BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c87779_g1_i1 len=1015 path=[993:0-1014]

Length=1015
                                                                      Score     E

ref|XP_011084146.1|  PREDICTED: cysteine proteinase inhibitor B       97.1    5e-21   
ref|XP_009588279.1|  PREDICTED: cysteine proteinase inhibitor B-like  95.5    3e-20   
ref|XP_004297057.1|  PREDICTED: cysteine proteinase inhibitor B-like  91.3    8e-19   
gb|EYU28504.1|  hypothetical protein MIMGU_mgv1a016168mg              90.5    1e-18   
ref|XP_006358790.1|  PREDICTED: cysteine proteinase inhibitor B-like  90.5    1e-18   
ref|XP_010101112.1|  Cysteine proteinase inhibitor 10                 90.5    2e-18   
ref|XP_010326957.1|  PREDICTED: cysteine proteinase inhibitor B       89.4    3e-18   
gb|EYU24293.1|  hypothetical protein MIMGU_mgv1a016063mg              89.4    3e-18   
ref|XP_009589279.1|  PREDICTED: cysteine proteinase inhibitor B-like  87.4    2e-17   
ref|XP_009763807.1|  PREDICTED: cysteine proteinase inhibitor B-like  86.3    4e-17   
gb|AEQ54766.1|  cysteine proteinase inhibitor CPI-1                   86.3    5e-17   
gb|KEH20629.1|  cysteine protease inhibitor cystatin                  85.9    6e-17   
ref|XP_009762060.1|  PREDICTED: cysteine proteinase inhibitor B-like  85.9    7e-17   
gb|ABS52572.1|  cysteine proteinase inhibitor                         85.1    8e-17   Gossypium hirsutum [American cotton]
ref|XP_008792948.1|  PREDICTED: cysteine proteinase inhibitor 4       85.1    9e-17   
ref|XP_008365221.1|  PREDICTED: cysteine proteinase inhibitor B-like  84.7    1e-16   
ref|XP_006492987.1|  PREDICTED: cysteine proteinase inhibitor 2-like  85.1    1e-16   
ref|XP_010673372.1|  PREDICTED: cysteine proteinase inhibitor B       85.1    2e-16   
ref|XP_004504436.1|  PREDICTED: cysteine proteinase inhibitor 4-like  84.3    2e-16   
gb|ACK87021.1|  cysteine protease inhibitor                           84.0    2e-16   Gossypium hirsutum [American cotton]
ref|XP_010926673.1|  PREDICTED: cysteine proteinase inhibitor 5       84.0    2e-16   
ref|XP_006421050.1|  hypothetical protein CICLE_v10006584mg           84.0    2e-16   
ref|XP_009371093.1|  PREDICTED: cysteine proteinase inhibitor B       83.6    3e-16   
ref|XP_007034159.1|  Cystatin                                         82.8    6e-16   
ref|XP_002265736.1|  PREDICTED: cysteine proteinase inhibitor 4       83.2    6e-16   Vitis vinifera
ref|XP_008337489.1|  PREDICTED: cysteine proteinase inhibitor B       82.4    7e-16   
gb|ACD85810.1|  cystcine proteinase inhibitor                         82.4    8e-16   Gossypium hirsutum [American cotton]
ref|XP_009373605.1|  PREDICTED: cysteine proteinase inhibitor B-like  82.0    9e-16   
ref|XP_008799565.1|  PREDICTED: cysteine proteinase inhibitor 10-...  84.3    9e-16   
ref|XP_009378164.1|  PREDICTED: cysteine proteinase inhibitor B-like  82.0    1e-15   
ref|XP_010243158.1|  PREDICTED: cysteine proteinase inhibitor 4-like  81.3    3e-15   
ref|XP_004160226.1|  PREDICTED: cysteine proteinase inhibitor B-like  80.5    5e-15   
ref|XP_004138536.1|  PREDICTED: cysteine proteinase inhibitor B-like  80.1    6e-15   
ref|XP_008465470.1|  PREDICTED: cysteine proteinase inhibitor B       79.7    7e-15   
emb|CAJ20032.1|  putative cystatin                                    79.3    8e-15   Zea mays [maize]
ref|XP_003538534.1|  PREDICTED: cysteine proteinase inhibitor 4       79.7    8e-15   
dbj|BAA20464.1|  extracellular insoluble cystatin                     79.7    1e-14   Daucus carota [carrots]
ref|XP_010510121.1|  PREDICTED: cysteine proteinase inhibitor 2-like  79.7    1e-14   
ref|XP_010414055.1|  PREDICTED: cysteine proteinase inhibitor 2-like  79.7    1e-14   
ref|XP_002456830.1|  hypothetical protein SORBIDRAFT_03g043680        79.7    1e-14   Sorghum bicolor [broomcorn]
ref|XP_007223412.1|  hypothetical protein PRUPE_ppa013391mg           79.0    2e-14   
gb|AFK48234.1|  unknown                                               79.0    2e-14   
gb|KHN44464.1|  Cysteine proteinase inhibitor 2                       79.7    2e-14   
ref|XP_010469645.1|  PREDICTED: cysteine proteinase inhibitor 2-like  79.0    2e-14   
ref|NP_001045185.1|  Os01g0915200                                     79.0    3e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76949.1|  hypothetical protein OsI_04907                        79.0    3e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_007163791.1|  hypothetical protein PHAVU_001G264400g           78.2    3e-14   
ref|XP_009402733.1|  PREDICTED: cysteine proteinase inhibitor 4-like  78.6    4e-14   
emb|CDM85644.1|  unnamed protein product                              78.2    6e-14   
gb|ACU17144.1|  unknown                                               77.0    7e-14   Glycine max [soybeans]
ref|XP_010314744.1|  PREDICTED: cysteine proteinase inhibitor B-like  77.4    8e-14   
emb|CAG38126.1|  cystatin Hv-CPI5                                     77.0    1e-13   Hordeum vulgare [barley]
gb|AHV85520.1|  cysteine proteinase inhibitor TrcC-6                  76.6    2e-13   
ref|XP_003552894.1|  PREDICTED: cysteine proteinase inhibitor 4-like  76.3    2e-13   
gb|KDP32576.1|  hypothetical protein JCGZ_13126                       77.4    2e-13   
ref|XP_003564913.1|  PREDICTED: cysteine proteinase inhibitor 4-like  76.6    2e-13   
gb|KHN24041.1|  Cysteine proteinase inhibitor 2                       76.6    2e-13   
pir||JE0308  cysteine proteinase inhibitor - common sunflower         75.5    3e-13
ref|XP_002516375.1|  Cysteine proteinase inhibitor B, putative        75.5    3e-13   Ricinus communis
ref|XP_006349967.1|  PREDICTED: cysteine proteinase inhibitor B-like  75.1    5e-13   
ref|XP_003524913.1|  PREDICTED: cysteine proteinase inhibitor 4-l...  75.1    5e-13   
gb|EMT28873.1|  Cysteine proteinase inhibitor 4                       75.5    5e-13   
ref|XP_010243160.1|  PREDICTED: cysteine proteinase inhibitor 2-like  75.1    5e-13   
ref|XP_010244063.1|  PREDICTED: cysteine proteinase inhibitor B-like  74.3    9e-13   
sp|Q10993.1|CYTB_HELAN  RecName: Full=Cysteine proteinase inhibit...  73.2    1e-12   Helianthus annuus
ref|XP_004971036.1|  PREDICTED: cysteine proteinase inhibitor 4-like  74.7    1e-12   
ref|XP_011024794.1|  PREDICTED: cysteine proteinase inhibitor B-like  73.9    1e-12   
ref|XP_004502264.1|  PREDICTED: cysteine proteinase inhibitor 2-like  73.6    1e-12   
ref|XP_002301749.1|  cystatin family protein                          73.2    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006296241.1|  hypothetical protein CARUB_v10025408mg           73.2    3e-12   
ref|NP_180758.1|  cysteine proteinase inhibitor 2                     73.2    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153801.1|  hypothetical protein PHAVU_003G065700g           72.8    3e-12   
gb|AAM64985.1|  putative cysteine proteinase inhibitor B (cystati...  73.2    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006645220.1|  PREDICTED: cysteine proteinase inhibitor 5-like  72.8    4e-12   
ref|XP_002862941.1|  hypothetical protein ARALYDRAFT_497243           72.4    5e-12   
ref|XP_006840903.1|  hypothetical protein AMTR_s00087p00084520        72.0    5e-12   
ref|XP_006410333.1|  hypothetical protein EUTSA_v10017392mg           72.4    6e-12   
ref|XP_006840905.1|  hypothetical protein AMTR_s00087p00085650        71.6    6e-12   
emb|CDY68279.1|  BnaC04g54180D                                        71.6    8e-12   
ref|XP_009387215.1|  PREDICTED: cysteine proteinase inhibitor 4-like  71.6    1e-11   
ref|XP_010557035.1|  PREDICTED: cysteine proteinase inhibitor 2-like  71.6    1e-11   
emb|CDY42085.1|  BnaA05g11010D                                        70.9    2e-11   
ref|XP_009144029.1|  PREDICTED: cysteine proteinase inhibitor 2-like  70.9    2e-11   
ref|XP_010039949.1|  PREDICTED: cysteine proteinase inhibitor B       70.9    2e-11   
gb|KFK31166.1|  hypothetical protein AALP_AA6G077400                  70.9    2e-11   
ref|NP_001172709.1|  Os01g0915401                                     70.5    2e-11   
ref|XP_010542782.1|  PREDICTED: cysteine proteinase inhibitor 2-like  70.1    3e-11   
gb|AES71980.2|  phloem filament protein PP1                           69.7    4e-11   
ref|XP_003601729.1|  Cysteine proteinase inhibitor                    69.7    4e-11   
ref|XP_010522274.1|  PREDICTED: cysteine proteinase inhibitor 2-like  69.7    4e-11   
ref|XP_006646602.1|  PREDICTED: cysteine proteinase inhibitor 4-like  69.3    7e-11   
ref|XP_009132828.1|  PREDICTED: cysteine proteinase inhibitor 2-like  68.9    8e-11   
ref|XP_009141203.1|  PREDICTED: cysteine proteinase inhibitor 2-like  68.9    8e-11   
emb|CDY62192.1|  BnaCnng39540D                                        68.9    1e-10   
ref|NP_001146946.1|  cysteine proteinase inhibitor B precursor        68.6    2e-10   Zea mays [maize]
gb|AFW84200.1|  putative cystatin                                     68.2    2e-10   
gb|EMT28874.1|  Cysteine proteinase inhibitor 4                       67.8    3e-10   
tpe|CAG29029.1|  TPA: putative cystatin                               67.8    3e-10   
emb|CDX79450.1|  BnaC03g17860D                                        71.2    3e-10   
emb|CDX84749.1|  BnaA03g14810D                                        71.2    3e-10   
ref|XP_002320446.1|  cystatin family protein                          66.6    6e-10   Populus trichocarpa [western balsam poplar]
ref|NP_001052530.1|  Os04g0350100                                     63.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAY93675.1|  hypothetical protein OsI_15462                        62.8    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_003532730.1|  PREDICTED: cysteine proteinase inhibitor 4-like  58.9    2e-07   
gb|ADV02771.1|  cysteine protease inhibitor                           59.3    2e-07   
ref|XP_010522275.1|  PREDICTED: cysteine proteinase inhibitor 2-like  59.3    2e-07   
emb|CAN70300.1|  hypothetical protein VITISV_001398                   59.7    3e-07   Vitis vinifera
ref|XP_001771745.1|  predicted protein                                57.8    7e-07   
ref|XP_007153806.1|  hypothetical protein PHAVU_003G066200g           57.8    9e-07   
emb|CAG38125.1|  cystatin Hv-CPI9                                     57.0    1e-06   Hordeum vulgare [barley]
sp|Q10992.1|CYTA_HELAN  RecName: Full=Cysteine proteinase inhibit...  55.5    2e-06   Helianthus annuus
gb|KDO52834.1|  hypothetical protein CISIN_1g035532mg                 55.5    3e-06   
ref|XP_006346810.1|  PREDICTED: cysteine proteinase inhibitor 5-like  54.7    9e-06   
ref|XP_009141947.1|  PREDICTED: cysteine proteinase inhibitor 3-like  53.1    2e-05   
emb|CDY14750.1|  BnaC04g47470D                                        53.1    2e-05   
emb|CDY06956.1|  BnaA04g23590D                                        53.1    2e-05   
ref|XP_007153810.1|  hypothetical protein PHAVU_003G066600g           52.8    3e-05   
pdb|4N6T|A  Chain A, Adhiron: A Stable And Versatile Peptide Disp...  52.0    3e-05   
ref|XP_009120653.1|  PREDICTED: cysteine proteinase inhibitor 6-like  54.3    3e-05   
gb|AAA96316.1|  cysteine proteinase inhibitor                         53.5    4e-05   Brassica rapa
gb|AFW97773.1|  cysteine protease inhibitor                           53.5    4e-05   
ref|XP_002465058.1|  hypothetical protein SORBIDRAFT_01g031440        52.0    6e-05   Sorghum bicolor [broomcorn]
gb|ABK23108.1|  unknown                                               52.0    6e-05   Picea sitchensis
ref|XP_003561918.1|  PREDICTED: putative cysteine proteinase inhi...  50.8    1e-04   
gb|EPS68642.1|  cysteine proteinase inhibitor                         50.4    1e-04   
gb|ABK21379.1|  unknown                                               51.2    1e-04   Picea sitchensis
dbj|BAA95416.1|  multicystatin                                        52.8    2e-04   Helianthus annuus
ref|XP_010245150.1|  PREDICTED: cysteine proteinase inhibitor 12-...  52.0    2e-04   
gb|AAA97906.1|  cysteine proteinase inhibitor                         50.1    2e-04   Glycine max [soybeans]
gb|AAC37479.1|  cysteine proteinase inhibitor                         51.2    2e-04   Brassica rapa
ref|XP_006411355.1|  hypothetical protein EUTSA_v10017418mg           50.1    2e-04   
ref|XP_006470502.1|  PREDICTED: cysteine proteinase inhibitor-like    49.7    2e-04   
ref|XP_009361915.1|  PREDICTED: cysteine proteinase inhibitor A-like  49.7    2e-04   
gb|AGF33489.1|  cysteine proteinase inhibitor                         50.1    2e-04   
ref|XP_006446360.1|  hypothetical protein CICLE_v10017285mg           49.7    3e-04   
ref|XP_008788566.1|  PREDICTED: cysteine proteinase inhibitor A-like  49.7    3e-04   
ref|XP_010508791.1|  PREDICTED: cysteine proteinase inhibitor 3       50.1    3e-04   
emb|CDY14748.1|  BnaC04g47450D                                        49.7    3e-04   
gb|ABK22677.1|  unknown                                               49.7    3e-04   Picea sitchensis
ref|XP_002268378.1|  PREDICTED: cysteine proteinase inhibitor A       49.7    3e-04   Vitis vinifera
gb|ABK23526.1|  unknown                                               49.7    4e-04   Picea sitchensis
gb|AAB71505.1|  cysteine protease inhibitor                           49.3    4e-04   Pyrus communis
emb|CDY42150.1|  BnaC05g40690D                                        50.4    4e-04   
ref|NP_001288858.1|  cysteine proteinase inhibitor 6-like             50.4    4e-04   
ref|XP_006407331.1|  hypothetical protein EUTSA_v10021442mg           50.8    4e-04   
gb|KCW50301.1|  hypothetical protein EUGRSUZ_J00085                   50.4    5e-04   
gb|AEQ54767.1|  cysteine proteinase inhibitor CPI-2                   48.5    6e-04   
emb|CAH57545.1|  cysteine protease inhibitor                          49.3    6e-04   Populus tremula [European aspen]
ref|XP_010031030.1|  PREDICTED: cysteine proteinase inhibitor 12      50.4    6e-04   
emb|CDY08429.1|  BnaA05g26650D                                        50.4    7e-04   
gb|KCW50299.1|  hypothetical protein EUGRSUZ_J00085                   50.4    7e-04   
ref|XP_008786873.1|  PREDICTED: cysteine proteinase inhibitor 12-...  49.7    8e-04   
emb|CAH57531.1|  cysteine protease inhibitor                          48.9    8e-04   Populus tremula [European aspen]
emb|CAN78115.1|  hypothetical protein VITISV_031522                   48.1    8e-04   Vitis vinifera
gb|ADK13078.1|  phytocystatin 5-3                                     48.5    8e-04   
emb|CBI32827.3|  unnamed protein product                              49.7    0.001   



