716   GSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPM  537
             GST RGREERY LWFDP++EFHRYSILWT   IIFY+DDVPIR+++RN+AMGGD+P KPM
Sbjct  141   GSTHRGREERYYLWFDPTREFHRYSILWTANNIIFYVDDVPIRQVVRNDAMGGDYPSKPM  200

Query  536   GLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDD  357
              LYATIWDAS+WATSGG+YKVNY+YAPFV+HF+DLVL+GC +DP+Q++       G C +
Sbjct  201   SLYATIWDASNWATSGGKYKVNYEYAPFVSHFSDLVLQGCPSDPIQQL-----PTGSCAE  255

Query  356   R-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKET  180
             +  ELE AD+A +T ++R AMK FRQ++MYYSYCYDS+RY VPPPECV   AER++FK+T
Sbjct  256   KDAELESADYAVITQERRAAMKNFRQRYMYYSYCYDSLRYPVPPPECVTVPAERRRFKDT  315

Query  179   GRLKFE  162
             GRLKF+
Sbjct  316   GRLKFD  321



>ref|XP_004163204.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Cucumis sativus]
 emb|CCH26637.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=348

 Score =   446 bits (1148),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 206/307 (67%), Positives = 253/307 (82%), Gaps = 4/307 (1%)
 Frame = -1

Query  1082  AFFLIAFLSYTA-AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSS  906
                +  F ++ A A+F+V+T  FD+G++ L+G+ N++RS    SVRL L+  +GSGF SS
Sbjct  20    TLMIFCFCNFVANASFNVSTIRFDEGYSPLFGDGNLVRSPDGKSVRLLLDRFTGSGFISS  79

Query  905   DLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNM  726
              +Y+HGFFSA+IKLPSDYTAGIVVAFYT+N DVFEK+HDELDFEFLGN++GKPWRFQTN+
Sbjct  80    KMYNHGFFSARIKLPSDYTAGIVVAFYTSNGDVFEKSHDELDFEFLGNIEGKPWRFQTNL  139

Query  725   YGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQ  546
             YGNGST+RGREERY LWFDP+KEFHRYSILWT   IIFYID+VPIRE++RNEAMGGDFP 
Sbjct  140   YGNGSTNRGREERYRLWFDPTKEFHRYSILWTANIIIFYIDEVPIREVVRNEAMGGDFPS  199

Query  545   KPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGG  366
             KPM LYATIWDAS+WATSGG+YKVNYKYAPFV+ F DLVL GC +DP+QEV+   P    
Sbjct  200   KPMSLYATIWDASNWATSGGKYKVNYKYAPFVSEFKDLVLEGCPSDPIQEVL--EPSDCS  257

Query  365   CDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
                 R L   DF  +TP++R AM+ FRQ +MYYSYCYD++RY+VPPPECVI  +E+Q+FK
Sbjct  258   ATITR-LNAQDFTTITPERRAAMRNFRQHYMYYSYCYDTLRYSVPPPECVIIPSEKQRFK  316

Query  185   ETGRLKF  165
             ++GRLKF
Sbjct  317   DSGRLKF  323



>ref|XP_008466018.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Cucumis melo]
Length=348

 Score =   444 bits (1143),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 207/315 (66%), Positives = 254/315 (81%), Gaps = 6/315 (2%)
 Frame = -1

Query  1103  PYLLHSSAFFLIAFLSYTA-AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLS  927
             P L       +  F ++ A A+F+V+T  FD+G++ L+G+ N++RS    SVRL L+  +
Sbjct  13    PNLFLLLTLMIFCFCNFVANASFNVSTIRFDEGYSPLFGDGNLVRSPDGKSVRLLLDRFT  72

Query  926   GSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKP  747
             GSGF SS +Y+HGFFSA+IKLPSDYTAGIVVAFYT+N DVFEK HDELDFEFLGN++GKP
Sbjct  73    GSGFISSKMYNHGFFSARIKLPSDYTAGIVVAFYTSNGDVFEKNHDELDFEFLGNIEGKP  132

Query  746   WRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEA  567
             WRFQTN+YGNGST+RGREERY LWFDP+KEFHRYSILWT   IIFYID+VPIRE++RNEA
Sbjct  133   WRFQTNLYGNGSTNRGREERYRLWFDPTKEFHRYSILWTANNIIFYIDEVPIREVVRNEA  192

Query  566   MGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVG  387
             MGGD+P KPM LYATIWDAS+WATSGG+YKVNYKYAPFV+ F DLVL GC +DP+QEV+ 
Sbjct  193   MGGDYPSKPMSLYATIWDASNWATSGGKYKVNYKYAPFVSEFKDLVLEGCPSDPIQEVLE  252

Query  386   EHPGVGGCDDR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVID  210
                    C D    L   DFA +TP++R AM+ FRQ +MYYSYCYD++RY+VPPPECVI 
Sbjct  253   P----SDCSDTIARLNAQDFATITPERRAAMRNFRQHYMYYSYCYDTLRYSVPPPECVII  308

Query  209   AAERQQFKETGRLKF  165
               E+++FK++GRLKF
Sbjct  309   PTEQRRFKDSGRLKF  323



>ref|XP_004136205.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Cucumis sativus]
 gb|KGN60351.1| hypothetical protein Csa_3G900960 [Cucumis sativus]
Length=348

 Score =   444 bits (1141),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 207/314 (66%), Positives = 255/314 (81%), Gaps = 9/314 (3%)
 Frame = -1

Query  1088  SSAFFLIAFLSYT------AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLS  927
             S+ F L+  + +        A+F+V+T  FD+G++ L+G+ N++RS    SVRL L+  +
Sbjct  13    SNLFLLLTLMIFCFCNIVANASFNVSTIRFDEGYSPLFGDGNLVRSPDGKSVRLLLDRFT  72

Query  926   GSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKP  747
             GSGF SS +Y+HGFFSA+IKLPSDYTAGIVVAFYT+N DVFEK+HDELDFEFLGN++GKP
Sbjct  73    GSGFISSKMYNHGFFSARIKLPSDYTAGIVVAFYTSNGDVFEKSHDELDFEFLGNIEGKP  132

Query  746   WRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEA  567
             WRFQTN+YGNGST+RGREERY LWFDP+KEFHRYSILWT   IIFYID+VPIRE++RNEA
Sbjct  133   WRFQTNLYGNGSTNRGREERYRLWFDPTKEFHRYSILWTANIIIFYIDEVPIREVVRNEA  192

Query  566   MGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVG  387
             MGGDFP KPM LYATIWDAS+WATSGG+YKVNYKYAPFV+ F DLVL GC +DP+QEV+ 
Sbjct  193   MGGDFPSKPMSLYATIWDASNWATSGGKYKVNYKYAPFVSEFKDLVLEGCPSDPIQEVL-  251

Query  386   EHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
               P        R L   DF  +TP++R AM+ FRQ +MYYSYCYD++RY+VPPPECVI  
Sbjct  252   -EPFDCSATITR-LNAQDFTTITPERRAAMRNFRQHYMYYSYCYDTLRYSVPPPECVIIP  309

Query  206   AERQQFKETGRLKF  165
             +E+Q+FK++GRLKF
Sbjct  310   SEKQRFKDSGRLKF  323



>gb|AFK40626.1| unknown [Lotus japonicus]
Length=354

 Score =   441 bits (1134),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 250/303 (83%), Gaps = 5/303 (2%)
 Frame = -1

Query  1070  IAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSH  891
             I+F S++ AAFD+ T PF+  ++ L+G+ N++RS   + V+L L+  +GSGF SS++Y H
Sbjct  29    ISFFSFSNAAFDLATIPFNDAYSPLFGDGNLVRSADGNGVQLLLDRFTGSGFVSSNMYQH  88

Query  890   GFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGS  711
             GFFSA IKLPS+Y+AGI VAFYT+N ++FEKTHDELDFEFLGN+ GKPWRFQTN+YGNGS
Sbjct  89    GFFSANIKLPSNYSAGICVAFYTSNNEMFEKTHDELDFEFLGNIAGKPWRFQTNLYGNGS  148

Query  710   TSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGL  531
             T+RGREERY LWFDP+K FHRYSILWT + IIFYID+VPIRE+IR+E MG D+P KPM L
Sbjct  149   TNRGREERYRLWFDPTKGFHRYSILWTAKNIIFYIDEVPIREIIRSEEMGADYPAKPMAL  208

Query  530   YATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRR  351
             YATIWDAS+WATSGG+YKVNYKYAPFV    DLVL+GC+ DP+QEV         C D+ 
Sbjct  209   YATIWDASNWATSGGKYKVNYKYAPFVTEMKDLVLKGCSVDPIQEVSAREL----CSDQH  264

Query  350   -ELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGR  174
              +LE  D+A VTP +R AM+RFRQ++MYYSYCYD++RY+VPPPECVI  AE+Q+FKETGR
Sbjct  265   ADLEEQDYAAVTPLRRLAMRRFRQRYMYYSYCYDTLRYSVPPPECVIIPAEKQRFKETGR  324

Query  173   LKF  165
             L+F
Sbjct  325   LRF  327



>ref|XP_010519083.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Tarenaya hassleriana]
Length=318

 Score =   439 bits (1128),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 201/305 (66%), Positives = 247/305 (81%), Gaps = 0/305 (0%)
 Frame = -1

Query  1085  SAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSS  906
             ++FF + F+  T+A  ++T++ F++  + L+G+SN++RS  D SVRL L+  +GSGF SS
Sbjct  8     TSFFCVLFVGLTSAFNNLTSSIFEETLSPLFGDSNLVRSPDDRSVRLLLDRYTGSGFISS  67

Query  905   DLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNM  726
             ++Y HGFFSA +KLP+DY AG+VVAFYT+N DVFEKTHDELDFEFLGN+KGKPWRFQTN+
Sbjct  68    NMYQHGFFSAMVKLPADYPAGVVVAFYTSNGDVFEKTHDELDFEFLGNIKGKPWRFQTNL  127

Query  725   YGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQ  546
             YGNGST RGREERY LWFDPSKEFHRYSILWT+  IIF++DDVPIRE++R+EAMGG++PQ
Sbjct  128   YGNGSTWRGREERYRLWFDPSKEFHRYSILWTSHKIIFWVDDVPIREVVRSEAMGGEYPQ  187

Query  545   KPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGG  366
             KPM LYATIWDASDWATSGG++K NYKYAPFVA F    L GCA DP+Q++ G       
Sbjct  188   KPMALYATIWDASDWATSGGKFKANYKYAPFVADFKSFSLHGCAVDPIQQLPGSDSDPDC  247

Query  365   CDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
              D    L  +DF+ +TP QR AM+RFRQ +MYYSYCYDSVRY  P PECVID AER +F+
Sbjct  248   ADSDDLLRSSDFSTITPHQRSAMRRFRQHYMYYSYCYDSVRYPEPLPECVIDPAERDRFR  307

Query  185   ETGRL  171
             ETGRL
Sbjct  308   ETGRL  312



>ref|XP_002518990.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
 gb|EEF43523.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
Length=350

 Score =   439 bits (1130),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 204/315 (65%), Positives = 253/315 (80%), Gaps = 7/315 (2%)
 Frame = -1

Query  1100  YLLHSSAFFLIAFLSY--TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLS  927
             Y L    F L +  SY   AAAF+++T  FD+G+T L+G+ N++RS +  SVRL L+  +
Sbjct  12    YSLVFHLFILSSLSSYIANAAAFNLSTISFDEGYTPLFGDGNLVRSPNGRSVRLLLDRFT  71

Query  926   GSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKP  747
             GSGF SS +Y +GFFSA IKLP DYTAG+ VAFYT+N + FEKTHDELDFEFLGN++GKP
Sbjct  72    GSGFISSKMYEYGFFSANIKLPGDYTAGLCVAFYTSNQEAFEKTHDELDFEFLGNIEGKP  131

Query  746   WRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEA  567
             WRFQTN+YGNGST+RGREERY LWFDPSKEFHRYSILWT + IIF+IDDVPIRE++RN+ 
Sbjct  132   WRFQTNLYGNGSTNRGREERYRLWFDPSKEFHRYSILWTERNIIFFIDDVPIREVVRNDE  191

Query  566   MGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVG  387
             MG ++P KPM LYATIWDAS+WATSGG+YKVNYKYAPFV+ + DLVL GC  DP+Q++  
Sbjct  192   MGSEYPSKPMSLYATIWDASNWATSGGKYKVNYKYAPFVSEYKDLVLEGCPIDPIQQI--  249

Query  386   EHPGVGGC-DDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVID  210
               P    C +    L  AD+A +T KQR+AM+RFRQ+ MYYSYCYD++RY +PPPECVID
Sbjct  250   --PLTSSCYESNARLLAADYATITRKQRQAMRRFRQRFMYYSYCYDTLRYPLPPPECVID  307

Query  209   AAERQQFKETGRLKF  165
              AE+Q++K+TGRLKF
Sbjct  308   PAEKQRYKDTGRLKF  322



>ref|XP_007158243.1| hypothetical protein PHAVU_002G136200g [Phaseolus vulgaris]
 gb|ESW30237.1| hypothetical protein PHAVU_002G136200g [Phaseolus vulgaris]
Length=346

 Score =   439 bits (1129),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 249/295 (84%), Gaps = 5/295 (2%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             AAFD+ T PF+ G++TL+G+SN++RS      +L L+  +GSGF SS++Y +GFFSA+IK
Sbjct  30    AAFDLATIPFNDGYSTLFGDSNVVRSADGYGAQLLLDRFTGSGFISSNMYHYGFFSARIK  89

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LPS+YTAGI VAFYT+N DVFEK+HDELDFEFLGN+ GKPWRFQTN+YGNGST+RGREER
Sbjct  90    LPSNYTAGICVAFYTSNGDVFEKSHDELDFEFLGNIAGKPWRFQTNLYGNGSTNRGREER  149

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDP+KE+HRYSILWT + +IFY+D+VPIRE++R+E MGGD+P KPM LY+TIWDAS
Sbjct  150   YRLWFDPTKEYHRYSILWTAKNVIFYVDEVPIREVLRSEEMGGDYPSKPMSLYSTIWDAS  209

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE-LEGADF  330
             +WATSGG+YKVNYKYAPFV  F DLVL+GC ADP+QE+      +  C D+ E LE  D+
Sbjct  210   NWATSGGKYKVNYKYAPFVTEFKDLVLKGCPADPIQEIF----DLNSCSDQYEDLEAQDY  265

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             A +TP +R AM+RFRQ++MYYSYCYD++RY VPPPECVI  +E+Q+FKETGRL+F
Sbjct  266   AVITPTRRLAMRRFRQRYMYYSYCYDTLRYNVPPPECVIVPSEKQRFKETGRLRF  320



>ref|XP_010053644.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Eucalyptus grandis]
 gb|KCW77986.1| hypothetical protein EUGRSUZ_D02229 [Eucalyptus grandis]
Length=356

 Score =   439 bits (1129),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 211/307 (69%), Positives = 253/307 (82%), Gaps = 4/307 (1%)
 Frame = -1

Query  1085  SAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSS  906
             S F    FLS + AAFDVT   FD+G+  L+G+ N++RS + D VR+ L+  +GSGF SS
Sbjct  28    SIFIFSCFLSTSDAAFDVTPISFDEGYRPLFGDGNVVRSPAGDGVRILLDRFTGSGFISS  87

Query  905   DLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNM  726
             D+Y HGFFSAKIKLPSDYTAG+VVAFYT+N DVFEKTHDELD EFLGN++GKPWRFQTN+
Sbjct  88    DMYQHGFFSAKIKLPSDYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIRGKPWRFQTNV  147

Query  725   YGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQ  546
             YGNGSTSRGREERY LWFDP+KE+HRYSILWT   IIFY+D+VPIRE++++EAMGGDFP 
Sbjct  148   YGNGSTSRGREERYTLWFDPTKEYHRYSILWTANKIIFYVDEVPIREIVKSEAMGGDFPS  207

Query  545   KPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGG  366
             KPM LYATIWDASDWATSGGRYKVNYKYAPFVA F DLVL GC ADP++++    P  G 
Sbjct  208   KPMSLYATIWDASDWATSGGRYKVNYKYAPFVAEFKDLVLEGCMADPIRQL----PASGC  263

Query  365   CDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
                  +LE  DFA +T  QRRAM+RFR+++MYYSYCYD++RY VPPPEC+I  +E+ +FK
Sbjct  264   HAKDAQLEARDFATITSSQRRAMRRFRERYMYYSYCYDTLRYPVPPPECMIIPSEKARFK  323

Query  185   ETGRLKF  165
             +TGRLKF
Sbjct  324   DTGRLKF  330



>ref|XP_007040721.1| Xyloglucan endotransglucosylase/hydrolase protein 30 [Theobroma 
cacao]
 gb|EOY25222.1| Xyloglucan endotransglucosylase/hydrolase protein 30 [Theobroma 
cacao]
Length=352

 Score =   439 bits (1129),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 243/295 (82%), Gaps = 5/295 (2%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             AAF++TT  FD+G++ L+G+ N++RS    SVRL L+  +GSGF SS +Y HGFFSAKIK
Sbjct  31    AAFNLTTLSFDEGYSPLFGDGNLVRSPDGHSVRLLLDVYTGSGFISSSMYQHGFFSAKIK  90

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LPSDYTAGIVVAFYT+N DVFEK HDELDFEFLGN++GKPWRFQTN+YGNGST+RGREER
Sbjct  91    LPSDYTAGIVVAFYTSNGDVFEKNHDELDFEFLGNIEGKPWRFQTNLYGNGSTNRGREER  150

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDPSKEFHRYSILWT + IIFYID+VPIRE++RN+ MGGD+P KPM LYATIWDAS
Sbjct  151   YSLWFDPSKEFHRYSILWTVKNIIFYIDEVPIREVVRNDEMGGDYPSKPMSLYATIWDAS  210

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE-LEGADF  330
              WATSGG+YKVNYKYAPF + F +LVL GC  DP+QE          C DR   LE  D+
Sbjct  211   SWATSGGKYKVNYKYAPFTSEFKELVLEGCPTDPIQEFT----NASACSDRHAWLESRDY  266

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             A +TP+QR AM+RFRQ++MYYSYCYDS+RY V PPECVI   E+++F+++GRLKF
Sbjct  267   ALITPEQRAAMRRFRQRYMYYSYCYDSLRYPVTPPECVIYPTEKERFQDSGRLKF  321



>gb|KHG00933.1| putative xyloglucan endotransglucosylase/hydrolase 30 -like protein 
[Gossypium arboreum]
Length=355

 Score =   438 bits (1127),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 207/324 (64%), Positives = 253/324 (78%), Gaps = 14/324 (4%)
 Frame = -1

Query  1118  SMAVPPYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHL  939
             S  + P LL    FFL +F+ +  A F+VTT  FD+G+  L+G+ N++RS    SVRL L
Sbjct  9     SETITPSLL----FFLFSFIGFGTATFNVTTLAFDEGYNPLFGDGNLVRSPDGHSVRLLL  64

Query  938   NHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFY-----TTNADVFEKTHDELDFE  774
             +  +GSGF SS +Y HGFFSAKIKLPSDYTAGIVVAFY     T+N DVFEK HDELD E
Sbjct  65    DVYTGSGFISSRMYQHGFFSAKIKLPSDYTAGIVVAFYLWSNQTSNGDVFEKNHDELDIE  124

Query  773   FLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVP  594
             FLGN++GKPWRFQTN+YGNGST+RGREERY LWFDPSKEFHRYSILWT + IIFY+D+VP
Sbjct  125   FLGNIEGKPWRFQTNVYGNGSTNRGREERYNLWFDPSKEFHRYSILWTAKNIIFYVDEVP  184

Query  593   IREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCA  414
             IRE++RN+AMGGD+P KPM LYATIWDAS WAT+GG+YKVNY+YAPF + F DLVL GCA
Sbjct  185   IREVVRNDAMGGDYPSKPMSLYATIWDASSWATNGGKYKVNYEYAPFTSEFKDLVLDGCA  244

Query  413   ADPLQEVVGEHPGVGGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYA  237
              DP+Q+     P    C +    LE  D+A +TPK R AM+RFRQ++MYYSYCYD+VRY 
Sbjct  245   IDPIQKF----PNSTACSETDTWLESRDYAIITPKSRSAMRRFRQRYMYYSYCYDNVRYP  300

Query  236   VPPPECVIDAAERQQFKETGRLKF  165
             + PPEC +D+ E+Q+F+ TGRL+F
Sbjct  301   ITPPECAVDSNEKQRFRNTGRLRF  324



>ref|XP_010055251.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Eucalyptus grandis]
 gb|KCW71714.1| hypothetical protein EUGRSUZ_E00225 [Eucalyptus grandis]
Length=353

 Score =   438 bits (1126),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 204/293 (70%), Positives = 240/293 (82%), Gaps = 6/293 (2%)
 Frame = -1

Query  1040  FDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLP  861
             FD+    FD+ +  L+G+SN++RS    SVRL L+  SGSGF SS+LY +GFFSA+IKLP
Sbjct  41    FDIVPITFDEAYAPLFGDSNVVRSGDGKSVRLLLDRFSGSGFISSNLYKYGFFSARIKLP  100

Query  860   SDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYL  681
             SDYTAGIVVAFYT+N DVFEKTHDELD EFLGN+KGK WRFQTN+YGNGSTSRGREERY 
Sbjct  101   SDYTAGIVVAFYTSNGDVFEKTHDELDIEFLGNIKGKKWRFQTNVYGNGSTSRGREERYT  160

Query  680   LWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDW  501
             LWFDP++ FHRYSILWT   IIFY+D+VPIRE+IRN+AMGGDFP KPM LYATIWDASDW
Sbjct  161   LWFDPTRAFHRYSILWTANNIIFYVDEVPIREIIRNDAMGGDFPAKPMALYATIWDASDW  220

Query  500   ATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE-LEGADFAN  324
             ATSGGRYKVNYKYAPFVA F DLVL+GC  DP+ +    H     C D+   LE  DFA 
Sbjct  221   ATSGGRYKVNYKYAPFVAEFKDLVLQGCPVDPIDQYSSGH-----CYDKLALLEAQDFAT  275

Query  323   VTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             VT ++  AM+RFRQ +MYYSYCYD++RYA+PPPECVI  +E+++FK+TGRLKF
Sbjct  276   VTAQRHAAMRRFRQNYMYYSYCYDTIRYAIPPPECVILQSEKERFKDTGRLKF  328



>ref|XP_003612793.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES95751.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
 gb|AFK43016.1| unknown [Medicago truncatula]
Length=349

 Score =   437 bits (1124),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 245/297 (82%), Gaps = 5/297 (2%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             T +AFD+ T PF+ G++ L+G+ N++RS+  + V+L L+  +GSGF SS++Y HGFFSA 
Sbjct  31    TNSAFDLATIPFNDGYSHLFGDGNVVRSSDGNGVQLLLDRYTGSGFISSNMYQHGFFSAN  90

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLPS+Y+AGI VAFYT+N DVFEKTHDELDFEFLGN+ GKPWRFQTN+YGNGST RGRE
Sbjct  91    IKLPSNYSAGICVAFYTSNGDVFEKTHDELDFEFLGNIAGKPWRFQTNLYGNGSTHRGRE  150

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDP+K +HRYSILWT + +IFYID+VPIRE++RNE MG ++P KPM LYATIWD
Sbjct  151   ERYRLWFDPTKGYHRYSILWTAKNVIFYIDEVPIREVLRNEEMGSEYPVKPMSLYATIWD  210

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRR-ELEGA  336
             AS+WATSGG+YKVNYKYAPFV  F DLVL+GC+ DP+QEV         C D+  +LE  
Sbjct  211   ASNWATSGGKYKVNYKYAPFVVEFKDLVLKGCSVDPIQEVSDNDV----CSDQNVDLEAQ  266

Query  335   DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             D+ANVTP +R AM+RFRQ+ MYYSYCYD++RY VPPPEC I  AE+Q+FKETGRLKF
Sbjct  267   DYANVTPMRRLAMRRFRQRFMYYSYCYDTIRYPVPPPECNIIPAEKQRFKETGRLKF  323



>ref|XP_007210518.1| hypothetical protein PRUPE_ppa007685mg [Prunus persica]
 gb|EMJ11717.1| hypothetical protein PRUPE_ppa007685mg [Prunus persica]
Length=359

 Score =   437 bits (1124),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 205/306 (67%), Positives = 248/306 (81%), Gaps = 6/306 (2%)
 Frame = -1

Query  1076  FLIAFLSYTAAAF-DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
               +A +    AAF ++TT PF+QG++ L+G+ N++RS     VRL L+  +GSGF SS+L
Sbjct  31    MCMANIGNVDAAFSNLTTIPFNQGYSPLFGDGNLVRSPDGKGVRLLLDRFTGSGFISSNL  90

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y+HGFFSA IKLPSDYTAGI VAFYT+NADVFEK+HDELD EFLGN +GKPWRFQTN+YG
Sbjct  91    YNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKSHDELDIEFLGNTEGKPWRFQTNIYG  150

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGST+RGREERY LWFDP+K+FHRYSILWT Q  IFY+DDVPIRE+ R E MGGD+P KP
Sbjct  151   NGSTNRGREERYRLWFDPTKDFHRYSILWTPQITIFYVDDVPIREVERREEMGGDYPSKP  210

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M LY TIWDAS+WATSGG+YKVNYKYAPFVA F DLVL GC ADP+Q++    P    C 
Sbjct  211   MSLYTTIWDASNWATSGGKYKVNYKYAPFVAEFKDLVLDGCPADPIQQI----PAAEACA  266

Query  359   DRRELEGA-DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKE  183
             ++  L    D++ +TP++R AM+RFRQ++MYYSYCYDS+RY VPPPECVI AAER +FK+
Sbjct  267   EKYALLATQDYSVITPQRRAAMRRFRQRYMYYSYCYDSLRYPVPPPECVIIAAERARFKD  326

Query  182   TGRLKF  165
             TGRLKF
Sbjct  327   TGRLKF  332



>ref|XP_010088654.1| putative xyloglucan endotransglucosylase/hydrolase protein 30 
[Morus notabilis]
 gb|EXB36814.1| putative xyloglucan endotransglucosylase/hydrolase protein 30 
[Morus notabilis]
Length=360

 Score =   437 bits (1124),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 250/314 (80%), Gaps = 8/314 (3%)
 Frame = -1

Query  1094  LHSSAFFLIAFLSYT---AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             L S A F+++ L +    +AAF++   PFD+ +  L+G+ N++RS    +VRL L+  +G
Sbjct  25    LVSLALFVLSMLCFCVANSAAFNLAAVPFDEAYRPLFGDGNLVRSPDGKAVRLLLDRFTG  84

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             SGF SS LY HGFFSA IKLPSDYTAG+ VAFYT+N DVFEKTHDELDFEFLGNV+GKPW
Sbjct  85    SGFISSSLYQHGFFSANIKLPSDYTAGVCVAFYTSNGDVFEKTHDELDFEFLGNVEGKPW  144

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             RFQTN+YGNGSTSRGREER  LWFDP+KEFHRYSILWT   IIFYID+VPIRE++R++ M
Sbjct  145   RFQTNLYGNGSTSRGREERSRLWFDPTKEFHRYSILWTPNNIIFYIDEVPIREIVRSDEM  204

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             GGDFP KPM LYATIWDAS WAT+GG+YKVNYKYAPFVA F DLVL GC  +P+QEV   
Sbjct  205   GGDFPSKPMSLYATIWDASTWATNGGKYKVNYKYAPFVAEFKDLVLEGCPVNPIQEV---  261

Query  383   HPGVGGCDDR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
              P    C ++   L+  D+A +TP +R AM++FRQ +MYYSYCYD++RY VPPPECVI  
Sbjct  262   -PAFVACAEKDLSLQREDYAVITPVRRSAMRKFRQHYMYYSYCYDTLRYPVPPPECVIIP  320

Query  206   AERQQFKETGRLKF  165
             +E+++FK+TGRLKF
Sbjct  321   SEKRRFKDTGRLKF  334



>ref|XP_004512469.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Cicer arietinum]
Length=350

 Score =   435 bits (1118),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 202/311 (65%), Positives = 251/311 (81%), Gaps = 6/311 (2%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             LL S + FL  F   T AAFD+ T PF+ G++ L+G+ N++RS+  + V+L L+  +GSG
Sbjct  19    LLFSFSIFLFTF---TNAAFDLATIPFNDGYSHLFGDGNVVRSSDGNGVKLLLDRYTGSG  75

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F SS++Y +GFFSA IKLPS+YTAGI +AFYT+N DVFEKTHDELDFEFLGN+ GKPWRF
Sbjct  76    FISSNMYQYGFFSANIKLPSNYTAGICIAFYTSNGDVFEKTHDELDFEFLGNIAGKPWRF  135

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST RGREERY LWFDP+K +HRYSILWT + IIFYID+VPIRE++R+E MGG
Sbjct  136   QTNLYGNGSTHRGREERYRLWFDPTKGYHRYSILWTAKNIIFYIDEVPIREVLRSEEMGG  195

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             ++P KPM LY+TIWDAS+WATSGG+YKVNYKYAPFV  F DLVL+GC+ DP+QEV G   
Sbjct  196   EYPSKPMSLYSTIWDASNWATSGGKYKVNYKYAPFVVEFKDLVLKGCSVDPIQEVSG---  252

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
             G    D    LE  D+A VTP +R AM+RFRQ++MYYSYCYD++RY +P PEC I  +E+
Sbjct  253   GEICSDQNTHLEAQDYAAVTPLRRLAMRRFRQRYMYYSYCYDTIRYPMPLPECDIIPSEK  312

Query  197   QQFKETGRLKF  165
             Q+FKETGRL+F
Sbjct  313   QRFKETGRLRF  323



>ref|XP_008373536.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Malus domestica]
Length=355

 Score =   434 bits (1116),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 199/305 (65%), Positives = 243/305 (80%), Gaps = 3/305 (1%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
               L+ F +  AA +++TT PFDQG+  L+G+ N++RS     VRL L+  +GSGF SS+L
Sbjct  26    LILVCFGNVGAAFYNLTTIPFDQGYIPLFGDGNLVRSPDGKGVRLLLDRFTGSGFISSNL  85

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y+HGFFSA IKLPSDYTAGI VAFYT+NADVFEK+HDELD EFLGN +GKPWRFQTN+YG
Sbjct  86    YNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKSHDELDIEFLGNTEGKPWRFQTNIYG  145

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGST+RGREERY LWFDP+K+FHRYSILWT + IIFY+D+VPIRE++RNE MG D+P KP
Sbjct  146   NGSTNRGREERYRLWFDPTKDFHRYSILWTPEKIIFYVDEVPIREVVRNEEMGADYPSKP  205

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M LY TIWDAS WATSGG+YKVNYKYAPFVA F DL L GC ADP+Q++    P     +
Sbjct  206   MSLYTTIWDASSWATSGGKYKVNYKYAPFVAEFKDLALEGCPADPIQQI---PPAEACAE  262

Query  359   DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKET  180
                 L   D++ ++P++R AM RFRQ++MYYSYCYDS+RY VPPPECV   AE+ +FK+T
Sbjct  263   HYTHLATQDYSVISPQRRAAMSRFRQRYMYYSYCYDSLRYPVPPPECVTVPAEKARFKDT  322

Query  179   GRLKF  165
             GRLKF
Sbjct  323   GRLKF  327



>gb|KDP30712.1| hypothetical protein JCGZ_15540 [Jatropha curcas]
Length=341

 Score =   432 bits (1111),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 205/316 (65%), Positives = 247/316 (78%), Gaps = 5/316 (2%)
 Frame = -1

Query  1103  PYLLHSSAFFLIAFLSYTAA---AFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNH  933
             P   HS    LI   SY  A   AF++TT  FD+G+  L+G+ N++RS +  SVRL L+ 
Sbjct  4     PMPCHSLFSLLILISSYGFANIEAFNLTTISFDEGYAPLFGDGNLVRSPNGRSVRLLLDR  63

Query  932   LSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKG  753
              +GSGF SS +Y +GFFSA IKLPSDYTAG+ VAFYT+N DVFEKTHDELDFEFLGNV+G
Sbjct  64    FTGSGFISSKMYKYGFFSANIKLPSDYTAGLCVAFYTSNQDVFEKTHDELDFEFLGNVEG  123

Query  752   KPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRN  573
             KPWRFQTN+YGNGSTS GREERY LWFDPSKEFHRYSILWT   IIF+IDDVPIRE++R 
Sbjct  124   KPWRFQTNLYGNGSTSHGREERYRLWFDPSKEFHRYSILWTEYKIIFFIDDVPIREVLRT  183

Query  572   EAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEV  393
               MG ++P KPM LYATIWDAS+WATSGGRYKVNYKYAPFV+ + DLV+ GC  DP+Q+ 
Sbjct  184   SEMGSEYPSKPMSLYATIWDASNWATSGGRYKVNYKYAPFVSEYKDLVIEGCPVDPIQQF  243

Query  392   VGEHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVI  213
                       + R  LE A++A +T +QR AM+RFRQ+ MYYSYCYD++RY+VPPPECVI
Sbjct  244   PVASTSCSESNAR--LESAEYATITRRQRMAMRRFRQRLMYYSYCYDTLRYSVPPPECVI  301

Query  212   DAAERQQFKETGRLKF  165
             D  E+++FK+TGRLKF
Sbjct  302   DPIEKERFKDTGRLKF  317



>ref|NP_001242723.1| uncharacterized protein LOC100800720 precursor [Glycine max]
 gb|ACU21372.1| unknown [Glycine max]
Length=348

 Score =   432 bits (1110),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 198/295 (67%), Positives = 244/295 (83%), Gaps = 5/295 (2%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             A+FD+ T PF+ G++ L+G SN++RS     V+L L+  +GSGF SS +Y +GFFSA+IK
Sbjct  32    ASFDLATIPFNDGYSPLFGASNVVRSEDGYGVQLRLDRYTGSGFISSSMYQYGFFSARIK  91

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LPS+Y+AGI VAFYT+N DVFEK+HDELDFEFLGNV GKPWRFQTN+ GNGST+RGREER
Sbjct  92    LPSNYSAGICVAFYTSNGDVFEKSHDELDFEFLGNVAGKPWRFQTNLCGNGSTNRGREER  151

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDP+KEFHRYSILWT + +IFYID+VPIRE++++E MGGD+P KPM LYATIWDAS
Sbjct  152   YRLWFDPTKEFHRYSILWTAKNVIFYIDEVPIREVLQSEEMGGDYPSKPMSLYATIWDAS  211

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRR-ELEGADF  330
             +WATSGG+YKVNYKYAPFV  F DLVL+GC+ADP+QEV     G   C D+  +LE  D+
Sbjct  212   NWATSGGKYKVNYKYAPFVTEFKDLVLKGCSADPIQEVT----GTKSCSDQHADLEAQDY  267

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             A VTP +R  M+RFRQ++MYYSYCYD++RY VP PECVI  +E+Q+FKE GRLKF
Sbjct  268   AGVTPMRRLTMRRFRQRYMYYSYCYDTLRYPVPQPECVIVPSEKQRFKEIGRLKF  322



>ref|XP_009373460.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Pyrus x bretschneideri]
Length=364

 Score =   431 bits (1109),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 244/311 (78%), Gaps = 6/311 (2%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
               L+ F +  AA +++TT PFDQG+  L+G+ N++RS     VRL L+  +GSGF SS+L
Sbjct  26    LILVCFGNVGAAFYNLTTIPFDQGYIPLFGDGNLVRSPDGKGVRLLLDRFTGSGFISSNL  85

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y+HGFFSA IKLPSDYTAGI VAFYT+NADVFEK+HDELD EFLGN +GKPWRFQTN+YG
Sbjct  86    YNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKSHDELDIEFLGNTEGKPWRFQTNLYG  145

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGST+RGREERY LWFDP+K+FHRYSILWT + IIFY+D+VPIRE++RNE MG D+P KP
Sbjct  146   NGSTNRGREERYRLWFDPTKDFHRYSILWTPEKIIFYVDEVPIREVVRNEEMGADYPSKP  205

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEV-----VGEHPG  375
             M LY TIWDAS WATSGG+YKVNYKYAPFVA F DL L GC ADP+Q++           
Sbjct  206   MSLYTTIWDASSWATSGGKYKVNYKYAPFVAEFIDLALEGCPADPIQQIPPAXXXXXXXX  265

Query  374   VGGCDDR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                C +    L   D++ +TP++R AM RFRQ++MYYSYCYDS+RY VPPPECV  +AE+
Sbjct  266   XXACAEHYTHLATQDYSVITPQRRAAMSRFRQRYMYYSYCYDSLRYPVPPPECVTVSAEK  325

Query  197   QQFKETGRLKF  165
              +FK+TGRLKF
Sbjct  326   ARFKDTGRLKF  336



>emb|CDP09316.1| unnamed protein product [Coffea canephora]
Length=295

 Score =   428 bits (1101),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 206/286 (72%), Positives = 240/286 (84%), Gaps = 7/286 (2%)
 Frame = -1

Query  932  LSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKG  753
            L  SGF+SSDLYSHGFFSAK+KLPSDYTAGIVVAFYTTN DVF++THDELDFEFLGN++G
Sbjct  16   LLSSGFKSSDLYSHGFFSAKMKLPSDYTAGIVVAFYTTNGDVFKRTHDELDFEFLGNIRG  75

Query  752  KPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRN  573
            K WRFQTNMYGNGSTSRGREERY LWFDPS+EFHRYSILWT + IIFYIDDVPIRE+IRN
Sbjct  76   KAWRFQTNMYGNGSTSRGREERYYLWFDPSREFHRYSILWTTKKIIFYIDDVPIREIIRN  135

Query  572  EAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEV  393
            + MG D+P KPM LYATIWDASDWATSGGRY+ NYKYAPF+A FTDL L GCAADPL+E+
Sbjct  136  QEMGADYPSKPMALYATIWDASDWATSGGRYRTNYKYAPFIAEFTDLALHGCAADPLEEI  195

Query  392  VGEHPGVGGCDDR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECV  216
                     C ++  +L+ A +A+++P+QR AMK FR KHMYYSYCYD++RY+VPPPEC+
Sbjct  196  FS-----SSCTEQDDQLDSASYASISPQQRMAMKNFRHKHMYYSYCYDTLRYSVPPPECL  250

Query  215  IDAAERQQFKETGRLKFEkrhhrrgkrssrSEVFERTNYGSNQDED  78
            ID +E+ +FKETGRLKFE RH  R  + SRS+     NYG N+DED
Sbjct  251  IDPSEKLRFKETGRLKFEGRHRHRRSKRSRSQDIGARNYG-NEDED  295



>ref|XP_008341063.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Malus domestica]
Length=355

 Score =   430 bits (1105),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 243/306 (79%), Gaps = 5/306 (2%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
               L+   +  AA +++TT PFDQG+T L+G+ N++RS     VRL L+  +GSGF SS+L
Sbjct  26    LILVCVGNVDAAFYNLTTIPFDQGYTPLFGDGNLVRSPDGKGVRLLLDRFTGSGFISSNL  85

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y+HGFFSA IKLPSDYTAGI VAFYT+NADVFEK HDELD EFLGN +GKPWRFQTN+YG
Sbjct  86    YNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKNHDELDIEFLGNTEGKPWRFQTNLYG  145

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGST+RGREERY LWFDP+K+FHRYSILWT +  IFY+D+VPIRE++RNE MG D+P KP
Sbjct  146   NGSTNRGREERYRLWFDPTKDFHRYSILWTPENTIFYVDEVPIREVVRNEEMGADYPSKP  205

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M LY TIWDAS WATSGG+YKVNYKYAPFVA F DLVL GC ADP+Q++    P    C 
Sbjct  206   MSLYTTIWDASSWATSGGQYKVNYKYAPFVAEFKDLVLEGCPADPIQQI----PAAEACA  261

Query  359   DR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKE  183
             +    L   D++ +T ++R AM+RFRQ++MYYSYCYDS+RY VPP ECV  +AE+ +FK+
Sbjct  262   EHYTHLATQDYSVITRQRRAAMRRFRQRYMYYSYCYDSLRYPVPPSECVTVSAEKARFKD  321

Query  182   TGRLKF  165
             TGRLKF
Sbjct  322   TGRLKF  327



>ref|XP_009348482.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Pyrus x bretschneideri]
Length=355

 Score =   430 bits (1105),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 242/306 (79%), Gaps = 5/306 (2%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
               L+   +  AA +++TT PFDQ +T L+G+ N++RS     VRL L+  +GSGF SS+L
Sbjct  26    LILVCVGNVDAAFYNLTTIPFDQSYTPLFGDGNLVRSPDGKGVRLLLDRFTGSGFISSNL  85

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y+HGFFSA IKLPSDYTAGI VAFYT+NADVFEK HDELD EFLGN +GKPWRFQTN+YG
Sbjct  86    YNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKNHDELDIEFLGNTEGKPWRFQTNLYG  145

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGST+RGREERY LWFDP+K+FHRYSILWT +  IFY+D+VPIRE++RNE MG D P KP
Sbjct  146   NGSTNRGREERYRLWFDPTKDFHRYSILWTPENTIFYVDEVPIREVVRNEEMGADSPSKP  205

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M LY TIWDAS WATSGG+YKVNYKYAPFVA F DLVL GC ADP+Q++    P    C 
Sbjct  206   MSLYTTIWDASSWATSGGQYKVNYKYAPFVAEFKDLVLEGCPADPIQQI----PAAEACA  261

Query  359   DR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKE  183
             +    L   D++ +T ++R AM+RFRQ++MYYSYCYDS+RY VPPPECV  +AE+ +FK+
Sbjct  262   EHYTHLATQDYSVITRQRRAAMRRFRQRYMYYSYCYDSLRYPVPPPECVTVSAEKARFKD  321

Query  182   TGRLKF  165
             TGRLKF
Sbjct  322   TGRLKF  327



>ref|XP_008238168.1| PREDICTED: LOW QUALITY PROTEIN: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Prunus mume]
Length=362

 Score =   429 bits (1104),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 249/310 (80%), Gaps = 9/310 (3%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAF-DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSD  903
             F  +A +    AAF ++TT PF+QG++ L+G+ N++RS     VRL L+  +GSGF SS+
Sbjct  30    FMCMANIGNVDAAFSNLTTIPFNQGYSPLFGDGNLVRSPDGKGVRLLLDRFTGSGFISSN  89

Query  902   LYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMY  723
             LY+HGFFSA IKLPSDYTAGI VAFYT+NADVFEK+HDELD EFLGN +GKPWRFQTN+Y
Sbjct  90    LYNHGFFSANIKLPSDYTAGICVAFYTSNADVFEKSHDELDIEFLGNTEGKPWRFQTNVY  149

Query  722   GNGSTSRG---REERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDF  552
             GNGST+RG   R+ERY LWFDP+++FHRYSILWT Q  IFY+DDVPIRE++R E MGGD+
Sbjct  150   GNGSTNRGRPRRKERYRLWFDPTRDFHRYSILWTPQITIFYVDDVPIREVVRREEMGGDY  209

Query  551   PQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGV  372
             P KPM LY TIWDAS+WATSGG+YKVNYKYAPFVA F DLVL GC ADP+Q+V    P  
Sbjct  210   PSKPMSLYTTIWDASNWATSGGKYKVNYKYAPFVAEFKDLVLDGCPADPIQQV----PAA  265

Query  371   GGCDDRRELEGA-DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQ  195
               C ++  L    D++ +TP++R A++RFRQ++MYYSYCYDS+RY VPPPECV  AAER 
Sbjct  266   EACAEKYALLATQDYSVITPQRRAAVRRFRQRYMYYSYCYDSLRYPVPPPECVTIAAERA  325

Query  194   QFKETGRLKF  165
             +FK+TGRLKF
Sbjct  326   RFKDTGRLKF  335



>ref|XP_010677382.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Beta vulgaris subsp. vulgaris]
Length=350

 Score =   429 bits (1102),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 196/300 (65%), Positives = 238/300 (79%), Gaps = 0/300 (0%)
 Frame = -1

Query  1064  FLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGF  885
             F   + AAF+V T  FD+G+T L+ + NI +S    +  LHLN  +GSGF SS  Y +GF
Sbjct  21    FTVVSNAAFNVPTIAFDEGYTPLFADFNIKKSDDGRAANLHLNRYAGSGFISSKYYDYGF  80

Query  884   FSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTS  705
             FSA+IKLP +YTAG+VVAFYT+NADV+EK HDELD EFLGN+KGKPWRFQTNMYGNGST+
Sbjct  81    FSARIKLPGNYTAGVVVAFYTSNADVWEKRHDELDIEFLGNLKGKPWRFQTNMYGNGSTN  140

Query  704   RGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYA  525
             RGREERY LWFDP+K+FH+YSILWT   IIFY+D+VPIRE++RNEAMG DFP KPM LYA
Sbjct  141   RGREERYRLWFDPTKDFHQYSILWTRNNIIFYVDNVPIREIVRNEAMGSDFPSKPMSLYA  200

Query  524   TIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRREL  345
             TIWDAS WAT+GGRYKV Y++ PFV+ FTD VL GC  DP+++V G          + E+
Sbjct  201   TIWDASSWATAGGRYKVKYEFEPFVSEFTDFVLDGCPVDPIEQVAGTTSSSDCATKKDEI  260

Query  344   EGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             E  +++ VTP  RRAMK FR+K+MYYSYCYD VRY VPPPECVI ++E+Q+FKETGRLKF
Sbjct  261   ENKEYSQVTPGGRRAMKWFREKYMYYSYCYDMVRYPVPPPECVIVSSEQQRFKETGRLKF  320



>ref|XP_011018473.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Populus euphratica]
Length=351

 Score =   428 bits (1101),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 243/295 (82%), Gaps = 4/295 (1%)
 Frame = -1

Query  1049  AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKI  870
             +AAF+++T  FD+G++ L+G+ N++RS +  + RL L+  +G+GF SS +Y +GFFSA I
Sbjct  33    SAAFNLSTISFDEGYSPLFGDGNLVRSPNGRTARLLLDRFTGAGFISSKMYKYGFFSANI  92

Query  869   KLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREE  690
             KLP DYTAG+ VAFYT+N DVFEKTHDELDFEFLGN +GKPWRFQTN+YGNGST RGREE
Sbjct  93    KLPGDYTAGLCVAFYTSNGDVFEKTHDELDFEFLGNTEGKPWRFQTNLYGNGSTRRGREE  152

Query  689   RYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDA  510
             RY LWFDPSK+FHRYSILWT + IIFYIDDVPIRE+IR+E MGG++P KPM LYATIWDA
Sbjct  153   RYRLWFDPSKQFHRYSILWTEKNIIFYIDDVPIREVIRSEEMGGEYPSKPMSLYATIWDA  212

Query  509   SDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF  330
             S+WATSGG+YKVNYKYAPFV+ F D VL GC +DP++E     P V   +    LE AD+
Sbjct  213   SNWATSGGKYKVNYKYAPFVSEFKDFVLEGCPSDPIEEF----PSVECYESYSRLESADY  268

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             A +T +QR AM++FRQ++MYYSYCYDS+RY VPPPECV+  +E+ +F++TGRL+F
Sbjct  269   ATITRRQRSAMRKFRQRYMYYSYCYDSLRYPVPPPECVVIPSEKDRFRDTGRLRF  323



>ref|XP_009344136.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Pyrus x bretschneideri]
Length=355

 Score =   428 bits (1100),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 242/306 (79%), Gaps = 5/306 (2%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
               L+   +  AA +++TT PFDQ +T L+G+ N++RS     VRL L+  +GSGF SS+L
Sbjct  26    LILVCVGNVDAAFYNLTTIPFDQSYTPLFGDGNLVRSPDGKGVRLLLDRFTGSGFISSNL  85

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y+HGFFSA IKLPSDYTAG+ VAFYT+NADVFEK HDELD EFLGN +GKPWRFQTN+YG
Sbjct  86    YNHGFFSANIKLPSDYTAGVCVAFYTSNADVFEKNHDELDIEFLGNTEGKPWRFQTNLYG  145

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGST+RGREERY LWFDP+K+FHRYSILWT +  IFY+D+VPIRE++RNE MG D+P KP
Sbjct  146   NGSTNRGREERYRLWFDPTKDFHRYSILWTPENTIFYVDEVPIREVVRNEEMGADYPSKP  205

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M LY TIWDAS WATSGG+YKVNYKYAPFVA F DLVL GC ADP+ ++    P    C 
Sbjct  206   MSLYTTIWDASSWATSGGQYKVNYKYAPFVAEFKDLVLEGCPADPILQI----PAAEACA  261

Query  359   DR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKE  183
             +    L   D++ +T ++R AM+RFRQ++MYYSYCYDS+RY VPPPECV  +AE+ +FK+
Sbjct  262   EHYTHLATQDYSVITRQRRAAMRRFRQRYMYYSYCYDSLRYPVPPPECVTVSAEKARFKD  321

Query  182   TGRLKF  165
             TGRLKF
Sbjct  322   TGRLKF  327



>ref|XP_006368348.1| xyloglucan endotransglycosylase 2 family protein [Populus trichocarpa]
 gb|ERP64917.1| xyloglucan endotransglycosylase 2 family protein [Populus trichocarpa]
Length=346

 Score =   426 bits (1096),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 241/295 (82%), Gaps = 4/295 (1%)
 Frame = -1