>ref|XP_011084146.1| PREDICTED: cysteine proteinase inhibitor B [Sesamum indicum]
Length=131

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 67/98 (68%), Gaps = 5/98 (5%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYninin-gnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVST  443
            K NQE+QELGRYCV EYN  +     G   L FS+V+AAE QV++GIKYYLKISAV    
Sbjct  38   KQNQEIQELGRYCVGEYNHQLQLKANGSTALVFSQVVAAETQVISGIKYYLKISAVTRDG  97

Query  444  GVPHTFDAQVVVKPWLQNSKHLLSFAPSSSYLLPAATK  557
                TFDA VVVKPWL +SK LL+FAPS     P +TK
Sbjct  98   APARTFDAVVVVKPWL-HSKELLNFAPSPP---PKSTK  131



>ref|XP_009588279.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana tomentosiformis]
 gb|AIE76382.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=142

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 8/133 (6%)
 Frame = +3

Query  144  MAAKTRVIYLWAVVMAAAMVCSTQvegrgvvvggrteiegvKGNQEVQELGRYCVDEYni  323
            M   T++I L + +   A   ST     G  VGGRT I+ VK N+++Q+LG+YCV+EYN 
Sbjct  1    MTKFTKIISLLSTLFIIATFSSTPSNVLGRKVGGRTPIKDVKTNKKIQDLGKYCVEEYNR  60

Query  324  ning------nggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHTFDAQVVVKP  485
            ++              L F+EVL AE QVV+GIKYYLKISA+ VS+G+P TFDA++V+KP
Sbjct  61   SLRKYKQILQEDNIEFLSFAEVLEAETQVVSGIKYYLKISAI-VSSGIPKTFDAELVIKP  119

Query  486  WLQNSKHLLSFAP  524
            W +  K L+ F P
Sbjct  120  W-EEKKELIHFLP  131



>ref|XP_004297057.1| PREDICTED: cysteine proteinase inhibitor B-like [Fragaria vesca 
subsp. vesca]
Length=138

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 6/97 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdg---gLRFSEVLAAERQVVAGIKYYLKISAV--  431
            K N+EVQELGR+ V EYN     +        L+F EV+ AE QVV+GIKYYLKIS V  
Sbjct  42   KTNKEVQELGRFSVAEYNRMQRQSLRSNGGGELQFREVVEAETQVVSGIKYYLKISTVRN  101

Query  432  AVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSSYLL  542
             ++ G P  FD+QVVVKPWL+ SK LL+FAP S  +L
Sbjct  102  GLNGGTPLLFDSQVVVKPWLR-SKRLLNFAPHSKPVL  137



>gb|EYU28504.1| hypothetical protein MIMGU_mgv1a016168mg [Erythranthe guttata]
Length=132

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLR-FSEVLAAERQVVAGIKYYLKISAVAVST  443
            K N++VQ+LGRYCV EYN  +        L  FS+V+AAE QVV+GIKYYLKISA     
Sbjct  38   KANKDVQDLGRYCVQEYNRQLQQKANGTKLLVFSQVVAAETQVVSGIKYYLKISAATRGG  97

Query  444  GVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
            G   +F+A +VVKPW+ +SK L++FAPS+
Sbjct  98   GAAKSFEAVIVVKPWI-HSKELVNFAPST  125



>ref|XP_006358790.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum tuberosum]
Length=135

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnin--ingnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            K NQE+Q+LG+YCV+E+N N           L FS+V+ AE+QVV+G+KYYLKISA+  S
Sbjct  41   KTNQEIQDLGKYCVEEHNRNLRKQNGALSSLLSFSQVVEAEKQVVSGVKYYLKISAIVKS  100

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            +  P  FDA VVVK W +  + LL+F PS S
Sbjct  101  SSSPKLFDAVVVVKSWEKKKEELLTFFPSPS  131



>ref|XP_010101112.1| Cysteine proteinase inhibitor 10 [Morus notabilis]
 gb|EXB87085.1| Cysteine proteinase inhibitor 10 [Morus notabilis]
Length=143

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 12/100 (12%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdgg-----------LRFSEVLAAERQVVAGIKYY  413
            K N+EVQELGR+ V+EYN         G            L FS+V+ AE+QVV+GIKYY
Sbjct  40   KTNEEVQELGRFSVEEYNRRSQKLIRRGNGGARDGYGDGELSFSQVVEAEKQVVSGIKYY  99

Query  414  LKISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            LK+SA A  TG    FD+ VVVKPWL+ S+ LL+FAPS++
Sbjct  100  LKVSATATETGESRIFDSVVVVKPWLR-SRQLLNFAPSTA  138



>ref|XP_010326957.1| PREDICTED: cysteine proteinase inhibitor B [Solanum lycopersicum]
Length=134

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 3/91 (3%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYninin--gnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            K NQE+Q+LG+YCV+E+N ++          L FS+V+ AE+QVV+G+KYYLKISA+  S
Sbjct  41   KTNQEIQDLGKYCVEEHNRDLRHINGALSSLLSFSQVVEAEKQVVSGVKYYLKISAIVKS  100

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            +  P  FDA VVVK W +  K LL+F+PS S
Sbjct  101  SSSPKLFDAVVVVKAW-EKKKELLTFSPSPS  130



>gb|EYU24293.1| hypothetical protein MIMGU_mgv1a016063mg [Erythranthe guttata]
Length=135

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLR-FSEVLAAERQVVAGIKYYLKISAVAVST  443
            K N++VQ+LGRYCV EYN  +        L  FS+V+AAE QVV+GIKYYLKISA     
Sbjct  42   KANKDVQDLGRYCVQEYNRQLQQKANGTKLLVFSQVVAAETQVVSGIKYYLKISAATRGG  101

Query  444  GVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
            G    F+A +VVKPW+ +SK L++FAPS+
Sbjct  102  GPAKNFEAVIVVKPWI-HSKELVNFAPST  129



>ref|XP_009589279.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana tomentosiformis]
 gb|AIE76376.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=136

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 7/92 (8%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdgg-----LRFSEVLAAERQVVAGIKYYLKISAV  431
            K N+E+Q+LG++CV+EYN N+             L FSEV+ AE+QVV+GIKYYLKISA 
Sbjct  43   KTNKEIQDLGKFCVEEYNRNLQKQKQKVNNNNGLLSFSEVVEAEKQVVSGIKYYLKISAT  102

Query  432  AVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
              S+G P  FDA +VVK W +  K LL+F+PS
Sbjct  103  -TSSGAPKMFDAVLVVKAW-EKKKELLNFSPS  132



>ref|XP_009763807.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana sylvestris]
Length=142

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 8/133 (6%)
 Frame = +3

Query  144  MAAKTRVIYLWAVVMAAAMVCSTQvegrgvvvggrteiegvKGNQEVQELGRYCVDEYni  323
            M   T++I L   +       ST     G  VGGRT I+ VK N+++Q+LG+YCV+EYN 
Sbjct  1    MTKSTKIISLLITLFIITTFSSTPSNVLGRKVGGRTPIKDVKTNKKIQDLGKYCVEEYNR  60

Query  324  ning------nggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHTFDAQVVVKP  485
            ++              L F+EV+ AE QVV+GIKYYLKISA  VS+  P  FDA++V+KP
Sbjct  61   SLRKYKQILQEDNIEFLSFAEVVEAETQVVSGIKYYLKISA-TVSSETPKMFDAELVIKP  119

Query  486  WLQNSKHLLSFAP  524
            W +  K L+ F+P
Sbjct  120  W-EKKKELIHFSP  131



>gb|AEQ54766.1| cysteine proteinase inhibitor CPI-1 [Coffea canephora]
Length=139

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdg--gLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            K N+EVQELG YCV EYN ++     +    + F+ V+ AE+QVVAGIKYYLKI A   S
Sbjct  47   KSNKEVQELGEYCVSEYNKSLRKKNNESGAPIIFTSVVEAEKQVVAGIKYYLKIKA-TTS  105

Query  441  TGVPHTFDAQVVVKPWLQNS-KHLLSFAPS  527
            +GVP  +DA VVV+PW+    + LL+F+PS
Sbjct  106  SGVPKVYDAIVVVRPWVHTKPRQLLNFSPS  135



>gb|KEH20629.1| cysteine protease inhibitor cystatin [Medicago truncatula]
Length=133

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 5/91 (5%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnining-nggdggLRFSEVLAAERQVVAGIKYYLKI---SAVA  434
            + N EVQELGR+ V+EYN ++     G+G LRF EV+ A++QVV+GIKYY+KI    A +
Sbjct  42   RTNDEVQELGRFAVEEYNRSVKIWKEGEGELRFVEVVEAQQQVVSGIKYYMKIWVTQAKS  101

Query  435  VSTGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
               G P  FD+ V+VKPWL NSKHLL FAPS
Sbjct  102  DGVGDPTMFDSVVLVKPWL-NSKHLLHFAPS  131



>ref|XP_009762060.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana sylvestris]
Length=138

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 9/94 (10%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdgg-------LRFSEVLAAERQVVAGIKYYLKIS  425
            K N+E+Q+LG++CV+EYN N+               L FSEV+ AE+QVV+GIKYYLKIS
Sbjct  43   KTNKEIQDLGKFCVEEYNRNLQKQKQKVNNNNNNGLLSFSEVVEAEKQVVSGIKYYLKIS  102

Query  426  AVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
            A   S+G P  FDA +VVK W +  K LL+F+PS
Sbjct  103  A-TTSSGSPKMFDAVLVVKAW-EKKKELLNFSPS  134



>gb|ABS52572.1| cysteine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 11/96 (11%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningngg--------dggLRFSEVLAAERQVVAGIKYYLKI  422
            K N+EVQELGR+ V+EYN    G              L FS+V+ AE+QVVAGIKYYLKI
Sbjct  32   KNNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTALVFSQVVGAEKQVVAGIKYYLKI  91

Query  423  SAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
               A+  GV  TF++ V+VKPW+Q SK LL+F+PS+
Sbjct  92   K--AMQGGVTKTFESVVLVKPWVQ-SKDLLNFSPST  124



>ref|XP_008792948.1| PREDICTED: cysteine proteinase inhibitor 4 [Phoenix dactylifera]
Length=125

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 66/88 (75%), Gaps = 6/88 (7%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            + N+EVQ+LG +CV+EYN +++G G    L F  VLAAERQVV+GIKYYLKI+A     G
Sbjct  42   ESNKEVQDLGLFCVEEYNQHLHGGGEV--LTFLRVLAAERQVVSGIKYYLKIAA---RDG  96

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
               +FDA VVVKPWL+ S+ LLSFAPS+
Sbjct  97   RERSFDAVVVVKPWLK-SRSLLSFAPSA  123



>ref|XP_008365221.1| PREDICTED: cysteine proteinase inhibitor B-like [Malus domestica]
 ref|XP_008365234.1| PREDICTED: cysteine proteinase inhibitor B-like [Malus domestica]
 gb|AAO18638.1| cystatin [Malus domestica]
 gb|AHZ92268.1| cystatin 2 [Malus prunifolia]
Length=123

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningngg--dggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            K N+EVQELGR+ V+EYN           G L+F EV+ A+ QVV+GIKYYLK+S  AV 
Sbjct  35   KTNKEVQELGRFSVEEYNRQRGTQKMDGGGELQFLEVVEAQSQVVSGIKYYLKVS--AVR  92

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
             GV   FD++VVVKPWL+ SK LL+FAP
Sbjct  93   NGVHRLFDSEVVVKPWLR-SKQLLNFAP  119



>ref|XP_006492987.1| PREDICTED: cysteine proteinase inhibitor 2-like [Citrus sinensis]
Length=130

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 7/93 (8%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggd------ggLRFSEVLAAERQVVAGIKYYLKISA  428
            K N+EVQELG++CV+E+N +    G        G LRFS+VL A++QVV+GIKYYL I A
Sbjct  38   KKNKEVQELGKFCVEEFNRSQQRQGKVIRNVAFGRLRFSQVLEAQKQVVSGIKYYLIIEA  97

Query  429  VAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
                 G    F++ VVVKPWL +SK LL FAPS
Sbjct  98   TTGENGEIQMFNSIVVVKPWL-HSKELLKFAPS  129



>ref|XP_010673372.1| PREDICTED: cysteine proteinase inhibitor B [Beta vulgaris subsp. 
vulgaris]
Length=147

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 63/104 (61%), Gaps = 13/104 (13%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningng-----------gdggLRFSEVLAAERQVVAGIKYYLK  419
            N+EVQELG++ V+EYN  I                +G L F +V+ A++QVVAG+KYYLK
Sbjct  41   NKEVQELGKFSVEEYNREILNMQQSPLRSVGLGDTNGPLNFVKVVKAQKQVVAGLKYYLK  100

Query  420  ISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSSYLLPAA  551
            + A     GV   FDA VVVKPW+  SK LL+F PSS   LP A
Sbjct  101  VEAT--KDGVTRIFDAVVVVKPWVHESKKLLNFGPSSRLSLPEA  142



>ref|XP_004504436.1| PREDICTED: cysteine proteinase inhibitor 4-like [Cicer arietinum]
Length=130

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 7/94 (7%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnining-nggdggLRFSEVLAAERQVVAGIKYYLKISAV----  431
            + N+EVQ++GRY V+EYN +      G+G L+F EV+ A++QVV+GIKYY+K+       
Sbjct  37   RTNEEVQDIGRYSVEEYNRSKKVWKEGEGELQFVEVVEAQQQVVSGIKYYMKLWVTRSQI  96

Query  432  -AVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
                 GVP  FD+ VVVKPWL NSKHLL FAPS+
Sbjct  97   DGDGDGVPTMFDSVVVVKPWL-NSKHLLHFAPST  129



>gb|ACK87021.1| cysteine protease inhibitor [Gossypium hirsutum]
Length=119

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 11/96 (11%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningngg--------dggLRFSEVLAAERQVVAGIKYYLKI  422
            K N+EVQELGR+ V+EYN    G              L FS+V+ AE+QVVAGIKYYLKI
Sbjct  26   KKNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTALVFSQVVGAEKQVVAGIKYYLKI  85

Query  423  SAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
               A+  GV  TF++ V+VKPW+Q SK LL+F+PS+
Sbjct  86   K--AMQGGVTKTFESVVLVKPWVQ-SKDLLNFSPST  118



>ref|XP_010926673.1| PREDICTED: cysteine proteinase inhibitor 5 [Elaeis guineensis]
Length=126

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 64/88 (73%), Gaps = 5/88 (6%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVP  452
            ++EVQ+LG +CV+EYN  ++G   +  L F  V+AAERQVV+GIKYYLKI+A     G  
Sbjct  44   DKEVQDLGLFCVEEYNQRLHGGRSEA-LTFLRVVAAERQVVSGIKYYLKIAA---RDGRE  99

Query  453  HTFDAQVVVKPWLQNSKHLLSFAPSSSY  536
             TFDA VVVKPWL+ S+ LLSF PS+ Y
Sbjct  100  RTFDAIVVVKPWLK-SRSLLSFTPSAHY  126



>ref|XP_006421050.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
 gb|ESR34290.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
Length=130

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggd------ggLRFSEVLAAERQVVAGIKYYLKISA  428
            K N+EVQELG++ V+E+N +    G        G LRFS+VL A++QVV+GIKYYL I A
Sbjct  38   KKNKEVQELGKFSVEEFNRSQQRQGKVIRNVAFGRLRFSQVLEAQKQVVSGIKYYLTIEA  97

Query  429  VAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
                 G    FD+ VV+KPWL +SK LL FAPS
Sbjct  98   TTGENGEIQMFDSIVVIKPWL-HSKELLKFAPS  129



>ref|XP_009371093.1| PREDICTED: cysteine proteinase inhibitor B [Pyrus x bretschneideri]
Length=123

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningngg--dggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            K N+EVQELGR+ V+EYN           G L+F EV+ A+ QVV+G+KYYLK+S  AV 
Sbjct  35   KTNKEVQELGRFSVEEYNRQRGTQKMDGGGELQFLEVVEAQSQVVSGLKYYLKVS--AVR  92

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
             GV   FD++VVVKPWL+ SK LL+FAP
Sbjct  93   NGVHMLFDSEVVVKPWLR-SKQLLNFAP  119



>ref|XP_007034159.1| Cystatin [Theobroma cacao]
 gb|EOY05085.1| Cystatin [Theobroma cacao]
Length=127

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 66/89 (74%), Gaps = 5/89 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggd--ggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            K N+EVQELGR+ V+E+N +  G   +    L FS+V+ A++QVV+GIKYYLKI   A+ 
Sbjct  40   KTNKEVQELGRFSVEEFNRSRGGLRSNGGTELVFSQVVEAQKQVVSGIKYYLKIE--AMQ  97

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
            +G+  TF++ VVVKPW ++SK LL+F+PS
Sbjct  98   SGLTRTFESVVVVKPW-EDSKELLNFSPS  125



>ref|XP_002265736.1| PREDICTED: cysteine proteinase inhibitor 4 [Vitis vinifera]
Length=140

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 63/100 (63%), Gaps = 13/100 (13%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnin----------ingnggdggLRFSEVLAAERQVVAGIKYYL  416
            K N+EVQ+LGR+ V+EYN +                   L FSEV+ A++QVV+G KYYL
Sbjct  44   KTNKEVQQLGRFSVEEYNRSHGRRWREAIGNVLGMDYEYLTFSEVVEAQKQVVSGFKYYL  103

Query  417  KISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSSY  536
            KI+  A   GV +TFDA VVVKPWL  SK LL F+PSS Y
Sbjct  104  KIA--ATQNGVRNTFDAVVVVKPWLP-SKQLLHFSPSSIY  140



>ref|XP_008337489.1| PREDICTED: cysteine proteinase inhibitor B [Malus domestica]
Length=123

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningngg--dggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            K N+EVQELGR+ V+EYN           G L+F EV+ A+ QVV+GIKYY+K+S  AV 
Sbjct  35   KTNKEVQELGRFSVEEYNRQRGTQKMDGGGELQFLEVVEAQSQVVSGIKYYVKVS--AVR  92

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
             GV   FD++VVVKPWL+ SK LL+FAP
Sbjct  93   NGVHMLFDSEVVVKPWLR-SKQLLNFAP  119



>gb|ACD85810.1| cystcine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 11/96 (11%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningngg--------dggLRFSEVLAAERQVVAGIKYYLKI  422
            K N+EVQELGR+ V+EYN    G              L FS+V+ AE+QVVAGIKYYL+I
Sbjct  32   KKNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTALVFSQVVGAEKQVVAGIKYYLEI  91

Query  423  SAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
               A+  GV  TF++ V+VKPW+Q SK LL F+PS+
Sbjct  92   K--AMQGGVTKTFESVVLVKPWVQ-SKDLLKFSPST  124



>ref|XP_009373605.1| PREDICTED: cysteine proteinase inhibitor B-like [Pyrus x bretschneideri]
Length=123

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningngg--dggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            K N+EVQELGR+ V+EYN           G L+F EV+ A+ QVV+G+KYY+K+S  AV 
Sbjct  35   KTNEEVQELGRFSVEEYNRQRGTQKMDGGGELQFLEVVEAQSQVVSGLKYYIKVS--AVR  92

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
             GV   FD++VVVKPWL+ SK LL+FAP
Sbjct  93   NGVHMLFDSEVVVKPWLR-SKQLLNFAP  119



>ref|XP_008799565.1| PREDICTED: cysteine proteinase inhibitor 10-like [Phoenix dactylifera]
Length=219

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 5/90 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            + ++EVQ+LG +CV+EYN      G +  L F  V+AAERQVV+GIKYYLKI+A     G
Sbjct  135  ESDKEVQDLGLFCVEEYNHRRRVGGEEL-LTFLRVVAAERQVVSGIKYYLKIAA---RDG  190

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSSSY  536
               TFDA VVV+PWL +S+ LLSFAPSS+Y
Sbjct  191  REVTFDAVVVVRPWL-DSRFLLSFAPSSAY  219



>ref|XP_009378164.1| PREDICTED: cysteine proteinase inhibitor B-like [Pyrus x bretschneideri]
Length=124

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 61/89 (69%), Gaps = 6/89 (7%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggd---ggLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            K N+EVQELGR+ V EYN     +      G L+F EV+ A+ QVV+GIKYYLK+S  AV
Sbjct  35   KSNKEVQELGRFSVAEYNSRQKASRKMDGGGELQFLEVVEAQSQVVSGIKYYLKVS--AV  92

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
              G    FD++VVVKPWL+ SK LL+FAP
Sbjct  93   KNGAHMLFDSEVVVKPWLR-SKQLLNFAP  120



>ref|XP_010243158.1| PREDICTED: cysteine proteinase inhibitor 4-like [Nelumbo nucifera]
Length=133

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 6/92 (7%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdgg---LRFSEVLAAERQVVAGIKYYLKISAVAV  437
            K N+EVQELGR+ V+E+N +        G   L FSEV+ AERQVV+GIKYYL +   A+
Sbjct  45   KDNEEVQELGRFSVEEFNRSQREEERSRGNVYLVFSEVVRAERQVVSGIKYYLNVE--AL  102

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
              G    FDA VVVKPWL+ SK LL+F P ++
Sbjct  103  EEGEAKKFDAVVVVKPWLE-SKQLLTFIPCTN  133



>ref|XP_004160226.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus]
Length=128

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVP  452
            N+EVQ LGR+ V+EYN  + G G    ++F+ V+AAERQVV+G KYYL+I  +    G  
Sbjct  40   NEEVQRLGRFSVEEYNRRMGGGGE---VKFTAVVAAERQVVSGTKYYLRI--LGTQNGER  94

Query  453  HTFDAQVVVKPWLQNSKHLLSFAPSSSYLLP  545
              FD+ V+VKPW+  SK LL F+PS+ +  P
Sbjct  95   KVFDSVVIVKPWI-GSKRLLDFSPSTVFRTP  124



>ref|XP_004138536.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus]
 gb|KGN45922.1| Cystatin [Cucumis sativus]
Length=128

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVP  452
            N+EVQ LGR+ V+EYN  + G G    ++F+ V+AAERQVV+G KYYL+I  +    G  
Sbjct  40   NEEVQRLGRFSVEEYNRRMGGGGE---VKFTAVVAAERQVVSGTKYYLRI--LGTQNGER  94

Query  453  HTFDAQVVVKPWLQNSKHLLSFAPSSSYLLP  545
              FD+ V+VKPW+  SK LL F+PS+ +  P
Sbjct  95   KVFDSVVIVKPWI-GSKRLLDFSPSAVFRTP  124



>ref|XP_008465470.1| PREDICTED: cysteine proteinase inhibitor B [Cucumis melo]
Length=128

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (68%), Gaps = 6/93 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            K N+EVQ LGR+ V+EYN  + G G    ++F+ V+AA+RQVV+G KYYL+I  + +  G
Sbjct  38   KRNEEVQRLGRFSVEEYNRRMGGGGE---VKFTAVVAADRQVVSGTKYYLRI--LGIQNG  92

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSSSYLLP  545
                FD+ V+VKPW+  SK LL F+PS+ +  P
Sbjct  93   ERKIFDSVVIVKPWI-GSKRLLDFSPSTVFSTP  124



>emb|CAJ20032.1| putative cystatin [Zea mays]
Length=120

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 5/93 (5%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAV----A  434
            +G+ EVQELGR+ V EYN  +   GG G L F  V+AA+RQVV+G+KYYL++ AV     
Sbjct  28   EGDGEVQELGRFSVAEYNRQLRDGGGGGRLEFGRVVAAQRQVVSGLKYYLRVVAVEEGGG  87

Query  435  VSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
               G    FDA VVVKPWL +S+ LL+FAP+++
Sbjct  88   AGNGGERVFDAVVVVKPWL-DSRTLLTFAPAAA  119



>ref|XP_003538534.1| PREDICTED: cysteine proteinase inhibitor 4 [Glycine max]
Length=126

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 5/90 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYninin--gnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            + N+EVQELGR+ V+EYN  +    N G   L FSEV+ A++QVV+G+KYYLKIS  A  
Sbjct  34   RTNREVQELGRFAVEEYNRGLKQWKNNGSEQLNFSEVVEAQQQVVSGMKYYLKIS--ATH  91

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
             GV   F + VVVKPWL +SK LL FAP++
Sbjct  92   KGVHKMFTSVVVVKPWL-HSKQLLHFAPAA  120



>dbj|BAA20464.1| extracellular insoluble cystatin [Daucus carota]
Length=133

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 83/136 (61%), Gaps = 9/136 (7%)
 Frame = +3

Query  144  MAAKTRVIYLWAVVMAAAMVCSTQvegrgvvvggrteiegvKGNQEVQELGRYCVDEYni  323
            MAAKT+ I +  ++ A  +       G    VGGRTEI  V+ N+E+Q+LG Y V++YN 
Sbjct  1    MAAKTQAILILLLISAVLIASPAAGLGGSGAVGGRTEIPDVESNEEIQQLGEYSVEQYNQ  60