Query  1049  AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKI  870
             +AAF+++T  FD+G++ L+G+ N++RS    + RL L+  +G+GF SS +Y +GFFSA I
Sbjct  28    SAAFNLSTISFDEGYSPLFGDGNLVRSPDGRTARLLLDRFTGAGFISSKMYKYGFFSANI  87

Query  869   KLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREE  690
             KLP DYTAG+ VAFYT+N DVFEKTHDELDFEFLGN +GKPWRFQTN+YGNGSTSRGREE
Sbjct  88    KLPGDYTAGLCVAFYTSNGDVFEKTHDELDFEFLGNTEGKPWRFQTNLYGNGSTSRGREE  147

Query  689   RYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDA  510
             RY LWFDPSK+FHRYSILWT +  IFYIDDVPIRE+IR+E MGG++P KPM LYATIWDA
Sbjct  148   RYRLWFDPSKQFHRYSILWTAKNTIFYIDDVPIREVIRSEEMGGEYPSKPMSLYATIWDA  207

Query  509   SDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF  330
             S+WATSGG+YKVNYKYAPFV+ F D VL GC +DP++E     P V   +    LE AD+
Sbjct  208   SNWATSGGKYKVNYKYAPFVSEFKDFVLEGCPSDPIEEF----PSVDCYESYSRLESADY  263

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             A +T +QR AM++FRQ++MYYSYCYDS+RY VPPPECV+   E+ +F++TGRL+F
Sbjct  264   ATITRRQRSAMRKFRQRYMYYSYCYDSLRYPVPPPECVVIPTEKDRFRDTGRLRF  318



>ref|XP_006415244.1| hypothetical protein EUTSA_v10008109mg [Eutrema salsugineum]
 gb|ESQ33597.1| hypothetical protein EUTSA_v10008109mg [Eutrema salsugineum]
Length=343

 Score =   422 bits (1086),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 245/311 (79%), Gaps = 12/311 (4%)
 Frame = -1

Query  1079  FFLIAF----LSYTAAAF-DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGF  915
             FFLI      L   ++AF ++ T  F++  + L+G++N++RS  D SVRL L+  +GSGF
Sbjct  10    FFLIIIVFLGLGLRSSAFTNLNTLSFEESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGF  69

Query  914   RSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQ  735
              SS++Y HGF+S+ IKLP+DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPWRFQ
Sbjct  70    ISSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQ  129

Query  734   TNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGD  555
             TN+YGNGST RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IR+EAMG D
Sbjct  130   TNLYGNGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRSEAMGAD  189

Query  554   FPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPG  375
             +P KPM LYATIWDASDWATSGG+YK NYK+APFVA F    L GC+ DP+QEV  +   
Sbjct  190   YPAKPMSLYATIWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPTD---  246

Query  374   VGGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                C D  E LE  D++++  +QR AM+RFRQ+ MYYSYCYD+VRY  PPPECVI  AE+
Sbjct  247   ---CSDSVEFLESQDYSSINSRQRAAMRRFRQRFMYYSYCYDTVRYPEPPPECVIVPAEK  303

Query  197   QQFKETGRLKF  165
              +F++TGRLKF
Sbjct  304   DRFRDTGRLKF  314



>gb|KFK44960.1| hypothetical protein AALP_AA1G325900 [Arabis alpina]
Length=342

 Score =   420 bits (1080),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 198/306 (65%), Positives = 243/306 (79%), Gaps = 8/306 (3%)
 Frame = -1

Query  1076  FLIAFLSYTAAAF-DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
             FL++F   T+ AF ++ +  F++  + L+G+SN++RS  D SVRL L+  +GSGF SS++
Sbjct  15    FLMSFGFKTSLAFTNLNSLSFEESLSPLFGDSNLVRSPDDLSVRLLLDKYTGSGFISSNM  74

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y HGF+S+ IKLP+DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPWRFQTN+YG
Sbjct  75    YQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYG  134

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGST RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IR++AMG D+P KP
Sbjct  135   NGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRSDAMGADYPAKP  194

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M LYATIWDASDWATSGG+YK NYK+APF A F    L GCA +P+QEV  +      C 
Sbjct  195   MSLYATIWDASDWATSGGKYKANYKFAPFTAEFKSFSLDGCAVEPIQEVPTD------CS  248

Query  359   DRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKE  183
             D  E LE  D++++  +QR AM+RFRQ+ MYYSYCYD+VRY  P PECVI  AE+ +FKE
Sbjct  249   DSVEFLESQDYSSINSRQRAAMRRFRQRFMYYSYCYDTVRYPSPLPECVIVPAEKDRFKE  308

Query  182   TGRLKF  165
             TGRLKF
Sbjct  309   TGRLKF  314



>emb|CDY29941.1| BnaC05g28950D [Brassica napus]
Length=343

 Score =   420 bits (1080),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/313 (63%), Positives = 244/313 (78%), Gaps = 8/313 (3%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAF-DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGS  921
             L+ S   F+   L   ++AF ++ T  F++  + L+G++N++RS  D SVRL L+  +GS
Sbjct  8     LIFSIIIFVFLCLGLRSSAFTNLNTLSFEESLSPLFGDANLVRSPDDLSVRLLLDKYTGS  67

Query  920   GFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWR  741
             GF SS++Y HGF+S+ IKLP+DYTAG+VVAFYT+N DVF+KTHDELD EFLGN+KGKPWR
Sbjct  68    GFISSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFQKTHDELDIEFLGNIKGKPWR  127

Query  740   FQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMG  561
             FQTN+YGNGST RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IR+EAMG
Sbjct  128   FQTNLYGNGSTPRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRSEAMG  187

Query  560   GDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEH  381
              D+P KPM LYATIWDASDWATSGG+YK NYK+APFVA F    L GC+ DP+QEV  + 
Sbjct  188   ADYPAKPMALYATIWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPVD-  246

Query  380   PGVGGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAA  204
                  C D  E LE  D++ +   QR AM+RFRQ+ MYYSYCYD+VRY  PPPECVI  A
Sbjct  247   -----CADSVEFLESQDYSAINSHQRAAMRRFRQRFMYYSYCYDTVRYPEPPPECVIVPA  301

Query  203   ERQQFKETGRLKF  165
             E+ +F++TGRLKF
Sbjct  302   EKGRFRDTGRLKF  314



>gb|EPS67980.1| xyloglucan endotransglucosylase/hydrolase 14, partial [Genlisea 
aurea]
Length=303

 Score =   418 bits (1074),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/297 (67%), Positives = 232/297 (78%), Gaps = 8/297 (3%)
 Frame = -1

Query  1049  AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKI  870
             AAAF+V+T  F   FT L+GESN+ RS  D S+++HLN  +GSGFRSS+LY HGFFS+KI
Sbjct  1     AAAFNVSTVAFAGSFTPLFGESNVFRSPDDRSLQIHLNQYTGSGFRSSNLYDHGFFSSKI  60

Query  869   KLPS-DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             KLPS DYTAGIVVAFY TN D+F + HDELDFEFLGNV+GKPW FQTNMYGNGSTSRGRE
Sbjct  61    KLPSPDYTAGIVVAFYLTNGDMF-RAHDELDFEFLGNVRGKPWSFQTNMYGNGSTSRGRE  119

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDPS E H YSILWT + IIF++DDVPIRE+ +   MGGDFP KPM LYAT+WD
Sbjct  120   ERYHLWFDPSHELHSYSILWTTKKIIFFVDDVPIREITKKVEMGGDFPAKPMALYATVWD  179

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGAD  333
             AS WATSGG+YKVNYKYAPFV  F+DLVL GC +DPL+EVVG  P    CDD       D
Sbjct  180   ASSWATSGGKYKVNYKYAPFVVEFSDLVLHGCISDPLEEVVGTAPQ-NSCDDV-----GD  233

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKFE  162
              A++ PKQR AM +FR  +MYY YCY  +RY+ P PECVIDAAE++ F E+G +  +
Sbjct  234   IADIKPKQRAAMNKFRLTYMYYCYCYHDLRYSTPLPECVIDAAEKRLFSESGEVSVQ  290



>ref|XP_006303176.1| hypothetical protein CARUB_v10009628mg [Capsella rubella]
 gb|EOA36074.1| hypothetical protein CARUB_v10009628mg [Capsella rubella]
Length=344

 Score =   419 bits (1076),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 199/313 (64%), Positives = 242/313 (77%), Gaps = 10/313 (3%)
 Frame = -1

Query  1091  HSSAFFLI---AFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGS  921
             H   FFLI     L  + A  ++ T  F++  + L+G++N++RS  D SVRL L+  +GS
Sbjct  8     HIFFFFLILGLCCLRSSLAFTNLNTLSFEESLSPLFGDANLVRSPDDLSVRLLLDRYTGS  67

Query  920   GFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWR  741
             GF SS++Y HGF+S+ IKLP+DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPWR
Sbjct  68    GFISSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWR  127

Query  740   FQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMG  561
             FQTN+YGNGST RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IRN+AMG
Sbjct  128   FQTNLYGNGSTQRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMG  187

Query  560   GDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEH  381
              D+P KPM LYATIWDASDWATSGG+YK NYK+APFVA F    L GC+ DP+QEV  + 
Sbjct  188   ADYPAKPMSLYATIWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPVD-  246

Query  380   PGVGGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAA  204
                  C D  + LE  D++ +  +QR AM+RFRQ+ MYYSYCYD+VRY   PPECVI  A
Sbjct  247   -----CSDSVDFLESQDYSTINSRQRAAMRRFRQRFMYYSYCYDTVRYPQAPPECVIVPA  301

Query  203   ERQQFKETGRLKF  165
             E+ +FK+TGRLKF
Sbjct  302   EKDRFKDTGRLKF  314



>emb|CDY35550.1| BnaA05g16360D [Brassica napus]
Length=343

 Score =   418 bits (1075),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 197/313 (63%), Positives = 242/313 (77%), Gaps = 8/313 (3%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAF-DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGS  921
             L+ S    +   L   ++AF ++ T  F++  + L+G++N++RS  D SVRL L+  +GS
Sbjct  8     LIFSIIILVFLCLGLRSSAFTNLNTLSFEESLSPLFGDANLVRSPDDLSVRLLLDKYTGS  67

Query  920   GFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWR  741
             GF SS++Y HGF+S+ IKLP+DYTAG+VVAFYT+N DVF+KTHDELD EFLGN+KGKPWR
Sbjct  68    GFISSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFQKTHDELDIEFLGNIKGKPWR  127

Query  740   FQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMG  561
             FQTN+YGNGST RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IR+EAMG
Sbjct  128   FQTNLYGNGSTPRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRSEAMG  187

Query  560   GDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEH  381
              D+P KPM LYATIWDASDWATSGG+YK NYK+APFVA F    L GC+ DP+QEV  + 
Sbjct  188   ADYPAKPMALYATIWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPVD-  246

Query  380   PGVGGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAA  204
                  C D  E LE  D++ +   QR AM+RFRQ+ MYYSYCYD+VRY  PPPECVI  A
Sbjct  247   -----CADSVEFLESQDYSAINSHQRAAMRRFRQRFMYYSYCYDTVRYPEPPPECVIVPA  301

Query  203   ERQQFKETGRLKF  165
             E+ +F+ TGRLKF
Sbjct  302   EKDRFRNTGRLKF  314



>ref|XP_009107996.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Brassica rapa]
 emb|CDY41742.1| BnaA08g06970D [Brassica napus]
Length=342

 Score =   418 bits (1074),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 199/314 (63%), Positives = 242/314 (77%), Gaps = 10/314 (3%)
 Frame = -1

Query  1094  LHSSAFFLIAFLSY---TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             L  +  F I FL     ++A  ++ T  F++  + L+G+ N++RS  D SVRL L+  +G
Sbjct  4     LSYNLIFFIVFLCLGLRSSAFTNLNTLSFEESLSPLFGDGNLVRSPDDLSVRLLLDKYTG  63

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             SGF SS++Y HGF+S+ IKLP+DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPW
Sbjct  64    SGFISSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPW  123

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             RFQTN+YGNGST RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IR+EAM
Sbjct  124   RFQTNLYGNGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRSEAM  183

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             G D+P KPM LYATIWDASDWATSGG+YK NYKYAPFVA F    L GC+ DP+QEV  +
Sbjct  184   GADYPAKPMSLYATIWDASDWATSGGKYKANYKYAPFVAEFKSFSLDGCSVDPIQEVPTD  243

Query  383   HPGVGGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
                   C D  + LE  D+ ++  +QR AM+RFRQ+ MYYSYCYD+VRY   PPECVI  
Sbjct  244   ------CSDSVDFLESQDYFSINSRQRAAMRRFRQRFMYYSYCYDTVRYPEAPPECVIVP  297

Query  206   AERQQFKETGRLKF  165
             AE+ +FK+TGRLKF
Sbjct  298   AEKDRFKDTGRLKF  311



>ref|NP_174496.1| probable xyloglucan endotransglucosylase/hydrolase 30 [Arabidopsis 
thaliana]
 sp|Q38908.2|XTH30_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 30; Short=At-XTH30; Short=XTH-30; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG23439.1|AC084165_5 endoxyloglucan transferase, putative [Arabidopsis thaliana]
 gb|AAL32776.1| endoxyloglucan transferase, putative [Arabidopsis thaliana]
 gb|AEE31443.1| probable xyloglucan endotransglucosylase/hydrolase 30 [Arabidopsis 
thaliana]
Length=343

 Score =   418 bits (1074),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 240/310 (77%), Gaps = 7/310 (2%)
 Frame = -1

Query  1091  HSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFR  912
             H     L   L  ++A  ++ T  F++  + L+G++N++RS  D SVRL L+  +GSGF 
Sbjct  8     HIFILILCLCLRSSSAFTNLNTLSFEESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFI  67

Query  911   SSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQT  732
             SS++Y HGF+S+ IKLP+DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPWRFQT
Sbjct  68    SSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQT  127

Query  731   NMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDF  552
             N+YGNGST RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IRN+AMG D+
Sbjct  128   NLYGNGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMGADY  187

Query  551   PQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGV  372
             P KPM LYATIWDASDWATSGG+YK NYK+APFVA F    L GC+ DP+QEV  +    
Sbjct  188   PAKPMALYATIWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPMD----  243

Query  371   GGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQ  195
               C D  + LE  D++++   QR AM+RFRQ+ MYYSYCYD++RY  P PECVI  AE+ 
Sbjct  244   --CSDSVDFLESQDYSSINSHQRAAMRRFRQRFMYYSYCYDTLRYPEPLPECVIVPAEKD  301

Query  194   QFKETGRLKF  165
             +FKETGRLKF
Sbjct  302   RFKETGRLKF  311



>gb|ABM91070.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-3 [Populus 
tremula x Populus tremuloides]
Length=348

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 239/295 (81%), Gaps = 5/295 (2%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             AAF+++T  FD+G++ L+G+ N++RS    S RL L+  +G+GF SS +Y +GFFSA IK
Sbjct  28    AAFNLSTISFDEGYSPLFGDGNLVRSPDGRSARLLLDRFTGAGFISSRMYKYGFFSANIK  87

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LP  YTAG+ VAFYT+N DVF+KTHDELD EFLGN KG+PWRFQTN+YGNGSTS GREER
Sbjct  88    LPGYYTAGLCVAFYTSNGDVFKKTHDELDIEFLGNTKGEPWRFQTNLYGNGSTSHGREER  147

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDPSKEFHRYSILWT +TIIFYIDDVPIRE+IRNE MG +FP KPM LYATIWDAS
Sbjct  148   YRLWFDPSKEFHRYSILWTAKTIIFYIDDVPIREVIRNEEMGSEFPSKPMSLYATIWDAS  207

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD-DRRELEGADF  330
             +WATSGG+YKVNYKYAPFV+ F DL L GC +DP++E     P     + D   LE AD+
Sbjct  208   NWATSGGKYKVNYKYAPFVSEFKDLALEGCPSDPIEEF----PSFDCHESDIARLENADY  263

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             A +T +QR AM+RFRQ++MYYSYCYD++RY VP PECVI  +E+++F++TGRLKF
Sbjct  264   ATITRRQRSAMRRFRQRYMYYSYCYDALRYPVPLPECVIIPSEKERFRDTGRLKF  318



>gb|AAB18365.1| xyloglucan endotransglycosylase-related protein, partial [Arabidopsis 
thaliana]
Length=341

 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 240/310 (77%), Gaps = 7/310 (2%)
 Frame = -1

Query  1091  HSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFR  912
             H     L   L  ++A  ++ T  F++  + L+G++N++RS  D SVRL L+  +GSGF 
Sbjct  6     HIFILILCLCLRSSSAFTNLNTLSFEESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFI  65

Query  911   SSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQT  732
             SS++Y HGF+S+ IKLP+DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPWRFQT
Sbjct  66    SSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQT  125

Query  731   NMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDF  552
             N+YGNGST RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IRN+AMG D+
Sbjct  126   NLYGNGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMGADY  185

Query  551   PQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGV  372
             P KPM LYATIWDASDWATSGG+YK NYK+APFVA F    L GC+ DP+QEV  +    
Sbjct  186   PAKPMALYATIWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPMD----  241

Query  371   GGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQ  195
               C D  + LE  D++++   QR AM+RFRQ+ MYYSYCYD++RY  P PECVI  AE+ 
Sbjct  242   --CSDSVDFLESQDYSSINSHQRAAMRRFRQRFMYYSYCYDTLRYPEPLPECVIVPAEKD  299

Query  194   QFKETGRLKF  165
             +FKETGRLKF
Sbjct  300   RFKETGRLKF  309



>ref|XP_010478638.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Camelina sativa]
Length=346

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 194/300 (65%), Positives = 237/300 (79%), Gaps = 7/300 (2%)
 Frame = -1

Query  1061  LSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFF  882
             L  + A  ++ T  F++  + L+G++N++RS  D SVRL L+  +GSGF SS++Y HGF+
Sbjct  23    LRLSLAFTNLNTLSFEESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFY  82

Query  881   SAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSR  702
             S+ IKLP+DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPWRFQTN+YGNGST R
Sbjct  83    SSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTQR  142

Query  701   GREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYAT  522
             GREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IRN+AMG D+P KPM LYAT
Sbjct  143   GREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMSLYAT  202

Query  521   IWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE-L  345
             IWDASDWATSGG+YK NYK+APFVA F    L GC+ DP+QEV  +      C D  + L
Sbjct  203   IWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPVD------CSDSVDFL  256

Query  344   EGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             E  D++ +  +QR AM+RFRQ+ MYYSYCYD+VRY   PPECVI  AE+ +FK+TGRLKF
Sbjct  257   ESQDYSTINSRQRAAMRRFRQRFMYYSYCYDTVRYPEAPPECVIVPAEKDRFKDTGRLKF  316



>ref|XP_010499761.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Camelina sativa]
Length=346

 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/300 (65%), Positives = 237/300 (79%), Gaps = 7/300 (2%)
 Frame = -1

Query  1061  LSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFF  882
             L  + A  ++ T  F++  + L+G++N++RS  D SVRL L+  +GSGF SS++Y HGF+
Sbjct  23    LRSSLAFTNLNTLSFEESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFY  82

Query  881   SAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSR  702
             S+ IKLP+DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPWRFQTN+YGNGST R
Sbjct  83    SSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTQR  142

Query  701   GREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYAT  522
             GREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IRN+AMG D+P KPM LYAT
Sbjct  143   GREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMSLYAT  202

Query  521   IWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE-L  345
             IWDASDWATSGG+YK NYK+APFVA F    L GC+ DP+QEV  +      C D  + L
Sbjct  203   IWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPVD------CSDSVDFL  256

Query  344   EGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             E  D++ +  +QR AM+RFRQ+ MYYSYCYD+VRY   PPECVI  AE+ +FK+TGRLKF
Sbjct  257   ESQDYSTINSRQRAAMRRFRQRFMYYSYCYDTVRYPEAPPECVIVPAEKDRFKDTGRLKF  316



>emb|CDY60254.1| BnaCnng35910D [Brassica napus]
Length=342

 Score =   416 bits (1069),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 241/314 (77%), Gaps = 10/314 (3%)
 Frame = -1

Query  1094  LHSSAFFLIAFLSY---TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             L  +  F I FL     ++A  ++ T  F++  + L+G+ N++RS  D SVRL L+  +G
Sbjct  4     LSYNLIFFIVFLCLGLRSSAITNLNTLSFEESLSPLFGDGNLVRSPDDLSVRLLLDKYTG  63

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             SGF SS++Y HGF+S+ IKLP+DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPW
Sbjct  64    SGFISSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPW  123

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             RFQTN+YGNGST RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IR+EAM
Sbjct  124   RFQTNLYGNGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRSEAM  183

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             G D+P KPM LYATIWDASDWATSGG+YK NYKYAPFVA F    L GC+ DP+QEV  +
Sbjct  184   GADYPAKPMSLYATIWDASDWATSGGKYKANYKYAPFVAEFKSFSLDGCSVDPIQEVPTD  243

Query  383   HPGVGGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
                   C D  + LE  D+ ++   QR +M+RFRQ+ MYYSYCYD+VRY   PPECVI  
Sbjct  244   ------CSDSVDFLESQDYFSINSLQRASMRRFRQRFMYYSYCYDTVRYPEAPPECVIVP  297

Query  206   AERQQFKETGRLKF  165
             AE+ +FK+TGRLKF
Sbjct  298   AEKDRFKDTGRLKF  311



>ref|XP_002304356.2| hypothetical protein POPTR_0003s09590g [Populus trichocarpa]
 gb|EEE79335.2| hypothetical protein POPTR_0003s09590g [Populus trichocarpa]
Length=348

 Score =   416 bits (1069),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 238/295 (81%), Gaps = 5/295 (2%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             AAF+++T  FD+G++ L+G+ N++RS    S RL L+  +G+GF SS +Y +GFFSA IK
Sbjct  28    AAFNLSTISFDEGYSPLFGDGNLVRSPDGRSARLLLDRFTGAGFISSRMYKYGFFSANIK  87

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LP  YTAG+ VAFYT+N DVF+KTHDELD EFLGN KG+PWRFQTN+YGNGSTS GREER
Sbjct  88    LPGYYTAGLCVAFYTSNGDVFKKTHDELDIEFLGNTKGEPWRFQTNLYGNGSTSHGREER  147

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDPSKEFHRYSILWT + IIFYIDDVPIRE+IRNE MG +FP KPM LYATIWDAS
Sbjct  148   YRLWFDPSKEFHRYSILWTAKNIIFYIDDVPIREVIRNEEMGSEFPSKPMSLYATIWDAS  207

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD-DRRELEGADF  330
             +WATSGG+YKVNYKYAPFV+ F DL L GC +DP++E     P     + D   LE AD+
Sbjct  208   NWATSGGKYKVNYKYAPFVSEFKDLALEGCPSDPIEEF----PSFDCYESDIARLENADY  263

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             A +T +QR AM+RFRQ++MYYSYCYD++RY VP PECVI  +E+++F++TGRLKF
Sbjct  264   ATITRRQRSAMRRFRQRYMYYSYCYDALRYPVPLPECVIIPSEKERFRDTGRLKF  318



>gb|AAM67311.1| endoxyloglucan transferase, putative [Arabidopsis thaliana]
Length=343

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 195/310 (63%), Positives = 239/310 (77%), Gaps = 7/310 (2%)
 Frame = -1

Query  1091  HSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFR  912
             H     L   L  ++A  ++ T  F++  + L+G++N++RS  D SVRL L+  +GSGF 
Sbjct  8     HIFILILCLCLRSSSAFTNLNTLSFEESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFI  67

Query  911   SSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQT  732
             SS++Y HGF+S+ IKLP+DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPWRFQT
Sbjct  68    SSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQT  127

Query  731   NMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDF  552
             N+YGNGST RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE+IRN+AMG D+
Sbjct  128   NLYGNGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMGADY  187

Query  551   PQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGV  372
             P KPM LYATIWDA DWATSGG+YK NYK+APFVA F    L GC+ DP+QEV  +    
Sbjct  188   PAKPMALYATIWDAFDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPMD----  243

Query  371   GGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQ  195
               C D  + LE  D++++   QR AM+RFRQ+ MYYSYCYD++RY  P PECVI  AE+ 
Sbjct  244   --CSDSVDFLESQDYSSINSHQRAAMRRFRQRFMYYSYCYDTLRYPEPLPECVIVPAEKD  301

Query  194   QFKETGRLKF  165
             +FKETGRLKF
Sbjct  302   RFKETGRLKF  311



>ref|XP_002890971.1| hypothetical protein ARALYDRAFT_473398 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67230.1| hypothetical protein ARALYDRAFT_473398 [Arabidopsis lyrata subsp. 
lyrata]
Length=346

 Score =   414 bits (1064),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 234/292 (80%), Gaps = 7/292 (2%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++ +  F++  + L+G++N++RS  D SVRL L+  +GSGF SS++Y HGF+S+ IKLP+
Sbjct  29    NLNSLSFEESLSPLFGDANLVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFYSSMIKLPA  88

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DYTAG+VVAFYT+N DVFEKTHDELD EFLGN+KGKPWRFQTN+YGNGST RGREERY L
Sbjct  89    DYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRL  148

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDPSKEFHRYSILWT   IIF++DDVPIRE+IRN+AMG D+P KPM LYATIWDASDWA
Sbjct  149   WFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMALYATIWDASDWA  208

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE-LEGADFANV  321
             TSGG+YK NYK+APFVA F    L GC+ DP+QEV  +      C D  + LE  D++++
Sbjct  209   TSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVPVD------CSDSVDFLESQDYSSI  262

Query  320   TPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
                QR AM+RFRQ+ MYYSYCYD++RY  P PECVI  AE+ +FKETGRLKF
Sbjct  263   NAHQRAAMRRFRQRFMYYSYCYDTLRYPEPLPECVIVPAEKDRFKETGRLKF  314



>ref|XP_004300192.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Fragaria vesca subsp. vesca]
Length=343

 Score =   413 bits (1061),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 235/296 (79%), Gaps = 5/296 (2%)
 Frame = -1

Query  1049  AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKI  870
             A  F++TT PFD+G++ L+G+ N++RS     VRL L+  +GSGF SS LY HGFFSAKI
Sbjct  27    AEPFNLTTIPFDEGYSPLFGDGNLVRSPDGKGVRLLLDQYTGSGFISSSLYDHGFFSAKI  86

Query  869   KLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREE  690
             KLPSD TAGI VAFYT+NADVFEK+HDELD EFLGN  GKPWRFQTN+YGNGSTSRGREE
Sbjct  87    KLPSDNTAGICVAFYTSNADVFEKSHDELDIEFLGNTAGKPWRFQTNLYGNGSTSRGREE  146

Query  689   RYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDA  510
             RY LWFDPSK+FHRYSILWT + IIFY+D+VPIRE++R EAMGGD+P KPM LYATIWDA
Sbjct  147   RYRLWFDPSKDFHRYSILWTPKNIIFYVDEVPIREVVRKEAMGGDYPAKPMSLYATIWDA  206

Query  509   SDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE-LEGAD  333
             S+WAT+GG+ K NYKYAPFVA F DLVL GC +DP+++     P    C ++   L   +
Sbjct  207   SNWATNGGKEKTNYKYAPFVAEFKDLVLDGCPSDPIEQF----PFAEACAEKLAYLNAQE  262

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             ++ ++  ++ AM+RFRQ++MYYSYCYDS+RY V  PEC I  AE+ +FK TGRLKF
Sbjct  263   YSTISRARQAAMRRFRQRYMYYSYCYDSLRYPVTMPECEISQAEKARFKNTGRLKF  318



>gb|KEH27691.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=318

 Score =   409 bits (1050),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 229/289 (79%), Gaps = 7/289 (2%)
 Frame = -1

Query  1028  TTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYT  849
              T F     T++  S+I+  T    +  H+ H+  SGF SS++Y HGFFSA IKLPS+Y+
Sbjct  10    VTLFVPPMATVFNSSSIV--TPVIILLNHIIHMQSSGFISSNMYQHGFFSANIKLPSNYS  67

Query  848   AGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFD  669
             AGI VAFYT+N DVFEKTHDELDFEFLGN+ GKPWRFQTN+YGNGST RGREERY LWFD
Sbjct  68    AGICVAFYTSNGDVFEKTHDELDFEFLGNIAGKPWRFQTNLYGNGSTHRGREERYRLWFD  127

Query  668   PSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSG  489
             P+K +HRYSILWT + +IFYID+VPIRE++RNE MG ++P KPM LYATIWDAS+WATSG
Sbjct  128   PTKGYHRYSILWTAKNVIFYIDEVPIREVLRNEEMGSEYPVKPMSLYATIWDASNWATSG  187

Query  488   GRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRR-ELEGADFANVTPK  312
             G+YKVNYKYAPFV  F DLVL+GC+ DP+QEV         C D+  +LE  D+ANVTP 
Sbjct  188   GKYKVNYKYAPFVVEFKDLVLKGCSVDPIQEVSDN----DVCSDQNVDLEAQDYANVTPM  243

Query  311   QRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             +R AM+RFRQ+ MYYSYCYD++RY VPPPEC I  AE+Q+FKETGRLKF
Sbjct  244   RRLAMRRFRQRFMYYSYCYDTIRYPVPPPECNIIPAEKQRFKETGRLKF  292



>gb|EPS64838.1| xyloglucan endotransglucosylase/hydrolase 14, partial [Genlisea 
aurea]
Length=326

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/304 (63%), Positives = 229/304 (75%), Gaps = 4/304 (1%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
             FFL + +  T   F+VTT  F++ ++ L+ + NI  S  D +VRL LN LSGSG  SSD 
Sbjct  5     FFLCSVVIVTVGGFNVTTLKFNEAYSPLFSKFNIHPSADDRAVRLLLNRLSGSGIVSSDY  64

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             YSHGFFSA IK+PS++TAG+VVAFYT+N D FE+ HDELD EFLGNVKGKPWRFQTN YG
Sbjct  65    YSHGFFSAAIKMPSEHTAGVVVAFYTSNVDTFERNHDELDIEFLGNVKGKPWRFQTNAYG  124

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGS SRGREERY LWFDP+ + HRYSILWT  T++FY+D++PIRE+ R  AM GDFP KP
Sbjct  125   NGSVSRGREERYRLWFDPTADSHRYSILWTPITVVFYVDEIPIREIRRCVAMRGDFPAKP  184

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M +YATIWDAS WAT+GGR KVNY+Y PFVA FTDLVLRGC  DP  ++    P     D
Sbjct  185   MSVYATIWDASSWATNGGREKVNYRYEPFVAEFTDLVLRGCIVDPSDQI----PSSNCTD  240

Query  359   DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKET  180
                 L   DFA V+P+ RR MKRFR+K+MYYSYCYD VRY V PPECVI  +ER+ FK T
Sbjct  241   STSSLMAEDFAAVSPQGRRWMKRFREKYMYYSYCYDVVRYPVRPPECVISESEREMFKNT  300

Query  179   GRLK  168
             GRL+
Sbjct  301   GRLR  304



>ref|XP_008800080.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Phoenix dactylifera]
Length=341

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/319 (61%), Positives = 247/319 (77%), Gaps = 7/319 (2%)
 Frame = -1

Query  1118  SMAVPPYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHL  939
             +MA+  +L  ++  F +   + T + F+VTT  FD+G++ L+GE N++RS+   +VRL L
Sbjct  4     AMAISRFL--TALVFFLGAATVTVSGFNVTTLAFDEGYSHLFGEGNLVRSSDGRTVRLLL  61

Query  938   NHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNV  759
             N  SG+GF SSDLY HGFFSA IKLPSDYTAGIVVAFYT+N D+F KTHDELDFEFLGN+
Sbjct  62    NRYSGAGFISSDLYHHGFFSASIKLPSDYTAGIVVAFYTSNGDIFPKTHDELDFEFLGNI  121

Query  758   KGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMI  579
             +G+ WR QTN+YGNGSTSRGREERY+L FDP+KE HRYSILWT   IIFYID  PIRE++
Sbjct  122   RGERWRIQTNVYGNGSTSRGREERYVLPFDPTKEAHRYSILWTATHIIFYIDKTPIREVV  181

Query  578   RNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQ  399
             R++AMGGD+P KPM LYATIWD S WATSGG+YKV YKYAPFVA F+DLVLRGC  DP+Q
Sbjct  182   RSDAMGGDYPSKPMSLYATIWDGSTWATSGGKYKVKYKYAPFVAEFSDLVLRGCRIDPIQ  241

Query  398   EVVGEHPGVGGC-DDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPE  222
              V    P    C +   +L  ADFA +TP++R AM+RFR+++M YS CYD++RY+   P+
Sbjct  242   PV----PSTDHCMEADGDLMAADFAIMTPRKRAAMRRFRERYMTYSVCYDALRYSGALPD  297

Query  221   CVIDAAERQQFKETGRLKF  165
             C I A+E+++F  +G +KF
Sbjct  298   CSIIASEQERFWASGHIKF  316



>ref|XP_009384131.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Musa acuminata subsp. malaccensis]
Length=335

 Score =   404 bits (1039),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 192/307 (63%), Positives = 238/307 (78%), Gaps = 3/307 (1%)
 Frame = -1

Query  1085  SAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSS  906
             SA  L++ +    AAFDVT  PFD+GF+ L+G  N++RS+   +  L LN  SGSGF S+
Sbjct  5     SAVVLLSCVVTVTAAFDVTAVPFDEGFSHLFGNDNLVRSSDGRTAHLSLNRYSGSGFVSN  64

Query  905   DLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNM  726
             D+Y HGFFSA IKLPSDYTAG+VVAFYT+N D+FEKTHDELDFEFLGNV+GK WR QTN+
Sbjct  65    DMYHHGFFSASIKLPSDYTAGVVVAFYTSNGDLFEKTHDELDFEFLGNVRGKDWRIQTNV  124

Query  725   YGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQ  546
             YGNGSTSRGREERY+L FDP+ E HRYSILWT+Q IIFY+DD PIRE++R++AMGGD+P 
Sbjct  125   YGNGSTSRGREERYVLPFDPTAEAHRYSILWTSQLIIFYVDDTPIREVVRSDAMGGDYPS  184

Query  545   KPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGG  366
             KPM +YATIWD S WAT  G+YKVNYKY PFV+ F+DLVLRGC ADP+Q+V  +      
Sbjct  185   KPMSVYATIWDGSTWATGNGKYKVNYKYEPFVSDFSDLVLRGCRADPIQQV--DSAAARR  242

Query  365   CDDRR-ELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
             C +   EL  ADFA +TPK+R AM+RFR+++M YS CYD+ RY V  P+C I  +E+ +F
Sbjct  243   CAEANDELLAADFALMTPKKRAAMRRFRERYMTYSCCYDTNRYPVAFPDCDIVPSEQSRF  302

Query  188   KETGRLK  168
              E G+ K
Sbjct  303   YEWGQSK  309



>ref|XP_010933426.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Elaeis guineensis]
Length=339

 Score =   403 bits (1036),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 242/318 (76%), Gaps = 5/318 (2%)
 Frame = -1

Query  1115  MAVPPYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLN  936
             MA+  +L     FF +A  + TA+ F+VTT  FD+G++ L+GE N++RS    +VRL LN
Sbjct  1     MAISRFLTALVFFFHVATATATASVFNVTTLAFDEGYSHLFGEGNLVRSPDGRTVRLLLN  60

Query  935   HLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVK  756
               SG+GF SSDLY+HGFFSA IKLPSDYTAG+VVAFYT+N D+F KTHDELDFEFLGN++
Sbjct  61    RYSGAGFISSDLYNHGFFSASIKLPSDYTAGVVVAFYTSNGDIFPKTHDELDFEFLGNIR  120

Query  755   GKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIR  576
             G+ WR QTN+YGNGS  RGREERY+L FDP+KE HRYSILWT   IIFY+D  PIRE++R
Sbjct  121   GEKWRIQTNVYGNGSIGRGREERYILPFDPTKEAHRYSILWTATHIIFYVDHTPIREVVR  180

Query  575   NEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQE  396
             ++AMGG++P KPM +YATIWD S WAT+GG YK+ YKYAPFVA F+DLVLRGC  DP+Q 
Sbjct  181   SDAMGGEYPSKPMSVYATIWDGSTWATAGGAYKIKYKYAPFVAEFSDLVLRGCRVDPIQ-  239

Query  395   VVGEHPGVGGCDDR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPEC  219
                + P    C D   EL  ADFA +TP++R AM+RFR+++M YS CYD++RY    P+C
Sbjct  240   ---QRPSTDHCTDADAELMAADFAIMTPRKRAAMRRFRERYMIYSVCYDTLRYPNTLPDC  296

Query  218   VIDAAERQQFKETGRLKF  165
              I  +E+++F E+G  KF
Sbjct  297   TIVPSEQERFWESGSTKF  314



>ref|XP_010434473.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 29 [Camelina sativa]
Length=361

 Score =   404 bits (1037),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 230/291 (79%), Gaps = 6/291 (2%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GE N++RS  D SVRL L+  +GSGF SS +Y HGFFS+ IKLP  YTAGI
Sbjct  42    FDEGLSHLFGEGNLIRSPDDRSVRLLLDKYTGSGFISSSMYQHGFFSSLIKLPGAYTAGI  101

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF K HDELD EFLGNV+GKPWRFQTNMYGNGST+RGREERY LWFDPSK
Sbjct  102   VVAFYTSNGDVFVKNHDELDIEFLGNVEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSK  161

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILWT   IIF++DDVPIRE+IR E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  162   EFHRYSILWTPTKIIFWVDDVPIREIIRKEEMEGDYPQKPMSLYATIWDASSWATSGGKF  221

Query  479   KVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEHPGVG----GCD-DRRELEGADFANVT  318
              V+Y +APFV+ F D+ L GC  +D L  V GE+  +G     C    + L   D++ ++
Sbjct  222   GVDYTFAPFVSEFKDIALDGCNVSDSLPTVTGENNNIGYDHINCSVSDKFLMTNDYSTIS  281

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             PKQ  +M+RFR+++MYYSYCYD++RY+VPPPECVI  AE+ +F++TGRLKF
Sbjct  282   PKQAASMRRFRERYMYYSYCYDTIRYSVPPPECVIVTAEKNRFRDTGRLKF  332



>ref|XP_010439782.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 29 [Camelina sativa]
Length=360

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/291 (64%), Positives = 230/291 (79%), Gaps = 6/291 (2%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GESN++RS  D SVRL L+  +GSGF SS +Y HGFFS+ IKLP  YTA I
Sbjct  41    FDEGLSHLFGESNLIRSPDDRSVRLLLDKYTGSGFISSSMYQHGFFSSLIKLPGAYTADI  100

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF K HDELD EFLGN++GKPWRFQTNMYGNGST+RGREERY LWFDPSK
Sbjct  101   VVAFYTSNGDVFVKNHDELDIEFLGNLEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSK  160

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILWT   IIF++DDVPIRE+IR E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  161   EFHRYSILWTPTKIIFWVDDVPIREIIRKEKMEGDYPQKPMSLYATIWDASSWATSGGKF  220

Query  479   KVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEHPGVG----GCD-DRRELEGADFANVT  318
              V+Y ++PFV+ F D+ L GC  +D L  V GE+  +G     C    + L   D++ ++
Sbjct  221   GVDYTFSPFVSEFKDIALDGCNVSDSLPTVTGENNNIGYDHINCSVSDKFLMTNDYSTIS  280

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             PKQ  +M+RFR+++MYYSYCYD++RY+VPPPECVI  AE+ +F++TGRLKF
Sbjct  281   PKQAASMRRFRERYMYYSYCYDTIRYSVPPPECVIVTAEKNRFRDTGRLKF  331



>ref|XP_006432690.1| hypothetical protein CICLE_v10001649mg [Citrus clementina]
 ref|XP_006471484.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Citrus sinensis]
 gb|ESR45930.1| hypothetical protein CICLE_v10001649mg [Citrus clementina]
Length=356

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 192/296 (65%), Positives = 236/296 (80%), Gaps = 4/296 (1%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             ++ AF++TT  FD+G++ L+G+ N++RS    +VRL LN  SGSGF SS LY+HGFFSA 
Sbjct  40    SSPAFNLTTISFDEGYSHLFGDGNLIRSPDGKNVRLLLNRFSGSGFVSSKLYNHGFFSAM  99

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLPSD+TAG+ VAFYT+N DVF KTHDELDFEFLGNV GKPWRFQTN YGNGST+RGRE
Sbjct  100   IKLPSDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTARGRE  159

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDP+K+FHRYSILWT+  IIFY+D+VPIRE++R+ AMGGDFP KPM LY TIWD
Sbjct  160   ERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSTAMGGDFPSKPMSLYTTIWD  219

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGAD  333
             AS+WATSGG+ KVNYKYAPF + F D VL GC  DP+++V    P     D    L    
Sbjct  220   ASNWATSGGKAKVNYKYAPFTSEFKDFVLEGCPVDPIEQV----PSSNCQDTDSRLAEKG  275

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              + +TP  RRAM+RFR++++YYSYCYD++RY VP PECV+  +ERQ+FK+TGRLKF
Sbjct  276   LSVITPAGRRAMRRFRERYIYYSYCYDTIRYPVPLPECVLVPSERQRFKDTGRLKF  331



>ref|XP_010449431.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 29 [Camelina sativa]
Length=361

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/291 (64%), Positives = 229/291 (79%), Gaps = 6/291 (2%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GE N++RS  D SVRL L+  +GSGF SS +Y HGFFS+ IKLP  YTAGI
Sbjct  42    FDEGLSHLFGEGNLIRSPDDRSVRLLLDKYTGSGFISSSMYQHGFFSSLIKLPGAYTAGI  101

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF K HDELD EFLGN++GKPWRFQTNMYGNGST+RGREERY LWFDPSK
Sbjct  102   VVAFYTSNGDVFVKNHDELDIEFLGNLEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSK  161

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILWT   IIF++DDVPIRE+ R E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  162   EFHRYSILWTPTKIIFWVDDVPIREIFRKEEMEGDYPQKPMSLYATIWDASSWATSGGKF  221

Query  479   KVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEHPGVG----GCDDRRE-LEGADFANVT  318
              V+Y +APFV+ F D+ L GC  +D L  V GE+  +G     C    + L   D++ ++
Sbjct  222   GVDYTFAPFVSEFKDIALDGCNVSDSLPTVTGENNNIGYDHINCSVSDQFLMTNDYSTIS  281

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             PKQ  +M+RFR+++MYYSYCYD++RY+VPPPECVI  AE+ +F++TGRLKF
Sbjct  282   PKQAASMRRFRERYMYYSYCYDTIRYSVPPPECVIVTAEKNRFRDTGRLKF  332



>ref|XP_010919979.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Elaeis guineensis]
Length=337

 Score =   397 bits (1021),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 190/317 (60%), Positives = 242/317 (76%), Gaps = 7/317 (2%)
 Frame = -1

Query  1115  MAVPPYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLN  936
             MA+  +L  ++  F +   + T + F+VTT  FD+G++ L+GE N++RS    +VRL LN
Sbjct  1     MAISRFL--TALVFFLGATTVTVSGFNVTTRAFDEGYSHLFGEGNLVRSPDGRTVRLVLN  58

Query  935   HLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVK  756
               SG+GF SSDLY HGFFSA IKLPSDYTAGIVVAFYT+N D+F KTHDELDFEFLG+++
Sbjct  59    RYSGAGFISSDLYYHGFFSASIKLPSDYTAGIVVAFYTSNGDIFPKTHDELDFEFLGSIR  118

Query  755   GKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIR  576
             G+ WR QTN+YGNGST+RGREERY+L FDP+K+ HRYSILWT   IIFYID+ PIRE+ R
Sbjct  119   GERWRIQTNVYGNGSTNRGREERYILPFDPTKDAHRYSILWTATHIIFYIDNTPIREVAR  178

Query  575   NEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQE  396
             ++AMGGDFP KPM LYATIWD S WATSGG+YKV YKYAPF+A F+DLVL GC  DP+Q+
Sbjct  179   SDAMGGDFPSKPMSLYATIWDGSTWATSGGKYKVKYKYAPFIAEFSDLVLHGCRVDPIQQ  238

Query  395   VVGEHPGVGGC-DDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPEC  219
             V    P    C +   EL  ADFA +TP++R AM+RFR+++M YS CYD++RY+   P+C
Sbjct  239   V----PSTEHCMEANDELMAADFAIMTPRKRAAMRRFRERYMTYSVCYDTLRYSDTLPDC  294

Query  218   VIDAAERQQFKETGRLK  168
              I  +E+ +F E+G  K
Sbjct  295   NIIPSEQGRFSESGHTK  311



>emb|CDX78912.1| BnaA01g09790D [Brassica napus]
Length=339

 Score =   397 bits (1020),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 185/285 (65%), Positives = 226/285 (79%), Gaps = 8/285 (3%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GESN++RS  D SVRL L+  +GSGF SS++Y HGFFS+ IKLP  YTAG+
Sbjct  40    FDEGLSHLFGESNLIRSPDDRSVRLLLDKYTGSGFISSNMYQHGFFSSLIKLPGAYTAGL  99

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF K HDELD EFLGNV+GKPWRFQTNMYGNGST+RGREERY LWFDPSK
Sbjct  100   VVAFYTSNGDVFVKNHDELDIEFLGNVEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSK  159

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILW    IIF++DDVPIRE+IR E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  160   EFHRYSILWNPTKIIFWVDDVPIREIIRKEEMKGDYPQKPMSLYATIWDASSWATSGGKF  219

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
              V+Y ++PFV+ F D+ L GC       V    P     ++  +L  +D++ ++PKQ  A
Sbjct  220   GVDYAFSPFVSEFKDVALDGC------NVSDSFP--NNNNNTVDLMASDYSTISPKQAAA  271

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             M+RFR+++MYYSYCYD+VRYAVPPPECVI  AE+ +FK+TGRLKF
Sbjct  272   MRRFRERYMYYSYCYDTVRYAVPPPECVIVTAEKDRFKDTGRLKF  316



>ref|XP_008802555.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Phoenix dactylifera]
Length=346

 Score =   397 bits (1020),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 233/313 (74%), Gaps = 4/313 (1%)
 Frame = -1

Query  1103  PYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             P++L S    +        A FDV    F++G++ L+GE N++RS    +VRL LNH SG
Sbjct  3     PHILMSFVITIFVATMMVTAGFDVPLLAFEEGYSPLFGEGNLIRSVDGRNVRLILNHNSG  62

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             +GF S+++Y HG FSA IKLPSDYTAGIVVAFYT+N DVFEK HDELDFEFLGN++GK W
Sbjct  63    AGFISTEMYHHGLFSASIKLPSDYTAGIVVAFYTSNGDVFEKNHDELDFEFLGNIRGKEW  122

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             R QTN+YGNGS SRGREERY L FDP+KEFHRYSI+WT + IIFYIDD PIRE+ R EAM
Sbjct  123   RVQTNVYGNGSVSRGREERYNLPFDPTKEFHRYSIIWTTENIIFYIDDTPIREVRRTEAM  182

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             GGD+P KPM LYATIWDAS+WATSGGRYKV+Y YAPFV+ FTDL L GC  DPLQ++   
Sbjct  183   GGDYPSKPMSLYATIWDASNWATSGGRYKVDYSYAPFVSEFTDLALLGCRLDPLQQIPS-  241

Query  383   HPGVGGCD-DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
                +  C  D  EL     A +TP++R+AM  FRQ++M YS+CYD+ RY V  P+C +  
Sbjct  242   --AMKNCSADDAELMATGLAAMTPEKRQAMLAFRQRYMTYSFCYDTKRYPVTFPDCDLVE  299

Query  206   AERQQFKETGRLK  168
             +ER +F++TG L+
Sbjct  300   SERSRFRDTGHLR  312



>ref|XP_009132429.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 29 [Brassica rapa]
Length=351

 Score =   397 bits (1021),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/289 (64%), Positives = 227/289 (79%), Gaps = 4/289 (1%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GESN++RS  D SVRL L+  +GSGF SS++Y HGFFS+ IKLP  YTAG+
Sbjct  40    FDEGLSHLFGESNLIRSPDDRSVRLLLDKYTGSGFISSNMYQHGFFSSLIKLPGAYTAGL  99

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF K HDELD EFLGNV+GKPWRFQTNMYGNGST+RGREERY LWFDPSK
Sbjct  100   VVAFYTSNGDVFVKNHDELDIEFLGNVEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSK  159

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILW    IIF++DDVPIRE+IR E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  160   EFHRYSILWNPTKIIFWVDDVPIREIIRKEEMKGDYPQKPMSLYATIWDASSWATSGGKF  219

Query  479   KVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEHPG---VGGCDDRRELEGADFANVTPK  312
              V+Y ++PFV+ F D+ L GC  +D          G   V      ++L  +D++ ++PK
Sbjct  220   GVDYAFSPFVSEFKDVALDGCNVSDSFPNNNNNTVGYNYVNCSASDQDLMASDYSTISPK  279

Query  311   QRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             Q  AM+RFR+++MYYSYCYD+VRYAVPPPECVI  AE+ +FK+TGRLKF
Sbjct  280   QAAAMRRFRERYMYYSYCYDTVRYAVPPPECVIVTAEKDRFKDTGRLKF  328



>emb|CDP11680.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   397 bits (1021),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/299 (61%), Positives = 233/299 (78%), Gaps = 6/299 (2%)
 Frame = -1