Query  324  ni------ngnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHTFDAQVVVKP  485
                    +     G L+F +V+AAE+QVVAGIKYYLKI  VA   G    FDA++VV+ 
Sbjct  61   QHHNGDGGDSTDSAGDLKFVKVVAAEKQVVAGIKYYLKI--VAAKGGHKKKFDAEIVVQA  118

Query  486  WLQNSKHLLSFAPSSS  533
            W + +K L+SFAPS +
Sbjct  119  W-KKTKQLMSFAPSHN  133



>ref|XP_010510121.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 82/141 (58%), Gaps = 14/141 (10%)
 Frame = +3

Query  138  AYMAAKTRVIYLWAVVMAAAMVCSTQvegrgvvvggrteiegvKGNQEVQELGRYCVDEY  317
            A M+  + V+ L   ++ A M  S     + +V+GG++++  VK N+E+QELGRYCV+++
Sbjct  2    AAMSKVSLVLSLLGFLVIAVMTPSANALRKSLVLGGKSDVANVKANREIQELGRYCVEQF  61

Query  318  ------------niningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHTF  461
                        +I  +       LRFS V++A++QVVAG KYYL+I  V    G    F
Sbjct  62   NQRDQSEEGKVESIAKSDTDMSNPLRFSRVVSAQKQVVAGTKYYLRIE-VTQPNGSTRMF  120

Query  462  DAQVVVKPWLQNSKHLLSFAP  524
            D+ VV++PWL +SK LL F P
Sbjct  121  DSVVVIQPWL-HSKQLLGFTP  140



>ref|XP_010414055.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 81/141 (57%), Gaps = 14/141 (10%)
 Frame = +3

Query  138  AYMAAKTRVIYLWAVVMAAAMVCSTQvegrgvvvggrteiegvKGNQEVQELGRYCVDEY  317
            A M+  + V+ L   ++ A M  S     + +V+GG++++  VK N+E+QELGRYCV+++
Sbjct  2    AAMSKVSLVLSLLGFLVIAVMTPSANALRKSLVLGGKSDVANVKANREIQELGRYCVEQF  61

Query  318  ------------niningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHTF  461
                        +I          LRFS V++A++QVVAG KYYL+I  V    G    F
Sbjct  62   NQRDQSEEGNVESIAKTDTDMSNPLRFSRVVSAQKQVVAGTKYYLRIE-VTQPNGSTKMF  120

Query  462  DAQVVVKPWLQNSKHLLSFAP  524
            D+ VV++PWL +SK LL F P
Sbjct  121  DSVVVIQPWL-HSKQLLGFTP  140



>ref|XP_002456830.1| hypothetical protein SORBIDRAFT_03g043680 [Sorghum bicolor]
 gb|EES01950.1| hypothetical protein SORBIDRAFT_03g043680 [Sorghum bicolor]
Length=155

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 5/90 (6%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAV---AVST  443
            + EVQELGR+ V EYN  + G+GG   L F  V+AA+RQVV+G+KYYL+++AV   A + 
Sbjct  67   DGEVQELGRFSVAEYNRQLRGDGGGR-LEFGRVVAAQRQVVSGLKYYLRVAAVEEGAQNA  125

Query  444  GVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            G    FDA VVVKPWL+ S+ LL+FAP+++
Sbjct  126  GGERAFDAVVVVKPWLE-SRTLLTFAPAAA  154



>ref|XP_007223412.1| hypothetical protein PRUPE_ppa013391mg [Prunus persica]
 ref|XP_008222787.1| PREDICTED: cysteine proteinase inhibitor B [Prunus mume]
 gb|EMJ24611.1| hypothetical protein PRUPE_ppa013391mg [Prunus persica]
Length=125

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 6/89 (7%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdg---gLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            K N+EVQ+LGR+ V EYN     +        L+F EV+ A+ QVV+GIKYYLK+S  AV
Sbjct  36   KTNKEVQKLGRFSVAEYNRTQRKSHQSNGGGELQFLEVVEAQSQVVSGIKYYLKVS--AV  93

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
              G    FD++VVVKPWL +SK LL+FAP
Sbjct  94   RNGAHMLFDSEVVVKPWL-HSKQLLNFAP  121



>gb|AFK48234.1| unknown [Medicago truncatula]
Length=133

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (69%), Gaps = 3/90 (3%)
 Frame = +3

Query  273  NQEVQELGRYCVDEY--niningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            N+EVQELG++ V EY     +N  GG  GL+F EV+ AE+QVV+G+KYYL ISAV    G
Sbjct  39   NKEVQELGKFAVKEYNYKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKYYLNISAVD-HNG  97

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSSSY  536
            V   F++ VVVKPWL   K ++ F PSS++
Sbjct  98   VQRMFNSVVVVKPWLHQYKKVIHFGPSSTF  127



>gb|KHN44464.1| Cysteine proteinase inhibitor 2 [Glycine soja]
Length=169

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 6/96 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYninin--gnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            + N+EVQELGR+ V+EYN  +    N G   L FSEV+ A++QVV+G+KYYLKIS  A  
Sbjct  34   RTNREVQELGRFAVEEYNRGLKQWKNNGSEQLNFSEVVEAQQQVVSGMKYYLKIS--ATH  91

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPSS-SYLLP  545
             GV   F + VVVKPWL +SK LL FAP++ S   P
Sbjct  92   KGVHKMFTSVVVVKPWL-HSKQLLHFAPAAPSRFFP  126



>ref|XP_010469645.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 80/141 (57%), Gaps = 14/141 (10%)
 Frame = +3

Query  138  AYMAAKTRVIYLWAVVMAAAMVCSTQvegrgvvvggrteiegvKGNQEVQELGRYCVDEY  317
            A M+  + V  L   ++ A M  S     + +V+GG++++  VK N+E+QELGRYCV+++
Sbjct  2    AAMSKVSLVFSLLGFLVIAVMTPSANALRKSLVLGGKSDVANVKANREIQELGRYCVEQF  61

Query  318  ------------niningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHTF  461
                        +I          LRFS V++A++QVVAG KYYL+I  V    G    F
Sbjct  62   NQRGQSEEGNVESIAKTDTDMSNPLRFSRVVSAQKQVVAGTKYYLRIE-VTQPNGSTRMF  120

Query  462  DAQVVVKPWLQNSKHLLSFAP  524
            D+ VV++PWL +SK LL F P
Sbjct  121  DSVVVIQPWL-HSKQLLGFTP  140



>ref|NP_001045185.1| Os01g0915200 [Oryza sativa Japonica Group]
 sp|Q5N806.1|CYT4_ORYSJ RecName: Full=Cysteine proteinase inhibitor 4; AltName: Full=Oryzacystatin 
IV; Short=OC-IV; AltName: Full=Oryzacystatin-4; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD82395.1| putative cystatin [Oryza sativa Japonica Group]
 dbj|BAF07099.1| Os01g0915200 [Oryza sativa Japonica Group]
 gb|EAZ14605.1| hypothetical protein OsJ_04530 [Oryza sativa Japonica Group]
 dbj|BAH00694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=158

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 65/95 (68%), Gaps = 7/95 (7%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningng-gdggLRFSEVLAAERQVVAGIKYYLKISAVAV--  437
            +G++EVQELGR+ V+E+N        GD  L F  V+AA+RQVV+G+KYYL+++A     
Sbjct  60   EGDREVQELGRFSVEEHNRRRRSRDCGDVRLEFGRVVAAQRQVVSGLKYYLRVAAAEEGA  119

Query  438  ---STGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
               + G P  FDA VVVKPWL+ S+ LL+FAP++ 
Sbjct  120  AGQNGGEPRVFDAVVVVKPWLE-SRTLLTFAPAAD  153



>gb|EAY76949.1| hypothetical protein OsI_04907 [Oryza sativa Indica Group]
Length=159

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 65/95 (68%), Gaps = 7/95 (7%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningng-gdggLRFSEVLAAERQVVAGIKYYLKISAVAV--  437
            +G++EVQELGR+ V+E+N        GD  L F  V+AA+RQVV+G+KYYL+++A     
Sbjct  61   EGDREVQELGRFSVEEHNRRRRSRDCGDVRLEFGRVVAAQRQVVSGLKYYLRVAAAEEGA  120

Query  438  ---STGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
               + G P  FDA VVVKPWL+ S+ LL+FAP++ 
Sbjct  121  AGQNGGEPRVFDAVVVVKPWLE-SRTLLTFAPAAD  154



>ref|XP_007163791.1| hypothetical protein PHAVU_001G264400g [Phaseolus vulgaris]
 gb|ESW35785.1| hypothetical protein PHAVU_001G264400g [Phaseolus vulgaris]
Length=130

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 63/90 (70%), Gaps = 5/90 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYninin--gnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            + N+EVQELGR+ V+EYN  +    +  +  L FSEV+ A++QVV+G+KYYLKIS  A  
Sbjct  34   RTNREVQELGRFSVEEYNNGLKLYNDSDNEKLTFSEVVEAQQQVVSGVKYYLKIS--ATH  91

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
             G+   F + VVVKPW+ +SK LL F+P+S
Sbjct  92   RGIHKMFSSVVVVKPWI-HSKKLLHFSPAS  120



>ref|XP_009402733.1| PREDICTED: cysteine proteinase inhibitor 4-like [Musa acuminata 
subsp. malaccensis]
Length=147

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 6/88 (7%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVP  452
            N+EVQ+LG + VDEYN  +   G    L FS V AA+RQVV+GIKYYL++ A    TG  
Sbjct  43   NKEVQDLGLFSVDEYNRRLALRGAGL-LTFSRVAAAQRQVVSGIKYYLQVVAAVEGTGEE  101

Query  453  ----HTFDAQVVVKPWLQNSKHLLSFAP  524
                 TFDA V+VKPWL +S+ L+SFAP
Sbjct  102  GQQHRTFDAVVIVKPWL-SSRSLVSFAP  128



>emb|CDM85644.1| unnamed protein product [Triticum aestivum]
Length=153

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 13/101 (13%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggd------ggLRFSEVLAAERQVVAGIKYYLKISA  428
            +G++EVQELGRY V+E+N                 L F+ V++A+RQVV+GIKYYL+++A
Sbjct  53   EGDREVQELGRYSVEEHNRRREEGCEGGGGGVCARLEFARVVSAQRQVVSGIKYYLRVAA  112

Query  429  V----AVSTGVP--HTFDAQVVVKPWLQNSKHLLSFAPSSS  533
                 A S G+     FDA VVVKPWLQ S+ L+ FAP+ S
Sbjct  113  AVDNGAGSNGISDGRVFDAVVVVKPWLQ-SRALVRFAPADS  152



>gb|ACU17144.1| unknown [Glycine max]
Length=122

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 5/90 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYninin--gnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            + N+EVQELGR+ V+EYN  +    N G   L FSEV+ A++QVV+G+ YYLKIS  A  
Sbjct  34   RTNREVQELGRFAVEEYNRGLKQWKNNGSEQLNFSEVVEAQQQVVSGMMYYLKIS--ATH  91

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
             GV   F + VVVKPWL +SK LL FAP++
Sbjct  92   KGVHKMFTSVVVVKPWL-HSKQLLHFAPAA  120



>ref|XP_010314744.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum lycopersicum]
Length=136

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 76/133 (57%), Gaps = 9/133 (7%)
 Frame = +3

Query  144  MAAKTRVIYLWAVVMAAAMVCSTQvegrgvvvggrteiegvKGNQEVQELGRYCVDEYni  323
            M   T+ I L   +       ST  +  G  VGGRT I+ VK N+++QELG+YCV+EYN 
Sbjct  1    MTKSTKTISLLITLFIITTFSSTPSKILGRKVGGRTPIKDVKTNKKIQELGKYCVEEYNH  60

Query  324  ning------nggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHTFDAQVVVKP  485
            ++              L F EVL AE Q+V+GIKYYLKIS   +  G+   FDA++V+K 
Sbjct  61   SLKKYNHIMQKDNIEFLNFVEVLEAETQIVSGIKYYLKISTFTL--GMVKIFDAELVIKS  118

Query  486  WLQNSKHLLSFAP  524
            W +  K L+ F+P
Sbjct  119  W-EKKKELIHFSP  130



>emb|CAG38126.1| cystatin Hv-CPI5 [Hordeum vulgare subsp. vulgare]
 dbj|BAK02746.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=151

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 66/100 (66%), Gaps = 12/100 (12%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnini-----ngnggdggLRFSEVLAAERQVVAGIKYYLKISAV  431
            +G++EVQELGRY V+E+N         G    G L F+ V++A+RQVV+G+KYYL+++A 
Sbjct  53   EGDREVQELGRYSVEEHNRRREEGCEGGGAVCGRLEFARVVSAQRQVVSGVKYYLRVAAA  112

Query  432  ----AVSTGVP--HTFDAQVVVKPWLQNSKHLLSFAPSSS  533
                A S GV     FDA VVVKPWLQ S+ L+ FAP+ +
Sbjct  113  EANGAGSNGVSDGRVFDAVVVVKPWLQ-SRSLVRFAPADA  151



>gb|AHV85520.1| cysteine proteinase inhibitor TrcC-6 [Secale cereale x Triticum 
aestivum]
Length=152

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 64/100 (64%), Gaps = 12/100 (12%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdg-----gLRFSEVLAAERQVVAGIKYYLKISAV  431
            +G++EVQELGRY V+E+N                L F+ V++A+RQ+V+GIKYYL+++A 
Sbjct  53   EGDREVQELGRYSVEEHNRRREEGCEGSGGVCGRLEFARVVSAQRQMVSGIKYYLRVAAA  112

Query  432  ----AVSTGVP--HTFDAQVVVKPWLQNSKHLLSFAPSSS  533
                A S GV     FDA VVVKPWLQ S+ L+ FAP+ +
Sbjct  113  EEGGAGSNGVSDGRVFDAVVVVKPWLQ-SRALVRFAPADA  151



>ref|XP_003552894.1| PREDICTED: cysteine proteinase inhibitor 4-like [Glycine max]
Length=142

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 9/93 (10%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdg------gLRFSEVLAAERQVVAGIKYYLKISA  428
            + N++VQELGR+ V+EYN+ +     +        L FS V+ A++QVV+G+KYYLKIS 
Sbjct  34   RKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQVVSGMKYYLKIS-  92

Query  429  VAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
             A   GV   F++ VVVKPWL  SK LL FAP+
Sbjct  93   -ATHNGVHEMFNSVVVVKPWLH-SKQLLHFAPA  123



>gb|KDP32576.1| hypothetical protein JCGZ_13126 [Jatropha curcas]
Length=197

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYnin-ingnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGV  449
            NQEVQ+LG++ V+E+N        G   L FSEV+ A+RQVV+GIKYYLKI A     G 
Sbjct  40   NQEVQDLGKFSVEEFNEQIHRHGNGGEELIFSEVVEAQRQVVSGIKYYLKIEAATKVNGE  99

Query  450  PHTFDAQVVVKPWLQNSKHLLSFAPS  527
               FD+ VVVK WL+ SK L+SF P 
Sbjct  100  MKVFDSVVVVKAWLE-SKELISFEPD  124



>ref|XP_003564913.1| PREDICTED: cysteine proteinase inhibitor 4-like [Brachypodium 
distachyon]
Length=161

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 64/101 (63%), Gaps = 18/101 (18%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAV---  437
            +GN+EVQELGRY VDE+N     +G    L F  V++A+RQVV+G+KYYL+++A  +   
Sbjct  62   EGNREVQELGRYSVDEHNRRREDDGR---LEFGRVVSAQRQVVSGLKYYLRVAAAELPQQ  118

Query  438  --STGVPHT---------FDAQVVVKPWLQNSKHLLSFAPS  527
                G+ +          FDA VVVKPWL +S+ LL FAP+
Sbjct  119  QQEEGINNNNKAVEGERVFDAVVVVKPWL-DSRALLRFAPA  158



>gb|KHN24041.1| Cysteine proteinase inhibitor 2, partial [Glycine soja]
Length=151

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 9/93 (10%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdgg------LRFSEVLAAERQVVAGIKYYLKISA  428
            + N++VQELGR+ V+EYN+ +     +        L FS V+ A++QVV+G+KYYLKIS 
Sbjct  43   RKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQVVSGMKYYLKIS-  101

Query  429  VAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
             A   GV   F++ VVVKPWL  SK LL FAP+
Sbjct  102  -ATHNGVHEMFNSVVVVKPWLH-SKQLLHFAPA  132



>pir||JE0308 cysteine proteinase inhibitor - common sunflower
Length=123

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdg-gLRFSEVLAAERQVVAGIKYYLKISAVAVST  443
            K + E+Q+LG Y VDEYN            L+FS+V+AAE QVVAG KYYLKI A+    
Sbjct  34   KTDTEIQQLGSYSVDEYNRLQRTKKTGAGDLKFSQVIAAETQVVAGTKYYLKIEAI-YKG  92

Query  444  GVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
            G    FDA+VVV+ W ++SK LL F P+
Sbjct  93   GKMKVFDAEVVVQSW-KHSKKLLGFKPA  119



>ref|XP_002516375.1| Cysteine proteinase inhibitor B, putative [Ricinus communis]
 gb|EEF45992.1| Cysteine proteinase inhibitor B, putative [Ricinus communis]
Length=138

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 9/96 (9%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningng-------gdggLRFSEVLAAERQVVAGIKYYLKIS  425
            K N+ VQELGR+CV E+N              G   L FSEV+AAE QVV+GIKYYLKI+
Sbjct  37   KSNEAVQELGRFCVKEFNKQQLRQQHGGSNGGGGELLMFSEVVAAETQVVSGIKYYLKIA  96

Query  426  AVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            A +   G    FD+ VVVK W+ + K L++F P+++
Sbjct  97   A-SNGKGEAKVFDSVVVVKAWI-DDKQLITFEPAAA  130



>ref|XP_006349967.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum tuberosum]
Length=136

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 57/92 (62%), Gaps = 9/92 (10%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYn------iningnggdggLRFSEVLAAERQVVAGIKYYLKISA  428
            K N+++QELG+YCV+EYN        I        L F EVL AE QVV+GIKYYLKIS 
Sbjct  42   KTNKKIQELGKYCVEEYNHSLRKYNQIMQKDNIELLNFVEVLEAETQVVSGIKYYLKIST  101

Query  429  VAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
              +  G+   +DA++V+K W +  K L+ F+P
Sbjct  102  FTL--GIVKVYDAELVIKSW-EKKKELIHFSP  130



>ref|XP_003524913.1| PREDICTED: cysteine proteinase inhibitor 4-like isoform 1 [Glycine 
max]
Length=130

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 61/90 (68%), Gaps = 3/90 (3%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnin-ingnggdggLRFSEVLAAERQVVAGIKYYLKISAV-AVS  440
            K N++VQ+LGR+ V+E+N         +  + F EV+ A++QVV+GIKYY+KISA     
Sbjct  41   KANKKVQDLGRFSVEEHNRMLRQAQKEEEQVTFVEVVEAQQQVVSGIKYYMKISATQGGD  100

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
             G    F++ VVVKPWL+ SK LL+FAPS+
Sbjct  101  GGDSRIFESVVVVKPWLR-SKQLLNFAPST  129



>gb|EMT28873.1| Cysteine proteinase inhibitor 4 [Aegilops tauschii]
Length=152

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 65/100 (65%), Gaps = 12/100 (12%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdgg-----LRFSEVLAAERQVVAGIKYYLKISAV  431
            +G++E QELGRY V+E+N         GG     L F+ V++A+RQVV+GIKYYL+++A 
Sbjct  53   EGDREGQELGRYSVEEHNRRREEGCEGGGGVCGRLEFARVVSAQRQVVSGIKYYLRVAAA  112

Query  432  ----AVSTGVP--HTFDAQVVVKPWLQNSKHLLSFAPSSS  533
                A S GV     FDA VVVKPWLQ S+ L+ FAP+ +
Sbjct  113  EEGGAGSNGVTDGRVFDAVVVVKPWLQ-SRALIRFAPADA  151



>ref|XP_010243160.1| PREDICTED: cysteine proteinase inhibitor 2-like [Nelumbo nucifera]
Length=145

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 62/102 (61%), Gaps = 15/102 (15%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnini------------ngnggdggLRFSEVLAAERQVVAGIKY  410
            K N E+Q+LGR+ V+E+N                 N  DG L FSEV+ AERQVV+GI Y
Sbjct  45   KCNHEIQKLGRFSVEEFNRRKQQEEVVLLHGQGTSNSDDGELVFSEVVMAERQVVSGINY  104

Query  411  YLKISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSSY  536
            YL I   A+  G+   FDA V VKPWL  SK LL+F+PS++Y
Sbjct  105  YLHIE--ALQHGMTKRFDAVVAVKPWLP-SKQLLAFSPSTNY  143



>ref|XP_010244063.1| PREDICTED: cysteine proteinase inhibitor B-like [Nelumbo nucifera]
Length=139

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYnini---------ngnggdggLRFSEVLAAERQVVAGIKYYLKIS  425
            N EVQE+GR+ VDE+N              +   G L FSEV+ A++QV+ G+KYYL I 
Sbjct  44   NDEVQEVGRFSVDEFNRKQHQEAEARGQGSSSNGGDLVFSEVVMAKQQVITGVKYYLYIE  103

Query  426  AVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSSY  536
              A   G    FDA V VKPWLQ SK LL F+PSS Y
Sbjct  104  --AFRDGFRQRFDAIVAVKPWLQ-SKELLIFSPSSGY  137



>sp|Q10993.1|CYTB_HELAN RecName: Full=Cysteine proteinase inhibitor B; AltName: Full=Cystatin-B; 
AltName: Full=SCB [Helianthus annuus]
Length=101

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdgg-LRFSEVLAAERQVVAGIKYYLKISAVAVST  443
            K + E+Q+LG Y VDEYN          G L+FS+V+AAE QVVAG KYYLKI A+    
Sbjct  12   KTDTEIQQLGSYSVDEYNRLQRTKKTGAGDLKFSQVIAAETQVVAGTKYYLKIEAI-TKG  70

Query  444  GVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
            G    FDA+VVV+ W ++SK LL F P+
Sbjct  71   GKMKVFDAEVVVQSW-KHSKKLLGFKPA  97



>ref|XP_004971036.1| PREDICTED: cysteine proteinase inhibitor 4-like [Setaria italica]
Length=160

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 10/95 (11%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAV-----  431
            +G++EVQELGR+ V EYN    G GG   L F+ V+AA+RQVV+G+KYYL+++A      
Sbjct  67   EGDEEVQELGRFSVAEYNRRRVGGGGR--LEFARVVAAQRQVVSGLKYYLRVAAEEEGGA  124

Query  432  --AVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
              A S      FDA VVVKPWL+ S+ LL FAP++
Sbjct  125  ENAGSGEGERVFDAVVVVKPWLE-SRTLLRFAPAA  158



>ref|XP_011024794.1| PREDICTED: cysteine proteinase inhibitor B-like [Populus euphratica]
 ref|XP_011011101.1| PREDICTED: cysteine proteinase inhibitor B-like [Populus euphratica]
Length=137

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (67%), Gaps = 5/90 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnining---nggdggLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            K N+E+QELGR+ V E+N + +     G  G L FSEV+ A+ QVV+G+KYYLKI  V  
Sbjct  43   KNNKEIQELGRFSVKEFNNHRSTYGKGGEVGELMFSEVVEAQTQVVSGLKYYLKIE-VTT  101

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
             +     FD+ +VVKPWL+ SK LLSF PS
Sbjct  102  QSEEKLVFDSVLVVKPWLR-SKELLSFEPS  130



>ref|XP_004502264.1| PREDICTED: cysteine proteinase inhibitor 2-like [Cicer arietinum]
Length=134

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 61/91 (67%), Gaps = 4/91 (4%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEY--niningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            + N+EVQELG++ V+EY     +N  GG   L+F EV+ A++QVV+G+KYYL ISA   S
Sbjct  36   RTNREVQELGKFAVEEYNYKQGLNNGGGGEALKFVEVVEAQQQVVSGMKYYLNISATDRS  95

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
             G+   F + VVVKPWLQ  K LL F P S+
Sbjct  96   -GIHRMFTSVVVVKPWLQYKK-LLHFEPLST  124



>ref|XP_002301749.1| cystatin family protein [Populus trichocarpa]
 gb|EEE81022.1| cystatin family protein [Populus trichocarpa]
Length=135

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (67%), Gaps = 5/90 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnining---nggdggLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            K N+E+QELGR+ V E+N + +     G  G L FSEV+ A+ QVV+G+KYYLKI A   
Sbjct  43   KTNKEIQELGRFSVKEFNNHRSTYGKGGEVGELMFSEVVEAQTQVVSGVKYYLKIEATTQ  102

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
            S      FD+ +VVKPWL+ SK LL+F PS
Sbjct  103  SEE-KLMFDSVLVVKPWLR-SKELLAFEPS  130



>ref|XP_006296241.1| hypothetical protein CARUB_v10025408mg [Capsella rubella]
 gb|EOA29139.1| hypothetical protein CARUB_v10025408mg [Capsella rubella]
Length=144

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 76/133 (57%), Gaps = 14/133 (11%)
 Frame = +3

Query  162  VIYLWAVVMAAAMVCSTQvegrgvvvggrteiegvKGNQEVQELGRYCVDEY--------  317
            V+ L   ++ A M  S     + VV+GG++++  VK N+E+Q+LGRYCV+++        
Sbjct  8    VLSLLGFLVIAVMTPSANALRKSVVLGGKSDVPNVKANREIQQLGRYCVEQFNQREQSEE  67

Query  318  ----niningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHTFDAQVVVKP  485
                +I          L FS V++A++QVVAG KYYL+I  V    G    FD+ VV++P
Sbjct  68   GNVESIAKTDTDMSNPLMFSRVVSAQKQVVAGTKYYLRIE-VTQPNGSTRMFDSVVVIQP  126

Query  486  WLQNSKHLLSFAP  524
            WL +SK LL F P
Sbjct  127  WL-HSKQLLGFTP  138



>ref|NP_180758.1| cysteine proteinase inhibitor 2 [Arabidopsis thaliana]
 sp|Q8L5T9.2|CYT2_ARATH RecName: Full=Cysteine proteinase inhibitor 2; Short=AtCYS-2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD15406.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
 dbj|BAF01107.1| putative cysteine proteinase inhibitor B [Arabidopsis thaliana]
 gb|AEC08615.1| cysteine proteinase inhibitor 2 [Arabidopsis thaliana]
Length=147

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 59/98 (60%), Gaps = 14/98 (14%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEY------------niningnggdggLRFSEVLAAERQVVAGIKY  410
            + N+E+Q+LGRYCV+++            +I          L+FS V++A++QVVAG+KY
Sbjct  46   RTNREIQQLGRYCVEQFNQQAQNEQGNIGSIAKTDTAISNPLQFSRVVSAQKQVVAGLKY  105

Query  411  YLKISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
            YL+I  V    G    FD+ VV++PWL +SK LL F P
Sbjct  106  YLRIE-VTQPNGSTRMFDSVVVIQPWL-HSKQLLGFTP  141



>ref|XP_007153801.1| hypothetical protein PHAVU_003G065700g [Phaseolus vulgaris]
 gb|ESW25795.1| hypothetical protein PHAVU_003G065700g [Phaseolus vulgaris]
Length=130