Query  1061  LSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFF  882
             ++ T +AF+ TT  FD+G+T L+ + NI RS  D +VRL LN LSGSG  SSD Y+HGFF
Sbjct  28    ITTTVSAFNRTTIRFDEGYTPLFSDFNIDRSPDDKTVRLLLNRLSGSGIISSDYYNHGFF  87

Query  881   SAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSR  702
             SA+IK+P++Y+AGIVVAFYT+N D +EK HDELDFEFLGNV  +PWRFQTNMYG GS SR
Sbjct  88    SARIKMPANYSAGIVVAFYTSNIDTWEKNHDELDFEFLGNVNDRPWRFQTNMYGGGSVSR  147

Query  701   GREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYAT  522
             GREERY LWFDPSKE H+YSI W+ + IIFY+DD+PIRE+I +  +GGD+P KPM LYAT
Sbjct  148   GREERYRLWFDPSKESHQYSIFWSPKNIIFYVDDIPIREVIHHPDLGGDYPSKPMSLYAT  207

Query  521   IWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR-REL  345
             IWDAS WAT+GG+ KVNY+Y PF A F DLVL GC  DP++++   +     C DR   L
Sbjct  208   IWDASSWATNGGKAKVNYEYEPFAAEFKDLVLEGCRVDPIEQISSTN-----CTDRIARL  262

Query  344   EGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
                ++A + P+ R+AMK FR+++MYYSYCYD++RY VPPPECVI   E+++F++TGRL+
Sbjct  263   IAQEYATIKPEGRKAMKWFRERYMYYSYCYDNLRYKVPPPECVIVPTEKERFRDTGRLR  321



>ref|XP_011070344.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Sesamum indicum]
Length=353

 Score =   397 bits (1019),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/294 (62%), Positives = 223/294 (76%), Gaps = 4/294 (1%)
 Frame = -1

Query  1049  AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKI  870
             A AF+VTT  F + ++ L+ + NI RS  D +V L LN LSGSG  SSD Y++GFFSA I
Sbjct  33    AKAFNVTTLTFGESYSPLFSKFNIRRSPDDRTVSLLLNRLSGSGIISSDYYNYGFFSASI  92

Query  869   KLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREE  690
             K+PS YTAGIVVAFYT+N D FEK HDELD EFLGNV GK WRFQTNMYGNGS SRGREE
Sbjct  93    KMPSKYTAGIVVAFYTSNVDTFEKNHDELDIEFLGNVPGKAWRFQTNMYGNGSVSRGREE  152

Query  689   RYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDA  510
             RY +WFDPSK+ HRYSILWT   IIFY+D++PIRE++RN AM GD+P KPM +YATIWDA
Sbjct  153   RYRMWFDPSKDSHRYSILWTPTNIIFYVDEIPIREVVRNAAMRGDYPSKPMSVYATIWDA  212

Query  509   SDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF  330
             S WATSGG+ KVNY++ PF+A F DLVL GC  DP+ +++  +      D    L   D+
Sbjct  213   SSWATSGGKRKVNYRFQPFIAEFKDLVLEGCIVDPVDQILSSN----CTDTAAALMAKDY  268

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
             + VTP+ R++M+ FRQ+HMYYSYCYD+ RY VPPPECVI  +ER+ F  +GR K
Sbjct  269   STVTPETRKSMRWFRQRHMYYSYCYDTRRYPVPPPECVILPSEREMFTSSGRPK  322



>ref|XP_009386254.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Musa acuminata subsp. malaccensis]
Length=339

 Score =   396 bits (1017),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/308 (61%), Positives = 231/308 (75%), Gaps = 4/308 (1%)
 Frame = -1

Query  1082  AFFLIAFLSY--TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             +F ++A L+   + A+ +VTT  FD+G+  L+GE N++RS    SV L LN  SGSGF S
Sbjct  9     SFVVVAVLALASSVASVNVTTLAFDEGYVPLFGEGNLVRSAGGRSVSLLLNRFSGSGFIS  68

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
              D+Y HG FSA IKLPSDYTAG+VVAFYT+N DVFEK HDELDFEFLGN++GK WR QTN
Sbjct  69    KDMYYHGLFSASIKLPSDYTAGVVVAFYTSNGDVFEKNHDELDFEFLGNIRGKEWRVQTN  128

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGST RGREERY L FDP+ +FHRYSILWT + IIFYIDD PIRE+ R++AMGGD+P
Sbjct  129   VYGNGSTCRGREERYYLPFDPTADFHRYSILWTAENIIFYIDDTPIREVRRSDAMGGDYP  188

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LYATIWDAS+WATSGG+YKVNYK+ PFV+ F+DL L GC  DP+Q+V     G  
Sbjct  189   SKPMSLYATIWDASNWATSGGKYKVNYKFGPFVSSFSDLALLGCRLDPIQQVPTTQNGCA  248

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
               D   EL       +TP++RRAM+ FR+++M YS CYD  RY  P PEC +  +E ++F
Sbjct  249   AAD--AELATTGLHVMTPEKRRAMRAFREQYMSYSVCYDRARYPEPLPECDVLESEGKRF  306

Query  188   KETGRLKF  165
             +ETG LKF
Sbjct  307   RETGHLKF  314



>ref|XP_004954728.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like, partial [Setaria italica]
Length=356

 Score =   396 bits (1018),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 230/295 (78%), Gaps = 2/295 (1%)
 Frame = -1

Query  1043  AFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKL  864
             A +VTT  F++G+  L+G+ NILRS  D +V L L+  +GSGF SS +Y HGFFSA IKL
Sbjct  19    AINVTTMAFEEGYAPLFGQDNILRSADDRTVSLLLDRSTGSGFISSSMYQHGFFSASIKL  78

Query  863   PSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERY  684
             PSDYTAG+VVAFYT+N DVFEK HDELDFEFLGN++GKPWR QTN+YGNGS SRGREERY
Sbjct  79    PSDYTAGVVVAFYTSNGDVFEKRHDELDFEFLGNIRGKPWRVQTNLYGNGSVSRGREERY  138

Query  683   LLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASD  504
             +L FDP+ EFHRYSILWT   + FY+DDVP+RE+ R+ AMGGDFP KPM LYAT+WDAS 
Sbjct  139   VLPFDPTTEFHRYSILWTAAAVAFYVDDVPVREVRRSAAMGGDFPSKPMSLYATVWDAST  198

Query  503   WATSGGRYKVNYKYAPFVAHFTDLVLRGCAA--DPLQEVVGEHPGVGGCDDRRELEGADF  330
             WATSGGRY+VNY+Y PFVA FTDL L GC A  DP++ V G  P  G       L  +D 
Sbjct  199   WATSGGRYRVNYRYGPFVASFTDLALLGCRADDDPIRMVAGGGPRRGCAAAEAALRASDL  258

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             A +T ++++AM+RFR+++M YSYCYD+ RY V PPEC +  +ER++FK++G L+F
Sbjct  259   AVMTVEKQQAMRRFREQNMVYSYCYDTWRYPVAPPECDVVESERRRFKDSGHLRF  313



>gb|AFR46573.1| xyloglucan endotransglucosylase/hydrolase 4 [Rosa x borboniana]
Length=348

 Score =   396 bits (1017),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 195/297 (66%), Positives = 237/297 (80%), Gaps = 5/297 (2%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
              AA F++TT PFD+G+  L+G+ N++RS     VRL L+  +GSGF SS LY HGFFSAK
Sbjct  31    NAAPFNLTTIPFDEGYNHLFGDGNLVRSPDGKGVRLLLDQYTGSGFISSSLYDHGFFSAK  90

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLPSDYTAGI VAFYT+NADVFEK+HDELD EFLGN + KPWRFQTN+YGNGST+RGRE
Sbjct  91    IKLPSDYTAGICVAFYTSNADVFEKSHDELDIEFLGNRERKPWRFQTNLYGNGSTNRGRE  150

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDP+K+FHRYSILWT   IIFY+D+VPIRE++R EAMGGD+P KPM LYATIWD
Sbjct  151   ERYRLWFDPTKDFHRYSILWTPNNIIFYVDEVPIREVVRKEAMGGDYPSKPMSLYATIWD  210

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE-LEGA  336
             AS+WAT GG+ KVNYK+APFVA F DLVL GC ADP+++     P    C ++   L   
Sbjct  211   ASNWATDGGKAKVNYKFAPFVAEFKDLVLEGCPADPIEQF----PFAEFCAEKLAYLTSQ  266

Query  335   DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             D++ ++  +R AM+RFRQ++MYYSYCYDS+RY VP PEC I  AE+ +FK+TGRLKF
Sbjct  267   DYSTISHARRAAMRRFRQRYMYYSYCYDSLRYPVPMPECEIIPAEKARFKDTGRLKF  323



>ref|XP_009136983.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 29 [Brassica rapa]
 emb|CDX98602.1| BnaA03g43870D [Brassica napus]
Length=347

 Score =   395 bits (1014),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 226/287 (79%), Gaps = 2/287 (1%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GESN++RS  D SVRL L+  +GSGF SS +Y HGFFS+ IKLP   TAG+
Sbjct  34    FDEGLSHLFGESNLIRSPDDRSVRLLLDKYTGSGFISSSMYQHGFFSSLIKLPGANTAGL  93

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF K HDELD EFLGNV+GKPWRFQTNMYGNGSTSRGREERY LWFDPSK
Sbjct  94    VVAFYTSNGDVFVKNHDELDIEFLGNVEGKPWRFQTNMYGNGSTSRGREERYRLWFDPSK  153

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILW    IIF++DDVPIRE+ R E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  154   EFHRYSILWNPTKIIFWVDDVPIREIKRKEEMKGDYPQKPMSLYATIWDASSWATSGGKF  213

Query  479   KVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEHPGVGGCDDRRE-LEGADFANVTPKQR  306
              V+Y ++PFV+ F D+ L GC  ++ L  V  ++     C    + L  +D++ ++PKQ 
Sbjct  214   GVDYTFSPFVSEFKDIALDGCNVSESLTTVTRDNYNNINCSASDQLLMTSDYSTISPKQA  273

Query  305   RAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              AM+RFR+++MYYSYCYD+VRYAVPPPECVI  AE+ +F++TGRLKF
Sbjct  274   AAMRRFRERYMYYSYCYDTVRYAVPPPECVILTAEKDRFRDTGRLKF  320



>gb|KDO57189.1| hypothetical protein CISIN_1g018153mg [Citrus sinensis]
Length=360

 Score =   395 bits (1015),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 232/292 (79%), Gaps = 4/292 (1%)
 Frame = -1

Query  1040  FDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLP  861
             F++ T  FD+G++ L+G+ N++RS    +VRL LN  SGSGF SS LY+HGFFSA IKLP
Sbjct  48    FNLATISFDEGYSHLFGDGNLIRSPDGKNVRLLLNRFSGSGFVSSKLYNHGFFSAMIKLP  107

Query  860   SDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYL  681
             SD+TAG+ VAFYT+N DVF KTHDELDFEFLGNV GKPWRFQTN YGNGST+RGREERY 
Sbjct  108   SDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTARGREERYQ  167

Query  680   LWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDW  501
             LWFDP+K+FHRYSILWT+  IIFY+D+VPIRE++R+ AMGGDFP KPM LY TIWDAS+W
Sbjct  168   LWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSTAMGGDFPSKPMSLYTTIWDASNW  227

Query  500   ATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANV  321
             ATSGG+ KVNYKYAPF + F D VL GC  DP+++V    P     D    L     + +
Sbjct  228   ATSGGKAKVNYKYAPFTSEFKDFVLEGCPVDPIEQV----PSSNCQDTDSRLAEKGLSVI  283

Query  320   TPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             TP  RRAM+RFR++++YYSYCYD++RY VP PECV+  +ERQ+FK+TGRLKF
Sbjct  284   TPAGRRAMRRFRERYIYYSYCYDTIRYPVPLPECVLVPSERQRFKDTGRLKF  335



>emb|CDX99402.1| BnaC01g11500D [Brassica napus]
Length=340

 Score =   394 bits (1013),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 227/285 (80%), Gaps = 7/285 (2%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GESN++RS  D SVRL L+  +GSGF SS++Y HGFFS+ IKLP  YTAG+
Sbjct  40    FDEGLSHLFGESNLIRSPDDRSVRLLLDKYTGSGFISSNMYQHGFFSSLIKLPGAYTAGL  99

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF KTHDELD EFLGNV+GKPWRFQTNMYGNGST+RGREERY LWFDPSK
Sbjct  100   VVAFYTSNGDVFVKTHDELDIEFLGNVEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSK  159

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILW    IIF++DDVPIRE+IR E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  160   EFHRYSILWNPTKIIFWVDDVPIREIIRKEEMKGDYPQKPMSLYATIWDASSWATSGGKF  219

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
              V+Y ++PFV+ F D+ L GC        V +       ++  +L  +D++ ++PKQ  A
Sbjct  220   GVDYAFSPFVSEFKDVALDGCN-------VSDSFPNNNNNNTVDLMTSDYSTISPKQAAA  272

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             M+RFR+++MYYSYCYD+VRYAVPPPECVI  AE+ +F++TGRLKF
Sbjct  273   MRRFRERYMYYSYCYDTVRYAVPPPECVIVTAEKNRFRDTGRLKF  317



>ref|XP_009401243.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Musa acuminata subsp. malaccensis]
Length=338

 Score =   394 bits (1012),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/308 (60%), Positives = 235/308 (76%), Gaps = 3/308 (1%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             ++A  +++ +   A A +VTT PFD+GF  L+G+ N++RS    S RL LN  SGSGF S
Sbjct  8     ATAVVMLSCIVTAAVALNVTTLPFDEGFCHLFGDDNLVRSPDGRSARLILNRYSGSGFIS  67

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
             +DLY HGFFSA IKLPSDYTAG+VVAFYT+N D+FEKTHDELDFEFLGN +G+ WR QTN
Sbjct  68    NDLYDHGFFSASIKLPSDYTAGVVVAFYTSNGDIFEKTHDELDFEFLGNTRGREWRIQTN  127

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGSTSRGREERYLL FDP+ E HRYSILWT+  IIFYIDD PIRE++R++AMGGD+P
Sbjct  128   VYGNGSTSRGREERYLLPFDPTVEAHRYSILWTSDFIIFYIDDTPIREVVRSDAMGGDYP  187

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM +YATIWD S WAT  G+YKVNYKYAPFV+ F+DLVLRGC  DP+Q+         
Sbjct  188   SKPMSVYATIWDGSTWATGNGKYKVNYKYAPFVSDFSDLVLRGCRVDPIQQPDSARRCAE  247

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
               +D   L  ADFA +TPK+R AM+RFR+++M Y++CYD+ RY +  P+C +  +E+ +F
Sbjct  248   ANED---LLTADFAVMTPKKRAAMRRFRERYMTYAFCYDTNRYPLTFPDCDVIPSEQSRF  304

Query  188   KETGRLKF  165
              E G  K+
Sbjct  305   FEWGETKY  312



>ref|XP_009804856.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nicotiana sylvestris]
Length=361

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/296 (61%), Positives = 231/296 (78%), Gaps = 6/296 (2%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             T  AF+++T  +++G++ L+ + NI RS  D S RL LN  SGSG  S++ Y++GFFSA 
Sbjct  31    TTRAFNLSTITYEEGYSPLFSDFNIERSPDDTSFRLLLNRFSGSGVISTEYYNYGFFSAS  90

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLP+ YTAGIVVAFYT+N D FEK HDELD EFLGNV G+PWRFQTN+YGNGS SRGRE
Sbjct  91    IKLPAIYTAGIVVAFYTSNVDTFEKNHDELDIEFLGNVNGQPWRFQTNLYGNGSVSRGRE  150

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY +WFDPSK+FH YSILWT + IIFYID+ PIRE+ RN AMGGDFP KPM LYATIWD
Sbjct  151   ERYRMWFDPSKDFHHYSILWTPKNIIFYIDETPIREVNRNPAMGGDFPSKPMSLYATIWD  210

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR-RELEGA  336
             AS WAT+GG+ KV+YK+ PF A F DLVL GC  DP++++   +     C DR  +L   
Sbjct  211   ASSWATNGGKAKVDYKHEPFAAEFKDLVLEGCIVDPIEQISSTN-----CTDRIAKLLAQ  265

Query  335   DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
             +++ +TP++R++MK FR+++MYYSYCYD++RY VPPPECVI  +ER  FK++GRL+
Sbjct  266   NYSIMTPERRKSMKWFRERYMYYSYCYDNIRYPVPPPECVIVQSERDLFKDSGRLR  321



>emb|CDY01577.1| BnaC07g35670D [Brassica napus]
Length=348

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/287 (64%), Positives = 226/287 (79%), Gaps = 2/287 (1%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GESN++RS  D SVRL L+  +GSGF SS +Y HGFFS+ IKLP   TAG+
Sbjct  35    FDEGLSHLFGESNLIRSPDDRSVRLLLDKYTGSGFISSSMYQHGFFSSLIKLPGANTAGL  94

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF K HDELD EFLGNV+GKPWRFQTNMYGNGSTSRGREERY LWFDPSK
Sbjct  95    VVAFYTSNGDVFVKNHDELDIEFLGNVEGKPWRFQTNMYGNGSTSRGREERYRLWFDPSK  154

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILW    IIF++DDVPIRE+ R E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  155   EFHRYSILWNPTKIIFWVDDVPIREIKRKEEMNGDYPQKPMSLYATIWDASSWATSGGKF  214

Query  479   KVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEHPGVGGCDDRRE-LEGADFANVTPKQR  306
              V+Y ++PFV+ F D+ L GC  ++ L  +  ++     C    + L  +D++ ++PKQ 
Sbjct  215   SVDYTFSPFVSEFKDIALDGCNVSESLTTLTRDNYNNINCSASDQLLMTSDYSTISPKQA  274

Query  305   RAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              AM+RFR+++MYYSYCYD+VRYAVPPPECVI  AE+ +F++TGRLKF
Sbjct  275   AAMRRFRERYMYYSYCYDTVRYAVPPPECVILTAEKDRFRDTGRLKF  321



>ref|XP_004245964.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Solanum lycopersicum]
Length=372

 Score =   393 bits (1010),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 225/295 (76%), Gaps = 4/295 (1%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             T  AF++ T  F +G++ L+ + NI RS  D S RL LN  SGSG  S++ Y++GFFSA 
Sbjct  35    TYKAFNLPTITFKEGYSPLFSDFNIERSPDDRSFRLLLNKFSGSGVISTEYYNYGFFSAS  94

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLP+ YTAGIVVAFYT+NAD FEK HDELD EFLGNV G+PWRFQTNMYGNGS SRGRE
Sbjct  95    IKLPAIYTAGIVVAFYTSNADTFEKNHDELDIEFLGNVNGQPWRFQTNMYGNGSVSRGRE  154

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY +WFDPSK+FH+YSILWT + IIFYID+ P+RE+ R+ AMGGDFP KPM LYATIWD
Sbjct  155   ERYRMWFDPSKDFHQYSILWTPKNIIFYIDETPLREINRHPAMGGDFPAKPMALYATIWD  214

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGAD  333
             AS WAT+GG+ KV+YKY PF     DLVL GC  DP +++    P     D   +L   D
Sbjct  215   ASSWATNGGKAKVDYKYEPFATELKDLVLEGCIVDPSEQI----PSTNCTDRNAKLLAQD  270

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
             ++N+TP++R  MK FR+++MYYSYCYD++RY VPPPECVI  +ER  F+++GRL+
Sbjct  271   YSNITPERRNNMKFFRERYMYYSYCYDNLRYPVPPPECVIVQSERDLFRDSGRLR  325



>ref|XP_006352933.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Solanum tuberosum]
Length=389

 Score =   393 bits (1009),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 227/292 (78%), Gaps = 4/292 (1%)
 Frame = -1

Query  1043  AFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKL  864
             AF+++T  F++G++ L+ + NI RS  D S RL LN  SGSG  S++ Y++GFFSA IKL
Sbjct  55    AFNLSTITFEEGYSPLFSDFNIERSPDDRSFRLLLNKFSGSGVISTEYYNYGFFSASIKL  114

Query  863   PSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERY  684
             P+ YTAGIVVAFYT+NAD FEK HDELD EFLGNV G+PWRFQTNMYGNGS SRGREERY
Sbjct  115   PAIYTAGIVVAFYTSNADTFEKNHDELDIEFLGNVNGQPWRFQTNMYGNGSVSRGREERY  174

Query  683   LLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASD  504
              +WFDPSK+FH+YSILWT + IIFYID+ P+RE+ R+ AMGGDFP KPM LYATIWDAS 
Sbjct  175   RMWFDPSKDFHQYSILWTPKNIIFYIDETPLREINRHPAMGGDFPSKPMSLYATIWDASS  234

Query  503   WATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFAN  324
             WAT+GG+ KV+YK+ PF     DLVL GC  DP +++    P     D   +L   D++N
Sbjct  235   WATNGGKAKVDYKFEPFATELKDLVLEGCIVDPTEQI----PSTNCTDRSAKLLAQDYSN  290

Query  323   VTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
             +T ++R++MK FR+++MYYSYCYD++RY VPPPECVI  +ER  F+++GRL+
Sbjct  291   ITTERRKSMKFFRERYMYYSYCYDNLRYPVPPPECVIVQSERDLFRDSGRLR  342



>gb|EYU45258.1| hypothetical protein MIMGU_mgv1a008549mg [Erythranthe guttata]
Length=370

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/293 (62%), Positives = 225/293 (77%), Gaps = 6/293 (2%)
 Frame = -1

Query  1043  AFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKL  864
             +F+VTT  FD+ ++ L+ + NI RS  D + RL LN LSGSG  SSD Y +GFFSA IK+
Sbjct  53    SFNVTTLTFDESYSPLFSDFNIQRSPDDKTARLLLNRLSGSGIISSDYYKYGFFSASIKM  112

Query  863   PSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERY  684
             PS YTAGIVVAFYT+N D FE+ HDELD EFLGNV+GK WRFQTN+YGNGS SRGREERY
Sbjct  113   PSRYTAGIVVAFYTSNVDTFERNHDELDIEFLGNVEGKAWRFQTNVYGNGSVSRGREERY  172

Query  683   LLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASD  504
              +WFDPSK+ HRYSILWT   IIFY+D++PIRE+IRN AM GD+P KPM +YATIWDAS 
Sbjct  173   RMWFDPSKDSHRYSILWTPTNIIFYVDEIPIREVIRNAAMRGDYPSKPMSVYATIWDASS  232

Query  503   WATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDD-RRELEGADFA  327
             WATSGG+ KV+Y+Y PFVA F DLVL GC  DP+ +++  +     C D    L   DFA
Sbjct  233   WATSGGKKKVDYRYQPFVAEFRDLVLEGCIVDPVDQLLSSN-----CTDITAALMARDFA  287

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
              VTP++R++M  FRQ++MYYSYCYD+VRY V PPECV+  +ER+ F+ +G L+
Sbjct  288   AVTPRRRQSMAWFRQRYMYYSYCYDNVRYPVSPPECVVVPSEREMFRSSGGLR  340



>ref|XP_006285076.1| hypothetical protein CARUB_v10006389mg [Capsella rubella]
 gb|EOA17974.1| hypothetical protein CARUB_v10006389mg [Capsella rubella]
Length=361

 Score =   390 bits (1002),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 233/322 (72%), Gaps = 11/322 (3%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             LL      +I          ++    FD+G + L+GE N++RS  D SVRL L+  +GSG
Sbjct  16    LLRVMMMMMIGSCRCVLGLENINPIFFDEGLSHLFGEGNLIRSPDDRSVRLLLDKYTGSG  75

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F SS +Y HGFFS+ IKLP  YTAGIVVAFYT+N DVF K HDELD EFLGN +GKPWRF
Sbjct  76    FISSSMYQHGFFSSLIKLPGAYTAGIVVAFYTSNGDVFVKNHDELDIEFLGNQEGKPWRF  135

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTNMYGNGST+RGREERY LWFDPSKEFHRYSILWT   IIF++DDVPIRE++R E M G
Sbjct  136   QTNMYGNGSTNRGREERYRLWFDPSKEFHRYSILWTPTKIIFWVDDVPIREIVRKEEMEG  195

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEH  381
             D+PQKPM LYATIWDAS WATSGG++ V+Y ++PFV+ F D+ L GC  +D L  V GE+
Sbjct  196   DYPQKPMSLYATIWDASSWATSGGKFGVDYTFSPFVSEFKDIALDGCNVSDSLPTVTGEN  255

Query  380   P---------GVGGCDDRRE-LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVP  231
                       G   C    + L   D++ ++PKQ  +M+RFR+++MYYSYCYD++RY+ P
Sbjct  256   NNNNNNVGNYGHINCSVSDQFLMTNDYSTISPKQAASMRRFRERYMYYSYCYDTIRYSKP  315

Query  230   PPECVIDAAERQQFKETGRLKF  165
             PPECVI  AE+ +F++TGRLKF
Sbjct  316   PPECVIVTAEKNRFRDTGRLKF  337



>dbj|BAO02542.1| endo-(1,4)-beta-D-glucanase ortholog, partial [Nicotiana alata]
Length=329

 Score =   389 bits (999),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 240/318 (75%), Gaps = 6/318 (2%)
 Frame = -1

Query  1118  SMAVPPYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHL  939
             S ++ P+ L    +   A  + T  AF+++T  +++G++ L+ + NI RS  D S RL L
Sbjct  10    SKSLTPFSLLLLLYIFPAAAAATTRAFNLSTITYEEGYSPLFSDFNIERSPDDTSFRLLL  69

Query  938   NHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNV  759
             N  SGSG  S++ Y++GFFSA IKLP+ YTAGIVVAFYT+N D FEK HDELD EFLGNV
Sbjct  70    NRFSGSGVISTEYYNYGFFSASIKLPAIYTAGIVVAFYTSNVDTFEKNHDELDIEFLGNV  129

Query  758   KGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMI  579
              G+PWRFQTN+YGNGS SRGREERY +WFDPSK+FH YSILWT + IIFYID+ PIRE+ 
Sbjct  130   NGQPWRFQTNLYGNGSVSRGREERYRMWFDPSKDFHHYSILWTPRNIIFYIDETPIREVN  189

Query  578   RNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQ  399
             RN AMGGDFP KPM LYATIWDAS WAT+GG+ KV+YK+ PF   F DLVL+GC  DP++
Sbjct  190   RNPAMGGDFPSKPMSLYATIWDASSWATNGGKAKVDYKHEPFATEFKDLVLQGCIVDPIE  249

Query  398   EVVGEHPGVGGCDDR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPE  222
             ++   +     C DR  +L   +++ +TP++R++MK FR+++MYYSYCYD++RY VPPPE
Sbjct  250   QISSTN-----CTDRIAKLLAQNYSIMTPERRKSMKWFRERYMYYSYCYDNIRYPVPPPE  304

Query  221   CVIDAAERQQFKETGRLK  168
             CVI  +ER  FK++GRL+
Sbjct  305   CVIVQSERDLFKDSGRLR  322



>emb|CAA16756.1| xyloglucan endo-transglycosylase-like protein [Arabidopsis thaliana]
 emb|CAB78901.1| xyloglucan endo-transglycosylase-like protein [Arabidopsis thaliana]
Length=338

 Score =   388 bits (997),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/285 (63%), Positives = 221/285 (78%), Gaps = 13/285 (5%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GE N++RS  D SVRL L+  +GSGF SS +Y HGFFS+ IKLP  YTAGI
Sbjct  40    FDEGLSHLFGEGNLIRSPDDRSVRLLLDKYTGSGFISSSMYQHGFFSSLIKLPGAYTAGI  99

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF K HDELD EFLGN++GKPWRFQTNMYGNGST+RGREERY LWFDPSK
Sbjct  100   VVAFYTSNGDVFVKDHDELDIEFLGNLEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSK  159

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILWT   IIF++DDVPIRE++R E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  160   EFHRYSILWTPTKIIFWVDDVPIREILRKEEMNGDYPQKPMSLYATIWDASSWATSGGKF  219

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
              V+Y ++PFV+ F D+ L GC              +      + L   D++ ++PKQ  A
Sbjct  220   GVDYTFSPFVSEFKDIALDGC-------------NINCSVSDQFLMSNDYSTISPKQATA  266

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             M+RFR+++MYYSYCYD++RY+VPPPECVI  AE+ +F++TGRLKF
Sbjct  267   MRRFRERYMYYSYCYDTIRYSVPPPECVIVTAEKNRFRDTGRLKF  311



>ref|XP_002867966.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44225.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=357

 Score =   388 bits (997),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/291 (63%), Positives = 225/291 (77%), Gaps = 6/291 (2%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GE N++RS  D SVRL L+  +GSGF SS +Y HGFFS+ IKLP  YTAGI
Sbjct  40    FDEGLSHLFGEGNLIRSPDDRSVRLLLDKYTGSGFISSSMYQHGFFSSLIKLPGAYTAGI  99

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF K HDELD EFLGN++GKPWRFQTNMYGNGST+RGREERY LWFDPSK
Sbjct  100   VVAFYTSNGDVFVKNHDELDIEFLGNLEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSK  159

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILWT   IIF++DDVPIRE+IR E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  160   EFHRYSILWTPTKIIFWVDDVPIREIIRKEEMEGDYPQKPMSLYATIWDASSWATSGGKF  219

Query  479   KVNYKYAPFVAHFTDLVLRGC-AADPL----QEVVGEHPGVGGCDDRRE-LEGADFANVT  318
              V+Y Y+PFV+ F D+ L GC  +D L          +     C    + L   D++ ++
Sbjct  220   GVDYTYSPFVSEFKDIALDGCNVSDSLPGEINNNNIGNYNNINCSVSDQFLMTNDYSTIS  279

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             PKQ  AM+RFR+++MYYSYCYD++RY+VPPPECVI  AE+ +F++TGRLKF
Sbjct  280   PKQAAAMRRFRERYMYYSYCYDTIRYSVPPPECVIVTAEKNRFRDTGRLKF  330



>ref|XP_009413224.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 isoform X1 [Musa acuminata subsp. malaccensis]
Length=331

 Score =   387 bits (994),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/292 (62%), Positives = 224/292 (77%), Gaps = 3/292 (1%)
 Frame = -1

Query  1040  FDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLP  861
              ++TT  FD GF+ L+G  N++RS      RL L+  SGSGF S+DLY HGFFSA IKLP
Sbjct  29    LNLTTLSFDDGFSHLFGNENLIRSPDGRGARLTLDRSSGSGFISNDLYDHGFFSASIKLP  88

Query  860   SDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYL  681
             SDY+AG+VVAFYT+N DVF+KTHDELDFEFLGN++GK WR QTN+YGNGSTSRGREERY 
Sbjct  89    SDYSAGVVVAFYTSNGDVFQKTHDELDFEFLGNIRGKDWRIQTNVYGNGSTSRGREERYF  148

Query  680   LWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDW  501
             L FDP+ E HRYSILWT+  IIFYIDD PIRE++R++AMGGD+P KPM +YATIWD S W
Sbjct  149   LPFDPTAEAHRYSILWTSDHIIFYIDDTPIREVVRSDAMGGDYPSKPMSIYATIWDGSTW  208

Query  500   ATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANV  321
             AT+ GRYKVNYKYAPFVA  +DLVLRGC  DP+Q+V          +D   L  ADFA +
Sbjct  209   ATANGRYKVNYKYAPFVAELSDLVLRGCRVDPIQQVDSARRCAEANED---LLAADFAQM  265

Query  320   TPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             TP +R AM+RFR+++M YS+CYD+ RY V  P+C I  +E+ +F E+G  K+
Sbjct  266   TPLKRAAMRRFRERYMTYSFCYDANRYPVTFPDCDIIPSEQSRFFESGETKY  317



>ref|XP_009607215.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Nicotiana tomentosiformis]
Length=365

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/292 (61%), Positives = 226/292 (77%), Gaps = 6/292 (2%)
 Frame = -1

Query  1040  FDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLP  861
             F+++T  F++G++ L+ + NI RS  D S RL LN  SGSG  S++ Y++GFFSA IKLP
Sbjct  39    FNLSTITFEEGYSPLFSDFNIERSPDDTSFRLLLNRFSGSGVISTEYYNYGFFSASIKLP  98

Query  860   SDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYL  681
             + YTAGIVVAFYT+N D FEK HDELD EFLGNV G+PWRFQTN+YGNGS SRGREERY 
Sbjct  99    AIYTAGIVVAFYTSNVDTFEKNHDELDIEFLGNVNGQPWRFQTNLYGNGSVSRGREERYR  158

Query  680   LWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDW  501
             +WFDPS +FH YSILWT + IIFY+D+ PIRE+ RN AMGGDFP KPM LYATIWDAS W
Sbjct  159   MWFDPSNDFHHYSILWTPKNIIFYVDETPIREVNRNPAMGGDFPSKPMSLYATIWDASSW  218

Query  500   ATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR-RELEGADFAN  324
             AT+GG+ KV+YK+ PF   F DLVL GC  DP++++   +     C DR   L   +++ 
Sbjct  219   ATNGGKAKVDYKHEPFATEFKDLVLEGCIVDPIEQISSTN-----CTDRIARLLSQNYSI  273

Query  323   VTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
             +TP++R++MK FR+++MYYSYCYD++RY VPPPECVI  +ER  FK++GRL+
Sbjct  274   MTPERRKSMKWFRERYMYYSYCYDNIRYPVPPPECVIVQSERDLFKDSGRLR  325



>ref|NP_193634.1| probable xyloglucan endotransglucosylase/hydrolase protein 29 
[Arabidopsis thaliana]
 sp|Q8L7H3.1|XTH29_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 29; Short=At-XTH29; Short=XTH-29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM91637.1| putative xyloglucan endo-transglycosylase [Arabidopsis thaliana]
 gb|AEE84120.1| probable xyloglucan endotransglucosylase/hydrolase protein 29 
[Arabidopsis thaliana]
Length=357

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/297 (62%), Positives = 224/297 (75%), Gaps = 18/297 (6%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G + L+GE N++RS  D SVRL L+  +GSGF SS +Y HGFFS+ IKLP  YTAGI
Sbjct  40    FDEGLSHLFGEGNLIRSPDDRSVRLLLDKYTGSGFISSSMYQHGFFSSLIKLPGAYTAGI  99

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N DVF K HDELD EFLGN++GKPWRFQTNMYGNGST+RGREERY LWFDPSK
Sbjct  100   VVAFYTSNGDVFVKDHDELDIEFLGNLEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSK  159

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             EFHRYSILWT   IIF++DDVPIRE++R E M GD+PQKPM LYATIWDAS WATSGG++
Sbjct  160   EFHRYSILWTPTKIIFWVDDVPIREILRKEEMNGDYPQKPMSLYATIWDASSWATSGGKF  219

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPG-----------VGGCDDRRE-LEGA  336
              V+Y ++PFV+ F D+ L GC       V    PG              C    + L   
Sbjct  220   GVDYTFSPFVSEFKDIALDGC------NVSDSFPGENNNNNIGNYNNINCSVSDQFLMSN  273

Query  335   DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             D++ ++PKQ  AM+RFR+++MYYSYCYD++RY+VPPPECVI  AE+ +F++TGRLKF
Sbjct  274   DYSTISPKQATAMRRFRERYMYYSYCYDTIRYSVPPPECVIVTAEKNRFRDTGRLKF  330



>ref|XP_009397822.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 isoform X2 [Musa acuminata subsp. malaccensis]
Length=339

 Score =   384 bits (987),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 229/309 (74%), Gaps = 4/309 (1%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             S   F++  L     AFDV T  F +GF+ L+G  N++RS  D SVRL LN  SGSGF S
Sbjct  10    SMVLFVLLGLVTATEAFDVPTLTFGEGFSHLFGNDNLIRSADDRSVRLTLNRYSGSGFIS  69

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
             SDLY HGFFSA IKLP DYTAG+VVAFYT+N DVF  THDELDFEFLGNV+GK WR QTN
Sbjct  70    SDLYEHGFFSASIKLPKDYTAGVVVAFYTSNGDVFPDTHDELDFEFLGNVRGKDWRIQTN  129

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGST+RGREERYL+ FDP++E H YSILWT   IIFYIDDVPIRE++R++AMGGDFP
Sbjct  130   VYGNGSTTRGREERYLVPFDPTEEPHLYSILWTPDYIIFYIDDVPIREVVRSDAMGGDFP  189

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM +YATIWD S WATS GR K+NYKYAP+V+ F+DLVLRGC  DP+Q+V        
Sbjct  190   SKPMSVYATIWDGSSWATSYGRIKINYKYAPYVSEFSDLVLRGCRVDPIQQVDSADRCAE  249

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYA-VPPPECVIDAAERQQ  192
               +   EL  AD+A +TP++R AM+RFR+++M YS+CYD  RY  V  P+C   ++E  +
Sbjct  250   AVE---ELMSADYALLTPRKRAAMRRFRERYMIYSFCYDQHRYGNVTFPDCDYVSSEHSR  306

Query  191   FKETGRLKF  165
             F E G  KF
Sbjct  307   FGEWGDNKF  315



>ref|XP_010943419.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Elaeis guineensis]
Length=347

 Score =   383 bits (984),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 231/313 (74%), Gaps = 3/313 (1%)
 Frame = -1

Query  1103  PYLLHSSAFFLIAFLSYTA-AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLS  927
             P ++ +S    +   + TA A FDV    F++G++ L+GE N++RS    +VRL L+  S
Sbjct  3     PRIILTSLVLAVFVATMTATAGFDVPMLAFEEGYSPLFGEGNLVRSVDGRNVRLILDRNS  62

Query  926   GSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKP  747
             G+GF S+++Y HG FSA IKLPSDYTAGIVVAFYT+N DVFEK HDELDFEFLGN+ GK 
Sbjct  63    GAGFISTEMYHHGLFSASIKLPSDYTAGIVVAFYTSNGDVFEKNHDELDFEFLGNILGKE  122

Query  746   WRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEA  567
             WR QTN+YGNGS SRGREERY L FDP+KEFHRYSI+WT + IIFYIDD PIRE+ R EA
Sbjct  123   WRVQTNVYGNGSVSRGREERYNLPFDPTKEFHRYSIIWTAENIIFYIDDTPIREVRRTEA  182

Query  566   MGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVG  387
             MGGD+P KPM LYATIWDAS WATSGGRYKV+Y YAPFV+ FTDL L GC  DPLQ+V  
Sbjct  183   MGGDYPSKPMSLYATIWDASSWATSGGRYKVDYNYAPFVSEFTDLALLGCRLDPLQQVPS  242

Query  386   EHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
                     D   EL     A +TP++R+AM  FR+++M YS+CYD+ RY V  P+C +  
Sbjct  243   AAKNCSVED--AELMATSLAVMTPERRQAMLDFRRRYMTYSFCYDTQRYPVTFPDCDLVE  300

Query  206   AERQQFKETGRLK  168
             +E+ +F++TG L+
Sbjct  301   SEKSRFRDTGHLR  313



>gb|KHN25980.1| Putative xyloglucan endotransglucosylase/hydrolase protein 28 
[Glycine soja]
Length=337

 Score =   383 bits (983),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 178/307 (58%), Positives = 230/307 (75%), Gaps = 9/307 (3%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             LL  S+    AF S  A++ ++   PFD+G+  L+G+SN++      SV L L+  +GSG
Sbjct  4     LLFFSSMLFAAFPS--ASSRNLPVIPFDEGYAPLFGDSNLVIHRDGKSVHLSLDERTGSG  61

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S DLY HG+FSA IKLPSDYTAG+VVAFY +N D+F+  HDE+DFEFLGN++GK WR 
Sbjct  62    FVSHDLYLHGYFSASIKLPSDYTAGVVVAFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRI  121

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST+ GREERY LWFDP+ +FH+Y+I+WT+  IIFY+D+VPIRE+ R E+MGG
Sbjct  122   QTNVYGNGSTNIGREERYGLWFDPADDFHQYTIVWTDSQIIFYVDNVPIREVTRTESMGG  181

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWDASDWAT+GG+Y+VNYKYAP+VA F+DLVL GCA DP+++      
Sbjct  182   DFPSKPMTLYATIWDASDWATNGGKYRVNYKYAPYVAEFSDLVLHGCAVDPIEQ------  235

Query  377   GVGGCDDRRELEGA-DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAE  201
              V  CD+ +  E     + VTP QR  M+ FR+KHM YSYCYD VRY VPP ECVI++ E
Sbjct  236   HVATCDNAQSSEATIPPSGVTPAQRIKMENFRKKHMTYSYCYDKVRYKVPPSECVINSQE  295

Query  200   RQQFKET  180
              ++ + +
Sbjct  296   AERLRSS  302



>ref|XP_003524850.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Glycine max]
Length=338

 Score =   382 bits (980),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 231/312 (74%), Gaps = 9/312 (3%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             LL  S+    AF S  A++ ++   PFD+G+  L+G+SN++      SV L L+  +GSG
Sbjct  9     LLFFSSMLFAAFPS--ASSRNLPVIPFDEGYAPLFGDSNLVIHRDGKSVHLSLDERTGSG  66

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S DLY HG+FSA IKLPSDYTAG+VVAFY +N D+F+  HDE+DFEFLGN++GK WR 
Sbjct  67    FVSHDLYLHGYFSASIKLPSDYTAGVVVAFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRI  126

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST+ GREERY LWFDP+ +FH+Y+I+WT+  IIFY+D+VPIRE+ R E+MGG
Sbjct  127   QTNVYGNGSTNIGREERYGLWFDPADDFHQYTIVWTDSQIIFYVDNVPIREVTRTESMGG  186

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWDASDWAT+GG+Y+VNYKYAP+VA F+DLVL GCA DP+++      
Sbjct  187   DFPSKPMTLYATIWDASDWATNGGKYRVNYKYAPYVAEFSDLVLHGCAVDPIEQ------  240

Query  377   GVGGCDDRRELEGA-DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAE  201
              V  CD+ +  E     + VTP QR  M+ FR+KHM YSYCYD VRY VPP ECVI++ E
Sbjct  241   HVATCDNAQSSEATIPPSGVTPAQRIKMENFRKKHMTYSYCYDKVRYKVPPSECVINSQE  300

Query  200   RQQFKETGRLKF  165
              ++ +    + F
Sbjct  301   AERLRRFDPVTF  312



>gb|EAZ21594.1| hypothetical protein OsJ_05221 [Oryza sativa Japonica Group]
Length=341

 Score =   380 bits (977),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 223/294 (76%), Gaps = 4/294 (1%)
 Frame = -1

Query  1043  AFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKL  864
             A +VTT  F++G+T L+G  NILRS  D +V L L+  +GSGF SS +Y HGFFSA IKL
Sbjct  27    AINVTTVAFEEGYTPLFGFDNILRSADDRTVSLLLDRSTGSGFMSSSMYQHGFFSASIKL  86

Query  863   PSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERY  684
             PSDYTAG+VVAFYT+N DV EK HDELDFEFLGN++GKPWR QTN+YGNGS SRGREERY
Sbjct  87    PSDYTAGVVVAFYTSNGDVIEKRHDELDFEFLGNIRGKPWRVQTNVYGNGSVSRGREERY  146

Query  683   LLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASD  504
             LL FDP+ EFHRYSILWT   I+F++DDVPIRE+ R  AM GDFP KPM +YAT+WDAS 
Sbjct  147   LLPFDPTTEFHRYSILWTRAAIVFFVDDVPIREVRRTPAMTGDFPSKPMSIYATVWDAST  206

Query  503   WATSGGRYKVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEHPGVGGCDDRRELEGADFA  327
             WATSGGRY+VNY+Y PFVA FTDL L GC   DP+ +++         D    L  +D A
Sbjct  207   WATSGGRYRVNYRYGPFVASFTDLALLGCRVGDPIGQMLSSAACTAAED---ALLASDLA  263

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              +T ++++AM+RFR+++M YSYCYD++RY  P  EC +  +ER++FK  G+L+ 
Sbjct  264   VMTLEKQQAMRRFREQNMVYSYCYDTLRYPAPFLECDVVESERRRFKGNGQLRL  317



>ref|XP_009417372.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Musa acuminata subsp. malaccensis]
Length=432

 Score =   384 bits (986),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 183/288 (64%), Positives = 218/288 (76%), Gaps = 2/288 (1%)
 Frame = -1

Query  1043  AFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKL  864
             + +VTT  FD G+  L+G+ N++RS    SV L L+  SGSGF SSD+Y HG FSA IKL
Sbjct  28    SVNVTTLAFDDGYAPLFGKGNLVRSADGRSVSLLLDRYSGSGFISSDMYHHGLFSASIKL  87

Query  863   PSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERY  684
             PSDYTAG+VVAFYT+N DVFEK+HDELDFEFLGN++GK WR QTN+YGNGSTSRGREERY
Sbjct  88    PSDYTAGVVVAFYTSNGDVFEKSHDELDFEFLGNIRGKEWRVQTNVYGNGSTSRGREERY  147

Query  683   LLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASD  504
              L FDP+ +FHRYSILWT   IIFY+DD PIRE+ R+EAMGGD+P KPM LYATIWDAS+
Sbjct  148   YLPFDPTADFHRYSILWTADNIIFYVDDTPIREVRRSEAMGGDYPSKPMSLYATIWDASN  207

Query  503   WATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFAN  324
             WATSGGRYKVNYKYAPFV+ F DL L GC  DP+Q+V     G           G   A 
Sbjct  208   WATSGGRYKVNYKYAPFVSSFADLTLLGCRLDPIQQVPTTRSGCPAAAAEIAATG--LAV  265

Query  323   VTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKET  180
             +TP++RRAM+ FR+++M YS CYD VRY  P PEC I   E+++F ET
Sbjct  266   MTPEKRRAMRAFRRQYMSYSVCYDRVRYPAPFPECDIVETEKKRFGET  313



>ref|XP_011081425.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Sesamum indicum]
Length=345

 Score =   380 bits (977),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/284 (61%), Positives = 213/284 (75%), Gaps = 4/284 (1%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             F + ++ L+ + NI  S  D +VRL LN  SGSG  SSD Y++GFFSA IK+PS + AGI
Sbjct  37    FHEAYSPLFSKFNIHPSPDDKTVRLLLNRFSGSGIISSDYYNYGFFSASIKMPSQHAAGI  96

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N D FEK HDELD EFLGN+KGKPWRFQTNMYGNGS SRGREERY +WFDP+ 
Sbjct  97    VVAFYTSNVDTFEKNHDELDIEFLGNIKGKPWRFQTNMYGNGSVSRGREERYRMWFDPTT  156

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
               HRYSILWT   IIFY+D++PIRE++R   M GD+P KPM +YATIWDAS WAT GG+ 
Sbjct  157   HSHRYSILWTPTNIIFYVDNIPIREVVRTAGMRGDYPSKPMSVYATIWDASSWATDGGKE  216

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             KVNYKY PFV  F DLVL GC  DP  +++  +      D+  EL   D++N+T + R++
Sbjct  217   KVNYKYEPFVTEFKDLVLEGCIVDPTDQILSSN----CTDNIAELMAKDYSNITSEGRKS  272

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
             MK FR+K+MYYSYCYD++RY VPPPECVI  +ER  FK +GRL+
Sbjct  273   MKWFREKYMYYSYCYDNIRYPVPPPECVIVPSERNLFKNSGRLR  316



>ref|NP_001045764.1| Os02g0127800 [Oryza sativa Japonica Group]
 dbj|BAD07973.1| putative xyloglucan endo-1,4-beta-D-glucanase [Oryza sativa Japonica 
Group]
 dbj|BAD08030.1| putative xyloglucan endo-1,4-beta-D-glucanase [Oryza sativa Japonica 
Group]
 dbj|BAF07678.1| Os02g0127800 [Oryza sativa Japonica Group]
 gb|EAY84314.1| hypothetical protein OsI_05690 [Oryza sativa Indica Group]
Length=340

 Score =   380 bits (975),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 222/292 (76%), Gaps = 4/292 (1%)
 Frame = -1

Query  1043  AFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKL  864
             A +VTT  F++G+T L+G  NILRS  D +V L L+  +GSGF SS +Y HGFFSA IKL
Sbjct  27    AINVTTVAFEEGYTPLFGFDNILRSADDRTVSLLLDRSTGSGFMSSSMYQHGFFSASIKL  86

Query  863   PSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERY  684
             PSDYTAG+VVAFYT+N DV EK HDELDFEFLGN++GKPWR QTN+YGNGS SRGREERY
Sbjct  87    PSDYTAGVVVAFYTSNGDVIEKRHDELDFEFLGNIRGKPWRVQTNVYGNGSVSRGREERY  146

Query  683   LLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASD  504
             LL FDP+ EFHRYSILWT   I+F++DDVPIRE+ R  AM GDFP KPM +YAT+WDAS 
Sbjct  147   LLPFDPTTEFHRYSILWTRAAIVFFVDDVPIREVRRTPAMTGDFPSKPMSIYATVWDAST  206

Query  503   WATSGGRYKVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEHPGVGGCDDRRELEGADFA  327
             WATSGGRY+VNY+Y PFVA FTDL L GC   DP+ +++         D    L  +D A
Sbjct  207   WATSGGRYRVNYRYGPFVASFTDLALLGCRVGDPIGQMLSSAACTAAED---ALLASDLA  263

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRL  171
              +T ++++AM+RFR+++M YSYCYD++RY  P  EC +  +ER++FK +G L
Sbjct  264   VMTLEKQQAMRRFREQNMVYSYCYDTLRYPAPFLECDVVESERRRFKGSGHL  315