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 5/90 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningng--gdggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            K N+EVQ+LG + V+E+N  +           +F EV+ A++Q+V+G KYYLKIS  A  
Sbjct  40   KRNKEVQDLGSFSVEEHNRMLRQALKGMSEETKFVEVVEAQKQMVSGTKYYLKIS--ATQ  97

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPSS  530
            +G P  FD+ VVV+P L  SK LLSFAPSS
Sbjct  98   SGNPVMFDSVVVVQPGLA-SKDLLSFAPSS  126



>gb|AAM64985.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
Length=144

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 59/98 (60%), Gaps = 14/98 (14%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEY------------niningnggdggLRFSEVLAAERQVVAGIKY  410
            + N+E+Q+LGRYCV+++            +I          L+FS V++A++QVVAG+KY
Sbjct  43   RTNREIQQLGRYCVEQFNQQAQNEQGNIGSIAKTDTAISNPLQFSRVVSAQKQVVAGLKY  102

Query  411  YLKISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
            YL+I  V    G    FD+ VV++PWL +SK LL F P
Sbjct  103  YLRIE-VTQPNGSTRMFDSVVVIQPWL-HSKQLLGFTP  138



>ref|XP_006645220.1| PREDICTED: cysteine proteinase inhibitor 5-like [Oryza brachyantha]
Length=143

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 60/92 (65%), Gaps = 5/92 (5%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAV-AVST  443
            +GN+EVQELG +CV E+N   +       L FS V+AA+ QVVAGIKYYL+I+A   +  
Sbjct  48   EGNREVQELGLFCVVEHNRRGSPTARGHRLVFSRVVAAQTQVVAGIKYYLRIAARNGLRE  107

Query  444  GVPH---TFDAQVVVKPWLQNSKHLLSFAPSS  530
            G       FDA VVVK W+  S+ +LSFAP++
Sbjct  108  GDDDEEKVFDAVVVVKAWVP-SREMLSFAPAA  138



>ref|XP_002862941.1| hypothetical protein ARALYDRAFT_497243 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002881207.1| hypothetical protein ARALYDRAFT_482126 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39200.1| hypothetical protein ARALYDRAFT_497243 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57466.1| hypothetical protein ARALYDRAFT_482126 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 14/98 (14%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEY------------niningnggdggLRFSEVLAAERQVVAGIKY  410
            + N+E+QELGRYCV+++            +I          L FS V++A++QVVAG KY
Sbjct  46   RTNREIQELGRYCVEQFNQQEQTEQGNIGSIAKTDTAMSNPLVFSRVVSAQKQVVAGTKY  105

Query  411  YLKISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
            YL+I  V    G    FD+ VV++PWL +SK LL F P
Sbjct  106  YLRIE-VTQPNGSTRMFDSVVVIQPWL-HSKQLLGFTP  141



>ref|XP_006840903.1| hypothetical protein AMTR_s00087p00084520 [Amborella trichopoda]
 gb|ERN02578.1| hypothetical protein AMTR_s00087p00084520 [Amborella trichopoda]
Length=120

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 58/89 (65%), Gaps = 8/89 (9%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            K N EVQ+LG++CV++YN   +       L FSEV+  ERQVV+G+KYYL I   A    
Sbjct  40   KSNTEVQDLGKFCVEKYNQVHDSR-----LVFSEVVQGERQVVSGMKYYLLIE--AKDGD  92

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            V   FDA VVV+ W ++SK +LSF+PS+ 
Sbjct  93   VLKKFDAVVVVQAW-RHSKQMLSFSPSTD  120



>ref|XP_006410333.1| hypothetical protein EUTSA_v10017392mg [Eutrema salsugineum]
 gb|ESQ51786.1| hypothetical protein EUTSA_v10017392mg [Eutrema salsugineum]
Length=142

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 59/99 (60%), Gaps = 14/99 (14%)
 Frame = +3

Query  273  NQEVQELGRYCVDEY------------niningnggdggLRFSEVLAAERQVVAGIKYYL  416
            N E+QELGRYCV+++            +I          L+FS V++A++QVVAG KYYL
Sbjct  43   NMEIQELGRYCVEQFNLQEQSEQGNVASIAKTDPAVLNPLKFSRVVSAQKQVVAGTKYYL  102

Query  417  KISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            +I  V+   G    FD+ +V++PWL +S+ LL F P +S
Sbjct  103  RIE-VSQPDGTTRMFDSVLVIQPWL-HSRKLLGFTPVAS  139



>ref|XP_006840905.1| hypothetical protein AMTR_s00087p00085650 [Amborella trichopoda]
 gb|ERN02580.1| hypothetical protein AMTR_s00087p00085650 [Amborella trichopoda]
Length=120

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            K + EVQ+LG++CV+ YN + +       L F+EV+  ERQVV+GIKYYL I   A   G
Sbjct  40   KSSTEVQDLGKFCVETYNQDHHPQ-----LDFNEVVKGERQVVSGIKYYLLIE--AKDGG  92

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            V   FDA VVV+ W ++SK +LSF+PS+ 
Sbjct  93   VLKKFDAVVVVQAW-RHSKQMLSFSPSTD  120



>emb|CDY68279.1| BnaC04g54180D [Brassica napus]
Length=140

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 55/101 (54%), Gaps = 14/101 (14%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEY------------niningnggdggLRFSEVLAAERQVVAGIKY  410
            + N E+QELGRYCV ++                        L+FS V +A++QVVAG KY
Sbjct  39   RTNMEIQELGRYCVKQFNLQQQSKQGNDATNARTDTAVLSPLKFSRVESAQKQVVAGTKY  98

Query  411  YLKISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            YL+I AV    G    FD+ +V++PWL  SK L+ F P +S
Sbjct  99   YLRI-AVTQPDGTSRMFDSVIVIQPWL-FSKKLIEFTPVAS  137



>ref|XP_009387215.1| PREDICTED: cysteine proteinase inhibitor 4-like [Musa acuminata 
subsp. malaccensis]
Length=140

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 7/89 (8%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAV---AV  437
            + N+EVQ+LGRY V+EYN +         L F+ V+ A+RQVV+GIKYYL++ A      
Sbjct  53   ESNKEVQDLGRYSVEEYNRHQGPAHP---LTFARVVGAQRQVVSGIKYYLRVLATEGDGG  109

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
            S G   T+DA VVVK WL  S+ L+SF P
Sbjct  110  SAGQQRTYDAVVVVKAWL-GSRELISFVP  137



>ref|XP_010557035.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=149

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (56%), Gaps = 14/104 (13%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYn------------iningnggdggLRFSEVLAAERQVVAGIKY  410
            + N+E+QELGRYCV E+N                       L FS V+ A+ QVV+GIKY
Sbjct  43   ESNRELQELGRYCVQEFNLREEREHEKGRGSTSEEAAVFDPLMFSRVVEAQEQVVSGIKY  102

Query  411  YLKISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSSYLL  542
            +LKI  V +S      F + VV+KPWLQ S+ LL F+P ++ L 
Sbjct  103  FLKIE-VTLSDRTTRMFTSVVVIKPWLQ-SRELLDFSPVTNPLF  144



>emb|CDY42085.1| BnaA05g11010D [Brassica napus]
Length=136

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 54/98 (55%), Gaps = 14/98 (14%)
 Frame = +3

Query  267  KGNQEVQELGRYCV------------DEYniningnggdggLRFSEVLAAERQVVAGIKY  410
            + N E+QELGRYCV            +E +           L+FS V +A++QVVAG KY
Sbjct  39   RTNIEIQELGRYCVKQFNLQQQSKQGNEASNARTDAAVLSPLKFSRVESAQKQVVAGTKY  98

Query  411  YLKISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
            YL+I AV    G    FD+ +V++PWL  SK LL F P
Sbjct  99   YLRI-AVTQPDGTSRMFDSVIVIQPWL-FSKKLLEFTP  134



>ref|XP_009144029.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ABB97037.1| cystatin-like protein [Brassica rapa]
Length=136

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 54/98 (55%), Gaps = 14/98 (14%)
 Frame = +3

Query  267  KGNQEVQELGRYCV------------DEYniningnggdggLRFSEVLAAERQVVAGIKY  410
            + N E+QELGRYCV            +E +           L+FS V +A++QVVAG KY
Sbjct  39   RTNIEIQELGRYCVKQFNLQQQSKQGNEASNARTDAAVLSPLKFSRVESAQKQVVAGTKY  98

Query  411  YLKISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
            YL+I AV    G    FD+ +V++PWL  SK LL F P
Sbjct  99   YLRI-AVTQPDGTSRMFDSVIVIQPWL-FSKKLLEFTP  134



>ref|XP_010039949.1| PREDICTED: cysteine proteinase inhibitor B [Eucalyptus grandis]
 gb|KCW45610.1| hypothetical protein EUGRSUZ_L00642 [Eucalyptus grandis]
Length=146

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 12/93 (13%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYninin---------gnggdggLRFSEVLAAERQVVAGIKYYLK  419
            + NQEVQ+LGRY V+EYN             G G +G + F EV+ AERQVVAGIKYYLK
Sbjct  39   RSNQEVQDLGRYSVEEYNRMQRWQRGGGGGRGGGDNGEIVFGEVVGAERQVVAGIKYYLK  98

Query  420  ISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSF  518
            I    +  G    F++ VVV+PW++ SK L++F
Sbjct  99   IE--GMQRGARKVFESVVVVRPWVR-SKELVTF  128



>gb|KFK31166.1| hypothetical protein AALP_AA6G077400 [Arabis alpina]
Length=139

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnin---------ingnggdggLRFSEVLAAERQVVAGIKYYLK  419
            + N+E+QELGRYCV+++N+                   L+FS V++A++QVVAG+KY+L+
Sbjct  41   QANREIQELGRYCVEQFNLREQREQGNIESISKTVTNTLKFSRVVSAQKQVVAGMKYFLR  100

Query  420  ISAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            I  V    G    FD+ VV++PWL + K ++ F P +S
Sbjct  101  IE-VTQPDGSRRMFDSVVVIQPWL-HYKRVIGFTPVAS  136



>ref|NP_001172709.1| Os01g0915401 [Oryza sativa Japonica Group]
 sp|Q0JGM8.2|CYT5_ORYSJ RecName: Full=Cysteine proteinase inhibitor 5; AltName: Full=Oryzacystatin 
V; Short=OC-V; AltName: Full=Oryzacystatin-5; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|EAY76950.1| hypothetical protein OsI_04908 [Oryza sativa Indica Group]
 gb|EAZ14606.1| hypothetical protein OsJ_04531 [Oryza sativa Japonica Group]
 dbj|BAH91439.1| Os01g0915401 [Oryza sativa Japonica Group]
Length=148

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            +GN+EVQELG +CV E+N          GL FS V+AA+ QVV+GIKYYL+I+A      
Sbjct  59   EGNREVQELGLFCVVEHNRRGGSATRGRGLVFSRVVAAQTQVVSGIKYYLRIAAQEADDE  118

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSSSYLLPA  548
            +   FDA VVVK W+  S+ ++SF P++   LP 
Sbjct  119  L--VFDAVVVVKAWVP-SREMVSFVPAAE--LPG  147



>ref|XP_010542782.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=145

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 11/93 (12%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdg---------gLRFSEVLAAERQVVAGIKYYLKIS  425
            N+E+QELGRYCV+E+N+                   L FS V+ A+RQVV+GIKY+LKI 
Sbjct  46   NKELQELGRYCVEEFNLKEGRREKGSGEEEEEVLGPLVFSRVVEAQRQVVSGIKYFLKIE  105

Query  426  AVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
             V +       F + VVVKPWL  S+ LL F+P
Sbjct  106  -VTLPDRTTRMFSSVVVVKPWLP-SRELLDFSP  136



>gb|AES71980.2| phloem filament protein PP1 [Medicago truncatula]
Length=130

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +3

Query  273  NQEVQELGRYCVDEY--niningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            N+EVQELG++ V EY     +N  GG  GL+F EV+ AE+QVV+G+KYYL ISAV    G
Sbjct  39   NKEVQELGKFAVKEYNYKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKYYLNISAVD-HNG  97

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSSSYLLP  545
            V   F++ VVVKPWL   K ++        L+P
Sbjct  98   VQRMFNSVVVVKPWLHQYKKVIQTRHIMGILVP  130



>ref|XP_003601729.1| Cysteine proteinase inhibitor [Medicago truncatula]
Length=129

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +3

Query  273  NQEVQELGRYCVDEY--niningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            N+EVQELG++ V EY     +N  GG  GL+F EV+ AE+QVV+G+KYYL ISAV    G
Sbjct  38   NKEVQELGKFAVKEYNYKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKYYLNISAVD-HNG  96

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSSSYLLP  545
            V   F++ VVVKPWL   K ++        L+P
Sbjct  97   VQRMFNSVVVVKPWLHQYKKVIQTRHIMGILVP  129



>ref|XP_010522274.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=132

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +3

Query  270  GNQEVQELGRYCVDEYniningnggdgg-LRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            GN+EVQ+LGRYCV+E+N       G+   L F+ V+ A +QVV+G KY+LKI    +S  
Sbjct  47   GNKEVQDLGRYCVEEFNRKEQEKNGNVAPLVFNRVVEARQQVVSGTKYFLKIET-TLSDR  105

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFA  521
                F++ VVVKPWLQ S+ L+ F+
Sbjct  106  TTKMFNSVVVVKPWLQ-SRELVDFS  129



>ref|XP_006646602.1| PREDICTED: cysteine proteinase inhibitor 4-like [Oryza brachyantha]
Length=146

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 65/99 (66%), Gaps = 12/99 (12%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAV---  437
            +G++EVQELGR+ V+E+N   +  G    L FS V+AA+RQVV+G+ YYL+++A      
Sbjct  48   EGDREVQELGRFSVEEHNRRRDCCGDVR-LEFSRVVAAQRQVVSGLMYYLRVAAAEEGAA  106

Query  438  ----STGVPH---TFDAQVVVKPWLQNSKHLLSFAPSSS  533
                + G  H    +DA VVVKPWL+ S+ LL+FAP++ 
Sbjct  107  AADQNGGGDHHARVYDAVVVVKPWLE-SRTLLTFAPAAD  144



>ref|XP_009132828.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ADD10747.1| phytocystatin 2-2 [Brassica rapa subsp. pekinensis]
Length=141

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 55/94 (59%), Gaps = 12/94 (13%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYn----------iningnggdggLRFSEVLAAERQVVAGIKYYLKI  422
            N EVQELGRYCV+++N           +         L FS V++A++QVVAG+KYYL+I
Sbjct  44   NMEVQELGRYCVEQFNLHEQSGKGNVASSIDRAVLNPLTFSRVVSAQQQVVAGLKYYLRI  103

Query  423  SAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
              V         FD+ VVV+PWL +SK LL F P
Sbjct  104  E-VTQPDRTSRMFDSVVVVQPWL-HSKTLLGFTP  135



>ref|XP_009141203.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ADD10746.1| phytocystatin 2-1 [Brassica rapa subsp. pekinensis]
 emb|CDY60964.1| BnaA04g28930D [Brassica napus]
Length=142

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (59%), Gaps = 12/94 (13%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYnining----------nggdggLRFSEVLAAERQVVAGIKYYLKI  422
            N E+QELGRYCV+++N+                    L FS V++A++QVVAG+KY L+I
Sbjct  45   NIEIQELGRYCVEQFNLMEESEQGNAESIADTAVLNPLNFSRVVSAQKQVVAGLKYDLRI  104

Query  423  SAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
              +    G    FD+ V+++PWL +SK LL F P
Sbjct  105  EVIQ-PDGTSRMFDSVVIIQPWL-HSKKLLGFTP  136



>emb|CDY62192.1| BnaCnng39540D [Brassica napus]
Length=142

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 12/94 (13%)
 Frame = +3

Query  273  NQEVQELGRYCVDEY----------niningnggdggLRFSEVLAAERQVVAGIKYYLKI  422
            N E+QELGRYCV+++            +I        L FS V++A++QVVAG+KY L+I
Sbjct  45   NIEIQELGRYCVEQFNLMEESEQGNAESIANTAVLNPLNFSRVVSAQKQVVAGLKYDLRI  104

Query  423  SAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
              +    G    FD+ V+++PWL  SK LL F P
Sbjct  105  EVIQ-PDGTNRMFDSVVIIQPWLH-SKKLLGFTP  136



>ref|NP_001146946.1| cysteine proteinase inhibitor B precursor [Zea mays]
 gb|ACG24630.1| cysteine proteinase inhibitor B [Zea mays]
Length=150

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 5/93 (5%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSE-VLAAERQVVAGIKYYLKISAV---A  434
            +G+ EVQELGR+ V EYN  +   GG GG      V+AA+RQVV+G+KYYL++ AV    
Sbjct  58   EGDGEVQELGRFSVAEYNRQLREGGGGGGRLEFGRVVAAQRQVVSGLKYYLRVVAVEEGG  117

Query  435  VSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
               G    FDA VVVKPWL +S+ LL+FAP+++
Sbjct  118  AGNGGERVFDAVVVVKPWL-DSRTLLTFAPAAA  149



>gb|AFW84200.1| putative cystatin [Zea mays]
Length=155

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSE-VLAAERQVVAGIKYYLKISAV----  431
            +G+ EVQELGR+ V EYN  +   GG GG      V+AA+RQVV+G+KYYL++ AV    
Sbjct  62   EGDGEVQELGRFSVAEYNRQLREGGGGGGRLEFGRVVAAQRQVVSGLKYYLRVVAVEEGG  121

Query  432  AVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
                G    FDA VVVKPWL +S+ LL+FAP+++
Sbjct  122  GAGNGGERVFDAVVVVKPWL-DSRTLLTFAPAAA  154



>gb|EMT28874.1| Cysteine proteinase inhibitor 4 [Aegilops tauschii]
Length=149

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 64/99 (65%), Gaps = 13/99 (13%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdg----gLRFSEVLAAERQVVAGIKYYLKISAV-  431
            +G++E  ELGRY V+E+N        DG     L F+ V++A+RQVV+G+KYYL+++A  
Sbjct  53   EGDRE--ELGRYSVEEHNRRRGEGCEDGGVCGRLEFARVVSAQRQVVSGVKYYLRVAAAE  110

Query  432  ---AVSTGVP--HTFDAQVVVKPWLQNSKHLLSFAPSSS  533
               A + GV     FDA VVVKPWLQ S+ L+ FAP+ +
Sbjct  111  ENGAGTNGVSDGRVFDAVVVVKPWLQ-SRALVRFAPADA  148



>tpe|CAG29029.1| TPA: putative cystatin [Zea mays]
Length=155

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSE-VLAAERQVVAGIKYYLKISAV----  431
            +G+ EVQELGR+ V EYN  +   GG GG      V+AA+RQVV+G+KYYL++ AV    
Sbjct  62   EGDGEVQELGRFSVAEYNRQLREGGGGGGRLEFGRVVAAQRQVVSGLKYYLRVVAVEEGG  121

Query  432  AVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
                G    FDA VVVKPWL +S+ LL+FAP+++
Sbjct  122  GAGNGGERVFDAVVVVKPWL-DSRTLLTFAPAAA  154



>emb|CDX79450.1| BnaC03g17860D [Brassica napus]
Length=752

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 55/94 (59%), Gaps = 12/94 (13%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYn----------iningnggdggLRFSEVLAAERQVVAGIKYYLKI  422
            N EVQELGRYCV+++N           +         L FS V++A++QVVAG+KYYL+I
Sbjct  655  NMEVQELGRYCVEQFNLHEQSGKGNVASSIDRAVLNPLTFSRVVSAQQQVVAGLKYYLRI  714

Query  423  SAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
              V    G    FD+ VVV+PWL  SK LL F P
Sbjct  715  E-VTQPDGTNRMFDSVVVVQPWLH-SKTLLGFTP  746



>emb|CDX84749.1| BnaA03g14810D [Brassica napus]
Length=757

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 55/94 (59%), Gaps = 12/94 (13%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYn----------iningnggdggLRFSEVLAAERQVVAGIKYYLKI  422
            N EVQELGRYCV+++N           +         L FS V++A++QVVAG+KYYL+I
Sbjct  660  NMEVQELGRYCVEQFNLHEQSGKGNVASSIERAVLNPLTFSRVVSAQQQVVAGLKYYLRI  719

Query  423  SAVAVSTGVPHTFDAQVVVKPWLQNSKHLLSFAP  524
              V    G    FD+ VVV+PWL  SK LL F P
Sbjct  720  E-VTQPDGTNRMFDSVVVVQPWLH-SKTLLGFTP  751



>ref|XP_002320446.1| cystatin family protein [Populus trichocarpa]
 gb|EEE98761.1| cystatin family protein [Populus trichocarpa]
Length=138

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%), Gaps = 5/95 (5%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYninin---gnggdggLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            K N++VQELGR+ V E+N + +     GG G L FSEV+ A +QVV+G+KYYL I A   
Sbjct  44   KTNKQVQELGRFSVKEFNSHRSLYWKGGGVGKLMFSEVVEAHKQVVSGLKYYLNIVA-TT  102

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAPSSSYLL  542
              G    FD+ VVV+P L+ ++ LL+F PS+  ++
Sbjct  103  QNGEKRMFDSVVVVQPGLRTTE-LLTFEPSAKLMV  136



>ref|NP_001052530.1| Os04g0350100 [Oryza sativa Japonica Group]
 sp|A2XS65.2|CYT10_ORYSI RecName: Full=Cysteine proteinase inhibitor 10; AltName: Full=Oryzacystatin 
X; Short=OC-X; AltName: Full=Oryzacystatin-10; 
Flags: Precursor [Oryza sativa Indica Group]
 sp|P0C579.1|CYT10_ORYSJ RecName: Full=Cysteine proteinase inhibitor 10; AltName: Full=Oryzacystatin 
X; Short=OC-X; AltName: Full=Oryzacystatin-10; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAE05518.1| OSJNBa0038P21.11 [Oryza sativa Japonica Group]
 dbj|BAF14444.1| Os04g0350100 [Oryza sativa Japonica Group]
 emb|CAH66615.1| OSIGBa0144C23.1 [Oryza sativa Indica Group]
 dbj|BAG88896.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95408.1| unnamed protein product [Oryza sativa Japonica Group]
Length=151

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 59/100 (59%), Gaps = 14/100 (14%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdg-------gLRFSEVLAAERQVVAGIKYYLKISAV  431
            N+ VQ LGR+ V E+N  +   G  G        L F+ V+ A++QVV+G+ YYLK++A 
Sbjct  51   NKAVQSLGRFAVAEHNRRLRHGGSGGPADPVPVKLAFARVVEAQKQVVSGVAYYLKVAAS  110

Query  432  A------VSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
            A       + G    FDA VVVK WL+ SK L+SF P+SS
Sbjct  111  ARDPRGGAAAGGDRVFDAVVVVKAWLK-SKELVSFTPASS  149



>gb|EAY93675.1| hypothetical protein OsI_15462 [Oryza sativa Indica Group]
Length=151

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 10/97 (10%)
 Frame = +3

Query  270  GNQEVQELGRYCVDEYniningnggdgg------LRFSEVLAAERQVVAGIKYYLKISAV  431
            GN+ VQ LGR+ V E+N  +    G         L F+ V+ A++QVV+G+ YYLK++A 
Sbjct  54   GNKAVQSLGRFAVAEHNRRLRHGSGGPADPVPVKLAFARVVEAQKQVVSGVAYYLKVAAR  113

Query  432  AVSTGV---PHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
                G       FDA VVVK WL+ SK L+SF P++S
Sbjct  114  DPRGGAAAGDRVFDAVVVVKAWLK-SKELVSFTPAAS  149



>ref|XP_003532730.1| PREDICTED: cysteine proteinase inhibitor 4-like [Glycine max]
Length=103

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 3/83 (4%)
 Frame = +3

Query  282  VQELGRYCVDEYnin-ingnggdggLRFSEVLAAERQVVAGIKYYLKISAV-AVSTGVPH  455
            VQ+LGR+ V+E+N         +  + F EV+ A+ QVV+GIKYY+KISA      G   
Sbjct  4    VQDLGRFSVEEHNRMLRQAQKEEEEVTFEEVVEAQSQVVSGIKYYMKISATQGGDGGDSR  63

Query  456  TFDAQVVVKPWLQNSKHLLSFAP  524
             F++ VVVKPWL+ SK LL+FAP
Sbjct  64   IFESVVVVKPWLR-SKQLLNFAP  85



>gb|ADV02771.1| cysteine protease inhibitor [Ipomoea batatas]
Length=134

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 5/93 (5%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningn----ggdggLRFSEVLAAERQVVAGIKYYLKISAVA  434
            K N EVQ LGR  V E+N  +N           L F+EV+ AE+QVVAG KY+L I A +
Sbjct  42   KTNAEVQNLGRKAVMEFNKRLNVKVNPENNAKRLVFTEVIKAEKQVVAGEKYFLTIKATS  101

Query  435  VSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
               G   T+++++ VKP  +    +L+FAP+++
Sbjct  102  -EDGQTKTYESEMWVKPGDETVHEMLNFAPAAA  133



>ref|XP_010522275.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=142

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 61/96 (64%), Gaps = 9/96 (9%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdgg-------LRFSEVLAAERQVVAGIKYYLKISAV  431
            N+E+QELGRYCV+E+N+      G  G       L F EV+  +RQVV+GIKY+L+I A 
Sbjct  45   NKELQELGRYCVEEFNLKEQREHGKSGGEEGFNPLMFGEVVEVQRQVVSGIKYFLRIQA-  103

Query  432  AVSTGVPHTFDAQVVVKPWLQNSKHLLSFAPSSSYL  539
             +       F++ VVVKPWLQ SK LL F+P ++ L
Sbjct  104  TLPDRTTRMFNSVVVVKPWLQ-SKELLDFSPVANPL  138



>emb|CAN70300.1| hypothetical protein VITISV_001398 [Vitis vinifera]
Length=199

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 12/81 (15%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYnin----------ingnggdggLRFSEVLAAERQVVAGIKYYL  416
            K N+EVQ+LGR+ V+EYN +                   L FSEV+ A++QVV+G KYYL
Sbjct  44   KTNKEVQQLGRFSVEEYNRSHGRRWREAIGNVLGMDYEYLTFSEVVEAQKQVVSGFKYYL  103

Query  417  KISAVAVSTGVPHTFDAQVVV  479
            KI+  A   GV +TFDA VVV
Sbjct  104  KIA--ATQNGVRNTFDAVVVV  122



>ref|XP_001771745.1| predicted protein [Physcomitrella patens]
 gb|EDQ63353.1| predicted protein [Physcomitrella patens]
Length=139

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 6/84 (7%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E+ EL  + VD+Y    N       + FS+VL+A+ QVV G  YY  I  +    GVP  
Sbjct  17   EIDELANFAVDQYKSRQNSIAV---ITFSKVLSAKEQVVQGKMYYFTIEVM--ENGVPKN  71

Query  459  FDAQVVVKPWLQNSKHLLSFAPSS  530
            +DA+V VKPW +  K L SF PS+
Sbjct  72   YDAKVWVKPW-EGYKELESFLPSA  94



>ref|XP_007153806.1| hypothetical protein PHAVU_003G066200g [Phaseolus vulgaris]
 gb|ESW25800.1| hypothetical protein PHAVU_003G066200g [Phaseolus vulgaris]
Length=173

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningng-gdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGV  449
            N+EVQ+LG++ V+E N ++         L F EVL A++QVV+  KYYLKIS     +G 
Sbjct  91   NKEVQDLGQFAVEERNQSMKEIAFAKPELTFVEVLEAQKQVVSVTKYYLKISTNK--SGG  148