>gb|ACU19067.1| unknown [Glycine max]
Length=333

 Score =   379 bits (973),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 230/312 (74%), Gaps = 9/312 (3%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             LL  S+    AF S  A++ ++   PFD+G+  L+G+SN++      SV L L+  +GSG
Sbjct  4     LLFFSSMLFAAFPS--ASSRNLPVIPFDEGYAPLFGDSNLVIHRDGKSVHLSLDERTGSG  61

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S DLY HG+FSA IKLPSDYTAG+VVAFY +N D+F+  HDE+DFEFLGN++GK WR 
Sbjct  62    FVSHDLYLHGYFSASIKLPSDYTAGVVVAFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRI  121

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST+ GREERY LWFDP+ +FH+Y+I+WT+  IIFY+D+VPIRE+ R E+MGG
Sbjct  122   QTNVYGNGSTNIGREERYGLWFDPADDFHQYTIVWTDSQIIFYVDNVPIREVTRTESMGG  181

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWDASDWAT+GG+Y+VNYKYAP+VA F+DLVL GCA DP+++      
Sbjct  182   DFPFKPMTLYATIWDASDWATNGGKYRVNYKYAPYVAEFSDLVLHGCAVDPIEQ------  235

Query  377   GVGGCDDRRELEGADFA-NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAE  201
              V  CD+ +  E       VTP QR  M+ FR+KHM YSYCYD VRY VPP ECVI++ E
Sbjct  236   HVATCDNAQSFEATIPPFGVTPAQRIKMENFRKKHMTYSYCYDKVRYKVPPSECVINSQE  295

Query  200   RQQFKETGRLKF  165
              ++ +    + F
Sbjct  296   AERLRRFDPVTF  307



>ref|XP_004504585.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cicer arietinum]
Length=331

 Score =   379 bits (972),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 224/296 (76%), Gaps = 8/296 (3%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             +A++ ++   PFD+G+T L+G++N+   T   SV L L+  +GSGF S DLY HG+FSA 
Sbjct  20    SASSRNLPIIPFDEGYTPLFGDNNVFVHTDGKSVHLSLDERTGSGFVSHDLYLHGYFSAS  79

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLP+DYTAG+VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+YGNGSTS GRE
Sbjct  80    IKLPADYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTSIGRE  139

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDP+++FH+YSILWT+  IIFY+D++PIRE+ R E+MGGDFP KPM LYATIWD
Sbjct  140   ERYGLWFDPAEDFHQYSILWTDSLIIFYVDNIPIREVTRTESMGGDFPAKPMTLYATIWD  199

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGAD  333
             ASDWAT+GG+Y+VNYKYAP++A F+DLVL GCA DP++        V  CD   + +   
Sbjct  200   ASDWATNGGKYRVNYKYAPYIAKFSDLVLHGCAVDPIEH-------VAKCDTASDSKSVP  252

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              + VTP QR  M+ FR+KHM YSYCYD +RY  PP EC I+  E ++ ++   + F
Sbjct  253   -SGVTPVQRIKMENFRKKHMTYSYCYDKIRYKAPPSECAINPQEAERLRKFDPVTF  307



>ref|XP_010105548.1| putative xyloglucan endotransglucosylase/hydrolase protein 27 
[Morus notabilis]
 gb|EXC05043.1| putative xyloglucan endotransglucosylase/hydrolase protein 27 
[Morus notabilis]
Length=340

 Score =   379 bits (972),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 216/296 (73%), Gaps = 8/296 (3%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             TA   D+    FD+G+T L+G+ N+L      +V L LN  +GSGF S DLY HGFFSA 
Sbjct  29    TAKTSDLPIIAFDEGYTQLFGDDNLLIHRDGKTVHLTLNERTGSGFVSQDLYLHGFFSAS  88

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLP DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR QTN+YGNGSTS GRE
Sbjct  89    IKLPPDYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKEWRIQTNVYGNGSTSVGRE  148

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDPS +FH +SILWT+  IIFY+D+VPIRE+ R E+MGGDFP KPM LYATIWD
Sbjct  149   ERYNLWFDPSDDFHHFSILWTDSLIIFYVDNVPIREVKRTESMGGDFPSKPMSLYATIWD  208

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGAD  333
              SDWAT+GG+Y+VNYKYAP+V  F+DLVL GCA DP+++          CD+ ++ E   
Sbjct  209   GSDWATNGGKYRVNYKYAPYVTEFSDLVLHGCAVDPIEQ-------FSKCDNSQDSESVP  261

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
                VTP QR  M+  R+KHM YSYCYD VRY VPPPECVI   E ++ +    + F
Sbjct  262   -TGVTPMQRTRMEGIRKKHMTYSYCYDRVRYKVPPPECVIIPQEAERLRSFDPVTF  316



>gb|AGV54504.1| xyloglucan endotransglucosylase/hydrolase protein 28-like protein 
[Phaseolus vulgaris]
Length=327

 Score =   378 bits (970),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 224/308 (73%), Gaps = 10/308 (3%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             FF  AF +  A++  +   P   F+ G+T L+G+ N++      SV L L+  +GSGF S
Sbjct  2     FFFSAFFAVIASSGSLANLPIIAFEDGYTHLFGDHNLVIHRDGKSVHLSLDERTGSGFVS  61

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
              DLY HG+FSA IKLPSDYTAG++VAFY +N D+F+K HDE+DFEFLGN++GK WR QTN
Sbjct  62    HDLYLHGYFSASIKLPSDYTAGVLVAFYLSNGDMFQKNHDEIDFEFLGNIRGKDWRVQTN  121

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGST+ GREER  LWFDP+++FH+YSILWT+  IIF +DDVPIRE+ R E+MGGDFP
Sbjct  122   VYGNGSTNTGREERCGLWFDPAEDFHQYSILWTDSKIIFLVDDVPIREVKRTESMGGDFP  181

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LYATIWDASDWAT+GG+Y+VNYKYAPFVA F+DLVL GCA DP++ V        
Sbjct  182   SKPMTLYATIWDASDWATNGGKYRVNYKYAPFVAEFSDLVLHGCAVDPIEHVT-------  234

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              CD   +   A  + +TP QR  M  FR KHM YSYCYD+VRY VPPPECVI   E ++ 
Sbjct  235   KCDSSAQDSEAVPSGITPVQRTKMGNFRLKHMTYSYCYDTVRYKVPPPECVIKPQEAERL  294

Query  188   KETGRLKF  165
             ++   + F
Sbjct  295   RKFDPVTF  302



>ref|XP_002451458.1| hypothetical protein SORBIDRAFT_04g002290 [Sorghum bicolor]
 gb|EES04434.1| hypothetical protein SORBIDRAFT_04g002290 [Sorghum bicolor]
Length=371

 Score =   379 bits (973),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/297 (59%), Positives = 224/297 (75%), Gaps = 4/297 (1%)
 Frame = -1

Query  1043  AFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKL  864
             A +VTT  F+ G+  L+G  NILRS    +V L L+  +GSGF SS +Y HGFFSA IKL
Sbjct  36    AINVTTMAFEDGYAPLFGHGNILRSADHRTVSLLLDRSTGSGFISSSMYQHGFFSASIKL  95

Query  863   PSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERY  684
             PSDYTAG+VVAFY +N DVFEK HDELDFEFLGN++GKPWR QTN+YGNGS  RGREERY
Sbjct  96    PSDYTAGVVVAFYASNGDVFEKRHDELDFEFLGNIRGKPWRVQTNVYGNGSVGRGREERY  155

Query  683   LLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASD  504
             +L FDP+ EFHRYSILWT   + FY+DDVP+RE+ R++AMGGDFP KPM +YAT+WDAS 
Sbjct  156   VLPFDPTTEFHRYSILWTPAAVAFYVDDVPVREVRRSDAMGGDFPSKPMSVYATVWDAST  215

Query  503   WATSGGRYKVNYKYAPFVAHFTDLVLRGCAAD----PLQEVVGEHPGVGGCDDRRELEGA  336
             WATSGGRY+VNY+Y PFVA FTDL L GC  D     +Q+V+          D  +L  +
Sbjct  216   WATSGGRYRVNYRYGPFVASFTDLALLGCRVDGPVAAIQQVLLPPVPSRCAADEEKLRAS  275

Query  335   DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             D A +T ++++AM+RFR+++M YSYCYD++RY    PEC +  +ER++FK++G L+F
Sbjct  276   DVAVMTVEKQQAMRRFRERNMVYSYCYDTLRYPAAFPECDVVESERRRFKDSGHLRF  332



>gb|AGZ15408.1| xyloglucan endotransglucosylase/hydrolase protein 28 [Phaseolus 
vulgaris]
Length=327

 Score =   377 bits (969),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/308 (58%), Positives = 224/308 (73%), Gaps = 10/308 (3%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             FF  AF +  A++  +   P   F+ G+T L+G+ N++      SV L L+  +GSGF S
Sbjct  2     FFFSAFFAVIASSGSLANLPIIAFEDGYTHLFGDHNLVIHRDGKSVHLSLDERTGSGFVS  61

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
              DLY HG+FSA IKLPSDYTAG+VVAFY +N D+F+K HDE+DFEFLGN++GK WR QTN
Sbjct  62    HDLYLHGYFSASIKLPSDYTAGVVVAFYLSNGDMFQKNHDEIDFEFLGNIRGKDWRVQTN  121

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGST+ GREER  LWFDP+++FH+YSILWT+  IIF +DDVPIRE+ R E+MGGDFP
Sbjct  122   VYGNGSTNTGREERCGLWFDPAEDFHQYSILWTDSKIIFLVDDVPIREVKRTESMGGDFP  181

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LYATIWDASDWAT+GG+Y+VNYKYAPFVA F+DLVL GCA DP++ V        
Sbjct  182   SKPMTLYATIWDASDWATNGGKYRVNYKYAPFVAEFSDLVLHGCAVDPIEHVT-------  234

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              CD   +   A  + +TP QR  M  FR KHM YSYCYD+VRY VPPPECVI   E ++ 
Sbjct  235   KCDSSAQDFEAVPSGITPVQRTKMGNFRLKHMTYSYCYDTVRYKVPPPECVIKPQEAERL  294

Query  188   KETGRLKF  165
             ++   + F
Sbjct  295   RKFDPVTF  302



>ref|XP_003638758.1| Xyloglucan endotransglycosylase/hydrolase [Medicago truncatula]
 gb|AFK34428.1| unknown [Medicago truncatula]
Length=332

 Score =   375 bits (964),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 231/306 (75%), Gaps = 9/306 (3%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
             FF + FLS +A++ ++  T FD+G+T L+G++N+       SV L L+  +GSGF S D+
Sbjct  11    FFSMLFLSASASSRNLPITAFDEGYTPLFGDNNVFVHRDGKSVHLSLDERTGSGFVSHDI  70

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y HG+FSA IKLP+DYTAG+VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+YG
Sbjct  71    YLHGYFSASIKLPADYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKDWRIQTNVYG  130

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGSTS GREERY LWFDP+++FH+YSILWT+  IIFY+D++PIRE+ R ++MGGDFP KP
Sbjct  131   NGSTSIGREERYGLWFDPAEDFHQYSILWTDSRIIFYVDNIPIREVTRTKSMGGDFPAKP  190

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M LYATIWDASDWAT+GG+Y+VNYKYAP+VA F+DLVL GCA DP++        V  CD
Sbjct  191   MTLYATIWDASDWATNGGKYRVNYKYAPYVAKFSDLVLHGCAVDPIEH-------VAKCD  243

Query  359   DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRY-AVPPPECVIDAAERQQFKE  183
               +  +    + +TP Q+  M+ FR+K+M YSYCYD +RY A PP ECVI+  E ++ ++
Sbjct  244   TAQSSKSIP-SGITPVQKIKMENFRKKYMTYSYCYDKIRYRAAPPSECVINPQEAERLRK  302

Query  182   TGRLKF  165
                + F
Sbjct  303   FDPVTF  308



>ref|XP_009399416.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Musa acuminata subsp. malaccensis]
Length=337

 Score =   375 bits (964),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 223/296 (75%), Gaps = 4/296 (1%)
 Frame = -1

Query  1049  AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKI  870
              AAFDV TTPF +GF+ L+G  N++RS  D SVRL LN  SGSGF SS+LY HGFFSA I
Sbjct  21    VAAFDVPTTPFSEGFSHLFGNDNLIRSKDDRSVRLSLNRYSGSGFISSELYEHGFFSASI  80

Query  869   KLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREE  690
             KLP DYTAG+VVAFYT+N D+F  THDELDFEFLGNV+GK WR QTN+YGNGST+RGREE
Sbjct  81    KLPRDYTAGVVVAFYTSNGDIFPNTHDELDFEFLGNVRGKDWRIQTNVYGNGSTARGREE  140

Query  689   RYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDA  510
             RYL+ FDP++  HRYSILWT   IIFYIDDV IRE++R+++MGGDFP KPM +YATIWD 
Sbjct  141   RYLVPFDPAEAAHRYSILWTPDYIIFYIDDVAIREVVRSDSMGGDFPSKPMSVYATIWDG  200

Query  509   SDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF  330
             S WATS G+ K+NYKYAP+V+ F++LVLRGC  DP+Q+V          +   EL  ADF
Sbjct  201   SSWATSYGKIKINYKYAPYVSEFSELVLRGCRVDPIQQV---DTAERCAETVEELMSADF  257

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYA-VPPPECVIDAAERQQFKETGRLKF  165
             A +TP +R AM+RFR+++M YS+CYD  RY     P+C   + E  +F E G  +F
Sbjct  258   ALLTPMKRAAMRRFRERYMIYSFCYDQHRYGNFTFPDCDYVSPEHTRFGEWGDNRF  313



>ref|XP_007158788.1| hypothetical protein PHAVU_002G182000g [Phaseolus vulgaris]
 gb|ESW30782.1| hypothetical protein PHAVU_002G182000g [Phaseolus vulgaris]
Length=332

 Score =   375 bits (963),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/312 (57%), Positives = 232/312 (74%), Gaps = 12/312 (4%)
 Frame = -1

Query  1100  YLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGS  921
             +LL SS  F  AFLS ++  F +   PFD+G+  L+G++N++      SV L L+  +GS
Sbjct  8     FLLFSSMLF--AFLSASSRNFPII--PFDEGYQPLFGDTNLVIHRDGKSVHLSLDERTGS  63

Query  920   GFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWR  741
             GF S DLY HG+FSA IKLP+DYTAG+VVAFY +N D+F+  HDE+DFEFLGN++GK WR
Sbjct  64    GFVSHDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDMFQNNHDEIDFEFLGNIRGKNWR  123

Query  740   FQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMG  561
              QTN+YGNGST+ GREERY LWFDP+ +FH+YSI+WT+  IIFY+D+VPIRE+ R E+MG
Sbjct  124   IQTNVYGNGSTNIGREERYGLWFDPADDFHQYSIVWTDSQIIFYVDNVPIREVKRTESMG  183

Query  560   GDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEH  381
             GDFP KPM LYATIWDASDWAT+GG+Y+VNYKYAP+VA F+DLVL GCA DP+++     
Sbjct  184   GDFPSKPMTLYATIWDASDWATNGGKYRVNYKYAPYVAKFSDLVLHGCAVDPIEQ-----  238

Query  380   PGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAE  201
               VG C++ +  E    ++VT  QR  M+ FR+KHM YSYCYD +RY   P ECVI++ E
Sbjct  239   --VGKCENDQSSEAIP-SSVTAAQRIKMENFRKKHMTYSYCYDRLRYKAAPSECVINSQE  295

Query  200   RQQFKETGRLKF  165
               + ++   + F
Sbjct  296   ADRLRKFDPVTF  307



>ref|XP_007222502.1| hypothetical protein PRUPE_ppa008275mg [Prunus persica]
 gb|EMJ23701.1| hypothetical protein PRUPE_ppa008275mg [Prunus persica]
Length=338

 Score =   375 bits (963),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 172/289 (60%), Positives = 217/289 (75%), Gaps = 7/289 (2%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             +A++ ++    FD+G+  L+G+ N++      SV L L+  +GSGF S DLY HGFFSA 
Sbjct  23    SASSRNLPIISFDEGYNKLFGDDNLMILRDGKSVHLSLDERTGSGFVSQDLYHHGFFSAS  82

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLP+DYTAG+VVAFY +N D+F K HDE+DFEFLGN++GK WR QTN+YGNGSTS GRE
Sbjct  83    IKLPADYTAGVVVAFYMSNGDMFPKNHDEIDFEFLGNIRGKEWRIQTNVYGNGSTSTGRE  142

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDPS +FH+YSILWT+  IIFY+DDVPIRE+ R E+MGGDFP KPM LYATIWD
Sbjct  143   ERYNLWFDPSDDFHQYSILWTDSQIIFYVDDVPIREVKRTESMGGDFPSKPMSLYATIWD  202

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGAD  333
              SDWAT+GG+Y+VNYKYAP++A F+DLVL GCA DP++++  +      CD+ R  E   
Sbjct  203   GSDWATNGGKYRVNYKYAPYLAQFSDLVLHGCAVDPIEQLSKK------CDNTRSSESVP  256

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
                VT  QR  M  FR+KHM YSYCYD +RY  PPPECVI+  E ++ +
Sbjct  257   -TGVTRLQRIKMDSFRKKHMTYSYCYDRIRYKSPPPECVINPQEAERLR  304



>ref|XP_007153190.1| hypothetical protein PHAVU_003G014400g [Phaseolus vulgaris]
 gb|ESW25184.1| hypothetical protein PHAVU_003G014400g [Phaseolus vulgaris]
Length=338

 Score =   375 bits (963),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 221/301 (73%), Gaps = 7/301 (2%)
 Frame = -1

Query  1067  AFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHG  888
             A ++ + +  ++    F+ G+T L+G+ N++      SV L L+  +GSGF S DLY HG
Sbjct  20    AVIASSGSLANLPIIAFEDGYTHLFGDHNLVIHRDGKSVHLSLDERTGSGFVSHDLYLHG  79

Query  887   FFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGST  708
             +FSA IKLPSDYTAG+VVAFY +N D+F+K HDE+DFEFLGN++GK WR QTN+YGNGST
Sbjct  80    YFSASIKLPSDYTAGVVVAFYLSNGDMFQKNHDEIDFEFLGNIRGKDWRIQTNVYGNGST  139

Query  707   SRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLY  528
             + GREER  LWFDP+++FH+YSILWT+  IIF +DDVPIRE+ R E+MGGDFP KPM LY
Sbjct  140   NTGREERCGLWFDPAEDFHQYSILWTDSKIIFLVDDVPIREVKRTESMGGDFPSKPMTLY  199

Query  527   ATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE  348
             ATIWDASDWAT+GG+Y+VNYKYAPFVA F+DLVL GCA DP++ V         CD   +
Sbjct  200   ATIWDASDWATNGGKYRVNYKYAPFVAEFSDLVLHGCAVDPIEHVT-------KCDSSAQ  252

Query  347   LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
                A  + +TP QR  M  FR KHM YSYCYD+VRY VPPPECVI   E ++ ++   + 
Sbjct  253   DSEAVPSGITPVQRTKMGNFRLKHMTYSYCYDTVRYKVPPPECVIKPQEAERLRKFDPVT  312

Query  167   F  165
             F
Sbjct  313   F  313



>ref|XP_006385680.1| xyloglucan endotransglycosylase 2 family protein [Populus trichocarpa]
 gb|ERP63477.1| xyloglucan endotransglycosylase 2 family protein [Populus trichocarpa]
Length=273

 Score =   372 bits (956),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 173/247 (70%), Positives = 204/247 (83%), Gaps = 5/247 (2%)
 Frame = -1

Query  902  LYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMY  723
            +Y +GFFSA IKLP  YTAG+ VAFYT+N DVF+KTHDELD EFLGN KG+PWRFQTN+Y
Sbjct  1    MYKYGFFSANIKLPGYYTAGLCVAFYTSNGDVFKKTHDELDIEFLGNTKGEPWRFQTNLY  60

Query  722  GNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQK  543
            GNGSTS GREERY LWFDPSKEFHRYSILWT + IIFYIDDVPIRE+IRNE MG +FP K
Sbjct  61   GNGSTSHGREERYRLWFDPSKEFHRYSILWTAKNIIFYIDDVPIREVIRNEEMGSEFPSK  120

Query  542  PMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGC  363
            PM LYATIWDAS+WATSGG+YKVNYKYAPFV+ F DL L GC +DP++E     P     
Sbjct  121  PMSLYATIWDASNWATSGGKYKVNYKYAPFVSEFKDLALEGCPSDPIEEF----PSFDCY  176

Query  362  D-DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
            + D   LE AD+A +T +QR AM+RFRQ++MYYSYCYD++RY VP PECVI  +E+++F+
Sbjct  177  ESDIARLENADYATITRRQRSAMRRFRQRYMYYSYCYDALRYPVPLPECVIIPSEKERFR  236

Query  185  ETGRLKF  165
            +TGRLKF
Sbjct  237  DTGRLKF  243



>ref|XP_010911228.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Elaeis guineensis]
Length=330

 Score =   375 bits (962),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 220/294 (75%), Gaps = 15/294 (5%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++TT  F++G+T L+G+SN++      +V L L+  +G+GF S DLY HGFFSA IKLPS
Sbjct  29    NLTTLSFEEGYTQLFGDSNLMLHRDGRAVHLSLDERTGAGFASQDLYLHGFFSANIKLPS  88

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY AG+VVAFY +N DVFEKTHDELDFEFLGN++GK WR QTN+YGNGSTS GREERY L
Sbjct  89    DYAAGVVVAFYMSNGDVFEKTHDELDFEFLGNIRGKEWRVQTNIYGNGSTSIGREERYGL  148

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP+++FH+YSILW++  IIFYID+VPIRE++R EAMGG FP KPM LYATIWD S+WA
Sbjct  149   WFDPTEDFHKYSILWSHDRIIFYIDNVPIREVVRTEAMGGQFPSKPMSLYATIWDGSNWA  208

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF---A  327
             TSGGRYK+NYKYAP++A F DL L GCA DP+            C++      AD     
Sbjct  209   TSGGRYKINYKYAPYIAEFADLTLHGCAVDPMDHTP-------TCNNL----AADLYSTI  257

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              V+  QR AM+RFR+K+M YSYCYD VRY+VP PEC     E +QF+E+G  +F
Sbjct  258   TVSADQRMAMERFRKKYMTYSYCYDRVRYSVPLPECST-GLEARQFQESGEARF  310



>ref|XP_003531138.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Glycine max]
Length=341

 Score =   374 bits (961),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 221/295 (75%), Gaps = 10/295 (3%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++   PFD+G+  L+G+SN++      SV L L+  +GSGF S DLY HG+FSA IKLPS
Sbjct  28    NLPIIPFDEGYAPLFGDSNLVIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPS  87

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DYTAG+VVAFY +N D+F+  HDE+DFEFLGN++GK WR QTN+YGNGST+ GREERY L
Sbjct  88    DYTAGVVVAFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTNIGREERYGL  147

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP+ +FH+Y+I+WT+  IIFY+D+VPIRE+ R E+MGGDFP KPM LYATIWDASDWA
Sbjct  148   WFDPADDFHQYTIVWTDSQIIFYVDNVPIREVTRTESMGGDFPSKPMTLYATIWDASDWA  207

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF----  330
             T+GG+Y+VNYKYAP+VA F+DLVL GCA DP+++ V +      CD+  +   A      
Sbjct  208   TNGGKYRVNYKYAPYVAEFSDLVLHGCAVDPIEQHVAK------CDNAPQSSEATTTIPS  261

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             + VTP QR  M+ FR+KHM YSYCYD VRY VPP ECVI + E ++ +    + F
Sbjct  262   SGVTPAQRIKMENFRKKHMTYSYCYDKVRYKVPPSECVISSQEAERLRRFDPVTF  316



>gb|KHN28876.1| Putative xyloglucan endotransglucosylase/hydrolase protein 28 
[Glycine soja]
Length=341

 Score =   374 bits (961),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 221/295 (75%), Gaps = 10/295 (3%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++   PFD+G+  L+G+SN++      SV L L+  +GSGF S DLY HG+FSA IKLPS
Sbjct  28    NLPIIPFDEGYAPLFGDSNLVIHRDGKSVHLSLDERTGSGFVSHDLYLHGYFSASIKLPS  87

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DYTAG+VVAFY +N D+F+  HDE+DFEFLGN++GK WR QTN+YGNGST+ GREERY L
Sbjct  88    DYTAGVVVAFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTNIGREERYGL  147

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP+ +FH+Y+I+WT+  IIFY+D+VPIRE+ R E+MGGDFP KPM LYATIWDASDWA
Sbjct  148   WFDPADDFHQYTIVWTDSQIIFYVDNVPIREVTRTESMGGDFPSKPMTLYATIWDASDWA  207

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF----  330
             T+GG+Y+VNYKYAP+VA F+DLVL GCA DP+++ V +      CD+  +   A      
Sbjct  208   TNGGKYRVNYKYAPYVAEFSDLVLHGCAVDPIEQHVAK------CDNAPQSSEATTTIPS  261

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             + VTP QR  M+ FR+KHM YSYCYD VRY VPP ECVI + E ++ +    + F
Sbjct  262   SGVTPAQRIKMENFRKKHMTYSYCYDKVRYKVPPSECVISSQEAERLRRFDPVTF  316



>ref|XP_002285140.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Vitis vinifera]
 emb|CBI26787.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   372 bits (954),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 223/296 (75%), Gaps = 7/296 (2%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             + ++ ++    FD+G++ L+G++N+      ++V + L+  +GSGF S DLY HGFFSA 
Sbjct  19    SGSSKELPIISFDEGYSPLFGDANLAILKDGETVHMSLDERTGSGFISQDLYLHGFFSAS  78

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLP+DYTAG+VVAFY +NAD+FE  HDELDFEFLGN++GK WR QTN+YGNGST+ GRE
Sbjct  79    IKLPADYTAGVVVAFYMSNADMFEANHDELDFEFLGNIRGKDWRIQTNVYGNGSTNVGRE  138

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDPS++FH+YSILW++  IIFY+D+VPIRE+ R EAMGGDFP KPM LYATIWD
Sbjct  139   ERYHLWFDPSEDFHQYSILWSDNLIIFYVDNVPIREIKRTEAMGGDFPSKPMSLYATIWD  198

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGAD  333
              S+WAT+GGRY+VNYKYAP+VA F++LVL GCA DP+++          CD+    + + 
Sbjct  199   GSEWATNGGRYRVNYKYAPYVAEFSNLVLHGCAVDPIEK-------SPKCDNGPTSKASI  251

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
                + P+QR  M++FR+ HM YSYCYD VRY VPP ECV++A E ++ +    + F
Sbjct  252   PTGIMPEQRSKMEKFRKTHMTYSYCYDRVRYTVPPSECVVNAQEAERLRRFDPVTF  307



>ref|XP_009390348.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 isoform X2 [Musa acuminata subsp. malaccensis]
Length=332

 Score =   372 bits (954),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 171/291 (59%), Positives = 215/291 (74%), Gaps = 8/291 (3%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++TT  F++G+T L+G+SN+L      +V L L+  +G+GF S DLY HGFFSA IKLPS
Sbjct  31    NLTTLSFEEGYTQLFGDSNLLLHRDGRAVHLALDQRTGAGFASQDLYLHGFFSASIKLPS  90

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY AG+VVAFY +N DVFEK+HDELDFEFLGN++G+ WR QTN+YGNGST+ GREERY L
Sbjct  91    DYAAGVVVAFYMSNGDVFEKSHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREERYQL  150

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP++++H+YSILW+++ IIFYID++PIRE++R +AMGGDFP KPM LYATIWD S WA
Sbjct  151   WFDPTEDYHQYSILWSHERIIFYIDNIPIREVVRTQAMGGDFPSKPMSLYATIWDGSTWA  210

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVT  318
             TSGGRYKVNYK AP+VA F DL+L GCA DP             C  R +    D   ++
Sbjct  211   TSGGRYKVNYKLAPYVADFADLILHGCAVDPSDHKT-------AC-QRSDAVLYDAITMS  262

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
               QR AM +FR+KHM YSYC+D +RY  PPPEC+    E Q F  +G  KF
Sbjct  263   ADQRTAMAKFRKKHMTYSYCHDRIRYPTPPPECMFVGPESQNFLASGDAKF  313



>ref|XP_002527547.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
 gb|EEF34856.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
Length=338

 Score =   372 bits (954),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 221/312 (71%), Gaps = 8/312 (3%)
 Frame = -1

Query  1100  YLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGS  921
             +LL+SS F L+A     +    +   PFD+G+  L+G+ N++      +V L LN  +GS
Sbjct  11    FLLNSSLFVLLAVSVSGSQTTTLPIIPFDEGYAHLFGDDNLVIHKDGKTVYLLLNERTGS  70

Query  920   GFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWR  741
             GF S DLY HG+FSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR
Sbjct  71    GFVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDIFEKNHDEIDFEFLGNIRGKDWR  130

Query  740   FQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMG  561
              QTN+YGNGSTS GREERY LWFDPS +FH+YSILWT+  IIFY+D+VPIRE+ R  +MG
Sbjct  131   IQTNIYGNGSTSIGREERYSLWFDPSDDFHQYSILWTDSQIIFYVDNVPIREVKRTVSMG  190

Query  560   GDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEH  381
             GDFP KPM LYATIWD SDWAT+GG+Y+VNY+YAP+V  F+D VL GCA DP+++     
Sbjct  191   GDFPSKPMSLYATIWDGSDWATNGGKYRVNYRYAPYVTQFSDFVLHGCAVDPIEQ-----  245

Query  380   PGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAE  201
               +  CD  +  +      VTP Q+  M+ FR K+M YSYCYD VRY  PP EC+++  E
Sbjct  246   --ISKCDAAQSSQAIP-TGVTPLQKIKMENFRTKYMTYSYCYDRVRYKNPPSECLVNPQE  302

Query  200   RQQFKETGRLKF  165
               + K    + F
Sbjct  303   AARLKSFDPVTF  314



>gb|KDO60844.1| hypothetical protein CISIN_1g019909mg [Citrus sinensis]
Length=334

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 219/301 (73%), Gaps = 10/301 (3%)
 Frame = -1

Query  1076  FLIAF--LSYTAAAF--DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             FL+ F  L+  A+    ++   PFD+G++ L+G  N++  T   SV L L+  +GSGF S
Sbjct  9     FLLVFSLLAVVASGLYRNLPIVPFDEGYSHLFGHDNLVVHTDGKSVHLSLDERTGSGFVS  68

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
              DLY HGFFSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR QTN
Sbjct  69    HDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKDWRIQTN  128

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGSTS GREERY LWFDPS +FH+YSILWT+  IIFYID +PIRE  R  +MGGDFP
Sbjct  129   IYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFP  188

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LYATIWD SDWAT+GG+Y+VNYKYAP+V  F+D VL GC+ DP+++   +     
Sbjct  189   AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSK-----  243

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              CD     + +    V+P QR  M+ FR+KHM YSYCYD +RY VPP ECVI+  E ++ 
Sbjct  244   -CDITESSKVSIPTGVSPSQRIKMENFRRKHMTYSYCYDQIRYKVPPFECVINPLEAERL  302

Query  188   K  186
             K
Sbjct  303   K  303



>gb|KEH40692.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=328

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 221/306 (72%), Gaps = 8/306 (3%)
 Frame = -1

Query  1082  AFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSD  903
              FF+     Y+ +  +    PFD+G+T L+G+ N++  +   +V L L+  SGSGF S D
Sbjct  12    CFFIFVMPCYSVSPRNFPIIPFDEGYTPLFGDHNLIIHSDSKAVHLLLDESSGSGFASHD  71

Query  902   LYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMY  723
             LY HG+FSA IKLPSDYTAG+VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+Y
Sbjct  72    LYLHGYFSASIKLPSDYTAGVVVAFYLSNGDMYEKNHDEIDFEFLGNIRGKDWRIQTNVY  131

Query  722   GNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQK  543
             GNGST+ GREERY LWFDPS+EFH YSILWT+  IIFY+DDVPIRE+ R E+M GDFP K
Sbjct  132   GNGSTNIGREERYGLWFDPSEEFHHYSILWTDSKIIFYVDDVPIREVKRTESMRGDFPSK  191

Query  542   PMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGC  363
              M LY+TIWDAS WAT+GG+YKVNYKYAP++A F+D VL GCA DP++ V         C
Sbjct  192   AMTLYSTIWDASTWATNGGKYKVNYKYAPYIAEFSDFVLHGCAVDPIEHVT-------KC  244

Query  362   DDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKE  183
             D  +  E    ++VT  +R  M+ FR KHM YSYCYD  RY VP PECVID+ + ++ ++
Sbjct  245   DSAQSSETVP-SDVTQLERIKMENFRLKHMTYSYCYDKTRYKVPLPECVIDSRQAERLRK  303

Query  182   TGRLKF  165
                + F
Sbjct  304   FDPVTF  309



>ref|XP_010043929.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Eucalyptus grandis]
 gb|KCW85954.1| hypothetical protein EUGRSUZ_B02660 [Eucalyptus grandis]
Length=332

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/297 (58%), Positives = 218/297 (73%), Gaps = 8/297 (3%)
 Frame = -1

Query  1076  FLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLY  897
             F +  +  + ++ ++    FD+G+T L+G++N+       SV L L+  +GSGF S DLY
Sbjct  14    FAVLLVLASGSSPNLPIISFDEGYTQLFGDNNLALHGDGQSVHLALDERTGSGFASQDLY  73

Query  896   SHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGN  717
              HGFFSA IKLP+DYTAG+VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+YGN
Sbjct  74    LHGFFSASIKLPADYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKNWRIQTNIYGN  133

Query  716   GSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPM  537
             GSTS GREERY LWFDPS +FH+Y ILWT+  IIFY+D+VPIRE  R EAMGG FP KPM
Sbjct  134   GSTSVGREERYGLWFDPSDDFHQYGILWTDSQIIFYVDNVPIREFKRTEAMGGQFPSKPM  193

Query  536   GLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDD  357
              LYATIWD SDWAT+GG+Y+VNYKYAP+VA F+DLVL GCA DP++  +        C+D
Sbjct  194   SLYATIWDGSDWATNGGKYRVNYKYAPYVAKFSDLVLHGCAVDPIEHQL-------SCND  246

Query  356   RRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
                 + A    ++P+QR  M+ FR+KHM YSYCYD  RY VPPPECVI+  E +  +
Sbjct  247   VPSHK-AIPQGISPRQRTKMEYFRKKHMTYSYCYDRARYKVPPPECVINPGEAEHLR  302



>ref|XP_009390870.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=333

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 218/296 (74%), Gaps = 19/296 (6%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++TT  F++G+T L+G+SN++      +V L L+  +G+GF S DLY HG FSA IKLPS
Sbjct  31    NLTTLSFEEGYTQLFGDSNLMLHRDGMAVHLSLDQRTGAGFASQDLYLHGVFSASIKLPS  90

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY AG+VVAFY +N DVFEKTHDELDFEFLGN++G+ WR QTN+YGNGST+ GREERY L
Sbjct  91    DYAAGVVVAFYMSNGDVFEKTHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREERYGL  150

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP++++HRYSILW+N+ IIFYID++PIRE++R++AMGGDFP KPM LYATIWD S+WA
Sbjct  151   WFDPTEDYHRYSILWSNRRIIFYIDNIPIREVVRSQAMGGDFPSKPMSLYATIWDGSNWA  210

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFA---  327
             TSGGRYKVNYK+AP+VA F DLVL GCA DP              D RR  + +D     
Sbjct  211   TSGGRYKVNYKFAPYVAEFADLVLHGCAVDP-------------SDRRRACQASDAELYD  257

Query  326   --NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
                ++  QR  M+  R+KHM YSYC+D +RY  PPPECV+   E + F  +G  KF
Sbjct  258   AITMSADQRTTMETLRKKHMTYSYCHDRIRYPAPPPECVL-GPEAESFLASGEAKF  312



>ref|XP_011070536.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Sesamum indicum]
Length=337

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 218/299 (73%), Gaps = 11/299 (4%)
 Frame = -1

Query  1076  FLIAFLSYTAAAF--DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSD  903
             F  AFL    + F  ++    FD+G++ L+G+ N++      SV + L+  +GSGF S D
Sbjct  16    FCSAFLVLMVSGFSRNLPILSFDEGYSHLFGDDNLMVLRDGKSVHISLDERTGSGFVSQD  75

Query  902   LYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMY  723
             LY HG+FSA IKLP+DYTAG+VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+Y
Sbjct  76    LYLHGYFSASIKLPADYTAGVVVAFYMSNGDIYEKNHDEIDFEFLGNIRGKDWRIQTNIY  135

Query  722   GNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQK  543
             GNGSTS GREERY LWFDPS++FH+YSILWT   I+FY+D+VPIRE+ R EAMGGDFP K
Sbjct  136   GNGSTSIGREERYGLWFDPSEDFHQYSILWTENFIVFYVDNVPIREIKRTEAMGGDFPSK  195

Query  542   PMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGC  363
             PM LYATIWD SDWAT+GG+YKV+YKYAP++A F+D VL GCA DP+++          C
Sbjct  196   PMSLYATIWDGSDWATNGGKYKVSYKYAPYIAEFSDFVLHGCAVDPIEQ--------SKC  247

Query  362   DDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             DD  +      A +T +QR  M  FR KHM YSYCYD  RY +PP ECVID +E ++ +
Sbjct  248   DDAAKFASIP-AGITRQQRAKMVSFRNKHMQYSYCYDRSRYKIPPSECVIDPSEAERLR  305



>ref|XP_006448095.1| hypothetical protein CICLE_v10015872mg [Citrus clementina]
 gb|ESR61335.1| hypothetical protein CICLE_v10015872mg [Citrus clementina]
Length=334

 Score =   370 bits (950),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 218/301 (72%), Gaps = 10/301 (3%)
 Frame = -1

Query  1076  FLIAF--LSYTAAAF--DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             FL+ F  L+  A+    ++   PFD+G++ L+G  N++      SV L L+  +GSGF S
Sbjct  9     FLLVFSLLAVVASGLYRNLPIVPFDEGYSHLFGHDNLVVHRDGKSVHLSLDERTGSGFVS  68

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
              DLY HGFFSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR QTN
Sbjct  69    HDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTN  128

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGSTS GREERY LWFDPS +FH+YSILWT+  IIFYID +PIRE  R  +MGGDFP
Sbjct  129   IYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFP  188

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LYATIWD SDWAT+GG+Y+VNYKYAP+V  F+D VL GC+ DP+++   +     
Sbjct  189   AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSK-----  243

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              CD     + +    V+P QR  M+ FR+KHM YSYCYD +RY VPP ECVI+  E ++ 
Sbjct  244   -CDITESSKVSIPTGVSPSQRIKMENFRRKHMTYSYCYDQIRYKVPPSECVINPLEAERL  302

Query  188   K  186
             K
Sbjct  303   K  303



>ref|NP_001146328.1| uncharacterized protein LOC100279904 precursor [Zea mays]
 gb|ACL53702.1| unknown [Zea mays]
Length=347

 Score =   370 bits (951),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 221/294 (75%), Gaps = 5/294 (2%)
 Frame = -1

Query  1043  AFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKL  864
             A +VTT  F+ G+  L+G  NILRS    +V L L+  +GSGF SS +Y HGFFSA IKL
Sbjct  27    AINVTTMAFEDGYAPLFGHGNILRSADHRTVSLLLDRSTGSGFISSSMYQHGFFSASIKL  86

Query  863   PSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERY  684
             PSDYTAG+VVAFY +N DVFEK HDELDFEFLGN++GKPWR QTN+YGNGS  RGREERY
Sbjct  87    PSDYTAGVVVAFYASNGDVFEKRHDELDFEFLGNIRGKPWRVQTNVYGNGSVGRGREERY  146

Query  683   LLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASD  504
             +L FDP+ EFHRYSILWT   + FY+DDVP+RE+ ++ AMGGDFP KPM +YAT+WDAS 
Sbjct  147   VLPFDPTTEFHRYSILWTPAAVAFYVDDVPVREVRQSAAMGGDFPSKPMSVYATVWDAST  206

Query  503   WATSGGRYKVNYKYAPFVAHFTDLVLRGCAAD-PLQEVVGEHPGVGGCDDRRELEGADFA  327
             WAT+GGRY+VNY+Y PFVA FTDL L GC  D P+Q+   E            L  +D A
Sbjct  207   WATAGGRYRVNYRYGPFVASFTDLALLGCRVDGPIQQTTAER----CAAAAEALRASDVA  262

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              +T ++++AM+RFR+++M YSYCYD++RY    PEC +  +ER++FK+TG L+F
Sbjct  263   VMTVEKQQAMRRFRERNMVYSYCYDTLRYPAAFPECDVVESERRRFKDTGHLRF  316



>gb|AFW66656.1| hypothetical protein ZEAMMB73_269375 [Zea mays]
Length=347

 Score =   370 bits (951),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 221/294 (75%), Gaps = 5/294 (2%)
 Frame = -1

Query  1043  AFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKL  864
             A +VTT  F+ G+  L+G  NILRS    +V L L+  +GSGF SS +Y HGFFSA IKL
Sbjct  27    AINVTTMAFEDGYAPLFGHGNILRSADHRTVSLLLDRSTGSGFISSSMYQHGFFSASIKL  86

Query  863   PSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERY  684
             PSDYTAG+VVAFY +N DVFEK HDELDFEFLGN++GKPWR QTN+YGNGS  RGREERY
Sbjct  87    PSDYTAGVVVAFYASNGDVFEKRHDELDFEFLGNIRGKPWRVQTNVYGNGSVGRGREERY  146

Query  683   LLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASD  504
             +L FDP+ EFHRYSILWT   + FY+DDVP+RE+ ++ AMGGDFP KPM +YAT+WDAS 
Sbjct  147   VLPFDPTTEFHRYSILWTPAAVAFYVDDVPVREVRQSAAMGGDFPSKPMSVYATVWDAST  206

Query  503   WATSGGRYKVNYKYAPFVAHFTDLVLRGCAAD-PLQEVVGEHPGVGGCDDRRELEGADFA  327
             WAT+GGRY+VNY+Y PFVA FTDL L GC  D P+Q+   E            L  +D A
Sbjct  207   WATAGGRYRVNYRYGPFVASFTDLALLGCRVDGPIQQTTAER----CAAAAEALRASDVA  262

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              +T ++++AM+RFR+++M YSYCYD++RY    PEC +  +ER++FK+TG L+F
Sbjct  263   VMTVEKQQAMRRFRERNMVYSYCYDTLRYPAAFPECDVVESERRRFKDTGHLRF  316



>ref|XP_009621666.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Nicotiana tomentosiformis]
Length=331

 Score =   369 bits (947),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/305 (57%), Positives = 219/305 (72%), Gaps = 9/305 (3%)
 Frame = -1

Query  1100  YLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGS  921
             Y + +  FF +  L Y  ++ ++    FD+G++ L+G+ N++      S  + L+  +G+
Sbjct  4     YHIVTFIFFSVIELVY-GSSRNLPILAFDEGYSHLFGDDNLMILKDGKSAHISLDERTGA  62

Query  920   GFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWR  741
             GF S DLY HGFFSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR
Sbjct  63    GFVSQDLYLHGFFSASIKLPADYTAGVVVAFYMSNVDMFEKNHDEIDFEFLGNIRGKDWR  122

Query  740   FQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMG  561
              QTN+YGNGSTS GREERY LWFDPS++FH YSILWT   IIFY+D+VPIRE+ R EAMG
Sbjct  123   IQTNIYGNGSTSVGREERYGLWFDPSEDFHHYSILWTENFIIFYVDNVPIREIKRTEAMG  182

Query  560   GDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEH  381
             GDFP KPM LYATIWD S WAT+GG+YKVNYKYAP++A F+D VL GCA DP++      
Sbjct  183   GDFPSKPMSLYATIWDGSGWATNGGKYKVNYKYAPYIAKFSDFVLHGCAVDPIEL-----  237

Query  380   PGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAE  201
                  CD   +        +TP QRR M++FR+K M YSYCYD  RY VPPPECVID  E
Sbjct  238   --SSKCDTAPKTASIP-TGITPDQRRKMEKFRKKQMQYSYCYDKTRYKVPPPECVIDPKE  294

Query  200   RQQFK  186
              ++ +
Sbjct  295   AERLR  299



>gb|KHN25480.1| Putative xyloglucan endotransglucosylase/hydrolase protein 28 
[Glycine soja]
Length=333

 Score =   369 bits (947),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 225/312 (72%), Gaps = 8/312 (3%)
 Frame = -1

Query  1100  YLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGS  921
             + L    F L+ F S  +   ++    F+ G+T L+G+ N+       SV L L+  +GS
Sbjct  3     WFLFCCCFSLLFFHSSGSPRRNLPIIAFEDGYTPLFGDHNLAIHRDGKSVHLSLDERTGS  62

Query  920   GFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWR  741
             GF S DLY HG+FSA IKLP+DYTAG+VVAFY +N ++F+  HDE+DFEFLGN++GK WR
Sbjct  63    GFVSHDLYLHGYFSASIKLPADYTAGVVVAFYMSNGEMFQNNHDEIDFEFLGNIRGKDWR  122

Query  740   FQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMG  561
              QTN+YGNGSTS GREERY LWFDP+++FH+YSILWT+  IIFY+D+VPIRE+ R E+MG
Sbjct  123   IQTNVYGNGSTSIGREERYGLWFDPAEDFHQYSILWTDSKIIFYVDNVPIREVKRTESMG  182

Query  560   GDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEH  381
             GDFP KPM +YATIWDASDWAT+GG+Y+VNYKYAP+VA F+DL+L GCA DP++      
Sbjct  183   GDFPSKPMTMYATIWDASDWATNGGKYRVNYKYAPYVAEFSDLILHGCAVDPIEH-----  237

Query  380   PGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAE  201
               V  C+  +  E    + VTP Q   M+ FR KHM YSYCYD+VRY VPPPECVI+  E
Sbjct  238   --VAKCESAQGSEKVP-SGVTPVQITKMRNFRLKHMAYSYCYDTVRYKVPPPECVINHQE  294

Query  200   RQQFKETGRLKF  165
              ++ ++   + F
Sbjct  295   AERLRKFDPVTF  306



>ref|XP_008220940.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Prunus mume]
Length=335

 Score =   369 bits (947),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 214/289 (74%), Gaps = 7/289 (2%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             +A++ ++    FD+G+  L+G+ N++      SV L L+  +GSGF S DLY HGFFSA 
Sbjct  23    SASSKNLPIISFDEGYNKLFGDDNLMIVRDGKSVHLSLDERTGSGFVSQDLYHHGFFSAS  82

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLP+DY AG+VVAFY +N D+F K HDE+DFEFLGN++GK WR QTN+YGNGSTS GRE
Sbjct  83    IKLPADYAAGVVVAFYMSNGDMFPKNHDEIDFEFLGNIRGKEWRIQTNVYGNGSTSTGRE  142

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDPS +FH+YSILWT+  IIFY+DDVPIRE+ R E+MGGDFP KPM LYATIWD
Sbjct  143   ERYNLWFDPSDDFHQYSILWTDSQIIFYVDDVPIREVKRTESMGGDFPSKPMSLYATIWD  202

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGAD  333
              SDWAT+GG+Y+VNYKYAP++A F+DLVL GCA DP++ +  +      CD+ +  E   
Sbjct  203   GSDWATNGGKYRVNYKYAPYLAQFSDLVLHGCAVDPIEHLSKK------CDNTQSSESVP  256

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
                VT  QR  M  FR+KHM YSYCYD +RY  PP ECVI+  E ++ +
Sbjct  257   -TGVTRLQRIKMDSFRKKHMTYSYCYDRIRYKSPPSECVINPQEAERLR  304



>ref|XP_003529235.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform X1 [Glycine max]
 ref|XP_006583754.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform X2 [Glycine max]
 ref|XP_006583755.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform X3 [Glycine max]
Length=338

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 225/312 (72%), Gaps = 8/312 (3%)
 Frame = -1

Query  1100  YLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGS  921
             + L    F L+ F S  +   ++    F+ G+T L+G+ N+       SV L L+  +GS
Sbjct  8     WFLFCCCFSLLFFHSSGSPRRNLPIIAFEDGYTPLFGDHNLAIHRDGKSVHLSLDERTGS  67

Query  920   GFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWR  741
             GF S DLY HG+FSA IKLP+DYTAG+VVAFY +N ++F+  HDE+DFEFLGN++GK WR
Sbjct  68    GFVSHDLYLHGYFSASIKLPADYTAGVVVAFYMSNGEMFQNNHDEIDFEFLGNIRGKDWR  127

Query  740   FQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMG  561
              QTN+YGNGSTS GREERY LWFDP+++FH+YSILWT+  IIFY+D+VPIRE+ R E+MG
Sbjct  128   IQTNVYGNGSTSIGREERYGLWFDPAEDFHQYSILWTDSKIIFYVDNVPIREVKRTESMG  187

Query  560   GDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEH  381
             GDFP KPM +YATIWDASDWAT+GG+Y+VNYKYAP+VA F+DL+L GCA DP++ V    
Sbjct  188   GDFPSKPMTMYATIWDASDWATNGGKYRVNYKYAPYVAEFSDLILHGCAVDPIEHVA---  244

Query  380   PGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAE  201
                  C+  +  E    + VTP Q   M+ FR KHM YSYCYD+VRY VPPPECVI+  E
Sbjct  245   ----KCESAQGSEKVP-SGVTPVQITKMRNFRLKHMAYSYCYDTVRYKVPPPECVINHQE  299

Query  200   RQQFKETGRLKF  165
              ++ ++   + F
Sbjct  300   AERLRKFDPVTF  311



>ref|XP_004513237.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cicer arietinum]
Length=341

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 168/286 (59%), Positives = 216/286 (76%), Gaps = 6/286 (2%)
 Frame = -1

Query  1022  PFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAG  843
             PFD+G+T L+G+ N++  T+  +V L L+  SGSGF S DLY HG+FSA IKLP DYTAG
Sbjct  36    PFDEGYTPLFGDHNLIIHTNSKTVHLSLDESSGSGFASHDLYLHGYFSASIKLPYDYTAG  95

Query  842   IVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPS  663
             +VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+YGNGST+ GREERY LWFDP+
Sbjct  96    VVVAFYLSNGDMYEKNHDEIDFEFLGNIRGKDWRVQTNVYGNGSTNIGREERYGLWFDPA  155

Query  662   KEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGR  483
             ++FH+YSILWT+  IIFY+DDVPIRE+ R E+M GDFP KPM LYATIWDAS+WAT+GG+
Sbjct  156   EDFHQYSILWTDSKIIFYVDDVPIREIKRTESMKGDFPSKPMTLYATIWDASNWATNGGK  215

Query  482   YKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRR  303
             YKVNYKYAP+VA FTD VL GC+ +P+  V         CD+  ++       VTP ++ 
Sbjct  216   YKVNYKYAPYVAEFTDFVLHGCSVNPIDHV------TTNCDNTAQISDNVSFGVTPLEKI  269

Query  302   AMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              M+ FR KHM YSYCYD +RY VP PECVI+  + ++ ++   + F
Sbjct  270   KMENFRLKHMTYSYCYDRIRYKVPLPECVINPQQDERLRKFDPVTF  315



>ref|XP_006469297.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Citrus sinensis]
Length=334

 Score =   369 bits (946),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 218/301 (72%), Gaps = 10/301 (3%)
 Frame = -1

Query  1076  FLIAF--LSYTAAAF--DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             FL+ F  L+  A+    ++   PFD+G++ L+G  N++      SV L L+  +GSGF S
Sbjct  9     FLLVFSLLAVVASGLYRNLPIVPFDEGYSHLFGHDNLVVHRDGKSVHLSLDERTGSGFVS  68

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
              DLY HGFFSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR QTN
Sbjct  69    HDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKNWRIQTN  128

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGSTS GREERY LWFDPS +FH+YSILWT+  IIFYID +PIRE  R  +MGGDFP
Sbjct  129   IYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTASMGGDFP  188

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LYATIWD SDWAT+GG+Y+VNYKYAP+V  F+D VL GC+ DP+++   +     
Sbjct  189   AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSK-----  243

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              CD     + +    V+P QR  M+ FR+KHM YSYCYD +RY VPP ECVI+  E ++ 
Sbjct  244   -CDITESSKVSIPTGVSPSQRIKMENFRRKHMTYSYCYDQIRYKVPPFECVINPLEAERL  302

Query  188   K  186
             K
Sbjct  303   K  303



>emb|CAN74084.1| hypothetical protein VITISV_018042 [Vitis vinifera]
Length=332

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 165/289 (57%), Positives = 219/289 (76%), Gaps = 7/289 (2%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
             + ++ ++    FD+G++ L+G++N+       +V + L+  +GSGF S DLY HGFFSA 
Sbjct  19    SGSSKELPIISFDEGYSPLFGDANLAILKDGKTVHMSLDERTGSGFISQDLYLHGFFSAS  78

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLP+DYTAG+VVAFY +NAD+FE  HDELDFEFLGN++GK WR QTN+YGNGST+ GRE
Sbjct  79    IKLPADYTAGVVVAFYMSNADMFEANHDELDFEFLGNIRGKDWRIQTNVYGNGSTNVGRE  138

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERY LWFDPS++FH+YSILW++  IIFY+D+VPIRE+ R EAMGGDFP KPM LYATIWD
Sbjct  139   ERYHLWFDPSEDFHQYSILWSDNLIIFYVDNVPIREIKRTEAMGGDFPSKPMSLYATIWD  198

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGAD  333
              S+WAT+GGRY+VNYKYAP+ A F++LVL GCA DP+++          CD+    + + 
Sbjct  199   GSEWATNGGRYRVNYKYAPYEAEFSNLVLHGCAVDPIEK-------SPKCDNGPTSKASI  251

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
                + P+QR  M++FR+ HM YSYCYD VRY VPP ECV++A E ++ +
Sbjct  252   PTGIMPEQRSKMEKFRKTHMTYSYCYDRVRYTVPPSECVVNAQEAERLR  300



>ref|XP_003555818.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Glycine max]
 gb|KHN32264.1| Putative xyloglucan endotransglucosylase/hydrolase protein 28 
[Glycine soja]
Length=343

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 221/308 (72%), Gaps = 8/308 (3%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             SS  F +A  S  +   ++    F+ G+T L+G+ N+       SV L L+  +GSGF S
Sbjct  17    SSLLFFVASSSSVSPRRNLPIIAFEDGYTPLFGDHNLAIHRDGKSVHLSLDERTGSGFVS  76

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
              DLY HG+FSA IKLP+DYTAG+VVAFY +N D+F+  HDE+DFEFLGN++GK WR QTN
Sbjct  77    HDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDMFQNNHDEIDFEFLGNIRGKDWRIQTN  136

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGSTS GREERY LWFDP+++FH+YSILWT+  IIFY+DDVPIRE+ R E+MGGDFP
Sbjct  137   VYGNGSTSIGREERYGLWFDPAEDFHQYSILWTDSKIIFYVDDVPIREVKRTESMGGDFP  196

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LYATIWDASDWAT+GG+Y+VNYKYAP+VA F+DLVL GCA DP++        V 
Sbjct  197   SKPMTLYATIWDASDWATNGGKYRVNYKYAPYVAEFSDLVLHGCAVDPIEH-------VA  249

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              CD     E    + VT  Q   M+ FR +HM YSYCYD+VRY VPPPECVI   E ++ 
Sbjct  250   KCDSALGSEEVP-SGVTQVQITKMRNFRLRHMTYSYCYDTVRYKVPPPECVISHQEAERL  308

Query  188   KETGRLKF  165
             ++   + F
Sbjct  309   RKFDPITF  316



>ref|XP_009389336.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Musa acuminata subsp. malaccensis]
Length=339

 Score =   368 bits (944),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 228/318 (72%), Gaps = 5/318 (2%)
 Frame = -1

Query  1115  MAVPPYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLN  936
             MA  P  + ++  FL+  ++  A  FDV +  F +GF+ L+G  N++RS    S RL LN
Sbjct  1     MAATPRSMPTAFIFLLC-ITTAAVGFDVPSLTFSEGFSHLFGNDNLIRSADGRSARLSLN  59

Query  935   HLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVK  756
               SGSGF SSDLY HGFFSA IKLPSDYTAG+VVAFYT+N D+   THDELDFEFLGNV+
Sbjct  60    RYSGSGFISSDLYDHGFFSASIKLPSDYTAGVVVAFYTSNGDIHPWTHDELDFEFLGNVR  119

Query  755   GKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIR  576
              K WR QTN++GNGS +RGREERYL+ FDP++E HRYSILWT  TIIFYIDD+PIRE++R
Sbjct  120   EKDWRIQTNVFGNGSNTRGREERYLVPFDPTQEAHRYSILWTPDTIIFYIDDIPIREVVR  179

Query  575   NEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQE  396
              + MGG+FP KPM +YATIWD S WATS GR K++YKY P+VAHF+DL L GC  DP+Q+
Sbjct  180   TDDMGGEFPAKPMSVYATIWDGSAWATSYGRIKIDYKYEPYVAHFSDLALVGCRVDPIQQ  239

Query  395   VVGEHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYA-VPPPEC  219
             V          +   EL  AD+A +TP +R AM+RFR+++M YS+CYD  RY  V  P+C
Sbjct  240   VDSADRCAEAVE---ELMSADYAILTPMKRAAMRRFRERYMIYSFCYDQHRYGNVTFPDC  296

Query  218   VIDAAERQQFKETGRLKF  165
                ++ER +F E G  K 
Sbjct  297   DYVSSERTRFGEWGDNKI  314



>ref|XP_004514368.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cicer arietinum]
Length=341

 Score =   368 bits (944),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 215/286 (75%), Gaps = 6/286 (2%)
 Frame = -1

Query  1022  PFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAG  843
             PFD+G+T L+G+ N++  +   +V L L+  SGSGF S DLY HG+FSA IKLP DYTAG
Sbjct  36    PFDEGYTPLFGDHNLIIHSDSKTVHLSLDESSGSGFASHDLYLHGYFSASIKLPYDYTAG  95

Query  842   IVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPS  663
             +VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+YGNGST+ GREERY LWFDP+
Sbjct  96    VVVAFYLSNGDMYEKNHDEIDFEFLGNIRGKDWRVQTNVYGNGSTNIGREERYGLWFDPA  155

Query  662   KEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGR  483
             ++FH+YSILWT+  IIFY+DDVPIRE+ R E+M GDFP KPM LYATIWDAS+WAT+GG+
Sbjct  156   QDFHQYSILWTDSKIIFYVDDVPIRELKRTESMKGDFPSKPMTLYATIWDASNWATNGGK  215

Query  482   YKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRR  303
             YKVNYKYAP+VA FTD VL GC+ +P+  V         CD+  ++       VTP ++ 
Sbjct  216   YKVNYKYAPYVAEFTDFVLHGCSVNPIDHV------TTNCDNTAQISDNVSFGVTPLEKI  269

Query  302   AMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              M+ FR KHM YSYCYD +RY VP PECVI+  + ++ ++   + F
Sbjct  270   KMENFRLKHMTYSYCYDRIRYKVPLPECVINPQQDERLRKFDPVTF  315



>ref|XP_002315842.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa]
 gb|EEF02013.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa]
Length=336

 Score =   368 bits (944),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/317 (56%), Positives = 220/317 (69%), Gaps = 15/317 (5%)
 Frame = -1

Query  1106  PPYLLHSSAFFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLN  936
             P +LL  S   L      + +    T+ P   FD+G+T L+G+ N++       V L L+
Sbjct  8     PCFLLICSLLALFV----SGSQIQRTSLPIISFDEGYTQLFGDDNLVMYRDGKRVHLSLD  63

Query  935   HLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVK  756
               +GSGF S DLY HG+FSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++
Sbjct  64    ERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDIFEKNHDEIDFEFLGNIR  123

Query  755   GKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIR  576
             GK WR QTN+YGNGSTS GREERY LWFDPS +FH+YSILWTN  IIFY+D++PIRE+ R
Sbjct  124   GKDWRIQTNIYGNGSTSAGREERYSLWFDPSDDFHQYSILWTNSQIIFYVDNIPIREVKR  183

Query  575   NEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQE  396
              E+MG DFP KPM LYATIWD SDWAT+GG+Y+VNYKYAP+VA F+DLVL GCA DP+++
Sbjct  184   TESMGADFPSKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVAEFSDLVLHGCAVDPVEQ  243

Query  395   VVGEHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECV  216
                       CD+  E   A    VTP QR  M+ FR K M YSYCYD VRY  PP ECV
Sbjct  244   -------FPRCDN-TESSQAIPTGVTPVQRIKMESFRAKFMTYSYCYDRVRYRAPPSECV  295

Query  215   IDAAERQQFKETGRLKF  165
             I+  E  + K    + F
Sbjct  296   INTKEADRLKSYDPVTF  312



>ref|XP_009390346.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 isoform X1 [Musa acuminata subsp. malaccensis]
Length=335

 Score =   367 bits (943),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 217/294 (74%), Gaps = 11/294 (4%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNH---LSGSGFRSSDLYSHGFFSAKIK  867
             ++TT  F++G+T L+G+SN+L      +V L L+    L G+GF S DLY HGFFSA IK
Sbjct  31    NLTTLSFEEGYTQLFGDSNLLLHRDGRAVHLALDQRTALLGAGFASQDLYLHGFFSASIK  90

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LPSDY AG+VVAFY +N DVFEK+HDELDFEFLGN++G+ WR QTN+YGNGST+ GREER
Sbjct  91    LPSDYAAGVVVAFYMSNGDVFEKSHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREER  150

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDP++++H+YSILW+++ IIFYID++PIRE++R +AMGGDFP KPM LYATIWD S
Sbjct  151   YQLWFDPTEDYHQYSILWSHERIIFYIDNIPIREVVRTQAMGGDFPSKPMSLYATIWDGS  210

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFA  327
              WATSGGRYKVNYK AP+VA F DL+L GCA DP      +H     C  R +    D  
Sbjct  211   TWATSGGRYKVNYKLAPYVADFADLILHGCAVDP-----SDHK--TAC-QRSDAVLYDAI  262

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              ++  QR AM +FR+KHM YSYC+D +RY  PPPEC+    E Q F  +G  KF
Sbjct  263   TMSADQRTAMAKFRKKHMTYSYCHDRIRYPTPPPECMFVGPESQNFLASGDAKF  316



>ref|XP_009397821.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 isoform X1 [Musa acuminata subsp. malaccensis]
Length=369

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 189/339 (56%), Positives = 229/339 (68%), Gaps = 34/339 (10%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNH--------  933
             S   F++  L     AFDV T  F +GF+ L+G  N++RS  D SVRL LN         
Sbjct  10    SMVLFVLLGLVTATEAFDVPTLTFGEGFSHLFGNDNLIRSADDRSVRLTLNRYSGRGRDV  69

Query  932   ----------------------LSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTT  819
                                    SGSGF SSDLY HGFFSA IKLP DYTAG+VVAFYT+
Sbjct  70    LVATFVVFFLLRGECVTKWCMWFSGSGFISSDLYEHGFFSASIKLPKDYTAGVVVAFYTS  129

Query  818   NADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSI  639
             N DVF  THDELDFEFLGNV+GK WR QTN+YGNGST+RGREERYL+ FDP++E H YSI
Sbjct  130   NGDVFPDTHDELDFEFLGNVRGKDWRIQTNVYGNGSTTRGREERYLVPFDPTEEPHLYSI  189

Query  638   LWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYA  459
             LWT   IIFYIDDVPIRE++R++AMGGDFP KPM +YATIWD S WATS GR K+NYKYA
Sbjct  190   LWTPDYIIFYIDDVPIREVVRSDAMGGDFPSKPMSVYATIWDGSSWATSYGRIKINYKYA  249

Query  458   PFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQK  279
             P+V+ F+DLVLRGC  DP+Q+V          +   EL  AD+A +TP++R AM+RFR++
Sbjct  250   PYVSEFSDLVLRGCRVDPIQQVDSADRCAEAVE---ELMSADYALLTPRKRAAMRRFRER  306

Query  278   HMYYSYCYDSVRYA-VPPPECVIDAAERQQFKETGRLKF  165
             +M YS+CYD  RY  V  P+C   ++E  +F E G  KF
Sbjct  307   YMIYSFCYDQHRYGNVTFPDCDYVSSEHSRFGEWGDNKF  345



>ref|XP_009351584.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Pyrus x bretschneideri]
Length=336

 Score =   367 bits (942),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 220/304 (72%), Gaps = 7/304 (2%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             L   +   L+  +  +A +  +   PFD+G+T L+GE N++      SV L L+  +GSG
Sbjct  8     LFLCACQVLVLGVVASAPSGKLPIIPFDEGYTKLFGEDNLMILRDGKSVHLSLDERTGSG  67

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S DLY HGFFSA IKLP+DYTAG+VVAFY +N D+F K HDE+DFEFLGN++GK WR 
Sbjct  68    FVSQDLYQHGFFSASIKLPADYTAGVVVAFYMSNGDMFPKYHDEIDFEFLGNIRGKEWRV  127

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGN ST+ GREERY LWFDPS ++H+YSILWT+  IIFY+D+VPIRE  + E+MGG
Sbjct  128   QTNIYGNRSTNTGREERYNLWFDPSDDYHQYSILWTDSQIIFYVDNVPIREFKKTESMGG  187

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWD SDWAT+GG+Y+VNYKYAP++A F+DLVL GCA DP++++  +  
Sbjct  188   DFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYLAEFSDLVLHGCAVDPIEQLSKK--  245

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 C++ R  E      VT  QR  M+ FR+KHM YSYCYD +RY  PP ECVI+  E 
Sbjct  246   ----CENTRSSESVP-TGVTRLQRMKMESFRKKHMTYSYCYDRIRYKSPPSECVINPQEA  300

Query  197   QQFK  186
             ++ +
Sbjct  301   ERLR  304



>ref|XP_007045473.1| Xyloglucan endotransglucosylase/hydrolase 28 [Theobroma cacao]
 gb|EOY01305.1| Xyloglucan endotransglucosylase/hydrolase 28 [Theobroma cacao]
Length=336

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/285 (59%), Positives = 210/285 (74%), Gaps = 7/285 (2%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G++ L+G+ N+       +V L LN  +GSGF S DLY HG+FSA IKLP+DYTAG+
Sbjct  35    FDEGYSQLFGDDNLAIHRDGKAVHLSLNERTGSGFVSQDLYLHGYFSASIKLPADYTAGV  94

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N D+FEK HDE+DFEFLGN++GK WR QTN+YGNGSTS GREERY LWFDP+ 
Sbjct  95    VVAFYMSNGDIFEKNHDEIDFEFLGNIRGKDWRIQTNVYGNGSTSVGREERYNLWFDPAD  154

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             +FH+Y+ILWT+  IIFY+D+ PIRE+ R  AMGGDFP KPM LYATIWD SDWAT+GG+Y
Sbjct  155   DFHQYTILWTDSKIIFYVDNTPIREVKRTAAMGGDFPSKPMSLYATIWDGSDWATNGGKY  214

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             +VNYKYAP+VA F+DL+L GCA DP++           CD  + LE      +TP QR  
Sbjct  215   RVNYKYAPYVAKFSDLILHGCAVDPIEFSSKR------CDTAQSLEELS-TTITPSQRSK  267

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             M  FR+K+M YSYCYD  RY  PPPECV++  E ++ K+   + F
Sbjct  268   MDSFRRKYMTYSYCYDQTRYKGPPPECVVNPQEAERLKKFDPVTF  312



>ref|XP_004228752.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Solanum lycopersicum]
Length=335

 Score =   365 bits (938),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/284 (58%), Positives = 211/284 (74%), Gaps = 7/284 (2%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++    FD+G++ L+G++N++      SV + L+  +G+GF S DLY HGFFSA IKLP+
Sbjct  25    NLPILAFDEGYSHLFGDNNLMILKDGKSVHISLDKRTGAGFVSQDLYFHGFFSASIKLPA  84

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR QTN+YGNGST+ GREERY L
Sbjct  85    DYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTNVGREERYGL  144

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDPS++FH+YSILWT   IIFY+D+VPIRE+ R +AMGGDFP KPM L ATIWD S+WA
Sbjct  145   WFDPSEDFHQYSILWTENLIIFYVDNVPIREIKRTKAMGGDFPSKPMSLIATIWDGSNWA  204

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVT  318
             T+GG+YKVNYKYAP++A F+D +L GCA DP++           CD+          ++T
Sbjct  205   TNGGKYKVNYKYAPYIAEFSDFILHGCAVDPIEL-------SSKCDNTTPKTPTIPTDIT  257

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
               QRR M+ FR+K M YSYCYD  RY VPPPECVID  E ++ +
Sbjct  258   LDQRRKMENFRKKQMQYSYCYDKTRYKVPPPECVIDPKEAERLR  301



>ref|XP_009763784.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Nicotiana sylvestris]
Length=331

 Score =   365 bits (938),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 215/298 (72%), Gaps = 9/298 (3%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
             FF +  L Y  ++ ++    FD+G++ L+G++N++      S  + L+  +G+GF S DL
Sbjct  11    FFSVVELVY-GSSRNLPILAFDEGYSHLFGDNNLMILKDGKSAHISLDERTGAGFVSQDL  69

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y HGFFSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR QTN+YG
Sbjct  70    YLHGFFSASIKLPADYTAGVVVAFYMSNVDMFEKNHDEIDFEFLGNIRGKDWRIQTNIYG  129

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGSTS GREERY LWFDPS++FH YSILWT   IIFY+D+VPIRE+ R EAMGGDFP KP
Sbjct  130   NGSTSFGREERYGLWFDPSEDFHHYSILWTENFIIFYVDNVPIREIKRTEAMGGDFPSKP  189

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M LYATIWD S WAT+GG+YKVNYKYAP++A F+D VL GCA DP++           CD
Sbjct  190   MSLYATIWDGSGWATNGGKYKVNYKYAPYIAKFSDFVLHGCAVDPIEL-------SSKCD  242

Query  359   DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
                +        +TP QRR M+ FR+K M YSYCYD  RY VPP ECVID  E ++ +
Sbjct  243   TAPKTSSIP-TGITPDQRRKMENFRKKQMQYSYCYDKTRYKVPPTECVIDPKEAERLR  299



>ref|XP_009380067.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=342

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 215/296 (73%), Gaps = 19/296 (6%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++TT  F++G+T L+G+SN++      SV L L+  +G+GF S DLY HGFFSA IKLP+
Sbjct  42    NLTTLAFEEGYTQLFGDSNLMLHRDGRSVHLSLDRRTGAGFASQDLYRHGFFSASIKLPA  101

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY AG+VVAFY +N DVFEKTHDELDFEFLGN++G+ WR QTN+YGNGST+ GREERY L
Sbjct  102   DYAAGVVVAFYMSNGDVFEKTHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREERYGL  161

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP++++H+YSILW+ + IIFYIDD+PIRE++R +AMGGDFP KPM LYATIWD S WA
Sbjct  162   WFDPTEDYHQYSILWSGERIIFYIDDIPIREVVRTQAMGGDFPSKPMSLYATIWDGSTWA  221

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFA---  327
             TSGGRYKVNYKYAP+ A F DLVL GCA DP++              R    G D A   
Sbjct  222   TSGGRYKVNYKYAPYEAEFADLVLHGCAVDPIEH-------------RTTCLGYDAAVYD  268

Query  326   --NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
                ++  QR AM +FR+KH+ YSYC+D VRY  PPPEC +   E + F  +G  K 
Sbjct  269   SITMSADQRTAMDKFRKKHITYSYCHDRVRYPTPPPECNL-GPEAEDFLASGEAKL  323



>ref|XP_008798384.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Phoenix dactylifera]
Length=335

 Score =   365 bits (937),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 215/289 (74%), Gaps = 9/289 (3%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++T+  F++G+T L+G+SN++       V L L+  +G+GF S DLY HGFFSA IKLPS
Sbjct  34    NLTSLSFEEGYTQLFGDSNLMLHRDGRGVHLSLDERTGAGFASQDLYLHGFFSAAIKLPS  93

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY AG+VVAFY +N DVFE+THDELDFEFLGN++GK WR QTN+YGNGST+ GREERY L
Sbjct  94    DYAAGVVVAFYMSNGDVFERTHDELDFEFLGNIRGKEWRVQTNIYGNGSTAIGREERYGL  153

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP+++FH+YSILW++  IIFYID+VPIRE+ R E +GG FP KPM LYATIWD S+WA
Sbjct  154   WFDPTEDFHKYSILWSHDRIIFYIDNVPIREVARTEVLGGQFPSKPMSLYATIWDGSNWA  213

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVT  318
             TSGGRYK+NYKYAP++A F DL+L GCA DP+       P   G       +  D   ++
Sbjct  214   TSGGRYKINYKYAPYIAEFADLILDGCAVDPMDHT----PTCNGL----VADLYDTITIS  265

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRL  171
               QR AM+RFR+KHM YSYCYD +RY+ P PEC     E +QF+E+G +
Sbjct  266   TDQRLAMERFRKKHMTYSYCYDRIRYSTPLPECSA-GPEARQFQESGEV  313



>ref|XP_010527818.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Tarenaya hassleriana]
Length=330

 Score =   365 bits (936),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 220/304 (72%), Gaps = 11/304 (4%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAF---DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             SS    +A  +  A+ F    +    FD+G+T L+G+ N++      S RL L+  +GSG
Sbjct  5     SSMLVFMALFAGLASGFALEKLHVISFDEGYTHLFGDQNLVVRKDGKSARLSLDERTGSG  64

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S+DLY HGFFSAKIKLP+DYTAG+V+AFY +N D++EK HDE+DFEFLGN++GK WR 
Sbjct  65    FVSNDLYLHGFFSAKIKLPADYTAGVVIAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRI  124

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST  GREERY LWFDP+++FH+YSILW++  IIFY+D+VPIRE+ R+E+MGG
Sbjct  125   QTNVYGNGSTHLGREERYNLWFDPTEDFHQYSILWSDSHIIFYVDNVPIREVKRSESMGG  184

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LY+TIWD S WAT GG+Y VNYKYAP++A F++ VL GC  DP+++      
Sbjct  185   DFPSKPMSLYSTIWDGSKWATDGGKYGVNYKYAPYIAQFSEFVLHGCTVDPIEQFP----  240

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 CD   E + +  A +T  QRR M+ FR+K M YSYCYD  RY V PPECV+D AE 
Sbjct  241   ---TCDASAE-DLSHVAELTSSQRRKMENFRRKRMTYSYCYDQTRYKVAPPECVVDPAEA  296

Query  197   QQFK  186
             ++ +
Sbjct  297   KRLR  300



>ref|XP_008365814.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Malus domestica]
 gb|ACD03234.1| xyloglucan endotransglucosylase/hydrolase 10 [Malus domestica]
Length=336

 Score =   365 bits (936),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 219/296 (74%), Gaps = 7/296 (2%)
 Frame = -1

Query  1073  LIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYS  894
             L+  +  +A +  +   PFD+G+T L+G+ N++      SV L L+  +GSGF S DLY 
Sbjct  16    LVLGVVASAPSGKLPIIPFDEGYTKLFGDDNLMILRDGKSVHLSLDERTGSGFVSQDLYQ  75

Query  893   HGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNG  714
             HGFFSA IKLP+DYTAG+VVAFY +N D+F K HDE+DFEFLGN++GK WR QTN+YGNG
Sbjct  76    HGFFSASIKLPADYTAGVVVAFYMSNGDMFPKYHDEIDFEFLGNIRGKEWRVQTNIYGNG  135

Query  713   STSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMG  534
             ST+ GREERY LWFDPS ++H+YSILWT+  IIFY+D+VPIRE  + ++MGGDFP KPM 
Sbjct  136   STNTGREERYNLWFDPSDDYHQYSILWTDIQIIFYVDNVPIREFKKTKSMGGDFPAKPMS  195

Query  533   LYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR  354
             LYATIWD SDWAT+GG+Y+VNYKYAP++A F+DLVL GCA DP++++  +      C++ 
Sbjct  196   LYATIWDGSDWATNGGKYRVNYKYAPYLAEFSDLVLHGCAVDPIEQLSKK------CENT  249

Query  353   RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             +  E      VT  QR  M+ FR+KHM YSYCYD +RY  PP ECVI+  E ++ +
Sbjct  250   QSSESVP-TGVTRLQRMKMESFRKKHMTYSYCYDRIRYKSPPSECVINPQEAERLR  304



>ref|XP_006364060.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Solanum tuberosum]
Length=334

 Score =   363 bits (933),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 209/278 (75%), Gaps = 7/278 (3%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G++ L+G++N++      SV + L+  +G+GF S DLY HGFFSA IKLP+DYTAG+
Sbjct  31    FDEGYSHLFGDNNLMILKDGKSVHISLDKRTGAGFVSQDLYFHGFFSASIKLPADYTAGV  90

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N D+FEK HDE+DFEFLGN++GK WR QTN+YGNGSTS GREERY LWFDPS+
Sbjct  91    VVAFYMSNGDMFEKNHDEIDFEFLGNIRGKDWRIQTNIYGNGSTSVGREERYGLWFDPSE  150

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             +FH+YSILWT   IIFY+D+VPIRE+ R +AMGGDFP KPM L ATIWD S+WAT+GG+Y
Sbjct  151   DFHQYSILWTENLIIFYVDNVPIREIKRTKAMGGDFPSKPMSLIATIWDGSNWATNGGKY  210

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             KVNYKYAP++A F+D VL GCA DP++           C++      +    +T  QRR 
Sbjct  211   KVNYKYAPYIAEFSDFVLHGCAVDPIEL-------SSKCENTTPKTPSIPTGITLDQRRK  263

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             M+ FR+K M YSYCYD  RY VPPPECVID  E ++ +
Sbjct  264   MENFRKKQMQYSYCYDKTRYKVPPPECVIDPKETERLR  301



>ref|XP_010674965.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Beta vulgaris subsp. vulgaris]
Length=339

 Score =   363 bits (933),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 209/284 (74%), Gaps = 7/284 (2%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++    FD+G++ L+G+ N++      SV L LN  +GSGF S DLY HGFFSA IKLP+
Sbjct  32    NLPIISFDEGYSHLFGDDNLMVLRDGKSVLLSLNERTGSGFMSHDLYLHGFFSASIKLPA  91

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DYTAG+VVAFY +N D++E  HDELDFEFLGN++GK WR QTN+YGNGST+ GREERY L
Sbjct  92    DYTAGVVVAFYMSNGDMYENNHDELDFEFLGNIRGKEWRIQTNVYGNGSTNVGREERYTL  151

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDPS+EFHRYSILW    IIFY+DDVPIRE+ R +AM  DFP KPM LY+TIWDAS WA
Sbjct  152   WFDPSEEFHRYSILWVEDQIIFYVDDVPIREIRRVKAMKHDFPSKPMSLYSTIWDASTWA  211

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVT  318
             T+GG+YKV+Y+YAP+VA F+DLVL GCA DP++           CDD + + G+    +T
Sbjct  212   TNGGKYKVDYRYAPYVAEFSDLVLHGCAVDPIER-------SRKCDDIKSISGSVPHGIT  264

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             P QR  M  FR+K + YSYCYD  RY +PP ECV+D+ E  + K
Sbjct  265   PLQRIKMADFRKKFLTYSYCYDKSRYKLPPSECVLDSQEADRLK  308



>gb|KDP38168.1| hypothetical protein JCGZ_04811 [Jatropha curcas]
Length=323

 Score =   363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 216/311 (69%), Gaps = 11/311 (4%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             SS F LI  L     +    T P   FD+G+T L+G+ N++       V L L+  +GSG
Sbjct  7     SSGFLLILSLFAVLVSGSQRTLPIISFDEGYTHLFGDDNLVIHKDGKRVHLLLDERTGSG  66

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S DLY HG+FSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR 
Sbjct  67    FVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDIFEKNHDEIDFEFLGNIRGKDWRI  126

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGSTS GREERY LWFDPS +FH+YSILWT+  IIFY+D+V IRE+ R E+MGG
Sbjct  127   QTNIYGNGSTSVGREERYNLWFDPSDDFHQYSILWTDSQIIFYVDNVTIREVKRTESMGG  186

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWD SDWAT+GG+Y+VNYKYAP+V  F+D VL GCA DP+++      
Sbjct  187   DFPSKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCAVDPIEQ------  240

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
              +  CD  +  +      VT  QR  M  FR+K M YSYCYD  RY +PP ECVI+  E 
Sbjct  241   -ISKCDTLQNSQAVP-TGVTRLQRIQMNSFRRKFMTYSYCYDKARYKIPPSECVINPREA  298

Query  197   QQFKETGRLKF  165
             ++ K    + F
Sbjct  299   ERLKSFDPVTF  309



>emb|CDP20286.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/312 (54%), Positives = 219/312 (70%), Gaps = 9/312 (3%)
 Frame = -1

Query  1094  LHSSAFFLIAFLSYTA-AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
              H   F L  F+     A+ ++    FD+G++ L+G+ N++      SV L L+  +GSG
Sbjct  4     FHLGFFALTTFIVLVCGASKNLPILSFDEGYSQLFGDDNLMVVKDGKSVHLTLDERTGSG  63

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S D+YS GFFSA IKLP+DYTAG+VVAFY +N D+F+K HDE+DFEFLGN++GK WR 
Sbjct  64    FVSQDIYSQGFFSASIKLPADYTAGVVVAFYMSNGDMFQKNHDEVDFEFLGNIRGKDWRM  123

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST+ GREERY LWFDPS++FH+YSILWT   IIFY+D+V IRE  R   MGG
Sbjct  124   QTNIYGNGSTNTGREERYGLWFDPSEDFHQYSILWTENQIIFYVDNVTIREFKRTATMGG  183

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWD SDWAT+GG++++NYKYAP++A F+DLVL GCA DP ++      
Sbjct  184   DFPSKPMSLYATIWDGSDWATNGGKFRINYKYAPYIAKFSDLVLHGCAVDPTEQAT----  239

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 CD   + +      +TP+QR  M+ FR+KHM YSYCYD  RY VPP ECV+DA E 
Sbjct  240   ---KCDIAPKHDSIP-TGITPEQRIRMQNFRKKHMQYSYCYDCARYTVPPAECVLDAKEA  295

Query  197   QQFKETGRLKFE  162
             +  +    + F+
Sbjct  296   EGLRAFDPVTFQ  307



>gb|ACD03223.1| xyloglucan endotransglucosylase/hydrolase 13 [Actinidia deliciosa]
Length=329

 Score =   363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/304 (56%), Positives = 215/304 (71%), Gaps = 12/304 (4%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             LL   +  ++A    + ++ ++    FD+G++ L+G+ N++      SV L L+  +GSG
Sbjct  7     LLAICSVLVVA----SGSSRNLPIISFDEGYSQLFGDENLMVLEDGKSVHLSLDERTGSG  62

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S DLY HGFFSA IKLP+DYTAG+VVAFY +N D+ EK HDELDFEFLGN++GK WR 
Sbjct  63    FVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMHEKNHDELDFEFLGNIRGKDWRI  122

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGSTS GREERY LWFDPS++FH YSILWT   I FY+D+VPIRE+ R EAMGG
Sbjct  123   QTNVYGNGSTSVGREERYGLWFDPSEDFHHYSILWTENQITFYVDNVPIREIKRTEAMGG  182

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWD S+WAT+GGRY+VNYKYAP++  F+DLVL GCA DP+++      
Sbjct  183   DFPSKPMSLYATIWDGSNWATNGGRYRVNYKYAPYITQFSDLVLHGCAVDPIEQ------  236

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 CD     E      +TP Q   M+ FR+KHM YSYCYD  RY VPP EC I+  E 
Sbjct  237   -SSTCDLPPNSESI-LTGITPDQLSKMENFRKKHMQYSYCYDRTRYKVPPSECAINPQEA  294

Query  197   QQFK  186
             ++ +
Sbjct  295   ERLR  298



>ref|XP_010554388.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Tarenaya hassleriana]
Length=336

 Score =   363 bits (932),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 216/294 (73%), Gaps = 13/294 (4%)
 Frame = -1

Query  1052  TAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFF  882
             T + F++   P   FD+G+T L+G+ N+       SVRL L+  +GSGF S+DLY HGFF
Sbjct  17    TVSGFNLEKLPVMSFDEGYTHLFGDQNLAVRKDGKSVRLSLDERTGSGFVSNDLYLHGFF  76

Query  881   SAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSR  702
             SAKIKLP+DYTAG+VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+YGNGST  
Sbjct  77    SAKIKLPADYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNVYGNGSTHM  136

Query  701   GREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYAT  522
             GREERY LWFDPS++FH+YSILW++  IIFY+DDV IRE+ R  +MGGDFP KPM LYAT
Sbjct  137   GREERYHLWFDPSEDFHQYSILWSDSHIIFYVDDVSIREVKRTASMGGDFPSKPMSLYAT  196

Query  521   IWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRR--E  348
             +WD S WAT+GG+Y VNYKYAP+VA F+D VL GCA DP+++          CDD    +
Sbjct  197   VWDGSKWATNGGKYGVNYKYAPYVAQFSDFVLHGCAVDPIEQFP-------KCDDASAGD  249

Query  347   LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             L  A  A +T  +R  M+ FR KHM YSYCYD  RY V PPECV++ AE ++ +
Sbjct  250   LRQAA-AEMTSSRRSKMENFRGKHMTYSYCYDQTRYKVAPPECVVNPAEAKRLR  302



>ref|XP_011021731.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Populus euphratica]
Length=335

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 217/311 (70%), Gaps = 13/311 (4%)
 Frame = -1

Query  1082  AFFLIAFLSY--TAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
              F LI  L+   + +    T+ P   FD+G+T L+G+ N++       V L L+  +GSG
Sbjct  9     CFLLICSLALFVSGSQTQRTSLPIISFDEGYTQLFGDDNLVMYRDGKRVHLSLDERTGSG  68

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S DLY HG+FSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR 
Sbjct  69    FVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDIFEKNHDEIDFEFLGNIRGKDWRI  128

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGSTS GREERY LWFDPS +FH+YSILWTN  IIFY+D++PIRE+ R E+MG 
Sbjct  129   QTNIYGNGSTSAGREERYSLWFDPSDDFHQYSILWTNSQIIFYVDNIPIREVKRTESMGA  188

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWD SDWAT+GG+Y+VNYKYAP+VA F+DLVL GCA DP++++    P
Sbjct  189   DFPSKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVAEFSDLVLHGCAVDPVEQL----P  244

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                  D  + +        TP QR  M+ FR K M YSYCYD VRY  P  ECVI+  E 
Sbjct  245   RCDNTDSSQAIP----TGATPVQRIKMESFRAKFMTYSYCYDRVRYRAPLSECVINTKEA  300

Query  197   QQFKETGRLKF  165
              + K    + F
Sbjct  301   DRLKSYDPVTF  311



>gb|EMT08504.1| Putative xyloglucan endotransglucosylase/hydrolase protein 30 
[Aegilops tauschii]
Length=322

 Score =   362 bits (929),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 216/288 (75%), Gaps = 14/288 (5%)
 Frame = -1

Query  1037  DVT-TTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLP  861
             DVT T  F  G+T L+G  NILRS  D +V L L+  +GSGF SS +Y HGFFSA IKLP
Sbjct  28    DVTATVAFGDGYTPLFGFDNILRSADDRTVSLLLDRTTGSGFISSAMYEHGFFSASIKLP  87

Query  860   SDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYL  681
             SDYTAG+VVAFYT+N DVF KTHDELDFEFLGN++GKPWR QTNMYGNGS SRGREERY+
Sbjct  88    SDYTAGVVVAFYTSNGDVFPKTHDELDFEFLGNIRGKPWRMQTNMYGNGSVSRGREERYV  147

Query  680   LWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDW  501
             L F P+ EFHRYSILW    ++FY+DDVP+R + R  A G DFP KPM LYAT+WDAS+W
Sbjct  148   LPFAPTTEFHRYSILWARDAVVFYVDDVPVRHLRRARA-GRDFPAKPMALYATVWDASNW  206

Query  500   ATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANV  321
             ATSGGRY+VNY Y PFVA FTDL L GC++ P +E         GC D   L  +D A +
Sbjct  207   ATSGGRYRVNYHYGPFVASFTDLALTGCSS-PTEE---------GCAD--ALAASDPAVM  254

Query  320   TPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETG  177
             T  Q++AM++FR+++M YSYCYD+ RY VP PEC +  +ER +FK++G
Sbjct  255   TLAQQQAMRQFRERNMVYSYCYDTRRYPVPFPECDLVESERSRFKDSG  302



>ref|XP_008389143.1| PREDICTED: LOW QUALITY PROTEIN: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Malus domestica]
Length=336

 Score =   362 bits (930),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 217/296 (73%), Gaps = 7/296 (2%)
 Frame = -1

Query  1073  LIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYS  894
             L+  +  +A   ++   PFD+G+T L+G+ N++      SV L L+  +GSGF S DLY 
Sbjct  16    LVLGVVASAPYGNLPIIPFDEGYTKLFGDDNLMILRDGKSVHLSLDERTGSGFVSQDLYQ  75

Query  893   HGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNG  714
             HGFFSA IKLP+DYTAG+VVAFY +N D+F K HDE+DFEFLGN++GK WR QTN+YGNG
Sbjct  76    HGFFSASIKLPADYTAGVVVAFYMSNGDMFPKHHDEIDFEFLGNIRGKEWRVQTNIYGNG  135

Query  713   STSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMG  534
             ST+ GREERY LWFDPS ++H+YSILWT+  IIFY+D+VPIRE  + E+MGGDFP KPM 
Sbjct  136   STNTGREERYNLWFDPSDDYHQYSILWTDSQIIFYVDNVPIREFKKTESMGGDFPAKPMS  195

Query  533   LYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR  354
             LYATIWD SDWAT+GG+Y+VNYKY+P++A F+DLVL GCA DP++++  +      C++ 
Sbjct  196   LYATIWDGSDWATNGGKYRVNYKYSPYLAEFSDLVLHGCAVDPIEQLSKK------CENT  249

Query  353   RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             +  E      VT  QR  M+  R+KHM YSYCYD +RY  PP ECVI   E ++ +
Sbjct  250   QNSESVP-TGVTRLQRTKMEGLRKKHMTYSYCYDRIRYKSPPSECVISPQEAERLR  304



>ref|XP_010271176.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Nelumbo nucifera]
Length=336

 Score =   362 bits (930),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 216/298 (72%), Gaps = 11/298 (4%)
 Frame = -1

Query  1067  AFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHG  888
             A +  +A   ++    FD+G++ L+GE N++      +V L L+  +G+GF S DLY HG
Sbjct  15    ALVLASATPKNLPVLSFDEGYSQLFGEDNLMLLRDGKTVHLSLDERTGAGFVSQDLYLHG  74

Query  887   FFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGST  708
             FFSA IKLP+DYTAG+VVAFY +N D+FE+ HDE+DFEFLGN++GK WR QTN+YGNGST
Sbjct  75    FFSASIKLPADYTAGVVVAFYMSNGDIFERNHDEIDFEFLGNIRGKEWRIQTNIYGNGST  134

Query  707   SRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLY  528
             + GREERY  WFDPS++FH+YSILWT   IIFY+D+ PIRE+ R + MGGDFP KPM LY
Sbjct  135   TVGREERYSFWFDPSEDFHQYSILWTENHIIFYVDETPIREIQRTKEMGGDFPSKPMSLY  194

Query  527   ATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD----  360
             ATIWD S+WAT+GGRYKVNYKYAP++A F+DLVL GCA DP+++          CD    
Sbjct  195   ATIWDGSNWATNGGRYKVNYKYAPYIAEFSDLVLHGCAVDPIEQ-------SPKCDQAVL  247

Query  359   DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             D         A +T KQR  M  FR+K+M YSYCYD +RY++PP ECVID+ E ++ +
Sbjct  248   DALFAGPLPVAGITSKQRVEMVNFRKKYMTYSYCYDRLRYSIPPSECVIDSREAERLR  305



>gb|ABM91072.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-39 [Populus 
tremula]
Length=336

 Score =   362 bits (928),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 171/313 (55%), Positives = 216/313 (69%), Gaps = 13/313 (4%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTT-----PFDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             + +  + + L++  +   +  T      FD+G+T L+G+ N+       +V L L+  +G
Sbjct  8     TCSLLICSLLAFLVSGSQIQKTFLPVISFDEGYTQLFGDDNLAIHRDGKTVHLSLDERTG  67

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             SGF S DLY HG+FSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK W
Sbjct  68    SGFVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDIFEKNHDEIDFEFLGNIRGKDW  127

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             R QTN+YGNGSTS GREERY LWFDPS++FH+YSILWT+  I FY+D+VPIRE  R E+M
Sbjct  128   RIQTNIYGNGSTSVGREERYSLWFDPSEDFHQYSILWTDSQITFYVDNVPIREFKRTESM  187

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             GGDFP KPM LYATIWD S WAT+GG+Y+VNYKYAP+V  F+DLVL GCA DP+++    
Sbjct  188   GGDFPSKPMSLYATIWDGSGWATNGGKYRVNYKYAPYVTEFSDLVLHGCAVDPIEQ----  243

Query  383   HPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAA  204
                   CD+    E      VT  QR  M+ FR K M YSYCYD VRY VPP ECVI+  
Sbjct  244   ---FPKCDNTESSEAIP-TGVTTVQRIKMESFRAKFMTYSYCYDRVRYKVPPSECVINPK  299

Query  203   ERQQFKETGRLKF  165
             E  + K    + F
Sbjct  300   EADRLKSFDPVTF  312



>ref|XP_008795338.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Phoenix dactylifera]
Length=337

 Score =   360 bits (925),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/308 (55%), Positives = 217/308 (70%), Gaps = 8/308 (3%)
 Frame = -1

Query  1100  YLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGS  921
             +   +S  FL +  + T+     +T  F++G+T  +G+SN++      +V + L+  +G+
Sbjct  11    FFFIASPLFLFSSSATTSVIESSSTVSFEEGYTQTFGDSNLMLLRHGKTVHIALDERTGA  70

Query  920   GFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWR  741
             GF S DLY HGFFSA IKLPSDY AG+VVAFY +N DVFEKTHDELDFEFLGN++G+ WR
Sbjct  71    GFASQDLYLHGFFSASIKLPSDYAAGVVVAFYMSNGDVFEKTHDELDFEFLGNIRGREWR  130

Query  740   FQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMG  561
              QTN+YGNGST+ GREERY LWFDP+ +FH+YSILW++  IIFYID VPIRE++R E+MG
Sbjct  131   VQTNVYGNGSTAIGREERYDLWFDPTDDFHQYSILWSHDRIIFYIDSVPIREIVRTESMG  190

Query  560   GDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEH  381
             G FP KPM LYATIWD S+WATSGGRYKVNY+YAP++A F DL+L GCA +P+       
Sbjct  191   GQFPSKPMSLYATIWDGSNWATSGGRYKVNYRYAPYIAEFADLILNGCAVNPMDH-----  245

Query  380   PGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAE  201
                  C+ R      D A ++ +QR  M+ FR+KH+ Y YCYD  RY  PPPEC ID   
Sbjct  246   --SSACEGRAAAR-YDSATMSSEQRAQMESFRRKHVTYFYCYDRNRYPNPPPECNIDREA  302

Query  200   RQQFKETG  177
             R+ +   G
Sbjct  303   RRSYGADG  310



>emb|CDP05491.1| unnamed protein product [Coffea canephora]
Length=366

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 217/304 (71%), Gaps = 9/304 (3%)
 Frame = -1

Query  1094  LHSSAFFLIAFLSYTA-AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
              H   F L  F+     A+ ++    FD+G++ L+G+ N++      SV L L+  +GSG
Sbjct  4     FHLGFFALTTFIVLVCGASKNLPILSFDEGYSQLFGDDNLMVIKDGKSVHLTLDERTGSG  63

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S D+YS GFFSA IKLP+DYTAG+VVAFY +N ++F+K HDE+DFEFLGN++GK WR 
Sbjct  64    FVSQDIYSQGFFSASIKLPADYTAGVVVAFYMSNGEMFQKNHDEVDFEFLGNIRGKDWRM  123

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST+ GREERY LWFDPS++FH+YSILWT   IIFY+D+VPIRE  R   MGG
Sbjct  124   QTNIYGNGSTNAGREERYGLWFDPSEDFHQYSILWTEDQIIFYVDNVPIREFERTATMGG  183

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWD SDWAT+GG++++NYKYAP++A F+DLVL GCA DP ++      
Sbjct  184   DFPSKPMSLYATIWDGSDWATNGGKFRINYKYAPYIAKFSDLVLHGCAVDPTEQAT----  239

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 CD   + +      +TP+QR  M+ FR+KHM YSYCYD  RY VPP ECV+DA E 
Sbjct  240   ---KCDIAPKHDSIP-TGITPEQRIRMQSFRKKHMQYSYCYDRARYTVPPAECVLDAEEA  295

Query  197   QQFK  186
             +  +
Sbjct  296   EGLR  299



>ref|XP_004980998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Setaria italica]
Length=358

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 225/325 (69%), Gaps = 13/325 (4%)
 Frame = -1

Query  1109  VPPYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHL  930
             VP  LL ++   +I  ++  AA  DV T  FD+GFT L+GE+N+ RS  D +VRL LN  
Sbjct  10    VPVALLVAALTMMI--MARPAAGSDVPTIAFDEGFTPLFGEANMERSPDDRTVRLTLNRY  67

Query  929   SGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGK  750
             SGSGF SS  Y HGFFSA I+LP D+TAG+VVAFY +N DVFEK HDELDFEFLGN +  
Sbjct  68    SGSGFISSHYYHHGFFSAAIRLPKDHTAGVVVAFYLSNGDVFEKNHDELDFEFLGNRRRH  127

Query  749   PWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNE  570
              WR QTN+YGNGST RGREERYL+ FDP+ E HR+SILW+++ +IFY+D V +RE+ R+ 
Sbjct  128   EWRLQTNVYGNGSTDRGREERYLMPFDPTAEAHRFSILWSSRVVIFYVDGVAVREVPRSG  187

Query  569   AMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPL---Q  399
             AMGGD+P KPM LYATIWD S WAT  GRYKVNYK  PF A F+DLVLRGC A  +   +
Sbjct  188   AMGGDYPSKPMALYATIWDGSTWATDNGRYKVNYKRGPFTAEFSDLVLRGCPAAAVMRHE  247

Query  398   EVVGEHPGVGGCDDRR--------ELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVR  243
             +       +G   + R        EL  AD+A VTP++R  M+R+RQ+ M Y+ CYD+ R
Sbjct  248   DTAALQLQLGAAAENRDRCAGAEFELMTADYAIVTPRKRMEMRRWRQRQMLYTVCYDTNR  307

Query  242   YAVPPPECVIDAAERQQFKETGRLK  168
             Y  P PEC ++ AER +F E G  K
Sbjct  308   YPAPFPECDVNMAERLKFWEWGESK  332



>ref|XP_009621345.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Nicotiana tomentosiformis]
Length=330

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/299 (56%), Positives = 215/299 (72%), Gaps = 9/299 (3%)
 Frame = -1

Query  1079  FFLIAFLSYTA-AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSD  903
             F L +FL     ++  + T PFD+G++ L+G  N++      SV L L+  +G+GF S D
Sbjct  9     FILCSFLVLVCGSSKQLQTLPFDEGYSQLFGHDNLMVLEDGKSVHLSLDERTGAGFVSQD  68

Query  902   LYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMY  723
             LY HG+FSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++ K WR QTN+Y
Sbjct  69    LYLHGYFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRAKKWRIQTNIY  128

Query  722   GNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQK  543
             GNGST+ GREERY LWFDPS++FH+YSILWT   IIFY+D++PIRE+ R +AMGGDFP K
Sbjct  129   GNGSTNVGREERYGLWFDPSEDFHQYSILWTESQIIFYVDNIPIREIKRTKAMGGDFPSK  188

Query  542   PMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGC  363
             PM LYATIWD S WAT+GG+YKVNYKYAP+VA F+D +L GCA DP++        +   
Sbjct  189   PMSLYATIWDGSSWATNGGKYKVNYKYAPYVAKFSDFILHGCAVDPIE--------LSPK  240

Query  362   DDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
              D      +   +++P QRR M+ FR+K++ YSYCYD  RY VP  ECVID  E  + +
Sbjct  241   CDTTPNSASIPTSISPDQRRKMESFRKKYLQYSYCYDRTRYNVPLSECVIDPKEADRLR  299



>gb|KFK33417.1| hypothetical protein AALP_AA5G010000 [Arabis alpina]
Length=333

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 214/304 (70%), Gaps = 10/304 (3%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             S     ++  S   + F +   P   F++G+T L+G+ N++      SVRL L+  +GSG
Sbjct  5     SGFLVFMSLFSCLVSGFSLQNLPITSFEEGYTQLFGDKNLIVHKDGKSVRLTLDERTGSG  64

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S+DLY HGFFSA IKLPSDY+AG+VVAFY +N D++EK HDE+DFEFLGN++GK WR 
Sbjct  65    FASNDLYLHGFFSASIKLPSDYSAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRI  124

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST  GREERY LWFDP+ +FH+YSILW+   IIFY+D+VPIRE+ R  +MGG
Sbjct  125   QTNIYGNGSTHLGREERYNLWFDPTDDFHQYSILWSASHIIFYVDNVPIREVKRTASMGG  184

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LY TIWD S WAT+GG+Y VNYKYAP++A F+DLVL GCA DP+++      
Sbjct  185   DFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCAVDPIEQFP----  240

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 CD+    +      +TP QR  M  FR+KHM YSYCYD  RY V  PECV++ AE 
Sbjct  241   ---KCDEGAAEDIRSMQEITPSQRGKMDIFRRKHMTYSYCYDRTRYNVALPECVVNPAEA  297

Query  197   QQFK  186
             ++ +
Sbjct  298   RRLR  301



>ref|XP_010553506.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Tarenaya hassleriana]
Length=331

 Score =   359 bits (921),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 174/308 (56%), Positives = 222/308 (72%), Gaps = 14/308 (5%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLS  927
             LL S   F++ F     + F + T P   F++G++ L+G+ N+       SVRL L+  +
Sbjct  3     LLGSVLVFMVLFAG-LVSGFALETLPVISFEEGYSHLFGDQNLAVRKDGKSVRLSLDERT  61

Query  926   GSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKP  747
             GSGF S+DLY HGFFSAKIKLP+DYTAG+VVAFY +N D++EK HDE+DFEFLGN++GK 
Sbjct  62    GSGFVSNDLYLHGFFSAKIKLPADYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKE  121

Query  746   WRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEA  567
             WR QTN+YGNGST  GREER  LWFDP+++FH+YSILW++  IIFYID+VPIRE+ R  +
Sbjct  122   WRIQTNIYGNGSTHLGREERCYLWFDPTEDFHQYSILWSDSHIIFYIDNVPIREVKRTAS  181

Query  566   MGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVG  387
             MGGDFP KPM LY+TIWD S WAT+GG+Y VNYKYAPFVA F+D VL GCA DP+++   
Sbjct  182   MGGDFPSKPMSLYSTIWDGSKWATNGGKYGVNYKYAPFVARFSDFVLHGCAVDPIEQ---  238

Query  386   EHPGVGGCD-DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVID  210
                 +  CD    EL  A  A +T  QR  M+ FR+KHM YSYCYD  RY V  PECV++
Sbjct  239   ----LPKCDFSGEELRRA--AELTSSQRITMEDFRRKHMTYSYCYDQTRYKVVLPECVLN  292

Query  209   AAERQQFK  186
              AE ++ +
Sbjct  293   PAEAKRLR  300



>ref|XP_009405165.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=340

 Score =   359 bits (922),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 213/294 (72%), Gaps = 17/294 (6%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++TT  F++G+T L+G+SN++      +V L L+  +G+GF S  LY HGFFSA IKLP+
Sbjct  40    NLTTLSFEEGYTQLFGDSNLILHLDGRTVHLSLDQRTGAGFASQGLYLHGFFSASIKLPA  99

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY AG+VVAFY +N DVFEKTHDELDFEFLGN++G+ WR QTN+YGNGST+ GREERY L
Sbjct  100   DYAAGVVVAFYMSNGDVFEKTHDELDFEFLGNIRGREWRVQTNVYGNGSTAVGREERYGL  159

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP++++H+YSILW+N+ IIFYID+ PIRE++R + MGGDFP KPM LYATIWD S WA
Sbjct  160   WFDPTEDYHQYSILWSNERIIFYIDNTPIREVVRTQTMGGDFPSKPMSLYATIWDGSTWA  219

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGA----DF  330
             TSGGRYKVNYK+AP+VA FTDLVL GC  DP               +R  LE      + 
Sbjct  220   TSGGRYKVNYKFAPYVAEFTDLVLHGCVVDPSNH------------NRTCLESNAGVYNA  267

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
               ++  QR AM+RFR+KHM YSYC+D +RY  P PEC +   E + F  TG  +
Sbjct  268   MMISTDQRAAMERFRKKHMTYSYCHDRIRYLTPSPECSL-GPETKSFLITGEAR  320



>ref|XP_010539209.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 29 [Tarenaya hassleriana]
Length=327

 Score =   358 bits (920),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 172/282 (61%), Positives = 212/282 (75%), Gaps = 7/282 (2%)
 Frame = -1

Query  1076  FLIAFLSYTAAAFD-VTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
              +I F      AF+ +    FD+G + L+G+ N++RS  D SVRL L+  +GSGF SSD+
Sbjct  13    LVIGFCVEGVTAFENMNPIFFDEGLSHLFGDGNLIRSPDDRSVRLLLDKYTGSGFISSDM  72

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y HGFFS+ IKLP  YTAGIVVAFYT+N DVF K HDELD EFLGN++GKPWRFQTNMYG
Sbjct  73    YQHGFFSSLIKLPGAYTAGIVVAFYTSNGDVFVKNHDELDIEFLGNIQGKPWRFQTNMYG  132

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGST+RGREERY LWFDPSKEFHRYSILW  + IIF++DDVPIRE+IR E MGGD+PQKP
Sbjct  133   NGSTNRGREERYRLWFDPSKEFHRYSILWNPRKIIFWVDDVPIREIIRKEEMGGDYPQKP  192

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEHPGVGGC  363
             M LYATIWDAS WAT+GG++ V+Y ++PFV+ F D+VL GC  +DP       +      
Sbjct  193   MSLYATIWDASSWATNGGKFSVDYSFSPFVSEFKDVVLDGCHVSDP-----NRNSSNCSL  247

Query  362   DDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYA  237
              +   L  +D+A +T +QR  M+RFR++ MYYSYCYDSVRYA
Sbjct  248   SEDAFLLTSDYARITSRQRAEMRRFRERFMYYSYCYDSVRYA  289



>ref|XP_004142294.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cucumis sativus]
 gb|KGN49677.1| hypothetical protein Csa_5G057140 [Cucumis sativus]
Length=331

 Score =   359 bits (921),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 160/278 (58%), Positives = 210/278 (76%), Gaps = 6/278 (2%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             F + +  L+G++N+L      SV LHL+  +G+GF S DLY HGFFSA IKLP+DYTAG+
Sbjct  32    FHEAYNHLFGDANLLLLNHGKSVHLHLDERTGAGFLSQDLYLHGFFSASIKLPADYTAGV  91

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N D+FE  HDE+DFEFLGN++GK WR QTN+YGNGST+ GREERY LWFDP++
Sbjct  92    VVAFYMSNGDMFENNHDEIDFEFLGNIRGKEWRVQTNIYGNGSTNVGREERYGLWFDPAE  151

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             +FH+YSILWT+  IIFY+D+VPIRE+ R  +MGG+FP KPM LYATIWD S WAT+GG+Y
Sbjct  152   DFHQYSILWTDSRIIFYVDEVPIREVKRTASMGGEFPSKPMTLYATIWDGSSWATNGGKY  211

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             KVNYKYAP++A F++ VL GC  DP+++V  +      CD  +  E +   N+T  +R  
Sbjct  212   KVNYKYAPYIAEFSEFVLHGCTVDPIEQVFPK------CDLTQISEASIPNNITTAKRTK  265

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             M+ FR+KHM YSYCYD +RY +PP ECV+D  E ++ +
Sbjct  266   MESFRRKHMTYSYCYDHLRYKIPPAECVLDPQEAKRLQ  303



>ref|XP_002311545.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa]
 gb|EEE88912.1| xyloglucan endotransglycosylase family protein [Populus trichocarpa]
Length=336

 Score =   359 bits (921),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 218/321 (68%), Gaps = 15/321 (5%)
 Frame = -1

Query  1118  SMAVPPYLLHSSAFFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVR  948
             S   P  LL  S   L+AFL  + +    T  P   FD+G+T L+G+ N+       +V 
Sbjct  4     SYLCPCSLLICS---LLAFL-VSGSQIQKTLLPVISFDEGYTQLFGDDNLAIHRDGKTVH  59

Query  947   LHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFL  768
             L L+  +GSGF S DLY HG+FSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFL
Sbjct  60    LSLDERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDIFEKNHDEIDFEFL  119

Query  767   GNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIR  588
             GN++GK WR QTN+YGNGSTS GREERY LWFDPS +FH+YSILWT+  I FY+D+VPIR
Sbjct  120   GNIRGKDWRIQTNIYGNGSTSVGREERYSLWFDPSDDFHQYSILWTDSQITFYVDNVPIR  179

Query  587   EMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAAD  408
             E  R E+MGGDFP KPM LYATIWD S WAT+GG+Y+VNYKYAP+V  F+DLVL GCA D
Sbjct  180   EFKRTESMGGDFPSKPMSLYATIWDGSGWATNGGKYRVNYKYAPYVTEFSDLVLHGCAVD  239

Query  407   PLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPP  228
             P+++          CD+    E      VT  QR  M+ FR K M YSYCYD VRY VPP
Sbjct  240   PIEQ-------FPKCDNSESSEVIP-TGVTTVQRIKMESFRAKFMTYSYCYDRVRYKVPP  291

Query  227   PECVIDAAERQQFKETGRLKF  165
              ECV +  E  + K    + F
Sbjct  292   SECVFNPKEADRLKSFDPVTF  312



>ref|XP_011024575.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Populus euphratica]
Length=336

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 214/311 (69%), Gaps = 10/311 (3%)
 Frame = -1

Query  1097  LLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             L+ S   FL++      A   V +  FD+G+T L+G+ N+       +V L L+  +GSG
Sbjct  12    LICSLLAFLVSGSPIQRALLPVIS--FDEGYTQLFGDDNLAIHRDGKTVHLSLDERTGSG  69

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S DLY HG+FSA IKLP+DYTAG+VVAFY +N D+FE  HDE+DFEFLGN++GK WR 
Sbjct  70    FASQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDIFETNHDEIDFEFLGNIRGKDWRI  129

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGSTS GREERY LWFDPS +FH+YSILWT+  I FY+D+VPIRE  R E+MGG
Sbjct  130   QTNIYGNGSTSVGREERYSLWFDPSDDFHQYSILWTDSQITFYVDNVPIREFKRTESMGG  189

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWD S WAT+GG+Y+VNYKYAP+V  F+DLVL GCA DP+++      
Sbjct  190   DFPSKPMSLYATIWDGSGWATNGGKYRVNYKYAPYVTEFSDLVLHGCAVDPIEQ------  243

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 CD+    E      VT  QR  M+ FR K M YSYCYD VRY VPP ECVI+  E 
Sbjct  244   -FPKCDNTESSEAIP-TGVTTVQRIKMESFRAKFMTYSYCYDRVRYKVPPSECVINPKEA  301

Query  197   QQFKETGRLKF  165
              + K    + F
Sbjct  302   DRLKSFDPVTF  312



>ref|XP_003570869.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Brachypodium distachyon]
Length=336

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/284 (60%), Positives = 213/284 (75%), Gaps = 4/284 (1%)
 Frame = -1

Query  1013  QGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVV  834
             +G+T L+G  NILRS  D +V L L+  +GSG  SS +Y HGFFSA IKLPSDYTAG++V
Sbjct  33    EGYTALFGFDNILRSADDRTVSLLLDRTTGSGLVSSSMYHHGFFSASIKLPSDYTAGVIV  92

Query  833   AFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEF  654
             AFYT+N +V+EKTHDELDFEFLGN++GKPWR QTN+YGNGS SRGREERY+L FDP+ EF
Sbjct  93    AFYTSNGEVYEKTHDELDFEFLGNIRGKPWRVQTNVYGNGSVSRGREERYVLPFDPTTEF  152

Query  653   HRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKV  474
             HRYSILWT   IIFY+DDVPIR + R+     DFP KPM LYATIWD S+WATSGGRY+V
Sbjct  153   HRYSILWTRDAIIFYVDDVPIRYIPRSSYTVDDFPSKPMSLYATIWDGSNWATSGGRYRV  212

Query  473   NYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDD-RRELEGADFANVTPKQRRAM  297
             +Y + PFVA FTDL L GC A P      +    G C +    L  +D A +T  +++AM
Sbjct  213   DYIHGPFVASFTDLALVGCRASPAARTPTDD---GYCTEAEAALAASDPAVMTLAKQQAM  269

Query  296   KRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
             +RFR+++M YSYCYD+ RY VP PEC +  +ER++FK++G L+ 
Sbjct  270   RRFREQNMVYSYCYDTRRYPVPFPECDLVESERRRFKQSGHLRL  313



>ref|XP_010066550.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Eucalyptus grandis]
 gb|KCW64460.1| hypothetical protein EUGRSUZ_G02075 [Eucalyptus grandis]
Length=335

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 221/323 (68%), Gaps = 10/323 (3%)
 Frame = -1

Query  1127  QTKSMAVPPYLLHSSAFFLI--AFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDS  954
              + S +V   L  +S   L+  A  S   +  ++    FD+G+  L+G+ N++      S
Sbjct  1     MSASWSVTSCLFFASCALLVVLAVGSPENSNSELPVVSFDEGYAHLFGDDNLVIHGDGKS  60

Query  953   VRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFE  774
             V L L+  +GSGF S DLY HGFFSA IKLP+DYTAG+VVAFY +N D+FEKTHDE+DFE
Sbjct  61    VHLTLDERTGSGFVSQDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKTHDEIDFE  120

Query  773   FLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVP  594
             FLGN++GK WR QTN+YGNGS   GREERY LWFDPS +FH+YSILWT+  I+FY+D+VP
Sbjct  121   FLGNIRGKEWRVQTNVYGNGSVGVGREERYNLWFDPSDDFHQYSILWTDSLIVFYVDNVP  180

Query  593   IREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCA  414
             IRE+ R +AMGGDFP KPM LYATIWD S WAT+GG+Y+V+YKYAP++  F+DLVL GCA
Sbjct  181   IREVKRTKAMGGDFPSKPMTLYATIWDGSSWATNGGKYRVSYKYAPYIVEFSDLVLHGCA  240

Query  413   ADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAV  234
              DP++           CD      G+    +T +QR  M+ FR++HM YSYCYD  RY +
Sbjct  241   VDPIER-------SSACDAVLP-SGSIPTAITREQRVQMESFRKRHMTYSYCYDRARYKI  292

Query  233   PPPECVIDAAERQQFKETGRLKF  165
             PPPEC++   E +  +    + F
Sbjct  293   PPPECILSVKEAKHLRSFDPVTF  315



>ref|XP_008466948.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Cucumis melo]
Length=333

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 215/306 (70%), Gaps = 10/306 (3%)
 Frame = -1

Query  1103  PYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             P+L  S   F    +S ++  F +    F++G+  L+G+ N++      SV LHL+  +G
Sbjct  7     PFLFASFLCFFSLLVSGSSRNFPILD--FEEGYNPLFGDDNLVLLKDGKSVHLHLDERTG  64

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             SGF S DLY HGFFSA IKLPSDYTAG+VVAFY +N D+F K HDE+DFEFLGN++GK W
Sbjct  65    SGFVSQDLYLHGFFSASIKLPSDYTAGVVVAFYMSNGDMFAKNHDEIDFEFLGNIRGKDW  124

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             R QTN+YGNGSTS GREERY LWFDPS++FH YSILWT   IIFY+D+VPIRE+ R   M
Sbjct  125   RIQTNIYGNGSTSIGREERYGLWFDPSEDFHEYSILWTESLIIFYVDNVPIREVKRTATM  184

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             GGDFP KPM LYATIWD S WAT+GG+YKVNYKYAP++A F++ +L GCA DP ++    
Sbjct  185   GGDFPSKPMTLYATIWDGSTWATNGGKYKVNYKYAPYIAEFSNFILHGCAVDPTEQ----  240

Query  383   HPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAA  204
                   CD  ++      + +TP QR  M+  R+KH+ YSYCYD +RY  PP ECVI+  
Sbjct  241   ---SSSCDHSQKSIPIP-SGMTPSQRAKMESLRKKHLTYSYCYDRIRYKTPPSECVINPD  296

Query  203   ERQQFK  186
             E ++ +
Sbjct  297   EAERLR  302



>ref|XP_004156140.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cucumis sativus]
 emb|CCH26641.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=331

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 209/278 (75%), Gaps = 6/278 (2%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             F + +  L+G++N+L      SV LHL+  +G+GF S DLY HGFFSA IKLP+DYTAG+
Sbjct  32    FHEAYNHLFGDANLLLLNHGKSVHLHLDERTGAGFLSQDLYLHGFFSASIKLPADYTAGV  91

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N D+FE  HDE+DFEFLGN++GK WR QTN+YGNGST+ GREERY LWFDP++
Sbjct  92    VVAFYMSNGDMFENNHDEIDFEFLGNIRGKEWRVQTNIYGNGSTNVGREERYGLWFDPAE  151

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             + H+YSILWT+  IIFY+D+VPIRE+ R  +MGG+FP KPM LYATIWD S WAT+GG+Y
Sbjct  152   DLHQYSILWTDSRIIFYVDEVPIREVKRTASMGGEFPSKPMTLYATIWDGSSWATNGGKY  211

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             KVNYKYAP++A F++ VL GC  DP+++V  +      CD  +  E +   N+T  +R  
Sbjct  212   KVNYKYAPYIAEFSEFVLHGCTVDPIEQVFPK------CDLTQISEASIPNNITTAKRTK  265

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             M+ FR+KHM YSYCYD +RY +PP ECV+D  E ++ +
Sbjct  266   MESFRRKHMTYSYCYDHLRYKIPPAECVLDPQEAKRLQ  303



>ref|XP_009117879.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Brassica rapa]
Length=328

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 219/302 (73%), Gaps = 13/302 (4%)
 Frame = -1

Query  1073  LIAFLSY---TAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFR  912
              +AF+S      + F +   P   FD+G+T L+G+ N++      SVRL L+  +GSGF 
Sbjct  7     FLAFMSLFTSLVSGFALQKLPLIQFDEGYTHLFGDQNLIVHRDGKSVRLILDERTGSGFV  66

Query  911   SSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQT  732
             S+D+Y HGFFS+ IKLP+DY+AG+V+AFY +N D++EK HDE+DFEFLGN++GK WR QT
Sbjct  67    SNDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDIYEKNHDEIDFEFLGNIRGKEWRIQT  126

Query  731   NMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDF  552
             N+YGNGST  GREERY LWFDP+++FH+YSI+W++  IIFY+D++PIRE+ R  +MGGDF
Sbjct  127   NIYGNGSTHLGREERYNLWFDPTEDFHQYSIMWSHSHIIFYVDNIPIREVKRTASMGGDF  186

Query  551   PQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGV  372
             P KPM LYATIWD S WAT+GG+Y VNYK+AP+VA FTD++L GCA DP+++V+      
Sbjct  187   PAKPMSLYATIWDGSKWATNGGKYGVNYKFAPYVAQFTDMILHGCAVDPIEKVL------  240

Query  371   GGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQ  192
               C D  E +    + +T  QR+ M   R+KHM YSYCYD  RY V  PECV++  E ++
Sbjct  241   -SCQDGAEEDLRLASEITDSQRKKMDSLRRKHMTYSYCYDRTRYKVALPECVVNTEEAKR  299

Query  191   FK  186
              +
Sbjct  300   LR  301



>ref|XP_004162296.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cucumis sativus]
 emb|CCH26638.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]
Length=333

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 214/306 (70%), Gaps = 10/306 (3%)
 Frame = -1

Query  1103  PYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             P+L  S   F    +S ++  F +    F++G+  L+G+ N++      SV LHL+  +G
Sbjct  7     PFLFASFLCFFSLLVSGSSRNFPILD--FEEGYNPLFGDDNLVLLKDGKSVHLHLDERTG  64

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             SGF S DLY HGFFSA IKLPSDYTAG+VVAFY +N D+F K HDE+DFEFLGN++GK W
Sbjct  65    SGFVSQDLYLHGFFSASIKLPSDYTAGVVVAFYMSNGDMFAKNHDEIDFEFLGNIRGKDW  124

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             R QTN+YGNGSTS GREERY LWFDPS++FH YSILWT   IIFY+D+VPIRE+ R   M
Sbjct  125   RIQTNIYGNGSTSIGREERYGLWFDPSEDFHEYSILWTESLIIFYVDNVPIREVKRTATM  184

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             GGDFP KPM LYATIWD S WAT+GG+YKVNYKYAP++A F+D +L GC  DP ++    
Sbjct  185   GGDFPSKPMTLYATIWDGSTWATNGGKYKVNYKYAPYIAEFSDFILHGCTVDPTEQ----  240

Query  383   HPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAA  204
                   CD  ++      + +TP QR  M+  R+KH+ YSYCYD +RY  PP ECVI+  
Sbjct  241   ---SSSCDHSQKSIPIP-SGMTPSQRAKMESLRKKHLTYSYCYDRIRYKTPPSECVINPD  296

Query  203   ERQQFK  186
             E ++ +
Sbjct  297   EAERLR  302



>ref|XP_009777519.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Nicotiana sylvestris]
Length=330

 Score =   357 bits (916),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/299 (56%), Positives = 216/299 (72%), Gaps = 9/299 (3%)
 Frame = -1

Query  1079  FFLIAFLSY-TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSD  903
             F L +FL   + ++  + T PFD+G++ L+G  N++      SV + L+  +G+GF S D
Sbjct  9     FILCSFLVLVSGSSKKLQTLPFDEGYSQLFGHDNLMVLEDGKSVHISLDERTGAGFVSQD  68

Query  902   LYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMY  723
             LY HG+FSA IKLP+DYTAG+VVAFY +N D+FEK+HDE+DFEFLGN++ K WR QTN+Y
Sbjct  69    LYLHGYFSASIKLPADYTAGVVVAFYMSNGDMFEKSHDEIDFEFLGNIRAKNWRIQTNIY  128

Query  722   GNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQK  543
             GNGST+ GREERY LWFDPS++FH+Y+ILWT   IIFY+D++PIRE+ R +AMGGDFP K
Sbjct  129   GNGSTNVGREERYGLWFDPSEDFHQYTILWTESQIIFYVDNIPIREIKRTKAMGGDFPSK  188

Query  542   PMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGC  363
             PM LYATIWD S WAT+GG+YKVNYKYAP+VA F+D VL GCA DP++           C
Sbjct  189   PMSLYATIWDGSSWATNGGKYKVNYKYAPYVAKFSDFVLHGCAVDPIEL-------SPKC  241

Query  362   DDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             D   +        ++P QRR M+ FR+K++ YSYCYD  RY VP  ECVID  E  + +
Sbjct  242   DTAPKSAFVP-TGISPDQRRKMESFRKKYLQYSYCYDRTRYNVPLSECVIDPKEADRLQ  299



>ref|XP_002875095.1| endoxyloglucan transferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51354.1| endoxyloglucan transferase [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score =   357 bits (915),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 211/287 (74%), Gaps = 7/287 (2%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             A  ++  T F++G+T L+G+ N+       SVRL L+  +GSGF S+DLY HGFFSA IK
Sbjct  22    ALQNLPITSFEEGYTQLFGDKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGFFSASIK  81

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LPSDY+AG+VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+YGNGST  GREER
Sbjct  82    LPSDYSAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREER  141

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDP+++FH+YSILW++  IIF++D+VPIRE+ R  +MGGDFP KPM LY TIWD S
Sbjct  142   YNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTASMGGDFPSKPMSLYTTIWDGS  201

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFA  327
              WAT+GG+Y VNYKYAP++A F+DLVL GC  DP+++          CD+   ++     
Sbjct  202   KWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQ-------FPRCDEGAAVDIRAAQ  254

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
              +TP QR+ M  FR+KHM YSYCYD  RY V   ECV++ AE Q+ +
Sbjct  255   EITPSQRKKMDVFRRKHMTYSYCYDRTRYKVALSECVVNPAEAQRLR  301



>ref|XP_010906322.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Elaeis guineensis]
Length=336

 Score =   357 bits (915),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 220/316 (70%), Gaps = 19/316 (6%)
 Frame = -1

Query  1103  PYLLHSSAFFLIA---FLSYTAAAFDV----TTTPFDQGFTTLYGESNILRSTSDDSVRL  945
             P++L    FF IA   FL  ++AA  V    +T  F++G+T  +G+ N++      +V +
Sbjct  6     PFVL----FFFIASPLFLFSSSAAISVIESSSTVSFEEGYTQTFGDGNLMLLRHGKTVHI  61

Query  944   HLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLG  765
              L+  +G+GF S DLY HGFFSA IKLPSDY AG+VVAFY +N DVFEKTHDELDFEFLG
Sbjct  62    ALDERTGAGFASQDLYLHGFFSASIKLPSDYAAGVVVAFYMSNGDVFEKTHDELDFEFLG  121

Query  764   NVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIRE  585
             N++G+ WR QTN+YGNGST+ GREERY LWFDP+++FH+YSILW++  IIFYID++PIRE
Sbjct  122   NIRGREWRVQTNVYGNGSTAIGREERYDLWFDPTEDFHQYSILWSHDRIIFYIDNIPIRE  181

Query  584   MIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADP  405
             ++R E+MGG FP KPM LYATIWD S+WATSGGRYKVNYKYAP++A F DL+L GC  +P
Sbjct  182   IVRTESMGGQFPSKPMSLYATIWDGSNWATSGGRYKVNYKYAPYIAEFADLILNGCTVNP  241

Query  404   LQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPP  225
             +           G D  R     D   ++  +R  M+ FR+KHM Y YCYD  RY  PP 
Sbjct  242   MD----HSSACEGSDSAR----YDSVTMSSDRRAQMESFRKKHMTYFYCYDRNRYTNPPS  293

Query  224   ECVIDAAERQQFKETG  177
             EC ID   R+ +   G
Sbjct  294   ECNIDREARRSYGADG  309



>ref|XP_006395846.1| hypothetical protein EUTSA_v10004560mg [Eutrema salsugineum]
 gb|ESQ33132.1| hypothetical protein EUTSA_v10004560mg [Eutrema salsugineum]
Length=333

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/304 (54%), Positives = 215/304 (71%), Gaps = 10/304 (3%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             S    +++  S   + F +   P   F++ +T L+G+ N+L      SVRL L+  +GSG
Sbjct  5     SRFLVIMSLFSGLVSGFSLQNLPITSFEESYTQLFGDKNLLVHKDGKSVRLTLDERTGSG  64

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S+DLY HGFFSA IKLPSDY+AG+VVAFY +N D++EK HDE+DFEFLGN++GK WR 
Sbjct  65    FASNDLYLHGFFSASIKLPSDYSAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKDWRI  124

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST  GREERY LWFDP+++FH+Y ILW++  IIFY+D+VPIRE+ R E+MGG
Sbjct  125   QTNIYGNGSTHSGREERYHLWFDPTEDFHQYGILWSDSHIIFYVDNVPIREVKRTESMGG  184

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LY TIWD S WAT+GG+Y VNYKYAP++A F+DLVL GCA DP+++      
Sbjct  185   DFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCAVDPIEQFP----  240

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 CD+    +      +TP QR  M  FR+K M YSYCYD  RY V  PECV++ AE 
Sbjct  241   ---KCDEGAAEDIRAAQEITPSQRVKMGIFRRKLMTYSYCYDRTRYKVALPECVVNPAEA  297

Query  197   QQFK  186
             ++ +
Sbjct  298   RRLR  301



>gb|ABK92940.1| unknown [Populus trichocarpa]
Length=336

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 217/321 (68%), Gaps = 15/321 (5%)
 Frame = -1

Query  1118  SMAVPPYLLHSSAFFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVR  948
             S   P  LL  S   L+AFL  + +    T  P   FD+G+T L+G+ N+       +V 
Sbjct  4     SYLCPCSLLICS---LLAFL-VSGSQIQRTLLPVISFDEGYTQLFGDDNLAIHRDGKTVH  59

Query  947   LHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFL  768
             L L+  +GSGF S DLY HG+FSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFL
Sbjct  60    LSLDERTGSGFVSQDLYLHGYFSASIKLPADYTAGVVVAFYMSNGDIFEKNHDEIDFEFL  119

Query  767   GNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIR  588
             GN++GK WR QTN+YGNGSTS GREERY LWFDPS +FH+YSILWT+  I FY+D+VPIR
Sbjct  120   GNIRGKDWRIQTNIYGNGSTSVGREERYSLWFDPSDDFHQYSILWTDSQITFYVDNVPIR  179

Query  587   EMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAAD  408
             E  R E+MGGDFP KPM LYATIWD S WAT+GG+Y+VNYKYAP+V  F+DLVL GCA D
Sbjct  180   EFKRTESMGGDFPSKPMSLYATIWDGSGWATNGGKYRVNYKYAPYVTEFSDLVLHGCAVD  239

Query  407   PLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPP  228
             P+++          CD+    E      VT  QR  M+ FR K M YSYCYD VRY VPP
Sbjct  240   PIEQ-------FPKCDNSESSEVIP-TGVTTVQRIKMESFRAKFMTYSYCYDRVRYKVPP  291

Query  227   PECVIDAAERQQFKETGRLKF  165
              ECV +     + K    + F
Sbjct  292   SECVFNPKVADRLKSFDPVTF  312



>gb|EYU43720.1| hypothetical protein MIMGU_mgv1a0191281mg, partial [Erythranthe 
guttata]
Length=280

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 201/253 (79%), Gaps = 6/253 (2%)
 Frame = -1

Query  923  SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
            SG  SSD Y++GFFSA IK+PS++TAGIVVAFYT+N D FE+ HDELD EFLGN KGKPW
Sbjct  1    SGIISSDYYNYGFFSASIKMPSEHTAGIVVAFYTSNVDTFERNHDELDIEFLGNTKGKPW  60

Query  743  RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
            RFQTNMYGNGS SRGREERY +WFDP+ + HRYSILWT + IIFY+D++PIRE+IRN+ M
Sbjct  61   RFQTNMYGNGSVSRGREERYRMWFDPTIDSHRYSILWTPRNIIFYVDEIPIREVIRNKEM  120

Query  563  GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             GD+P KPM +YATIWDAS WAT+GG+ KV+YKY PF+A FTDLVL GC  DP  +++  
Sbjct  121  KGDYPSKPMSVYATIWDASSWATNGGQEKVDYKYQPFIAEFTDLVLEGCIVDPTDQLLSS  180

Query  383  HPGVGGCDDR-RELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
            +     C D    L G +++ +T   R++MK FR+K+MYYSYCYD++RY +PPPEC+I  
Sbjct  181  N-----CTDSISALIGKEYSTITSDGRKSMKWFREKYMYYSYCYDNLRYPIPPPECIILP  235

Query  206  AERQQFKETGRLK  168
            +ER  FK++GRL+
Sbjct  236  SERDLFKDSGRLR  248



>ref|XP_004142816.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like [Cucumis sativus]
 gb|KGN51447.1| hypothetical protein Csa_5G548130 [Cucumis sativus]
Length=333

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/306 (55%), Positives = 213/306 (70%), Gaps = 10/306 (3%)
 Frame = -1

Query  1103  PYLLHSSAFFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             P+L  S   F    +S ++  F +    F++G+  L+G+ N++      SV LHL+  +G
Sbjct  7     PFLFASFLCFFSLLVSGSSRNFPILD--FEEGYNPLFGDDNLVLLKDGKSVHLHLDERTG  64

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             SGF S DLY HG FSA IKLPSDYTAG+VVAFY +N D+F K HDE+DFEFLGN++GK W
Sbjct  65    SGFVSQDLYLHGLFSASIKLPSDYTAGVVVAFYMSNGDMFAKNHDEIDFEFLGNIRGKDW  124

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             R QTN+YGNGSTS GREERY LWFDPS++FH YSILWT   IIFY+D+VPIRE+ R   M
Sbjct  125   RIQTNIYGNGSTSIGREERYGLWFDPSEDFHEYSILWTESLIIFYVDNVPIREVKRTATM  184

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             GGDFP KPM LYATIWD S WAT+GG+YKVNYKYAP++A F+D +L GC  DP ++    
Sbjct  185   GGDFPSKPMTLYATIWDGSTWATNGGKYKVNYKYAPYIAEFSDFILHGCTVDPTEQ----  240

Query  383   HPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAA  204
                   CD  ++      + +TP QR  M+  R+KH+ YSYCYD +RY  PP ECVI+  
Sbjct  241   ---SSSCDHSQKSIPIP-SGMTPSQRAKMESLRKKHLTYSYCYDRIRYKTPPSECVINPD  296

Query  203   ERQQFK  186
             E ++ +
Sbjct  297   EAERLR  302



>ref|XP_006305074.1| hypothetical protein CARUB_v10009442mg, partial [Capsella rubella]
 gb|EOA37972.1| hypothetical protein CARUB_v10009442mg, partial [Capsella rubella]
Length=381

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 215/301 (71%), Gaps = 10/301 (3%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             F  ++ L+   + F +   P   FD+G+T L+G+ N++      SVRL L+  +GSGF S
Sbjct  57    FVFMSLLAGLVSGFALQKLPLVQFDEGYTHLFGDQNLVVHRDGKSVRLTLDERTGSGFVS  116

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
             +D+Y HGFFS+ IKLP+DY+AG+V+AFY +N D++EK HDE+DFEFLGN++GK WR QTN
Sbjct  117   NDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGKEWRIQTN  176

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGST  GREERY LWFDP++EFH+YSILW+   IIFY+D+VPIRE+ R  +MGGDFP
Sbjct  177   IYGNGSTHLGREERYNLWFDPTEEFHQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFP  236

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LYATIWD S WAT GG+Y VNYKYAP+V HFTDL+L GCA DP ++         
Sbjct  237   AKPMSLYATIWDGSKWATDGGKYGVNYKYAPYVTHFTDLILHGCAVDPTEK-------FP  289

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              C D    +    + +T  QR  M+ FR+KHM YSYCYD +RY V   ECV++ AE ++ 
Sbjct  290   ACQDEAVEDLRLASEITVSQRNKMEIFRRKHMTYSYCYDHMRYKVVLSECVVNPAEAKRL  349

Query  188   K  186
             +
Sbjct  350   R  350



>ref|XP_010496847.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Camelina sativa]
Length=333

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 214/304 (70%), Gaps = 10/304 (3%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             S     ++  S   + F +   P   F++G+T L+G+ N+       SVRL L+  SGSG
Sbjct  5     SRFLVFMSLFSGLVSGFAIQNLPITSFEEGYTQLFGDKNLFVHKDGKSVRLTLDERSGSG  64

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S+DLY HGFFSA IKLPSDY+AG+VVAFY +N D++EK HDE+DFEFLGN++GK WR 
Sbjct  65    FASNDLYLHGFFSASIKLPSDYSAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRI  124

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST  GREERY LWFDP+++FH+YSILW++  IIF++D+VPIRE+ R  +MGG
Sbjct  125   QTNIYGNGSTHLGREERYNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTASMGG  184

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LY TIWD S WAT+GG+Y VNYKYAP++A F+DLVL GC  DP+++      
Sbjct  185   DFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQF--PRC  242

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
               G  +D R  +      +TP QR  M  FR+KHM YSYCYD  RY V   ECV++ AE 
Sbjct  243   DEGAAEDIRAAQ-----EITPSQRSKMDIFRRKHMTYSYCYDRTRYKVALSECVVNPAEA  297

Query  197   QQFK  186
             Q+ +
Sbjct  298   QRLR  301



>ref|XP_002892825.1| hypothetical protein ARALYDRAFT_471659 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69084.1| hypothetical protein ARALYDRAFT_471659 [Arabidopsis lyrata subsp. 
lyrata]
Length=325

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/300 (55%), Positives = 218/300 (73%), Gaps = 12/300 (4%)
 Frame = -1

Query  1073  LIAFLSYTAAAFDVTTTPF---DQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSD  903
              ++  +   + F +   PF   D+G+T L+G+ N++   +  SVRL L+  +GSGF S+D
Sbjct  10    FMSLFTGLVSGFALQKLPFIQFDEGYTHLFGDQNLIVHRNGKSVRLTLDERTGSGFVSND  69

Query  902   LYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMY  723
             +Y HGFFS+ IKLP+DY+AG+V+AFY +N D++EK HDE+DFEFLGN++GK WR QTN+Y
Sbjct  70    IYLHGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGKEWRIQTNIY  129

Query  722   GNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQK  543
             GNGST  GREERY LWFDP++EFH+YSILW+   IIFY+D+VPIRE+ R  +MGGDFP K
Sbjct  130   GNGSTHLGREERYNLWFDPTEEFHQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAK  189

Query  542   PMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGC  363
             PM LYATIWD S WAT GG+Y VNYKYAP+VA FTDL+L GCA DP ++          C
Sbjct  190   PMSLYATIWDGSKWATDGGKYGVNYKYAPYVAQFTDLILHGCAVDPTEK-------FPSC  242

Query  362   DDRRELEGADFAN-VTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             +D  E+E    A+ +T  QR  M+ FR+KHM YSYCYD +RY V   ECV++ AE ++ +
Sbjct  243   ED-EEVENLHLASEITESQRNKMEIFRRKHMTYSYCYDHMRYKVALSECVVNPAEAKRLR  301



>gb|AAK30204.1|AF349963_1 endoxyloglucan transferase [Daucus carota]
Length=330

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/288 (56%), Positives = 208/288 (72%), Gaps = 8/288 (3%)
 Frame = -1

Query  1049  AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKI  870
              ++ ++    F++G++ L+G+SN++      S  L L+  +GSGF S DLY HGFFSA I
Sbjct  20    GSSRNLPIVSFEEGYSQLFGDSNLMILQDGKSAHLSLDERTGSGFVSHDLYKHGFFSASI  79

Query  869   KLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREE  690
             KLP+DYTAG+VVAFY +N D+F K HDE+DFEFLGN++GK WR QTN+YGNGST  GREE
Sbjct  80    KLPADYTAGVVVAFYMSNVDMFAKNHDEIDFEFLGNIRGKEWRLQTNVYGNGSTGAGREE  139

Query  689   RYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDA  510
             RY LWFDPS +FH+YSILW+   IIFYID+VPIRE+ + EAMGGDFP KPM LYATIWD 
Sbjct  140   RYGLWFDPSDDFHQYSILWSKDRIIFYIDNVPIREVKKTEAMGGDFPSKPMSLYATIWDG  199

Query  509   SDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF  330
             S+WAT+GG+YKVNYKY+P++A F+D VL GCA DP++           CD   + +    
Sbjct  200   SNWATNGGKYKVNYKYSPYIAEFSDFVLHGCAVDPIEMST-------SCDTAPKSQSVP-  251

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
                T + R  M+  R+K+M YSYCYD+ RY VPP ECVID  E ++ +
Sbjct  252   TGTTKESRTKMQNLRKKYMQYSYCYDTTRYQVPPSECVIDPLESERLR  299



>emb|CDY33745.1| BnaA09g45510D [Brassica napus]
Length=328

 Score =   354 bits (909),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/304 (53%), Positives = 220/304 (72%), Gaps = 12/304 (4%)
 Frame = -1

Query  1082  AFFLIAFLSYTA--AAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             A FL+    +T   + F +   P   FD+G+T L+G+ N++ +    SVRL L+  +GSG
Sbjct  5     ARFLVFMSLFTGLVSGFALQKLPLIQFDEGYTHLFGDQNMIVNRDGKSVRLILDERTGSG  64

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S+D+Y HGFFS+ IKLP+DY+AG+V+AFY +N D++EK HDE+DFEFLGN++GK WR 
Sbjct  65    FVSNDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDIYEKNHDEIDFEFLGNIRGKEWRI  124

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST  GREERY LWFDP+++FH+YSI+W++  IIFY+D++PIRE+ R  +MGG
Sbjct  125   QTNIYGNGSTHLGREERYNLWFDPTEDFHQYSIMWSHSHIIFYVDNIPIREVKRTASMGG  184

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWD S WAT+GG+Y VNYK+AP+VA FTD++L GCA DP+++V+    
Sbjct  185   DFPAKPMSLYATIWDGSKWATNGGKYGVNYKFAPYVAQFTDMILHGCAVDPIEKVL----  240

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 C D    +    + +T  QR+ M   R+KHM YSYCYD  RY V  PECV++  E 
Sbjct  241   ---SCQDGAAEDLRLASEITESQRKKMDSLRRKHMTYSYCYDRTRYKVALPECVVNPEEA  297

Query  197   QQFK  186
             ++ +
Sbjct  298   KRLR  301



>ref|XP_008454733.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Cucumis melo]
Length=337

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 159/286 (56%), Positives = 214/286 (75%), Gaps = 7/286 (2%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++    F + +  L+G++N+L      SV L+L+  +G+GF S DLY HGFFSA IKLP+
Sbjct  31    NLPVLSFHEAYNHLFGDANLLLLNHGKSVHLYLDERTGAGFLSQDLYLHGFFSASIKLPA  90

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DYTAG+VVAFY +N D+FE  HDE+DFEFLGN++GK WR QTN+YGNGST+ GREERY L
Sbjct  91    DYTAGVVVAFYMSNGDMFENNHDEIDFEFLGNIRGKEWRVQTNIYGNGSTNVGREERYGL  150

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP+++FH+YSILWT+  IIFY+D+VPIRE+ R  +MGG+FP KPM LYATIWD S WA
Sbjct  151   WFDPAEDFHQYSILWTDSRIIFYVDEVPIREVKRTASMGGEFPSKPMTLYATIWDGSSWA  210

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRREL-EGADFANV  321
             T+GG+YKVNYKY+P++A F++ VL GC  DP+++V  +      CD   ++ E A   N+
Sbjct  211   TNGGKYKVNYKYSPYIAEFSEFVLHGCTVDPIEQVFRK------CDLTPQISEAAIPNNI  264

Query  320   TPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKE  183
             T  +R  M+ FR+KHM YSYCYD +RY +PP ECV+D  E ++ ++
Sbjct  265   TTAKRTKMESFRRKHMTYSYCYDHLRYKIPPAECVLDPQEAKRLRK  310



>ref|XP_006849428.1| hypothetical protein AMTR_s00024p00025540 [Amborella trichopoda]
 gb|ERN11009.1| hypothetical protein AMTR_s00024p00025540 [Amborella trichopoda]
Length=325

 Score =   354 bits (909),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/284 (58%), Positives = 207/284 (73%), Gaps = 8/284 (3%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G++ L+G  N++ S    + ++ L+  +G+GF S DL+ HGFFSA IKLP+DYTAG+
Sbjct  25    FDEGYSRLFGGDNLIVSKDGKTAQILLDKSTGAGFLSQDLFLHGFFSASIKLPADYTAGV  84

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N D+FEK HDELDFEFLGN++GK WR QTN+YGNGST+ GREER+ LWFDPS+
Sbjct  85    VVAFYMSNGDIFEKNHDELDFEFLGNIRGKEWRVQTNVYGNGSTNVGREERFDLWFDPSE  144

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             +FH YSILWT   I+FYID+VPIREM R E MG  +P KPM LYATIWD SDWATSGGR+
Sbjct  145   DFHAYSILWTEDQIVFYIDNVPIREMKR-EGMGTHYPSKPMSLYATIWDGSDWATSGGRF  203

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             KVNYKYAPFVA F+DLVL GC  DP+Q+       +  C+D           ++P+ R A
Sbjct  204   KVNYKYAPFVAQFSDLVLDGCTVDPIQQ-------LSSCEDHSRPFHLPMPEISPELRSA  256

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
             M++ R KHM YSYCYD  RY+ P PECVID    ++   +  +K
Sbjct  257   MRKIRTKHMAYSYCYDRERYSKPLPECVIDPRNSKRLAGSKAVK  300



>ref|XP_006291465.1| hypothetical protein CARUB_v10017602mg [Capsella rubella]
 gb|EOA24363.1| hypothetical protein CARUB_v10017602mg [Capsella rubella]
Length=333

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 209/287 (73%), Gaps = 7/287 (2%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             A  ++  T F++G+T L+G+ N+       SVRL L+  +GSGF S+DLY HGFFSA IK
Sbjct  22    ALQNLPVTSFEEGYTQLFGDKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGFFSASIK  81

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LPSDY+AG+VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+YGNGST  GREER
Sbjct  82    LPSDYSAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREER  141

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDP+++FH+YSILW++  IIF++D VPIRE+ R  +MGGDFP KPM LY TIWD S
Sbjct  142   YNLWFDPTEDFHQYSILWSDSHIIFFVDSVPIREVKRTASMGGDFPSKPMSLYTTIWDGS  201

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFA  327
              WAT+GG+Y VNYKYAP++A F+DLVL GC  DP+++          CD+    + +   
Sbjct  202   KWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQFP-------RCDEGAAEDISAAQ  254

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
              +TP QR  M  FR+KHM YSYCYD  RY V   ECV++ AE Q+ +
Sbjct  255   EITPTQRSKMDIFRRKHMTYSYCYDRTRYKVALSECVVNPAEAQRLR  301



>ref|XP_004297402.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform 2 [Fragaria vesca subsp. vesca]
Length=330

 Score =   354 bits (908),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 162/280 (58%), Positives = 211/280 (75%), Gaps = 11/280 (4%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G+  L+G+ N++      SV L L+  +GSGF S DLY HGFFSA IKLP+DYTAG+
Sbjct  27    FDEGYNKLFGDDNLMILKDGKSVHLTLDERTGSGFVSQDLYIHGFFSASIKLPTDYTAGV  86

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N+D+F K HDE+DFEFLGN++GK WR QTN+YGNGST  GREERY LWFDPS+
Sbjct  87    VVAFYMSNSDMFPKNHDEIDFEFLGNIRGKEWRVQTNVYGNGSTETGREERYNLWFDPSE  146

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             ++H+YSILWT+  IIFY+D++PIR + ++E+MGGD+P KPM LYATIWD S WAT GG+Y
Sbjct  147   DYHQYSILWTDSQIIFYVDNIPIRVVKKSESMGGDYPSKPMSLYATIWDGSGWATDGGKY  206

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF--ANVTPKQR  306
             +VNYKYAPF A F+DLVL GCA DP+++V  +      CD   + +G+++    VT  QR
Sbjct  207   RVNYKYAPFRAEFSDLVLHGCAVDPIEQVSKK------CD---KTQGSEYIPTGVTRLQR  257

Query  305   RAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
               M+ FR++ M YSYCYD +RY V PPECVI   E ++ +
Sbjct  258   MRMESFRKRQMTYSYCYDRIRYKVAPPECVITPQEAERLR  297



>emb|CDX81665.1| BnaC08g39360D [Brassica napus]
Length=328

 Score =   353 bits (907),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 161/304 (53%), Positives = 219/304 (72%), Gaps = 12/304 (4%)
 Frame = -1

Query  1082  AFFLIAFLSYTA--AAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             A FL+    +T   + F +   P   FD+G+T L+G+ N++ +    SVRL L+  +GSG
Sbjct  5     ARFLVFMSLFTGLVSGFALQKLPLIQFDEGYTHLFGDQNMIVNRDGKSVRLILDERTGSG  64

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S+D+Y HGFFS+ IKLP+DY+AG+V+AFY +N D++EK HDE+DFEFLGN++GK WR 
Sbjct  65    FVSNDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDIYEKNHDEIDFEFLGNIRGKEWRI  124

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST  GREERY LWFDP+++FH+YSI+W++  IIFY+D++PIRE+ R  +MGG
Sbjct  125   QTNIYGNGSTHLGREERYNLWFDPTEDFHQYSIMWSHSHIIFYVDNIPIREVKRTASMGG  184

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LYATIWD S WAT+GG+Y VNYK+AP+VA F DL+L GCA DP+++V+    
Sbjct  185   DFPAKPMSLYATIWDGSKWATNGGKYGVNYKFAPYVAQFADLILHGCAVDPIEKVL----  240

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 C D    +    + +T  QR+ M   R+KHM YSYCYD  RY V  PECV++  E 
Sbjct  241   ---SCQDGAAEDLRLASEITESQRKKMDSLRRKHMTYSYCYDRTRYKVALPECVVNPEEA  297

Query  197   QQFK  186
             ++ +
Sbjct  298   KRLR  301



>ref|XP_009414788.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=349

 Score =   354 bits (909),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 167/291 (57%), Positives = 214/291 (74%), Gaps = 9/291 (3%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++ T  F++G+T L+G+SN++   +  +V L L+  +G+GF S DLY HGFFSA IKLPS
Sbjct  47    NLATLSFEEGYTQLFGDSNLMLHRNGRTVHLSLDQRTGAGFASQDLYLHGFFSASIKLPS  106

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY AG+VVAFY +N D+FEKTHDELDFEFLGN++G+ WR QTN+YGNGST+ GREERY L
Sbjct  107   DYAAGVVVAFYMSNGDIFEKTHDELDFEFLGNIRGREWRVQTNVYGNGSTAIGREERYGL  166

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP+++FH+YSILW++  I+FYID+ PIRE+IR +AMGG FP KPM LYATIWD S+WA
Sbjct  167   WFDPTEDFHQYSILWSHDKILFYIDNTPIREVIRTQAMGGQFPSKPMSLYATIWDGSNWA  226

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVT  318
             T GGRYKVNYKYAP+VA F DL+L GCA DP      +H     C  R ++   D   ++
Sbjct  227   TLGGRYKVNYKYAPYVAEFGDLILHGCAVDP-----SDH--TQSC-QRPDVLLYDAITMS  278

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
               QR AM++FR+K+M YSYC+D VRY    PEC I   E + F  +G  K 
Sbjct  279   TVQRSAMEKFRKKYMTYSYCHDRVRYQTLLPECKI-GPESESFHSSGETKL  328



>gb|EAY87162.1| hypothetical protein OsI_08563 [Oryza sativa Indica Group]
Length=354

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/300 (60%), Positives = 219/300 (73%), Gaps = 2/300 (1%)
 Frame = -1

Query  1061  LSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFF  882
             LS  A+AF V +  FD+G++ L+G+ N++RS+ D SVRL L+  SGSGF SSD Y HGFF
Sbjct  22    LSAVASAFAVPSVAFDEGYSPLFGDDNLVRSSDDKSVRLLLDRRSGSGFISSDYYLHGFF  81

Query  881   SAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSR  702
             SA IKLP  YTAG+VVAFY +N DV+EKTHDELDFEFLG+  G  WR QTN+YGNGST+R
Sbjct  82    SASIKLPKAYTAGVVVAFYLSNGDVYEKTHDELDFEFLGSRWGGQWRVQTNVYGNGSTAR  141

Query  701   GREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYAT  522
             GREERYLL FDP+ E HRYS+LW    IIFYIDD PIRE+IR+  MGGDFP KPM +YAT
Sbjct  142   GREERYLLPFDPTLEAHRYSVLWAPTHIIFYIDDTPIREVIRHPGMGGDFPSKPMAVYAT  201

Query  521   IWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD-DRREL  345
             IWD S WAT GG+YKVNYKYAPF + F+DL L GC ADP+     +  G G  + D   L
Sbjct  202   IWDGSTWATDGGKYKVNYKYAPFASEFSDLALLGCRADPVLRAPRDGGGAGCAEPDLLGL  261

Query  344   EGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPP-PECVIDAAERQQFKETGRLK  168
               AD+A +TP++R AM+ FR +HM Y+ CYD+VRYA  P PEC +   E++ F   G  K
Sbjct  262   LTADYAIMTPRKRAAMRAFRARHMTYTVCYDAVRYAAGPFPECDVSDVEKESFSAWGESK  321



>ref|XP_006355045.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27-like [Solanum tuberosum]
Length=330

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/300 (54%), Positives = 210/300 (70%), Gaps = 10/300 (3%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFD--VTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSS  906
              F+  ++    + F   + T PF +G++ L+G  N++    + SV + L+  +G+GF S 
Sbjct  8     IFIFCYVLVLVSGFSEKLETLPFHEGYSQLFGHDNLMVLQDEKSVHISLDERTGAGFVSQ  67

Query  905   DLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNM  726
             DLY  G FSA IKLP DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++ K WR QTN+
Sbjct  68    DLYLLGLFSASIKLPEDYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRAKNWRIQTNI  127

Query  725   YGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQ  546
             YGNGST+ GREERY LWFDP+++FH Y+ILWT+  IIFY+D+VPIRE+ R +AMGGDFP 
Sbjct  128   YGNGSTNVGREERYGLWFDPTEDFHTYTILWTDSHIIFYVDNVPIREIKRTQAMGGDFPS  187

Query  545   KPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGG  366
             KPM LYATIWD S WAT+GG+YKVNYKYAP+V  F+D VL GCA DP++      P    
Sbjct  188   KPMSLYATIWDGSSWATNGGKYKVNYKYAPYVTKFSDFVLHGCAVDPIE----LSPKCDI  243

Query  365   CDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
               D   +       ++P QRR M+RFR+KH+ YSYCYD  RY VP  ECVID  E  + +
Sbjct  244   VQDSASIP----TEISPDQRRKMERFRKKHLQYSYCYDRTRYNVPLSECVIDPKEANRLR  299



>ref|XP_006416979.1| hypothetical protein EUTSA_v10008160mg [Eutrema salsugineum]
 gb|ESQ35332.1| hypothetical protein EUTSA_v10008160mg [Eutrema salsugineum]
Length=332

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/306 (53%), Positives = 215/306 (70%), Gaps = 16/306 (5%)
 Frame = -1

Query  1076  FLIAFLSYTA------AAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             FL  FL + +      + F +   P   FD+G+T L+G+ N++      SVRL L+  +G
Sbjct  3     FLTRFLVFVSLFTGLVSGFALQRLPLIQFDEGYTQLFGDQNLIVHRDGKSVRLTLDERTG  62

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             SGF S+D+Y HGFFS+ IKLP+DY+AG+V+AFY +N D++EK HDE+DFEFLGN++GK W
Sbjct  63    SGFVSNDIYLHGFFSSSIKLPADYSAGVVIAFYMSNGDMYEKNHDEIDFEFLGNIRGKEW  122

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             R QTN+YGNGST  GREERY LWFDP+++FHRYS+LW++  IIFY+DDVPIRE+ R   M
Sbjct  123   RIQTNIYGNGSTHLGREERYNLWFDPTEDFHRYSVLWSHSHIIFYVDDVPIREVKRTATM  182

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             GGDFP KPM LYATIWD S WAT+GG+Y VNYKYAP++A FTDL+L GCA DP  +    
Sbjct  183   GGDFPAKPMSLYATIWDGSKWATNGGKYGVNYKYAPYIAQFTDLILHGCAVDPTDK----  238

Query  383   HPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAA  204
                +  C+D         + +T  +R  MK FR+KH+ YSYCYD  RY V   ECV++  
Sbjct  239   ---ISSCEDGAAKNLRVASEITMSERNKMKSFRRKHLTYSYCYDHTRYKVVLSECVVNPE  295

Query  203   ERQQFK  186
             E ++ +
Sbjct  296   EAKRLR  301



>ref|XP_010458984.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Camelina sativa]
Length=332

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 218/307 (71%), Gaps = 18/307 (6%)
 Frame = -1

Query  1076  FLIAFLSYTA------AAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             FL  FL + +      + F +   P   FD+G+T L+G+ N+       SVRL L+  +G
Sbjct  3     FLTRFLVFLSLFTGLVSGFALQKLPLIQFDEGYTQLFGDQNLFVHRDGKSVRLTLDERTG  62

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             SGF S+D+Y HGFFS+ IKLPSDY+AG+V+AFY +N D++EK HDE+DFEFLGN++GK W
Sbjct  63    SGFASNDIYLHGFFSSSIKLPSDYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGKEW  122

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             R QTN+YGNGST  GREERY LWFDP++EFH+YSILW+   IIFY+D+VPIRE+ R  +M
Sbjct  123   RIQTNIYGNGSTHLGREERYNLWFDPTEEFHQYSILWSLSHIIFYVDNVPIREVKRTASM  182

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             GGDFP KPM LYATIWD S WAT GG+Y VNYKYAP+V  FTDL+L GCA DP ++    
Sbjct  183   GGDFPAKPMSLYATIWDGSKWATDGGKYGVNYKYAPYVTQFTDLILHGCAVDPTEKFP--  240

Query  383   HPGVGGCDDRRELEGADFAN-VTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
                   C+D   +E    A+ +T  QR+ M+ FR+KHM YSYCYD +RY V   ECV++ 
Sbjct  241   -----SCED-EAVENLRLASEITVSQRKQMESFRRKHMTYSYCYDHMRYKVVLSECVVNP  294

Query  206   AERQQFK  186
             AE ++ +
Sbjct  295   AEAKRLR  301



>ref|XP_010424960.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Camelina sativa]
Length=333

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/304 (54%), Positives = 212/304 (70%), Gaps = 10/304 (3%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             S     ++  S   + F +   P   F++G+T L+G+ N+       SVRL L+  +GSG
Sbjct  5     SRFLVFMSLFSGLVSGFAIQNLPITSFEEGYTQLFGDKNLFVHKDGKSVRLTLDERTGSG  64

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S+DLY HGFFSA IKLPSDY+AG+VVAFY +N D++EK HDE+DFEFLGN++GK WR 
Sbjct  65    FASNDLYLHGFFSASIKLPSDYSAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRI  124

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST  GREERY LWFDP+++FH+YSILW++  IIF++D+VPIRE+ R  +MGG
Sbjct  125   QTNIYGNGSTHLGREERYNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTASMGG  184

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LY TIWD S WAT+GG+Y VNYKYAP++A F+DLVL GC  DP+++      
Sbjct  185   DFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQFP----  240

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 CD+           +TP QR  M  FR+KHM YSYCYD  RY V   ECV++ AE 
Sbjct  241   ---RCDEGAAEYIRAAQEITPSQRSKMDVFRRKHMTYSYCYDRTRYKVALSECVVNPAEA  297

Query  197   QQFK  186
             Q+ +
Sbjct  298   QRLR  301



>ref|NP_001047814.1| Os02g0696500 [Oryza sativa Japonica Group]
 dbj|BAD08162.1| putative xyloglucan endo-1,4-beta-D-glucanase [Oryza sativa Japonica 
Group]
 dbj|BAF09728.1| Os02g0696500 [Oryza sativa Japonica Group]
 dbj|BAG95292.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97400.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57621.1| hypothetical protein OsJ_08020 [Oryza sativa Japonica Group]
Length=351

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/300 (60%), Positives = 218/300 (73%), Gaps = 2/300 (1%)
 Frame = -1

Query  1061  LSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFF  882
             LS  A+AF V +  FD+G++ L+G+ N++RS+ D SVRL L+  SGSGF SSD Y HGFF
Sbjct  22    LSAVASAFAVPSVAFDEGYSPLFGDDNLVRSSDDKSVRLLLDRRSGSGFISSDYYLHGFF  81

Query  881   SAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSR  702
             SA IKLP  YTAG+VVAFY +N DV+EKTHDELDFEFLG+  G  WR QTN YGNGST+R
Sbjct  82    SASIKLPKAYTAGVVVAFYLSNGDVYEKTHDELDFEFLGSRWGGQWRVQTNAYGNGSTAR  141

Query  701   GREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYAT  522
             GREERYLL FDP+ E HRYS+LW    IIFYIDD PIRE+IR+  MGGDFP KPM +YAT
Sbjct  142   GREERYLLPFDPTLEAHRYSVLWAPTHIIFYIDDTPIREVIRHPGMGGDFPSKPMAVYAT  201

Query  521   IWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD-DRREL  345
             IWD S WAT GG+YKVNYKYAPF + F+DL L GC ADP+     +  G G  + D   L
Sbjct  202   IWDGSTWATDGGKYKVNYKYAPFASEFSDLALLGCRADPVLRAPRDGGGAGCAEPDLLGL  261

Query  344   EGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPP-PECVIDAAERQQFKETGRLK  168
               AD+A +TP++R AM+ FR +HM Y+ CYD+VRYA  P PEC +   E++ F   G  K
Sbjct  262   LTADYAVMTPRKRAAMRAFRARHMTYTVCYDAVRYAAGPFPECDVSDVEKESFSAWGESK  321



>ref|XP_010513916.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Camelina sativa]
Length=333

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/304 (54%), Positives = 212/304 (70%), Gaps = 10/304 (3%)
 Frame = -1

Query  1088  SSAFFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             S     ++  S   + F +   P   F++G+T L+G+ N+       SVRL L+  +GSG
Sbjct  5     SRFLVFMSLFSGLVSGFAIQNLPITSFEEGYTQLFGDKNLFVHKDGKSVRLTLDERTGSG  64

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S+DLY HGFFSA IKLPSDY+AG+VVAFY +N D++EK HDE+DFEFLGN++GK WR 
Sbjct  65    FASNDLYLHGFFSASIKLPSDYSAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRI  124

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST  GREERY LWFDP+ +FH+YSILW++  IIF++D VPIRE+ R  +MGG
Sbjct  125   QTNIYGNGSTHLGREERYNLWFDPTDDFHQYSILWSDSHIIFFVDSVPIREVKRTASMGG  184

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
             DFP KPM LY TIWD S WAT+GG+Y VNYKYAP++A F+DLVL GC  DP+++      
Sbjct  185   DFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQF--PRC  242

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
               G  +D R  +      +TP QR  M  FR+KHM YSYCYD  RY V   ECV++ AE 
Sbjct  243   DEGAAEDIRAAQ-----EITPSQRSKMDIFRRKHMTYSYCYDRTRYKVALSECVVNPAEA  297

Query  197   QQFK  186
             Q+ +
Sbjct  298   QRLR  301



>gb|ADE42489.1| xyloglucan endotransglucosylase/hydrolase 2 [Fragaria chiloensis]
Length=324

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/277 (58%), Positives = 209/277 (75%), Gaps = 11/277 (4%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G+  L+G+ N++      SV L L+  +GSGF S DLY HGFFSA IKLP+DYTAG+
Sbjct  27    FDEGYNKLFGDDNLMILKDGKSVHLTLDERTGSGFVSQDLYIHGFFSASIKLPTDYTAGV  86

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N+D+F K HDE+DFEFLGN++GK WR QTN+YGNGST  GREERY LWFDPS+
Sbjct  87    VVAFYMSNSDMFPKNHDEIDFEFLGNIRGKEWRVQTNVYGNGSTETGREERYNLWFDPSE  146

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             ++H+YSILWT+  IIFY+D++PIR + ++E+MGGD+P KPM LYATIWD S WAT GG+Y
Sbjct  147   DYHQYSILWTDSQIIFYVDNIPIRVVKKSESMGGDYPSKPMSLYATIWDGSGWATDGGKY  206

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF--ANVTPKQR  306
             +VNYKYAPF A F+DLVL GCA DP+++V  +      CD   + +G+++    VT  QR
Sbjct  207   RVNYKYAPFRAEFSDLVLHGCAVDPIEQVSKK------CD---KTQGSEYIPTGVTRLQR  257

Query  305   RAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQ  195
               M+ FR++ M YSYCYD +RY V PPECVI   E +
Sbjct  258   MRMESFRKRQMTYSYCYDRIRYKVAPPECVITPPEAE  294



>ref|XP_010476541.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Camelina sativa]
Length=332

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 220/308 (71%), Gaps = 18/308 (6%)
 Frame = -1

Query  1079  FFLIAFLSYTA------AAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLS  927
             +FL  FL + +      + F +   P   FD+G+T L+G+ N++      SVRL L+  +
Sbjct  2     WFLTRFLVFISLFTGYVSGFALQKLPLIQFDEGYTQLFGDQNLIVHRDGKSVRLTLDERT  61

Query  926   GSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKP  747
             GSGF S+D+Y HGFFS+ IKLP+DY+AG+V+AFY +N D++EK HDE+DFEFLGN++GK 
Sbjct  62    GSGFVSNDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGKE  121

Query  746   WRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEA  567
             WR QTN+YGNGST  GREERY LWFDP++EFH+YSILW+   IIFY+D+VPIRE+ R  +
Sbjct  122   WRIQTNIYGNGSTHLGREERYNLWFDPTEEFHQYSILWSLSHIIFYVDNVPIREVKRTAS  181

Query  566   MGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVG  387
             MGGDFP KPM LYATIWD S WAT GG+Y VNYKYAP+V  FTDL+L GCA DP ++   
Sbjct  182   MGGDFPAKPMSLYATIWDGSKWATDGGKYGVNYKYAPYVTQFTDLILHGCAVDPTEK---  238

Query  386   EHPGVGGCDDRRELEGADFAN-VTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVID  210
                    C+D   +E    A+ +T  QR+ M+ FR+KHM YSYCYD +RY V   ECV++
Sbjct  239   ----FPSCED-EAVESLRLASEITVSQRKQMESFRRKHMTYSYCYDHMRYKVVLSECVVN  293

Query  209   AAERQQFK  186
              AE ++ +
Sbjct  294   PAEAKRLR  301



>gb|KFK43745.1| hypothetical protein AALP_AA1G167300 [Arabis alpina]
Length=322

 Score =   352 bits (902),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 207/278 (74%), Gaps = 7/278 (3%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G+T L+G+ N++      SVRL L+  +GSGF S+D+Y HGFFS+ IKLPSDY+AG+
Sbjct  21    FDEGYTQLFGDQNLIVHRDGKSVRLTLDERTGSGFVSNDIYLHGFFSSSIKLPSDYSAGV  80

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             V+AFY +N D++EK HDE+DFEFLGN++GK WR QTN+YGNGST  GREERY LWFDP++
Sbjct  81    VIAFYLSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERYNLWFDPTE  140

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             +FH+YS+LW+   IIF +DD+PIRE+ R  +MGGDFP KPM LYATIWD S WAT+GG+Y
Sbjct  141   DFHQYSVLWSPSHIIFNVDDIPIREVKRTASMGGDFPTKPMSLYATIWDGSKWATNGGKY  200

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
              VNYKYAP+VA FTDL+L GCA DP ++       +  C+D    +    + +T  QR  
Sbjct  201   SVNYKYAPYVAQFTDLILHGCAVDPTEK-------LPSCEDGAAEDLWLASEITVSQRSK  253

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             M+ FR+KHM YSYCYD +RY V   ECV+D  E ++ K
Sbjct  254   MESFRRKHMTYSYCYDHMRYKVVLSECVVDPVEAKRLK  291



>gb|ADE42491.1| xyloglucan endotransglucosylase/hydrolase 2 [Fragaria x ananassa]
Length=269

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/271 (59%), Positives = 206/271 (76%), Gaps = 11/271 (4%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             FD+G+  L+G+ N++      SV L L+  +GSGF S DLY HGFFSA IKLP+DYTAG+
Sbjct  6     FDEGYNKLFGDDNLMILKDGKSVHLTLDERTGSGFVSQDLYIHGFFSASIKLPTDYTAGV  65

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N+D+F K HDE+DFEFLGN++GK WR QTN+YGNGST  GREERY LWFDPS+
Sbjct  66    VVAFYMSNSDMFPKNHDEIDFEFLGNIRGKEWRVQTNVYGNGSTETGREERYNLWFDPSE  125

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             ++H+YSILWT+  IIFY+D++ IR + ++E+MGGD+P KPM LYATIWD S WAT GG+Y
Sbjct  126   DYHQYSILWTDSQIIFYVDNISIRVVKKSESMGGDYPSKPMSLYATIWDGSGWATDGGKY  185

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF--ANVTPKQR  306
             +VNYKYAPF A F+DLVL GCA DP+++V  +      CD   + +G+++    VT  QR
Sbjct  186   RVNYKYAPFKAEFSDLVLHGCAVDPIEQVSKK------CD---KTQGSEYIPTGVTRLQR  236

Query  305   RAMKRFRQKHMYYSYCYDSVRYAVPPPECVI  213
               M+ FR++ M YSYCYD +RY V PPECVI
Sbjct  237   MRMESFRKRQMTYSYCYDRIRYKVAPPECVI  267



>gb|AFR46578.1| xyloglucan endotransglucosylase/hydrolase 9, partial [Rosa x 
borboniana]
Length=292

 Score =   347 bits (891),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/268 (60%), Positives = 204/268 (76%), Gaps = 11/268 (4%)
 Frame = -1

Query  983  NILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVF  804
            N++      SV L LN  +GSGF S DLY HGFFSA IKLP+DYTAGIVVAFY +NAD+F
Sbjct  1    NLMILRDGKSVHLTLNERTGSGFVSQDLYIHGFFSASIKLPTDYTAGIVVAFYMSNADMF  60

Query  803  EKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQ  624
             K HDE+DFEFLGN++GK WR QTN+YGNGST  GREERY LWFDPS+++H+YSILWT+ 
Sbjct  61   PKNHDEIDFEFLGNIRGKEWRVQTNVYGNGSTDTGREERYNLWFDPSEDYHQYSILWTDS  120

Query  623  TIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAH  444
             IIFY+D++PIR + ++E MGGD+P KPM LYATIWD SDWAT+GG+Y+VNYKYAPF A 
Sbjct  121  HIIFYVDNIPIRVVKKSEGMGGDYPSKPMSLYATIWDGSDWATNGGKYRVNYKYAPFKAE  180

Query  443  FTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF--ANVTPKQRRAMKRFRQKHMY  270
            F+DLVL GCA DP+++V  +      CD   + +G+++    VT  QR  M+ FR++ M 
Sbjct  181  FSDLVLHGCAVDPIEQVSKK------CD---KTQGSEYIPTGVTRLQRMRMESFRKRQMT  231

Query  269  YSYCYDSVRYAVPPPECVIDAAERQQFK  186
            YSYCYD +RY V PPECVI+  E ++ +
Sbjct  232  YSYCYDRIRYKVAPPECVINPQEAERLR  259



>ref|NP_172925.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 
[Arabidopsis thaliana]
 sp|Q38909.1|XTH28_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 28; Short=At-XTH28; Short=XTH-28; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD45124.1|AF163820_1 endoxyloglucan transferase [Arabidopsis thaliana]
 gb|AAF79246.1|AC006917_31 F10B6.12 [Arabidopsis thaliana]
 gb|AAK60305.1|AF385714_1 At1g14720/F10B6_29 [Arabidopsis thaliana]
 gb|AAB18366.1| xyloglucan endotransglycosylase-related protein [Arabidopsis 
thaliana]
 dbj|BAA20290.1| endoxyloglucan transferase related protein [Arabidopsis thaliana]
 gb|AAM63068.1| xyloglucan endo-transglycosylase, putative [Arabidopsis thaliana]
 gb|AEE29214.1| probable xyloglucan endotransglucosylase/hydrolase protein 28 
[Arabidopsis thaliana]
Length=332

 Score =   349 bits (895),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/301 (53%), Positives = 212/301 (70%), Gaps = 10/301 (3%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
                ++  +   + F +   P   FD+G+T L+G+ N++      SVRL L+  +GSGF S
Sbjct  8     LVFMSLFTSLVSGFALQKLPLIQFDEGYTQLFGDQNLIVHRDGKSVRLTLDERTGSGFVS  67

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
             +D+Y HGFFS+ IKLP+DY+AG+V+AFY +N D++EK HDE+DFEFLGN++G+ WR QTN
Sbjct  68    NDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGREWRIQTN  127

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGST  GREERY LWFDP+++FH+YSILW+   IIFY+D+VPIRE+ R  +MGGDFP
Sbjct  128   IYGNGSTHLGREERYNLWFDPTEDFHQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFP  187

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LY+TIWD S WAT GG+Y VNYKYAP+V+ FTDL+L GCA DP ++         
Sbjct  188   AKPMSLYSTIWDGSKWATDGGKYGVNYKYAPYVSQFTDLILHGCAVDPTEK-------FP  240

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              C D         + +T  QR  M+ FRQKHM YSYCYD +RY V   ECV++ AE ++ 
Sbjct  241   SCKDEAVQNLRLASEITESQRNKMEIFRQKHMTYSYCYDHMRYKVVLSECVVNPAEAKRL  300

Query  188   K  186
             +
Sbjct  301   R  301



>ref|XP_004297401.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28-like isoform 1 [Fragaria vesca subsp. vesca]
Length=335

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/285 (57%), Positives = 211/285 (74%), Gaps = 16/285 (6%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSG-----SGFRSSDLYSHGFFSAKIKLPSD  855
             FD+G+  L+G+ N++      SV L L+  +G     SGF S DLY HGFFSA IKLP+D
Sbjct  27    FDEGYNKLFGDDNLMILKDGKSVHLTLDERTGPLCFRSGFVSQDLYIHGFFSASIKLPTD  86

Query  854   YTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLW  675
             YTAG+VVAFY +N+D+F K HDE+DFEFLGN++GK WR QTN+YGNGST  GREERY LW
Sbjct  87    YTAGVVVAFYMSNSDMFPKNHDEIDFEFLGNIRGKEWRVQTNVYGNGSTETGREERYNLW  146

Query  674   FDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWAT  495
             FDPS+++H+YSILWT+  IIFY+D++PIR + ++E+MGGD+P KPM LYATIWD S WAT
Sbjct  147   FDPSEDYHQYSILWTDSQIIFYVDNIPIRVVKKSESMGGDYPSKPMSLYATIWDGSGWAT  206

Query  494   SGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF--ANV  321
              GG+Y+VNYKYAPF A F+DLVL GCA DP+++V  +      CD   + +G+++    V
Sbjct  207   DGGKYRVNYKYAPFRAEFSDLVLHGCAVDPIEQVSKK------CD---KTQGSEYIPTGV  257

Query  320   TPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             T  QR  M+ FR++ M YSYCYD +RY V PPECVI   E ++ +
Sbjct  258   TRLQRMRMESFRKRQMTYSYCYDRIRYKVAPPECVITPQEAERLR  302



>ref|XP_009409244.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=337

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/288 (58%), Positives = 203/288 (70%), Gaps = 10/288 (3%)
 Frame = -1

Query  1034  VTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSD  855
             + T  F++G+T L+G+ N++       V L L+  +G+GF S DLY HGFFSA IKLPSD
Sbjct  31    LPTLSFEEGYTQLFGDGNLMLLRDGKRVHLSLDERTGAGFASQDLYLHGFFSASIKLPSD  90

Query  854   YTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLW  675
             YTAG+VVAFY +N D FEKTHDELDFEFLGNV+G+ WR QTN+YGNGST+ GREER  LW
Sbjct  91    YTAGVVVAFYMSNGDAFEKTHDELDFEFLGNVRGREWRVQTNVYGNGSTAVGREERCDLW  150

Query  674   FDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWAT  495
             FDP+++FH YSILW +  IIFY+DD PIRE++R EA GG FP KPM LYATIWD S+WAT
Sbjct  151   FDPTEDFHHYSILWNHDRIIFYVDDTPIREIVRAEAAGGVFPAKPMSLYATIWDGSNWAT  210

Query  494   SGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTP  315
             SGGRYKV YKYAP+VA F++LVL GCA DP+            C +R E    D   ++ 
Sbjct  211   SGGRYKVKYKYAPYVAEFSELVLHGCAVDPIDH-------SSPC-ERPENARYDTLTMSS  262

Query  314   KQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVID--AAERQQFKETG  177
              QR  M  FR+ HM Y YCYD  RY  PPPEC ID  + ERQ +   G
Sbjct  263   DQRARMTSFRRNHMQYLYCYDRDRYPTPPPECSIDESSKERQSYGLDG  310



>gb|KDO60845.1| hypothetical protein CISIN_1g019909mg [Citrus sinensis]
Length=325

 Score =   347 bits (889),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/301 (55%), Positives = 211/301 (70%), Gaps = 19/301 (6%)
 Frame = -1

Query  1076  FLIAF--LSYTAAAF--DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             FL+ F  L+  A+    ++   PFD+G++ L+G  N++  T   SV L L+  +GSGF S
Sbjct  9     FLLVFSLLAVVASGLYRNLPIVPFDEGYSHLFGHDNLVVHTDGKSVHLSLDERTGSGFVS  68

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
              DLY HGFFSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK WR QTN
Sbjct  69    HDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGKDWRIQTN  128

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGSTS GREERY LWFDPS +FH+YSILWT+  I+         E  R  +MGGDFP
Sbjct  129   IYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIM---------EFKRTASMGGDFP  179

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LYATIWD SDWAT+GG+Y+VNYKYAP+V  F+D VL GC+ DP+++   +     
Sbjct  180   AKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTSSK-----  234

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              CD     + +    V+P QR  M+ FR+KHM YSYCYD +RY VPP ECVI+  E ++ 
Sbjct  235   -CDITESSKVSIPTGVSPSQRIKMENFRRKHMTYSYCYDQIRYKVPPFECVINPLEAERL  293

Query  188   K  186
             K
Sbjct  294   K  294



>ref|NP_001049503.1| Os03g0239000 [Oryza sativa Japonica Group]
 gb|ABF94871.1| xyloglucan endotransglucosylase/hydrolase protein 28precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11417.1| Os03g0239000 [Oryza sativa Japonica Group]
 gb|EAZ26213.1| hypothetical protein OsJ_10080 [Oryza sativa Japonica Group]
 dbj|BAG87835.1| unnamed protein product [Oryza sativa Japonica Group]
Length=338

 Score =   347 bits (889),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/289 (56%), Positives = 204/289 (71%), Gaps = 16/289 (6%)
 Frame = -1

Query  1034  VTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSD  855
              T   F++G+T L+G+SN++       V + L+  +G+GF S   Y HGFFSA IKLP+D
Sbjct  42    ATALSFEEGYTQLFGDSNLMLHGDGKRVHISLDERTGAGFASQGAYHHGFFSASIKLPAD  101

Query  854   YTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLW  675
             +TAG+VVAFY +N DV+E+THDELDFEFLGNV+G+ WR QTN+YGNGST+ GREERY LW
Sbjct  102   HTAGVVVAFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYGNGSTAAGREERYGLW  161

Query  674   FDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWAT  495
             FDP+++FHRY+I W++ TIIFY+D+ PIRE++R  +MG  FP KPM LYATIWD S WAT
Sbjct  162   FDPTQDFHRYAIRWSHDTIIFYVDETPIREVVRTASMGAQFPSKPMSLYATIWDGSSWAT  221

Query  494   SGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTP  315
             SGGRYKVNYKYAP+VA FTDL+L GC A       G  P   G         A  A + P
Sbjct  222   SGGRYKVNYKYAPYVAEFTDLLLHGCPA-------GSPPPCEGA--------AASATMPP  266

Query  314   KQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
              QR AM+RFR +HM Y YCYD VRY  P PEC +  AE + F  +G  +
Sbjct  267   GQRSAMERFRARHMTYGYCYDRVRYHAPLPECSV-GAEAEAFLPSGEAR  314



>gb|EAY89191.1| hypothetical protein OsI_10687 [Oryza sativa Indica Group]
Length=338

 Score =   346 bits (888),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/289 (56%), Positives = 204/289 (71%), Gaps = 16/289 (6%)
 Frame = -1

Query  1034  VTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSD  855
              T   F++G+T L+G+SN++       V + L+  +G+GF S   Y HGFFSA IKLP+D
Sbjct  42    ATALSFEEGYTQLFGDSNLMLHGDGKRVHISLDERTGAGFASQGAYHHGFFSASIKLPAD  101

Query  854   YTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLW  675
             +TAG+VVAFY +N DV+E+THDELDFEFLGNV+G+ WR QTN+YGNGST+ GREERY LW
Sbjct  102   HTAGVVVAFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYGNGSTAAGREERYGLW  161

Query  674   FDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWAT  495
             FDP+++FHRY+I W++ TIIFY+D+ PIRE++R  +MG  FP KPM LYATIWD S WAT
Sbjct  162   FDPTQDFHRYAIRWSHDTIIFYVDETPIREVVRTASMGAQFPSKPMSLYATIWDGSSWAT  221

Query  494   SGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTP  315
             SGGRYKVNYKYAP+VA FTDL+L GC A       G  P   G         A  A + P
Sbjct  222   SGGRYKVNYKYAPYVAEFTDLLLHGCPA-------GSPPPCEGA--------AASATMPP  266

Query  314   KQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
              QR AM+RFR +HM Y YCYD VRY  P PEC +  AE + F  +G  +
Sbjct  267   GQRSAMERFRTRHMTYGYCYDRVRYHAPLPECSV-GAEAEAFLPSGEAR  314



>ref|XP_004236920.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Solanum lycopersicum]
Length=330

 Score =   346 bits (887),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/301 (53%), Positives = 210/301 (70%), Gaps = 12/301 (4%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAF--DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSS  906
              F+  ++    + F  ++ T+ F++G++ L+G  N++      SV + L+  +G+GF S 
Sbjct  8     IFIFCYVVVLVSGFSENLETSSFNEGYSQLFGHDNLMVIQDGKSVHISLDERTGAGFVSQ  67

Query  905   DLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNM  726
             DLY HG FSA IKLP DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++ K WR QTN+
Sbjct  68    DLYLHGLFSASIKLPEDYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRAKNWRIQTNI  127

Query  725   YGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQ  546
             YGNGST+ GREERY LWFDP+++FH Y+ILWT+  IIFY+D+VPIRE+ R +AM  DFP 
Sbjct  128   YGNGSTNVGREERYGLWFDPTEDFHTYTILWTDSHIIFYVDNVPIREIKRTQAMSEDFPS  187

Query  545   KPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGG  366
             KPM LY TIWD S WAT+GG+YKVNYKYAP+VA F+D VL GC  DP++           
Sbjct  188   KPMSLYGTIWDGSSWATNGGKYKVNYKYAPYVAKFSDFVLHGCGVDPIEL-------SPK  240

Query  365   CDDRRELEGADF-ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
             CD    L+ A     ++P QRR M+RFR K++ YSYCYD  RY VP  ECVID  E  + 
Sbjct  241   CD--IVLDSASIPTRISPDQRRKMERFRNKYLQYSYCYDRTRYNVPQSECVIDPKEANRL  298

Query  188   K  186
             +
Sbjct  299   R  299



>emb|CDY03100.1| BnaC07g21270D [Brassica napus]
Length=333

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/304 (54%), Positives = 212/304 (70%), Gaps = 11/304 (4%)
 Frame = -1

Query  1085  SAFFLIAFL-SYTAAAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSG  918
             S F +  FL S   + F +   P   F++ +T L+G+ N        SVRL L+  +GSG
Sbjct  5     SRFLVFMFLFSRFVSGFTLQNLPVTSFEESYTQLFGDKNFFVHKDGKSVRLTLDERTGSG  64

Query  917   FRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRF  738
             F S+DLY HG FSA IKLPSDY+AG+VVAFY +N D++EK HDE+DFEFLGN++GK WR 
Sbjct  65    FVSNDLYLHGLFSASIKLPSDYSAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRI  124

Query  737   QTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGG  558
             QTN+YGNGST  GREER  LWFDP++++H+YSILW++  IIF++D++PIRE+ R  +MGG
Sbjct  125   QTNIYGNGSTHLGREERSNLWFDPTEDYHQYSILWSDSHIIFFVDNIPIREVKRTASMGG  184

Query  557   DFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHP  378
              FP KPM LY TIWD S WAT+GG+Y VNYKYAP+VA  TDLVL GCA DP+++      
Sbjct  185   HFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYVAKLTDLVLHGCAVDPIEQ------  238

Query  377   GVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAER  198
                 CD+  + +      ++P QR  M  FR+KHM YSYCYD  RY V  PECV++ AE 
Sbjct  239   -FPKCDEGADEDIRAAQEISPSQRVKMGAFRRKHMTYSYCYDRNRYKVALPECVVNPAEA  297

Query  197   QQFK  186
             Q+ +
Sbjct  298   QRLR  301



>emb|CDY17630.1| BnaA06g34490D [Brassica napus]
Length=333

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/284 (56%), Positives = 205/284 (72%), Gaps = 7/284 (2%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++  T F++ +T L+G+ N+       SVRL L+  +GSGF S+DLY HG FSA IKLPS
Sbjct  25    NLPVTSFEESYTQLFGDKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGLFSASIKLPS  84

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY+AG+VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+YGNGST  GREER  L
Sbjct  85    DYSAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERSNL  144

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP++++H+YSILW++  IIF++D+VPIRE+ R  +MGG FP KPM LY TIWD S WA
Sbjct  145   WFDPTEDYHQYSILWSDSHIIFFVDNVPIREVKRTASMGGHFPSKPMSLYTTIWDGSKWA  204

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVT  318
             T+GG+Y VNYKYAP+VA  TDLVL GCA DP+++          CD+  + +      ++
Sbjct  205   TNGGKYGVNYKYAPYVAQLTDLVLHGCAVDPIEQ-------FPKCDEGADEDIRAAQEIS  257

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             P QR  M  FR+KHM YSYCYD  RY V  PECV+  AE Q+ +
Sbjct  258   PSQRVKMGVFRRKHMTYSYCYDRNRYKVALPECVVIPAEAQRLR  301



>ref|XP_010496455.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 isoform X1 [Camelina sativa]
 ref|XP_010496463.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 isoform X2 [Camelina sativa]
Length=333

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 218/308 (71%), Gaps = 19/308 (6%)
 Frame = -1

Query  1076  FLIAFLSYTA------AAFDVTTTP---FDQGFTTLYGESNILRSTSDDSVRLHLNHLSG  924
             FL  FL + +      + F +   P   FD+G+T L+G+ N+       SVRL L+  +G
Sbjct  3     FLTRFLVFLSLFTGLVSGFALQKLPLIQFDEGYTQLFGDQNLFVHRDGKSVRLTLDERTG  62

Query  923   SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
             SGF S+D+Y HGFFS+ IKLP+DY+AG+V+AFY +N D++EK HDE+DFEFLGN++GK W
Sbjct  63    SGFVSNDIYLHGFFSSFIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGKEW  122

Query  743   RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
             R QTN+YGNGST  GREERY LWFDP++EFH+YSILW+   IIFY+D+VPIRE+ R  +M
Sbjct  123   RIQTNIYGNGSTHLGREERYNLWFDPTEEFHQYSILWSLSHIIFYVDNVPIREVKRTASM  182

Query  563   GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
             GGDFP KPM LYATIWD S WAT GG+Y VNYKYAP+V  FTDL+L GCA DP ++    
Sbjct  183   GGDFPAKPMSLYATIWDGSKWATDGGKYGVNYKYAPYVTQFTDLILHGCAVDPTEK----  238

Query  383   HPGVGGCDDRRELEGADFAN-VTPKQRRAMKRFRQKHMYYSYCYDSVRY-AVPPPECVID  210
                   C+D   +E    A+ +T  QR+ M+ FR+KHM YSYCYD +RY  V   ECV++
Sbjct  239   ---FPSCED-EAVESLRLASEITSSQRKQMENFRRKHMTYSYCYDHMRYKVVLLSECVLN  294

Query  209   AAERQQFK  186
              AE ++ +
Sbjct  295   PAEAKRLR  302



>dbj|BAJ92690.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01289.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/295 (59%), Positives = 207/295 (70%), Gaps = 4/295 (1%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             +AFDV T  F++GF+ L+G+ N++R+  D + RL L+  SGSGF SSD Y HGFFSA IK
Sbjct  22    SAFDVPTVAFEEGFSPLFGDGNLVRARDDRAARLLLDRRSGSGFISSDYYLHGFFSASIK  81

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LP DYTAG+VVAFY +N DV+EKTHDELDFEFLG+  G  WR QTN+YGNGSTSRGREER
Sbjct  82    LPRDYTAGVVVAFYLSNGDVYEKTHDELDFEFLGSRWGGQWRVQTNVYGNGSTSRGREER  141

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             YLL FDP+   HRYSILW    IIFY+DD  IRE++R+  MGGDFP KPM  YATIWD S
Sbjct  142   YLLPFDPTLAAHRYSILWAPTHIIFYVDDTAIREVVRHPGMGGDFPAKPMAAYATIWDGS  201

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGC-AADPLQEVVGEHPGVGGCDDRRELEGADF  330
              WAT GG+YKVNYKYAPF + F+DL LRGC  ADP    +    G  GC D   L  AD+
Sbjct  202   AWATEGGKYKVNYKYAPFASDFSDLSLRGCRVADPASPAL-RLAGGDGC-DLLGLMTADY  259

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPP-PECVIDAAERQQFKETGRLK  168
             A +TP++R AM+ FR   M Y+ CYD+ RYA  P PEC     E   F   G  K
Sbjct  260   AVMTPQKRAAMRAFRAHRMTYTVCYDAARYAAGPFPECDNSEEESGTFWAWGESK  314



>gb|KDO60846.1| hypothetical protein CISIN_1g019909mg [Citrus sinensis]
Length=310

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 190/248 (77%), Gaps = 6/248 (2%)
 Frame = -1

Query  929  SGSGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGK  750
            +GSGF S DLY HGFFSA IKLP+DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++GK
Sbjct  38   TGSGFVSHDLYLHGFFSASIKLPADYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRGK  97

Query  749  PWRFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNE  570
             WR QTN+YGNGSTS GREERY LWFDPS +FH+YSILWT+  IIFYID +PIRE  R  
Sbjct  98   DWRIQTNIYGNGSTSIGREERYNLWFDPSDDFHQYSILWTDSQIIFYIDGIPIREFKRTA  157

Query  569  AMGGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVV  390
            +MGGDFP KPM LYATIWD SDWAT+GG+Y+VNYKYAP+V  F+D VL GC+ DP+++  
Sbjct  158  SMGGDFPAKPMSLYATIWDGSDWATNGGKYRVNYKYAPYVTEFSDFVLHGCSFDPIEQTS  217

Query  389  GEHPGVGGCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVID  210
             +      CD     + +    V+P QR  M+ FR+KHM YSYCYD +RY VPP ECVI+
Sbjct  218  SK------CDITESSKVSIPTGVSPSQRIKMENFRRKHMTYSYCYDQIRYKVPPFECVIN  271

Query  209  AAERQQFK  186
              E ++ K
Sbjct  272  PLEAERLK  279



>ref|XP_009101303.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Brassica rapa]
Length=333

 Score =   344 bits (883),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 205/284 (72%), Gaps = 7/284 (2%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++  T F++ +T L+G+ N+       +VRL L+  +GSGF S+DLY HG FSA IKLPS
Sbjct  25    NLPVTSFEESYTQLFGDKNLFVHKDGKTVRLTLDERTGSGFVSNDLYLHGLFSASIKLPS  84

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY+AG+VVAFY +N D++EK HDE+DFEFLGN++GK WR QTN+YGNGST  GREER  L
Sbjct  85    DYSAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIRGKEWRIQTNIYGNGSTHLGREERSNL  144

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP++++H+YSILW++  IIF++D+VPIRE+ R  +MGG FP KPM LY TIWD S WA
Sbjct  145   WFDPTEDYHQYSILWSDSHIIFFVDNVPIREVKRTASMGGHFPSKPMSLYTTIWDGSKWA  204

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVT  318
             T+GG+Y VNYKYAP+VA  TDLVL GCA DP+++          CD+  + +      ++
Sbjct  205   TNGGKYGVNYKYAPYVAQLTDLVLHGCAVDPIEQ-------FPKCDEGADEDIRAAQEIS  257

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             P QR  M  FR+KHM YSYCYD  RY V  PECV+  AE Q+ +
Sbjct  258   PSQRVKMGVFRRKHMTYSYCYDRNRYKVALPECVVIPAEAQRLR  301



>gb|EPS65144.1| hypothetical protein M569_09632 [Genlisea aurea]
Length=448

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 212/298 (71%), Gaps = 21/298 (7%)
 Frame = -1

Query  1079  FFLIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
             F L++F+  T ++ ++    FD+G+  L+GESN++      SVR+ L+  +GSGF S D+
Sbjct  10    FLLVSFV--TGSSGNLPILSFDEGYAHLFGESNLMVLKDGKSVRISLDETTGSGFVSQDV  67

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             YS+GFFSA +KLP DYTAG+VVA Y +NAD++ K HDE+D EFLGNV+GK WR QTN+YG
Sbjct  68    YSNGFFSASVKLPGDYTAGVVVALYLSNADMYVKNHDEIDIEFLGNVRGKEWRIQTNVYG  127

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGST  GREER  LWFDPS +FH+YSILWT+  I+F +D +PIREM R  A+GGDFP KP
Sbjct  128   NGSTGFGREERCGLWFDPSDDFHQYSILWTHDLILFSVDGIPIREMKRRAAVGGDFPSKP  187

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M LYATIWDASDWAT+GG+Y+V+YKYAPFV+ ++D VL GC+AD   E+ GE PG     
Sbjct  188   MSLYATIWDASDWATNGGKYRVDYKYAPFVSEYSDFVLHGCSAD-CDELAGEIPG-----  241

Query  359   DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
               RE            +RR M  FR K++ YSYCYD  RY  PPPECVIDA E    +
Sbjct  242   -GRE------------RRRMMAEFRNKYLQYSYCYDRSRYPAPPPECVIDAGEADALR  286



>emb|CDY70985.1| BnaAnng35740D [Brassica napus]
Length=333

 Score =   344 bits (883),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 155/284 (55%), Positives = 205/284 (72%), Gaps = 7/284 (2%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++  T F++ +T L+G  N+       SVRL L+  +GSGF S+DLY HGFFSA IKLPS
Sbjct  25    NLPITSFEESYTQLFGAKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGFFSASIKLPS  84

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY+AG+VVAFY +N D +EK HDE+DFEFLGN++G+ WR QTN+YGNGST  GREER  L
Sbjct  85    DYSAGVVVAFYMSNGDTYEKNHDEIDFEFLGNIRGREWRIQTNIYGNGSTHLGREERCNL  144

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP++++H+YSILW++  IIFY+D+VPIRE+ R  +MGGDFP KPM LY TIWD S WA
Sbjct  145   WFDPTEDYHQYSILWSDSHIIFYVDNVPIREVKRTSSMGGDFPSKPMSLYTTIWDGSKWA  204

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVT  318
             T+GG+Y VNYKY P++A F+DLVL GCA DP+++          C++R          ++
Sbjct  205   TNGGKYGVNYKYGPYIARFSDLVLHGCAVDPIEQ-------FPKCEERAIEYIRAAQEIS  257

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             P +R  M+ FR+KHM YSYCYD  RY V  P+CV++ AE  + +
Sbjct  258   PSERAKMEVFRRKHMTYSYCYDRTRYKVSLPDCVVNPAEAHRLR  301



>gb|KEH20811.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=322

 Score =   343 bits (881),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/300 (55%), Positives = 219/300 (73%), Gaps = 12/300 (4%)
 Frame = -1

Query  1058  SYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFS  879
             +++ AAFD+ T PF  GFT L+G+ N++ S   ++V+L ++  SGSGF+S D+Y+ GFFS
Sbjct  8     NFSFAAFDLATIPFHDGFTYLWGKENVIPSLDGNTVKLIIHEHSGSGFKSIDMYTSGFFS  67

Query  878   AKIKLPSDY--TAGIVVAFYTTNADVFEKT-HDELDFEFLGNVKGKPWRFQTNMYGNGST  708
             A+IKLPS+Y  TAG+ V FYTT+ DVF++  HDELDFEFLGN  GKPW+FQTN++GNG++
Sbjct  68    AEIKLPSNYFATAGVCVTFYTTSIDVFDRRRHDELDFEFLGNKAGKPWQFQTNLFGNGTS  127

Query  707   SRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLY  528
               GREERY LWFDP+KE+HRYSILWT   IIF++D++PIRE++RN+ M  ++P KPM LY
Sbjct  128   --GREERYDLWFDPTKEYHRYSILWTEINIIFFVDEIPIREVLRNKQMENNYPSKPMYLY  185

Query  527   ATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE  348
             ATIWDAS WA   G  KV+Y Y PF+A + +L+L+GC  DP+     E P    C +   
Sbjct  186   ATIWDASKWAIHEGNRKVDYSYGPFIATYKNLILKGCIFDPI-----EVPDDEFCSEN--  238

Query  347   LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLK  168
             L+  D+A + P +R  M+ FRQ+ M YSYCY + RY VPPPECVI + E+Q F E G LK
Sbjct  239   LKAQDYAIMNPLRRLKMQNFRQRFMSYSYCYHTYRYPVPPPECVIVSKEKQMFNENGMLK  298



>ref|XP_009129188.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Brassica rapa]
Length=333

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/284 (55%), Positives = 206/284 (73%), Gaps = 7/284 (2%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++  T F++ +  L+G+ N+       SVRL L+  +GSGF S+DLY HGFFSA IKLPS
Sbjct  25    NLPITSFEESYMQLFGDKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGFFSASIKLPS  84

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY+AG+VVAFY +N D +EK HDE+DFEFLGN++G+ WR QTN+YGNGST  GREER  L
Sbjct  85    DYSAGVVVAFYMSNGDTYEKNHDEIDFEFLGNIRGREWRIQTNIYGNGSTHLGREERCNL  144

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP++++H+YSILW++  IIFY+D+VPIRE+ R  +MGGDFP KPM LY TIWD S WA
Sbjct  145   WFDPTEDYHQYSILWSDFHIIFYVDNVPIREVKRTSSMGGDFPSKPMSLYTTIWDGSKWA  204

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVT  318
             T+GG+Y VNYKYAP++A F+DLVL GCA DP+++       +  CD+           ++
Sbjct  205   TNGGKYGVNYKYAPYIARFSDLVLHGCAVDPIEQ-------LPKCDEGAIEYIRAAQEIS  257

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
               +R  M+ FR+KHM YSYCYD  RY V  PECV++ AE Q+ +
Sbjct  258   LSERAKMEVFRRKHMTYSYCYDRTRYKVSLPECVVNPAEAQRLR  301



>ref|XP_006854072.1| hypothetical protein AMTR_s00048p00113910 [Amborella trichopoda]
 gb|ERN15539.1| hypothetical protein AMTR_s00048p00113910 [Amborella trichopoda]
Length=295

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/254 (62%), Positives = 192/254 (76%), Gaps = 9/254 (4%)
 Frame = -1

Query  923  SGFRSSDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPW  744
            S     DLY HG+FSA IKLPSDYTAG+VVAFYT+N D+FEK HDELDFEFLGN++GK W
Sbjct  24   SSMNPPDLYMHGYFSADIKLPSDYTAGVVVAFYTSNGDIFEKNHDELDFEFLGNIRGKDW  83

Query  743  RFQTNMYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAM  564
            R QTN+YGNGSTSRGREERY LWFDP+  FHRYSILWT + IIFYID VPIRE++R  AM
Sbjct  84   RIQTNVYGNGSTSRGREERYNLWFDPTNGFHRYSILWTQKHIIFYIDSVPIREVVRTPAM  143

Query  563  GGDFPQKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGE  384
            GGD+P KPM +YATIWD S+WAT+GGRYK NYKYAPF A F++LVL+G  +DP++++  +
Sbjct  144  GGDYPSKPMSVYATIWDGSNWATNGGRYKANYKYAPFTAEFSNLVLKGRPSDPIEQISAK  203

Query  383  HPGVGGC-DDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
                G    +  EL  A        QR +M   R +HM YSYCYD  RY  PP ECV+  
Sbjct  204  SSESGDSFGENTELAHA--------QRLSMNGVRHRHMTYSYCYDRARYPEPPSECVVIP  255

Query  206  AERQQFKETGRLKF  165
            +E+++FK+TGR+KF
Sbjct  256  SEQKRFKDTGRVKF  269



>dbj|BAA88668.1| ETAG-A3 [Solanum lycopersicum]
Length=314

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/285 (55%), Positives = 203/285 (71%), Gaps = 10/285 (4%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++ T+ F++G++ L+G  N++      SV + L+  +G+GF S DLY HG FSA IKLP 
Sbjct  8     NLETSSFNEGYSQLFGHDNLMVIQDGKSVHISLDERTGAGFVSQDLYLHGLFSASIKLPE  67

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DYTAG+VVAFY +N D+FEK HDE+DFEFLGN++ K WR QTN+YGNGST+ G EERY L
Sbjct  68    DYTAGVVVAFYMSNGDMFEKNHDEIDFEFLGNIRAKNWRIQTNIYGNGSTNVGGEERYGL  127

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
             WFDP+++FH Y+ILWT+  IIFY+D+VPIRE+ R +AM  DFP KPM LY TIWD S WA
Sbjct  128   WFDPTEDFHTYTILWTDSHIIFYVDNVPIREIKRTQAMSEDFPSKPMSLYGTIWDGSSWA  187

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADF-ANV  321
             T+GG+YKVNYKYAP+VA F+D VL GC  DP++           CD    L+ A     +
Sbjct  188   TNGGKYKVNYKYAPYVAKFSDFVLHGCGVDPIELSP-------KCD--IVLDSASIPTRI  238

Query  320   TPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             +P QRR M+RFR K++ YSYCYD  RY VP  ECVID  E  + +
Sbjct  239   SPDQRRKMERFRNKYLQYSYCYDRTRYNVPQSECVIDPKEANRLR  283



>dbj|BAK07675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   341 bits (874),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/271 (59%), Positives = 193/271 (71%), Gaps = 16/271 (6%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             F +G+T L+G+SN+        V + L+  +GSGF S   Y HGFFSA IKLPSDY AG+
Sbjct  41    FREGYTQLFGDSNLRLHGDGKRVHISLDERTGSGFASQGAYFHGFFSASIKLPSDYAAGV  100

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N DV+EKTHDELDFEFLGNV+GK WR QTN+YG+GST+ GREERY LWFDP+ 
Sbjct  101   VVAFYMSNGDVYEKTHDELDFEFLGNVRGKEWRVQTNVYGDGSTAVGREERYGLWFDPTH  160

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             +FHRY+ILWTN+TI+FY+D  PIRE++R+EAMG  FP KPM LYATIWD S WATSGGRY
Sbjct  161   DFHRYAILWTNRTIVFYVDGTPIREVVRSEAMGAQFPSKPMSLYATIWDGSSWATSGGRY  220

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             KV YKYAP+VA FTDL LRGCA+                 DR +    +   +  +QR A
Sbjct  221   KVEYKYAPYVAEFTDLELRGCAS----------------HDRAQPASCEPEGMPARQRAA  264

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
             M+R R +HM Y YCYD  RY  P PEC + A
Sbjct  265   MERVRARHMTYGYCYDRARYPAPLPECRVGA  295



>gb|ACN35866.1| unknown [Zea mays]
Length=345

 Score =   341 bits (875),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 214/297 (72%), Gaps = 7/297 (2%)
 Frame = -1

Query  1049  AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKI  870
             A+AFDV T  F++GF+ L+G+ N++RS+ D SVRL L+  SGSGF SSD Y HGFFSA I
Sbjct  26    ASAFDVPTVAFEEGFSPLFGDGNLVRSSDDRSVRLLLDRRSGSGFISSDYYLHGFFSASI  85

Query  869   KLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREE  690
             KLP DYTAG+VVAFY +N DV+EKTHDELDFEFLG+  G  WR QTN+YGNGSTSRGREE
Sbjct  86    KLPKDYTAGVVVAFYLSNGDVYEKTHDELDFEFLGSRWGGQWRVQTNVYGNGSTSRGREE  145

Query  689   RYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDA  510
             RYLL FDP+ E H YSILW    IIFY+DD PIRE+IR+  MGGDFP KPM +YATIWD 
Sbjct  146   RYLLPFDPTVEAHSYSILWAPTHIIFYVDDTPIREVIRHPDMGGDFPAKPMAVYATIWDG  205

Query  509   SDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGC--DDRRELEGA  336
             S WAT GG+YKVNYKYAPF + F++L + G  ADP+  V    P   G    D   L  A
Sbjct  206   SAWATDGGKYKVNYKYAPFASDFSELAVVGSRADPVLRV----PRRDGAAHQDLLALMTA  261

Query  335   DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPP-PECVIDAAERQQFKETGRLK  168
             D+A VTP++R AM+ FR + M Y+ CYD+VRYA  P PEC     ER+ F   G  K
Sbjct  262   DYAVVTPRKRAAMRAFRARQMTYTVCYDAVRYADGPFPECDNSDEERESFSAWGESK  318



>ref|NP_001130874.1| hypothetical protein precursor [Zea mays]
 gb|ACF79249.1| unknown [Zea mays]
 gb|AFW72908.1| hypothetical protein ZEAMMB73_758929 [Zea mays]
Length=345

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 214/297 (72%), Gaps = 7/297 (2%)
 Frame = -1

Query  1049  AAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKI  870
             A+AFDV T  F++GF+ L+G+ N++RS+ D SVRL L+  SGSGF SSD Y HGFFSA I
Sbjct  26    ASAFDVPTVAFEEGFSPLFGDGNLVRSSDDRSVRLLLDRRSGSGFISSDYYLHGFFSASI  85

Query  869   KLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREE  690
             KLP DYTAG+VVAFY +N DV+EKTHDELDFEFLG+  G  WR QTN+YGNGSTSRGREE
Sbjct  86    KLPKDYTAGVVVAFYLSNGDVYEKTHDELDFEFLGSRWGGQWRVQTNVYGNGSTSRGREE  145

Query  689   RYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDA  510
             RYLL FDP+ E H YSILW    IIFY+DD PIRE+IR+  MGGDFP KPM +YATIWD 
Sbjct  146   RYLLPFDPTVEAHSYSILWAPTHIIFYVDDTPIREVIRHPDMGGDFPAKPMAVYATIWDG  205

Query  509   SDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGC--DDRRELEGA  336
             S WAT GG+YKVNYKYAPF + F++L + G  ADP+  V    P   G    D   L  A
Sbjct  206   SAWATDGGKYKVNYKYAPFASDFSELAVVGSRADPVLRV----PRRDGAAHQDLLALMTA  261

Query  335   DFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPP-PECVIDAAERQQFKETGRLK  168
             D+A VTP++R AM+ FR + M Y+ CYD+VRYA  P PEC     ER+ F   G  K
Sbjct  262   DYAVVTPRKRAAMRAFRARQMTYTVCYDAVRYADGPFPECDNSDEERESFSAWGESK  318



>gb|AAD45125.1|AF163821_1 endoxyloglucan transferase [Arabidopsis thaliana]
Length=333

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 207/294 (70%), Gaps = 7/294 (2%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             A  ++  T F++ +T L+G+ N+       SVRL L+  +GSGF S+D Y HGFFSA IK
Sbjct  22    ALQNLPITSFEESYTQLFGDKNLFVHQDGKSVRLTLDERTGSGFVSNDYYLHGFFSASIK  81

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LPSDYTAG+VVAFY +N D++EK HDE+DFEFLGN++ K WR QTN+YGNGST  GREER
Sbjct  82    LPSDYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREER  141

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDP+++FH+YSILW++  IIF++D+VPIRE+ R   MGG FP KPM LY TIWD S
Sbjct  142   YNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTAQMGGHFPSKPMSLYTTIWDGS  201

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFA  327
              WAT+GG+Y VNYKYAP++A F+DLVL GC  DP+++        G  +D R  +     
Sbjct  202   KWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQF--PRCDEGAAEDMRAAQ-----  254

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              +TP QR  M  FR++ M YSYCYD  RY V   ECV++ AE Q+ +    ++F
Sbjct  255   EITPSQRSKMDVFRRRLMTYSYCYDRARYNVALSECVVNPAEAQRLRVYDPVRF  308



>ref|NP_178294.1| endoxyloglucan transferase A3 [Arabidopsis thaliana]
 sp|Q8LDS2.2|XTH27_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 27; Short=At-XTH27; Short=XTH-27; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA20289.1| endoxyloglucan transferase related protein [Arabidopsis thaliana]
 gb|AAD21783.1| xyloglucan endotransglycosylase (EXGT-A3) [Arabidopsis thaliana]
 gb|AAL24392.1| putative xyloglucan-specific glucanase [Arabidopsis thaliana]
 gb|AAP68259.1| At2g01850 [Arabidopsis thaliana]
 gb|AEC05508.1| endoxyloglucan transferase A3 [Arabidopsis thaliana]
Length=333

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 207/294 (70%), Gaps = 7/294 (2%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             A  ++  T F++ +T L+G+ N+       SVRL L+  +GSGF S+D Y HGFFSA IK
Sbjct  22    ALQNLPITSFEESYTQLFGDKNLFVHQDGKSVRLTLDERTGSGFVSNDYYLHGFFSASIK  81

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LPSDYTAG+VVAFY +N D++EK HDE+DFEFLGN++ K WR QTN+YGNGST  GREER
Sbjct  82    LPSDYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREER  141

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDP+++FH+YSILW++  IIF++D+VPIRE+ R   MGG FP KPM LY TIWD S
Sbjct  142   YNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTAEMGGHFPSKPMSLYTTIWDGS  201

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFA  327
              WAT+GG+Y VNYKYAP++A F+DLVL GC  DP+++        G  +D R  +     
Sbjct  202   KWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQF--PRCDEGAAEDMRAAQ-----  254

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              +TP QR  M  FR++ M YSYCYD  RY V   ECV++ AE Q+ +    ++F
Sbjct  255   EITPSQRSKMDVFRRRLMTYSYCYDRARYNVALSECVVNPAEAQRLRVYDPVRF  308



>gb|AAM63050.1| putative xyloglucan-specific glucanase [Arabidopsis thaliana]
Length=333

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 207/294 (70%), Gaps = 7/294 (2%)
 Frame = -1

Query  1046  AAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIK  867
             A  ++  T F++ +T L+G+ N+       SVRL L+  +GSGF S+D Y HGFFSA IK
Sbjct  22    ALQNLPITSFEESYTQLFGDKNLFVHQDGKSVRLTLDERTGSGFVSNDYYLHGFFSASIK  81

Query  866   LPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREER  687
             LPSDYTAG+VVAFY +N D++EK HDE+DFEFLGN++ K WR QTN+YGNGST  GREER
Sbjct  82    LPSDYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREER  141

Query  686   YLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDAS  507
             Y LWFDP+++FH+YSILW++  IIF++D+VPIRE+ R   MGG FP KPM LY TIWD S
Sbjct  142   YNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTAEMGGHFPSKPMSLYTTIWDGS  201

Query  506   DWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFA  327
              WAT+GG+Y VNYKYAP++A F+DLVL GC  DP+++        G  +D R  +     
Sbjct  202   KWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQF--PRCDEGAAEDIRAAQ-----  254

Query  326   NVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
              +TP QR  M  FR++ M YSYCYD  RY V   ECV++ AE Q+ +    ++F
Sbjct  255   EITPSQRSKMDVFRRRLMTYSYCYDRARYNVALSECVVNPAEAQRLRVYDPVRF  308



>ref|XP_009145277.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Brassica rapa]
Length=278

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 181/224 (81%), Gaps = 7/224 (3%)
 Frame = -1

Query  833  AFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSKEF  654
            AFYT+N DVF+KTHDELD EFLGN+KGKPWRFQTN+YGNGST RGREERY LWFDPSKEF
Sbjct  32   AFYTSNGDVFQKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTPRGREERYRLWFDPSKEF  91

Query  653  HRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRYKV  474
            HRYSILWT   IIF++DDVPIRE+IR+EAMG D+P KPM LYATIWDASDWATSGG+YK 
Sbjct  92   HRYSILWTPHKIIFWVDDVPIREVIRSEAMGADYPAKPMALYATIWDASDWATSGGKYKA  151

Query  473  NYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE-LEGADFANVTPKQRRAM  297
            NYK+APFVA F    L GC+ DP+QEV  +      C D  E LE  D++ +   QR AM
Sbjct  152  NYKFAPFVAEFKSFSLDGCSVDPIQEVPVD------CADSVEFLESQDYSAINSHQRAAM  205

Query  296  KRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETGRLKF  165
            +RFRQ+ MYYSYCYD+VRY  PPPECVI  AE+ +F++TGRLKF
Sbjct  206  RRFRQRFMYYSYCYDTVRYPEPPPECVIVPAEKVRFRDTGRLKF  249



>ref|XP_002465580.1| hypothetical protein SORBIDRAFT_01g041510 [Sorghum bicolor]
 gb|EER92578.1| hypothetical protein SORBIDRAFT_01g041510 [Sorghum bicolor]
Length=341

 Score =   339 bits (870),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 198/281 (70%), Gaps = 3/281 (1%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             F +G+T L+G+SN+        V + L+  +G+GF S   Y HG FSA+IKLP+D+TAG+
Sbjct  41    FGEGYTQLFGDSNLALHGGGKRVHISLDERTGAGFASQAAYLHGSFSARIKLPADHTAGV  100

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N DV+E+THDELDFEFLGNV+G+ WR QTN+YGNGST+ GREERY L FDP++
Sbjct  101   VVAFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYGNGSTAVGREERYGLPFDPTE  160

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             +FHRY+I W+   IIFY+DD PIRE++R EAMG  FP KPM LYATIWD S WATSGGRY
Sbjct  161   DFHRYAIHWSRHRIIFYVDDTPIREVVRTEAMGAQFPSKPMSLYATIWDGSSWATSGGRY  220

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             KV+YKYAP+VA F DL LRGCA  P        PG    DD      AD   ++P +R A
Sbjct  221   KVDYKYAPYVAEFADLALRGCAVGPASASACATPGSASDDDDAYGRAAD--AISPARRSA  278

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETG  177
             M+ FR ++M Y YCYD +RY  P PEC +  AE   F  +G
Sbjct  279   MEAFRARYMTYGYCYDRLRYPAPLPECSV-GAEAAAFLPSG  318



>ref|XP_002454441.1| hypothetical protein SORBIDRAFT_04g031050 [Sorghum bicolor]
 gb|EES07417.1| hypothetical protein SORBIDRAFT_04g031050 [Sorghum bicolor]
Length=351

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 214/299 (72%), Gaps = 3/299 (1%)
 Frame = -1

Query  1061  LSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFF  882
             ++ +A+AFDV +  F++ F+ L+G+ N++RS+ D SVRL L+  SGSGF SSD Y HGFF
Sbjct  24    VAASASAFDVPSVAFEERFSPLFGDGNVVRSSDDRSVRLLLDRRSGSGFISSDYYLHGFF  83

Query  881   SAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSR  702
             SA IKLP DYTAG+VVAFY +N DV+EKTHDELDFEFLG+  G  WR QTN+YGNGSTS 
Sbjct  84    SASIKLPKDYTAGVVVAFYLSNGDVYEKTHDELDFEFLGSRWGGQWRVQTNVYGNGSTSH  143

Query  701   GREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYAT  522
             GREERYLL FDP+ E H YSILW    IIFYIDD PIRE+IR+  MGGDFP KPM +YAT
Sbjct  144   GREERYLLPFDPTLEAHSYSILWAPTHIIFYIDDTPIREVIRHPDMGGDFPAKPMAVYAT  203

Query  521   IWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELE  342
             IWD S WAT GG+YKVNYKYAPF + F++L + G  ADP+  V   H       D   L 
Sbjct  204   IWDGSAWATDGGKYKVNYKYAPFASDFSELAVVGFRADPVLRVAHRHGARQA--DLLGLM  261

Query  341   GADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPP-PECVIDAAERQQFKETGRLK  168
              AD+A +TP++R AM+ FR + M Y+ CYD+VRYA  P PEC     ER+ F   G  K
Sbjct  262   TADYAVMTPQKRAAMRAFRARQMTYTVCYDAVRYADGPFPECDNSDEERESFSAWGESK  320



>ref|XP_004953564.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Setaria italica]
Length=350

 Score =   337 bits (865),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 176/291 (60%), Positives = 208/291 (71%), Gaps = 2/291 (1%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             DV T  FD+ F+ L+G+ N++RS+ D SVRL L+  SGSGF SSD Y HGFFSA IKLP 
Sbjct  29    DVPTVAFDERFSPLFGDGNLVRSSDDRSVRLLLDRRSGSGFISSDYYLHGFFSASIKLPK  88

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DYTAG+VVAFY +N DV+EKTHDELDFEFLG+  G  WR QTN+YGNGSTS GREERYLL
Sbjct  89    DYTAGVVVAFYLSNGDVYEKTHDELDFEFLGSRWGGQWRVQTNVYGNGSTSHGREERYLL  148

Query  677   WFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWA  498
              FDP+ E HRYS+LW    IIFYIDD PIRE+IR+  MGGDFP KPM +YATIWD S WA
Sbjct  149   PFDPTLEAHRYSVLWAPTHIIFYIDDTPIREVIRHPDMGGDFPAKPMAVYATIWDGSAWA  208

Query  497   TSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVT  318
             T GG+YKVNYKYAPF + F+DL + G  ADP+        G G   D   L  AD+A +T
Sbjct  209   TEGGKYKVNYKYAPFASEFSDLAVVGPRADPVLRFP-RRAGAGADQDLLGLMTADYAVMT  267

Query  317   PKQRRAMKRFRQKHMYYSYCYDSVRYAVPP-PECVIDAAERQQFKETGRLK  168
             P++R AM+ FR + M Y+ CYD+VRYA  P PEC     ER+ F   G  K
Sbjct  268   PQKRAAMRAFRARQMTYTVCYDAVRYASGPFPECDNSDEERENFSAWGESK  318



>gb|AGT17403.1| hypothetical protein SHCRBa_230_N09_R_40 [Saccharum hybrid cultivar 
R570]
Length=333

 Score =   336 bits (862),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/281 (56%), Positives = 197/281 (70%), Gaps = 9/281 (3%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             F +G+T L+G+SN+        V + L+  +G+GF     Y HG FSA+IKLP+D+TAG+
Sbjct  39    FGEGYTQLFGDSNLALHGGGKRVHISLDERTGAGF----AYLHGHFSARIKLPADHTAGV  94

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFY +N DV+E+THDELDFEFLGNV+G+ WR QTN+YGNGST+ GREERY LWFDP++
Sbjct  95    VVAFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYGNGSTAVGREERYGLWFDPTE  154

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             +FHRY+I W+   IIFY+DD PIRE++R EAMG  FP KPM LYATIWD S WATSGGRY
Sbjct  155   DFHRYAIHWSRHRIIFYVDDTPIREVVRTEAMGAQFPSKPMSLYATIWDGSSWATSGGRY  214

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             KV+YKYAP+VA F DL LRGCA  P        PG    DD         A ++P +R A
Sbjct  215   KVDYKYAPYVAEFADLALRGCAVGPASATACATPGSASDDDAY----GHAAAISPARRSA  270

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFKETG  177
             M+ FR ++M Y YCYD +RY  P PEC +  AE   F  +G
Sbjct  271   MEAFRARYMTYGYCYDRLRYPAPLPECSV-GAEAAAFLPSG  310



>ref|XP_003561836.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27 [Brachypodium distachyon]
Length=328

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 203/287 (71%), Gaps = 18/287 (6%)
 Frame = -1

Query  1067  AFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHG  888
               LS  AAA       F++G+T L+G+SN+        V + L+  +G+GF S   Y HG
Sbjct  32    GLLSRPAAA----ALSFEEGYTQLFGDSNLRLHGDGKRVHISLDERTGAGFASQGAYLHG  87

Query  887   FFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGST  708
             FFSA+IKLPSDY AG+VVAFY TN DV+EKTHDELDFEFLGNV+GK WR QTN+YG+GST
Sbjct  88    FFSARIKLPSDYAAGVVVAFYMTNGDVYEKTHDELDFEFLGNVRGKEWRVQTNVYGDGST  147

Query  707   SRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLY  528
             S GREERY L FDP++++HRY+ILWTN+TI+FY+D+ PIRE++R+EAMG  FP KPM LY
Sbjct  148   SVGREERYGLPFDPTQDYHRYAILWTNRTIVFYVDETPIREVVRSEAMGLQFPSKPMSLY  207

Query  527   ATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRE  348
             ATIWD S WATSGGRYKV+YKYAP+VA F DL+LRGCA+             G C    E
Sbjct  208   ATIWDGSSWATSGGRYKVDYKYAPYVAEFDDLLLRGCAS--------SSSSTGAC----E  255

Query  347   LEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDA  207
             L   D+ +    +R AM+RFR +H+ Y YCYD  RY  P  EC + A
Sbjct  256   LPEEDYMD--SGERSAMERFRARHLTYGYCYDRARYPAPLSECRVGA  300



>ref|NP_001051939.1| Os03g0854600 [Oryza sativa Japonica Group]
 gb|AAO66525.1| putative endoxyloglucan transferase [Oryza sativa Japonica Group]
 gb|ABF99964.1| xyloglucan endotransglucosylase/hydrolase protein 28precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13853.1| Os03g0854600 [Oryza sativa Japonica Group]
 gb|EAZ29353.1| hypothetical protein OsJ_13419 [Oryza sativa Japonica Group]
 dbj|BAG96802.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   335 bits (859),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/307 (54%), Positives = 211/307 (69%), Gaps = 6/307 (2%)
 Frame = -1

Query  1070  IAFLSYTAAAFD-VTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYS  894
             +A  S  A+ F+ V T  FD+GF+ L+GE N+++S    +V + LN  +GSGF SSD Y 
Sbjct  18    LAPASLAASGFEEVPTIAFDEGFSPLFGEDNMVKSADGRTVSITLNRYTGSGFISSDYYH  77

Query  893   HGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNG  714
             HGFFSA IKLP D+TAG+VVAFY +N DVFEKTHDELDFEFLGN     W+ QTN+YGNG
Sbjct  78    HGFFSASIKLPKDHTAGVVVAFYLSNGDVFEKTHDELDFEFLGNRYRHEWKMQTNVYGNG  137

Query  713   STSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMG  534
             ST RGREERYL+ FDP+ + HR+SILW ++ I+FY+D VPIRE+ R  AMG D+P KPM 
Sbjct  138   STDRGREERYLMPFDPTADAHRFSILWHSRLIVFYVDGVPIREVPRTAAMGADYPSKPMA  197

Query  533   LYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR  354
             LY TIWD S WAT  G+YKVNYK  PF A F+DLVLRGC A     +         C   
Sbjct  198   LYVTIWDGSTWATDNGKYKVNYKRGPFTAVFSDLVLRGCTARSDIRLATTADDQDRCAAA  257

Query  353   RE--LEGADFAN---VTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              E  +E  ++++   +T ++R AM+RFRQ+ M Y+ CYD+ RY  P PEC ++ AERQ +
Sbjct  258   EEDLMESDEYSSTMAMTARKRMAMRRFRQRQMLYTVCYDTNRYPEPFPECDVNMAERQMY  317

Query  188   KETGRLK  168
              + G  K
Sbjct  318   WQWGESK  324



>gb|EAY92640.1| hypothetical protein OsI_14384 [Oryza sativa Indica Group]
Length=361

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/307 (54%), Positives = 211/307 (69%), Gaps = 6/307 (2%)
 Frame = -1

Query  1070  IAFLSYTAAAFD-VTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYS  894
             +A  S  A+ F+ V T  FD+GF+ L+GE N+++S    +V + LN  +GSGF SSD Y 
Sbjct  18    LAPASLAASGFEEVPTIAFDEGFSPLFGEDNMVKSADGRTVSITLNRYTGSGFISSDYYH  77

Query  893   HGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNG  714
             HGFFSA IKLP D+TAG+VVAFY +N DVFEKTHDELDFEFLGN     W+ QTN+YGNG
Sbjct  78    HGFFSASIKLPKDHTAGVVVAFYLSNGDVFEKTHDELDFEFLGNRYRHEWKMQTNVYGNG  137

Query  713   STSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMG  534
             ST RGREERYL+ FDP+ + HR+SILW ++ I+FY+D VPIRE+ R  AMG D+P KPM 
Sbjct  138   STDRGREERYLMPFDPTADAHRFSILWHSRLIVFYVDGVPIREVPRTAAMGADYPSKPMA  197

Query  533   LYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDR  354
             LY TIWD S WAT  G+YKVNYK  PF A F+DLVLRGC A     +         C   
Sbjct  198   LYVTIWDGSTWATDNGKYKVNYKRGPFTAVFSDLVLRGCTARSDIRLATTADDQDRCAAA  257

Query  353   RE--LEGADFAN---VTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              E  +E  ++++   +T ++R AM+RFRQ+ M Y+ CYD+ RY  P PEC ++ AERQ +
Sbjct  258   EEDLMESDEYSSTMAMTARKRMAMRRFRQRQMLYTVCYDTNRYPEPFPECDVNMAERQMY  317

Query  188   KETGRLK  168
              + G  K
Sbjct  318   WQWGESK  324



>ref|XP_006650922.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30-like [Oryza brachyantha]
Length=363

 Score =   332 bits (852),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/307 (53%), Positives = 207/307 (67%), Gaps = 5/307 (2%)
 Frame = -1

Query  1073  LIAFLSYTAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYS  894
             ++A  S      DV T  F++GF+ L+GE N+ +S    +V + LN  +GSGF SSD Y 
Sbjct  23    MVAVRSAADGLEDVPTIAFEEGFSPLFGEDNMEKSADGRTVSITLNRYTGSGFISSDYYH  82

Query  893   HGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNG  714
             HGFFSA IKLP D+TAG+VVAFY +N DVFEKTHDELDFEFLGN     W+ QTN+YGNG
Sbjct  83    HGFFSASIKLPKDHTAGVVVAFYLSNGDVFEKTHDELDFEFLGNRYRHEWKMQTNVYGNG  142

Query  713   STSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMG  534
             ST RGREERYL+ FDP+ + HR+SILW+++ I+FY+D VPIRE+ R+ AMG D+P KPM 
Sbjct  143   STDRGREERYLMPFDPTADAHRFSILWSSRLIVFYVDGVPIREVPRSPAMGADYPSKPMA  202

Query  533   LYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADP---LQEVVGEHPGVGGC  363
             LY TIWD S WAT  G+YKVNYK  PF A F+DLVLRGC A     L  V  +       
Sbjct  203   LYVTIWDGSTWATDNGKYKVNYKRGPFTAVFSDLVLRGCRARSDIRLASVSADEQDRCAA  262

Query  362   DDRRELEGADFANVTPKQRRAMKR--FRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
             ++  EL  A +A +T ++R AM+R       M Y+ CYD+ RY  P PEC ++ AERQ +
Sbjct  263   EEEEELMSASYATMTARKRLAMRRGGGGGGQMLYTVCYDTNRYPEPFPECDVNMAERQMY  322

Query  188   KETGRLK  168
              + G  K
Sbjct  323   WQWGESK  329



>ref|XP_004985060.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 27-like [Setaria italica]
Length=333

 Score =   331 bits (849),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 196/273 (72%), Gaps = 15/273 (5%)
 Frame = -1

Query  1031  TTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDY  852
             T+  F +G+T L+G+SN+        V + L+  +G+GF S   Y HG FSA+IKLP+D+
Sbjct  40    TSLSFREGYTQLFGDSNLALHGDGKRVHITLDERTGAGFASQGAYLHGLFSARIKLPADH  99

Query  851   TAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWF  672
             TAG+VVAFY +N DV+E+THDELDFEFLGNV+G+ WR QTN+YGNGST+ GREERY LWF
Sbjct  100   TAGVVVAFYMSNGDVYERTHDELDFEFLGNVRGREWRVQTNVYGNGSTAAGREERYGLWF  159

Query  671   DPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATS  492
             DP+++FHRY+ILW++  IIFY+D+ PIRE++R  +MG  FP KPM LYATIWD S WATS
Sbjct  160   DPTEDFHRYAILWSHDRIIFYVDETPIREVVRTGSMGAQFPSKPMSLYATIWDGSSWATS  219

Query  491   GGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPK  312
             GGRYKV+YKYAP+VA F DL LRGCA            G   C++     G+    ++P 
Sbjct  220   GGRYKVDYKYAPYVAEFADLALRGCAV-----------GRRACEE----PGSAATAMSPA  264

Query  311   QRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVI  213
             +R AM+ FR ++M Y YCYD +RY  P PEC +
Sbjct  265   ERSAMEAFRARYMTYGYCYDRLRYLAPLPECSV  297



>ref|XP_003572846.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 30 [Brachypodium distachyon]
Length=345

 Score =   332 bits (850),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 206/295 (70%), Gaps = 11/295 (4%)
 Frame = -1

Query  1040  FDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLP  861
             FDV +  F +GF+ L+G+ N+ R+  D + RL L+  SGSGF SSD Y HGFFSA IKLP
Sbjct  26    FDVPSVAFGEGFSPLFGDGNLARTPDDRTARLSLDRRSGSGFISSDYYLHGFFSASIKLP  85

Query  860   SDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYL  681
              DYTAG+VVAFY +N DV+EKTHDELDFEFLG+  G  WR QTN+YGNGSTSRGREERYL
Sbjct  86    KDYTAGVVVAFYLSNGDVYEKTHDELDFEFLGSRWGGQWRVQTNVYGNGSTSRGREERYL  145

Query  680   LWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDW  501
             L FDP+ E HRYSILW    IIFY+DD PIRE+IR+  MGGDFP KPM +YATIWD S W
Sbjct  146   LPFDPTVEAHRYSILWAPTHIIFYVDDTPIREVIRHAGMGGDFPAKPMAVYATIWDGSAW  205

Query  500   ATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEG---ADF  330
             AT GG+YKVNYKYAPF + F+DL L GC       V   H   GG     EL G   AD+
Sbjct  206   ATEGGKYKVNYKYAPFASDFSDLALHGC------RVAATHD-AGGASSGCELLGLMTADY  258

Query  329   ANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPP-PECVIDAAERQQFKETGRLK  168
             A +TP++R AM+ FR + M Y+ CYD+ RYA  P PEC     E++ F   G  K
Sbjct  259   AVMTPRKRAAMRAFRARQMTYTVCYDAARYAAGPFPECDNSDQEKEAFWAWGESK  313



>gb|ACF80442.1| unknown [Zea mays]
 gb|AFW72907.1| hypothetical protein ZEAMMB73_758929 [Zea mays]
Length=322

 Score =   330 bits (847),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 171/274 (62%), Positives = 204/274 (74%), Gaps = 6/274 (2%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
              A+AFDV T  F++GF+ L+G+ N++RS+ D SVRL L+  SGSGF SSD Y HGFFSA 
Sbjct  25    AASAFDVPTVAFEEGFSPLFGDGNLVRSSDDRSVRLLLDRRSGSGFISSDYYLHGFFSAS  84

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLP DYTAG+VVAFY +N DV+EKTHDELDFEFLG+  G  WR QTN+YGNGSTSRGRE
Sbjct  85    IKLPKDYTAGVVVAFYLSNGDVYEKTHDELDFEFLGSRWGGQWRVQTNVYGNGSTSRGRE  144

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERYLL FDP+ E H YSILW    IIFY+DD PIRE+IR+  MGGDFP KPM +YATIWD
Sbjct  145   ERYLLPFDPTVEAHSYSILWAPTHIIFYVDDTPIREVIRHPDMGGDFPAKPMAVYATIWD  204

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGC--DDRRELEG  339
              S WAT GG+YKVNYKYAPF + F++L + G  ADP+  V    P   G    D   L  
Sbjct  205   GSAWATDGGKYKVNYKYAPFASDFSELAVVGSRADPVLRV----PRRDGAAHQDLLALMT  260

Query  338   ADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYA  237
             AD+A VTP++R AM+ FR + M Y+ CYD+VRYA
Sbjct  261   ADYAVVTPRKRAAMRAFRARQMTYTVCYDAVRYA  294



>ref|XP_002529962.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
 gb|EEF32405.1| Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, 
putative [Ricinus communis]
Length=297

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 210/283 (74%), Gaps = 7/283 (2%)
 Frame = -1

Query  1031  TTTPFDQGFTTLYGESNIL-RSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSD  855
             TT+ F+Q F+ L+G+++I+      +SV++ L+  +GSGF S   Y + +FSA IKLP+D
Sbjct  18    TTSTFNQSFSRLFGDNHIVFLDDEGNSVQISLDQSTGSGFMSRVYYYYAYFSASIKLPAD  77

Query  854   YTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLW  675
             YTAG+VV FYT+N+++++  HDELDFEFLGNV+G+ W  QTN+YGNGSTSRGREERY LW
Sbjct  78    YTAGVVVTFYTSNSNIYQNFHDELDFEFLGNVRGQNWVVQTNVYGNGSTSRGREERYNLW  137

Query  674   FDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWAT  495
             FDP+++ H YSILW ++ IIFY+D+VPIRE+ R +AMGGDFP KPM LYATIWD S WAT
Sbjct  138   FDPTQDSHTYSILWVSKWIIFYVDNVPIREIRRVDAMGGDFPSKPMSLYATIWDGSSWAT  197

Query  494   SGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTP  315
              GG+YKVNY+YAPF+A ++D VL GC+ +P Q+    H  +G      +L  A F+ +T 
Sbjct  198   GGGKYKVNYQYAPFIAMYSDFVLYGCSVNPTQKAQACHEDIGS-----DLN-ATFSGLTS  251

Query  314   KQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
             +++  MK FR K++ YSYC D  RY+ P PECVID  E ++ +
Sbjct  252   QEKMRMKNFRSKYLKYSYCDDRARYSTPLPECVIDPQEARKLQ  294



>gb|AFW72906.1| hypothetical protein ZEAMMB73_758929 [Zea mays]
Length=322

 Score =   328 bits (842),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/274 (62%), Positives = 203/274 (74%), Gaps = 6/274 (2%)
 Frame = -1

Query  1052  TAAAFDVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAK  873
              A+AFDV T  F++GF+ L+G+ N++RS+ D SVRL L+  SGSGF SSD Y HGFFSA 
Sbjct  25    AASAFDVPTVAFEEGFSPLFGDGNLVRSSDDRSVRLLLDRRSGSGFISSDYYLHGFFSAS  84

Query  872   IKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGRE  693
             IKLP DYTAG+VVAFY +N DV+EKTHDELDFEFLG+  G  WR QTN+YGNGSTSRGRE
Sbjct  85    IKLPKDYTAGVVVAFYLSNGDVYEKTHDELDFEFLGSRWGGQWRVQTNVYGNGSTSRGRE  144

Query  692   ERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             ERYLL FDP+ E H YSILW    IIFY+DD PIRE+IR+  MGGDFP KPM +YATIWD
Sbjct  145   ERYLLPFDPTVEAHSYSILWAPTHIIFYVDDTPIREVIRHPDMGGDFPAKPMAVYATIWD  204

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGC--DDRRELEG  339
              S WAT GG+YKVNYKYAPF + F++L + G  ADP+  V    P   G    D   L  
Sbjct  205   GSAWATDGGKYKVNYKYAPFASDFSELAVVGSRADPVLRV----PRRDGAAHQDLLALMT  260

Query  338   ADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYA  237
             AD+A VTP++R AM+ FR + M Y+ CYD+VRY 
Sbjct  261   ADYAVVTPRKRAAMRAFRARQMTYTVCYDAVRYG  294



>emb|CDY09410.1| BnaA02g26000D [Brassica napus]
Length=335

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/289 (53%), Positives = 201/289 (70%), Gaps = 15/289 (5%)
 Frame = -1

Query  1037  DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPS  858
             ++  T F++ +  L+G+ N+       SVRL L+  +GSGF S+DLY HGFFSA IKLPS
Sbjct  25    NLPITSFEESYMQLFGDKNLFVHKDGKSVRLTLDERTGSGFVSNDLYLHGFFSASIKLPS  84

Query  857   DYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLL  678
             DY+AG+VVAFY +N D +EK HDE+DFEFLGN++G+ WR QTN+YGNGST  GREER  L
Sbjct  85    DYSAGVVVAFYMSNGDTYEKNHDEIDFEFLGNIRGREWRIQTNIYGNGSTHLGREERCNL  144

Query  677   WFDPSKEFHRYSI-----LWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWD  513
             WFDP++++H+YSI     LW  +   FY+D+VPIRE+ R   MGGDFP KPM LY TIWD
Sbjct  145   WFDPTEDYHQYSILCLFYLWLCR---FYVDNVPIREVKRTSTMGGDFPSKPMSLYTTIWD  201

Query  512   ASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGAD  333
              S WAT+GG+Y VNYKYAP++A F+DLVL GCA DP+++          CD+        
Sbjct  202   GSKWATNGGKYGVNYKYAPYIARFSDLVLHGCAVDPIEQ-------FPKCDEGAIEYIRA  254

Query  332   FANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQFK  186
                ++  +R  M+ FR+KHM YSYCYD  RY V  PECV++ AE Q+ +
Sbjct  255   AQEISLSERAKMEVFRRKHMTYSYCYDRTRYKVSLPECVVNPAEAQRLR  303



>gb|ABK24235.1| unknown [Picea sitchensis]
Length=352

 Score =   327 bits (837),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 195/267 (73%), Gaps = 3/267 (1%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             F++G+T+L+GE N+  +    +V L L+  +GSG  S D+Y +G FSA IKLP DYTAG+
Sbjct  46    FEEGYTSLFGEDNVKVAEDGKAVMLSLDKRTGSGLLSQDMYMYGLFSASIKLPDDYTAGV  105

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N D+F+ THDELDFEFLGN++GK WR QTN+YGNGST+ GREERY LWFDP++
Sbjct  106   VVAFYTSNGDIFQGTHDELDFEFLGNIRGKEWRIQTNVYGNGSTAFGREERYTLWFDPTE  165

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             +FH+Y+ILWT++  +F++DDVPIRE+ R  AMG  +P KPM +YAT+WD SDWAT GGRY
Sbjct  166   DFHQYTILWTDKRTLFFVDDVPIREIPRTAAMGAHYPSKPMSVYATVWDGSDWATKGGRY  225

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             +VNYKY+PFV   ++LVL GCA DPL++    H      D       + F+ ++  Q+  
Sbjct  226   RVNYKYSPFVVSLSNLVLEGCAVDPLEQF---HTVSCPADTTSSDSLSQFSELSEDQKAL  282

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPEC  219
             M+ FR K++ YSYC D VRY   P +C
Sbjct  283   MEWFRSKYISYSYCDDDVRYPTTPADC  309



>gb|ABK23681.1| unknown [Picea sitchensis]
Length=352

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 195/267 (73%), Gaps = 3/267 (1%)
 Frame = -1

Query  1019  FDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSDYTAGI  840
             F++G+T+L+GE N+  +    +V L L+  +GSG  S D+Y +G FSA IKLP DYTAG+
Sbjct  46    FEEGYTSLFGEDNVKVAEDGKAVMLSLDKRTGSGLLSQDMYMYGLFSASIKLPDDYTAGV  105

Query  839   VVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLWFDPSK  660
             VVAFYT+N D+F+ THDELDFEFLGN++GK WR QTN+YGNGST+ GREERY LWFDP++
Sbjct  106   VVAFYTSNGDIFQGTHDELDFEFLGNIRGKEWRIQTNVYGNGSTAFGREERYTLWFDPTE  165

Query  659   EFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWATSGGRY  480
             +FH+Y+ILWT++  +F++DDVPIRE+ R  AMG  +P KPM +YAT+WD SDWAT GGRY
Sbjct  166   DFHQYTILWTDKRTLFFVDDVPIREIPRTAAMGAHYPSKPMSVYATVWDGSDWATKGGRY  225

Query  479   KVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTPKQRRA  300
             +VNYKY+PFV   ++LVL GCA DPL++    H      D       + F+ ++  Q+  
Sbjct  226   RVNYKYSPFVVSLSNLVLEGCAVDPLEQF---HTVSCPADTTSSDSLSQFSELSEDQKAL  282

Query  299   MKRFRQKHMYYSYCYDSVRYAVPPPEC  219
             M+ FR K++ YSYC D VRY   P +C
Sbjct  283   MEWFRGKYISYSYCDDDVRYPTTPADC  309



>ref|XP_009414090.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=343

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/300 (55%), Positives = 210/300 (70%), Gaps = 10/300 (3%)
 Frame = -1

Query  1085  SAFFLIAFLSYTAAAFD-VTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRS  909
             S  FL  F + +AA  + + T  F++G+  L+G  N++       VR+ L+  +G+GF S
Sbjct  21    SPLFLF-FCNASAALLESLPTLSFEEGYAQLFGGGNLILLRDGKRVRISLDERTGAGFTS  79

Query  908   SDLYSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTN  729
              DLY  GFFSA IKLP+DY AG+VVAFY +N DVF KTHDELDFEFLGN++G+ WR QTN
Sbjct  80    QDLYLQGFFSASIKLPADYAAGVVVAFYMSNGDVFPKTHDELDFEFLGNIRGREWRVQTN  139

Query  728   MYGNGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFP  549
             +YGNGST+ GREERY LWFDP+++FHRYSILW ++ I FYIDD+PIRE +R+EAM G FP
Sbjct  140   VYGNGSTAVGREERYELWFDPTEDFHRYSILWNHERITFYIDDIPIRETVRSEAMAGCFP  199

Query  548   QKPMGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVG  369
              KPM LY+TIWD S WATSGGRYKVNY+YAP+VA F D V+ GCA +P+           
Sbjct  200   SKPMSLYSTIWDGSGWATSGGRYKVNYRYAPYVAEFQDFVIHGCAVNPMDH-------SS  252

Query  368   GCDDRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
              C +R +      + ++P+QR  M  FR++HM Y YCYD  RY  PP EC ID  E +Q+
Sbjct  253   AC-ERPDAAIYGSSTMSPEQRAQMDGFRRRHMTYYYCYDRDRYPTPPAECKIDQIETRQY  311



>ref|XP_008652681.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Zea mays]
 tpg|DAA61339.1| TPA: hypothetical protein ZEAMMB73_897061 [Zea mays]
 tpg|DAA61340.1| TPA: hypothetical protein ZEAMMB73_897061 [Zea mays]
Length=342

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/272 (58%), Positives = 190/272 (70%), Gaps = 8/272 (3%)
 Frame = -1

Query  1034  VTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDLYSHGFFSAKIKLPSD  855
             V    FD+G+T ++G +N+        VRL L+  +G+GF S D++ HGFFSA IKLP+D
Sbjct  39    VRPLAFDEGYTQIFGSANLALLRDGRRVRLTLDESTGAGFASQDVFLHGFFSAAIKLPAD  98

Query  854   YTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYGNGSTSRGREERYLLW  675
             Y AG+VVAFY +N DV+EKTHDELDFEFLGNV+G+ WR QTN+YGNGST  GREERY L 
Sbjct  99    YAAGVVVAFYLSNGDVYEKTHDELDFEFLGNVRGREWRVQTNVYGNGSTDAGREERYDLP  158

Query  674   FDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKPMGLYATIWDASDWAT  495
             FDP+ +FH YSILWT+  IIFY+D+ PIRE++R  AMG  FP KPM LYATIWD S WAT
Sbjct  159   FDPTDDFHHYSILWTSDRIIFYVDETPIREVVRTAAMGAAFPSKPMSLYATIWDGSAWAT  218

Query  494   SGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCDDRRELEGADFANVTP  315
              GGRY+VNYKYAPFVA F DL ++GCA DP  +      G G       L  A  A V+ 
Sbjct  219   LGGRYRVNYKYAPFVAEFADLAIQGCAVDPAADHAVASCGAG-------LGLAPLA-VSA  270

Query  314   KQRRAMKRFRQKHMYYSYCYDSVRYAVPPPEC  219
             +QR AM  FR+ H  YSYC+D  RY V   EC
Sbjct  271   EQRSAMAAFRRAHTSYSYCHDRRRYPVALSEC  302



>ref|XP_009417676.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 28 [Musa acuminata subsp. malaccensis]
Length=341

 Score =   324 bits (830),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/297 (55%), Positives = 211/297 (71%), Gaps = 10/297 (3%)
 Frame = -1

Query  1073  LIAFLSYTAAAF--DVTTTPFDQGFTTLYGESNILRSTSDDSVRLHLNHLSGSGFRSSDL  900
             L  FLS  +A     + T  F+QG+T L+G+ N++       V + L+  +G+GF S DL
Sbjct  21    LSLFLSDASAGVTHSLPTLSFEQGYTQLFGDGNLMLLRDGKRVHISLDERTGAGFASQDL  80

Query  899   YSHGFFSAKIKLPSDYTAGIVVAFYTTNADVFEKTHDELDFEFLGNVKGKPWRFQTNMYG  720
             Y HGFFSA IKLPSDY AG+VVAFY +N DV+ KTHDELDFEFLGN++G+ WR QTN+YG
Sbjct  81    YLHGFFSASIKLPSDYAAGVVVAFYMSNGDVYAKTHDELDFEFLGNIRGREWRVQTNVYG  140

Query  719   NGSTSRGREERYLLWFDPSKEFHRYSILWTNQTIIFYIDDVPIREMIRNEAMGGDFPQKP  540
             NGST+ GREERY LWFDP+++FH+YSI+W ++ IIF ID++PIRE++R  A+GG FP KP
Sbjct  141   NGSTAVGREERYDLWFDPTEDFHQYSIIWNHERIIFSIDNIPIREIVRTGAIGGCFPSKP  200

Query  539   MGLYATIWDASDWATSGGRYKVNYKYAPFVAHFTDLVLRGCAADPLQEVVGEHPGVGGCD  360
             M LYATIWD S WATSGGRYKVNYKYAP+VA F DL++ GCA +P+            C 
Sbjct  201   MTLYATIWDGSTWATSGGRYKVNYKYAPYVAEFEDLIIGGCAVNPMDH-------SSDC-  252

Query  359   DRRELEGADFANVTPKQRRAMKRFRQKHMYYSYCYDSVRYAVPPPECVIDAAERQQF  189
             ++ +   +D   ++ +Q+  M RFR++HM Y YCYD  RY +PPPEC  D  E + F
Sbjct  253   EKPDTAISDSLTMSLEQQALMDRFRRRHMTYYYCYDRDRYPIPPPECNADQIEARLF  309



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3153915041376