Query  450  PHTFDAQVVVKPWLQNSKHLLSFAPS  527
              T+D+ VVVKP   +SK LL+F  S
Sbjct  149  SKTYDSVVVVKP---SSKQLLNFTAS  171



>emb|CAG38125.1| cystatin Hv-CPI9 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91797.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=143

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 53/93 (57%), Gaps = 9/93 (10%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdgg-------LRFSEVLAAERQVVAGIKYYLKISAV  431
            N+ VQ LGR+ V E+N  +   G           L F+ V AA++QV++G+ YYLK+ A 
Sbjct  50   NKLVQSLGRFAVAEHNRRLGHGGSGNNGDPVQVQLAFTAVAAAQKQVISGVVYYLKVIAR  109

Query  432  A-VSTGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
            A    G    FDA VVVK W + SK L+SF PS
Sbjct  110  APAGGGGDRPFDAVVVVKAWAK-SKELVSFMPS  141



>sp|Q10992.1|CYTA_HELAN RecName: Full=Cysteine proteinase inhibitor A; AltName: Full=Cystatin-A; 
AltName: Full=SCA [Helianthus annuus]
Length=82

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 8/82 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E+ EL R+ VDE+N   N       L F +V+  + QVVAG  YY+ +   A + GV  T
Sbjct  3    EIDELARFAVDEHNKKQNAL-----LEFGKVVNTKEQVVAGKMYYITLE--ATNGGVKKT  55

Query  459  FDAQVVVKPWLQNSKHLLSFAP  524
            ++A+V VKPW +N K L  F P
Sbjct  56   YEAKVWVKPW-ENFKELQEFKP  76



>gb|KDO52834.1| hypothetical protein CISIN_1g035532mg, partial [Citrus sinensis]
Length=112

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 6/75 (8%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningn------ggdggLRFSEVLAAERQVVAGIKYYLKISA  428
            K N+EVQELG++ V+E+N +             G LRFS+VL A++QVV+GIKYYL I A
Sbjct  38   KKNKEVQELGKFSVEEFNRSQQRQGKVIRNVAFGRLRFSQVLEAQKQVVSGIKYYLTIEA  97

Query  429  VAVSTGVPHTFDAQV  473
                 G    FD+ V
Sbjct  98   TTGENGEIQMFDSIV  112



>ref|XP_006346810.1| PREDICTED: cysteine proteinase inhibitor 5-like [Solanum tuberosum]
Length=134

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVP  452
            N EV E+G++ VDE+N           L+F E+   E QVVAGI Y L IS  A  +  P
Sbjct  46   NPEVVEIGKFAVDEHNKEAKTK-----LKFQEITEGESQVVAGINYRLVIS--AKDSDSP  98

Query  453  HTFDAQVVVKPWLQNSKHLLSFAPSS  530
            H + A+V  KPW +  ++L SF   S
Sbjct  99   HNYLAEVWDKPW-EKFRNLTSFVECS  123



>ref|XP_009141947.1| PREDICTED: cysteine proteinase inhibitor 3-like [Brassica rapa]
Length=130

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 11/92 (12%)
 Frame = +3

Query  267  KGNQ---EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            +GNQ   E++ L R+ + E+N   N       L F +++ A  QVVAG  YYL +   A 
Sbjct  47   RGNQNSGEIESLARFAIQEHNNRENMV-----LEFKKIVKAREQVVAGTMYYLTLE--AN  99

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
              G    F+A+V VKPW+ N K L  F  SSS
Sbjct  100  EGGQAKNFEAKVWVKPWM-NFKQLQEFKESSS  130



>emb|CDY14750.1| BnaC04g47470D [Brassica napus]
Length=129

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 50/91 (55%), Gaps = 11/91 (12%)
 Frame = +3

Query  270  GNQ---EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVS  440
            GNQ   E++ L R+ + E+N   N       L F +++ A +QVVAG+ YYL +   A  
Sbjct  47   GNQNSGEIESLARFAIQEHNNKENKV-----LEFKKIVKARQQVVAGMMYYLTLE--ANE  99

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
             G    F+A+V VKPW+ N K L  F  SSS
Sbjct  100  GGQAKNFEAKVWVKPWM-NFKQLREFKESSS  129



>emb|CDY06956.1| BnaA04g23590D [Brassica napus]
Length=130

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 11/92 (12%)
 Frame = +3

Query  267  KGNQ---EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            +GNQ   E++ L R+ + E+N   N       L F +++ A  QVVAG  YYL +   A 
Sbjct  47   RGNQNSGEIESLARFAIQEHNNRENKV-----LEFKKIVKAREQVVAGTMYYLTLE--AN  99

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
              G    F+A+V VKPW+ N K L  F  SSS
Sbjct  100  EGGQAKNFEAKVWVKPWM-NFKQLQEFKESSS  130



>ref|XP_007153810.1| hypothetical protein PHAVU_003G066600g [Phaseolus vulgaris]
 gb|ESW25804.1| hypothetical protein PHAVU_003G066600g [Phaseolus vulgaris]
Length=126

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 50/88 (57%), Gaps = 4/88 (5%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdg-gLRFSEVLAAERQVVAGIKYYLKISAVAVST  443
            K NQEVQ+LGR+ VDE N  +  +G     + F  VL A++QVV+G KYYLKIS      
Sbjct  41   KTNQEVQDLGRFAVDERNRKLKESGAMRPVVAFVTVLEAQKQVVSGTKYYLKISTNQNEA  100

Query  444  GVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
                 +D+ VVVK    +SK L  F  S
Sbjct  101  RESVIYDSVVVVKG---SSKELQIFTVS  125



>pdb|4N6T|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold 
- Full Length Adhiron
 pdb|4N6U|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold 
- Truncated Adhiron
Length=79

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 8/82 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E++EL R+ VDE+N   N       L F  V+ A+ QVVAG  YYL +   A   G    
Sbjct  5    EIEELARFAVDEHNKKENAL-----LEFVRVVKAKEQVVAGTMYYLTLE--AKDGGKKKL  57

Query  459  FDAQVVVKPWLQNSKHLLSFAP  524
            ++A+V VKPW +N K L  F P
Sbjct  58   YEAKVWVKPW-ENFKELQEFKP  78



>ref|XP_009120653.1| PREDICTED: cysteine proteinase inhibitor 6-like [Brassica rapa]
Length=235

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            EV+ L R+ VDE+N   N       L F+ V+ A+ QVVAG  ++L +  +    G    
Sbjct  48   EVESLARFAVDEHNKKENAL-----LEFARVVKAKEQVVAGTMHHLTLEII--EAGKKKL  100

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSSYLLPAAT  554
            ++A+V VKPWL N K L  F P+S    P+AT
Sbjct  101  YEAKVWVKPWL-NFKELQEFKPASDDGSPSAT  131



>gb|AAA96316.1| cysteine proteinase inhibitor [Brassica rapa subsp. oleifera]
Length=205

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 9/92 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            EV+ L R+ VDE+N   N       L F+ V+ A+ QVVAG  ++L +  +     +   
Sbjct  18   EVESLARFAVDEHNKKENAL-----LEFARVVKAKEQVVAGTMHHLTLEIIEAGKKL---  69

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSSYLLPAAT  554
            ++A+V VKPWL N K L  F P+S    P+AT
Sbjct  70   YEAKVWVKPWL-NFKELQEFKPASDDGSPSAT  100



>gb|AFW97773.1| cysteine protease inhibitor [Brassica oleracea var. italica]
 emb|CDY50343.1| BnaC01g38380D [Brassica napus]
Length=205

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 8/92 (9%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            EV+ L R+ VDE+N   N       L F+ V+ A+ QVVAG  ++L +  +    G    
Sbjct  18   EVESLARFAVDEHNKKENAL-----LEFARVVKAKEQVVAGTMHHLTLEII--EAGKKKL  70

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSSYLLPAAT  554
            ++A+V VKPWL N K L  F P+S    P+ T
Sbjct  71   YEAKVWVKPWL-NFKELQEFKPASDDGAPSTT  101



>ref|XP_002465058.1| hypothetical protein SORBIDRAFT_01g031440 [Sorghum bicolor]
 gb|EER92056.1| hypothetical protein SORBIDRAFT_01g031440 [Sorghum bicolor]
Length=125

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 7/86 (8%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVP  452
            + E+QE+GR+ V E+            L FS+V+  E QVVAG  Y L I A   + G  
Sbjct  47   DPEIQEIGRWAVSEH-----DAAASDSLVFSKVVRGEEQVVAGTNYKLVIEATKGAGGKI  101

Query  453  HTFDAQVVVKPWLQNSKHLLSFAPSS  530
             T+ A V  K  + N++ LLSFAP +
Sbjct  102  ATYGAVVYEK--VDNTRQLLSFAPEN  125



>gb|ABK23108.1| unknown [Picea sitchensis]
Length=128

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 8/84 (10%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVP  452
             +E+Q+LGR+ V+EYN+  N       + FS VL A+ QVV+G+ YYL++    +  G  
Sbjct  47   KKEIQDLGRFAVNEYNVQQNAR-----ILFSRVLKAQEQVVSGLLYYLRVE--TMDGGKT  99

Query  453  HTFDAQVVVKPWLQNSKHLLSFAP  524
              + A++ VKPW +  + L  F P
Sbjct  100  KLYAAKIWVKPW-EKFRQLQEFKP  122



>ref|XP_003561918.1| PREDICTED: putative cysteine proteinase inhibitor 7 [Brachypodium 
distachyon]
Length=112

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 49/87 (56%), Gaps = 7/87 (8%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVP  452
            N  VQELG++ V E+  N +       LRFS+V + E Q VAG+KY L I AV    G  
Sbjct  33   NPHVQELGKWAVTEHAKNAHDG-----LRFSKVTSGEEQDVAGVKYRLSIDAVQ-GNGKV  86

Query  453  HTFDAQVVVKPWLQNSKHLLSFAPSSS  533
              +   ++ +P   N++ L+SFAP+ +
Sbjct  87   GKYSTVLIEEP-RSNTRTLISFAPAGN  112



>gb|EPS68642.1| cysteine proteinase inhibitor, partial [Genlisea aurea]
Length=79

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 8/83 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            EV+ LGR+ + E+N N N       L F+ V+ AE+QVV+G  Y+L +   AV  G    
Sbjct  5    EVESLGRFAIQEHNKNQNAA-----LEFTRVVKAEQQVVSGKLYHLTVE--AVDGGQKQV  57

Query  459  FDAQVVVKPWLQNSKHLLSFAPS  527
            ++A+V VKPWL N K L  F  +
Sbjct  58   YEAKVWVKPWL-NFKQLNEFKKA  79



>gb|ABK21379.1| unknown [Picea sitchensis]
 gb|ABK22996.1| unknown [Picea sitchensis]
 gb|ACN40467.1| unknown [Picea sitchensis]
Length=130

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 8/84 (10%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVP  452
             +E+Q+LGR+ VDEYN   N       + FS+V+ A+ QVV+G+ YYL I     S    
Sbjct  49   KKEIQDLGRFAVDEYNTQQNVG-----ISFSKVVKAQEQVVSGLLYYLTIKTKEGSK--T  101

Query  453  HTFDAQVVVKPWLQNSKHLLSFAP  524
              + A++ VKPW +  K L  F P
Sbjct  102  KLYAAKIWVKPW-EKFKQLQEFKP  124



>dbj|BAA95416.1| multicystatin [Helianthus annuus]
Length=282

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 10/115 (9%)
 Frame = +3

Query  282  VQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHTF  461
            + +L R+ VDEYN   N       L F +VL A+ Q+V+G  YY+ +   A + G+  T+
Sbjct  19   IDDLARFAVDEYNKKQNTL-----LEFRKVLNAKEQIVSGTLYYITLD--AANGGIIKTY  71

Query  462  DAQVVVKPWLQNSKHLLSFAP--SSSYLLPAATKYLSF*GSL*LAPGRRPARSFH  620
            +A+V VK W +N K L  F P  +++ ++   T+   F  SL +    R A   H
Sbjct  72   EAKVWVKKW-ENLKELQEFKPVDAATSVIGGITEVKDFANSLEIEDLARFAVDEH  125



>ref|XP_010245150.1| PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera]
Length=204

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (53%), Gaps = 8/85 (9%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E++ LGR+ VDEY         +  L F  V+ A+ Q+VAG  ++L +       G+   
Sbjct  21   EIESLGRFAVDEY-----NKKQNALLEFGRVVEAKEQLVAGTLHHLTLE--VTEAGMKKL  73

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSS  533
            ++A+V VKPWL N K L  F P S 
Sbjct  74   YEAKVWVKPWL-NFKELQEFTPVSD  97



>gb|AAA97906.1| cysteine proteinase inhibitor [Glycine max]
Length=103

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (57%), Gaps = 10/83 (12%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG-VPH  455
            E+  L R+ V+E          +  L F  V++A++QVVAG+ YY+ + A     G + +
Sbjct  23   EINNLARFAVEE-----QNKRENSVLEFVRVISAKQQVVAGVNYYITLEA---KDGLIKN  74

Query  456  TFDAQVVVKPWLQNSKHLLSFAP  524
             ++A+V V+ WL NSK LL F P
Sbjct  75   EYEAKVWVREWL-NSKELLEFKP  96



>gb|AAC37479.1| cysteine proteinase inhibitor [Brassica rapa subsp. oleifera]
Length=199

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            EV+ L R+ VDE+N   N       L F+ V+ A+ QVVAG  ++L +  +    G    
Sbjct  18   EVESLARFAVDEHNKKENAL-----LEFARVVKAKEQVVAGTMHHLTLEII--EAGKKKL  70

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSS  533
            ++A+V VKPWL N K L  F PS++
Sbjct  71   YEAKVWVKPWL-NFKELQEFKPSTT  94



>ref|XP_006411355.1| hypothetical protein EUTSA_v10017418mg [Eutrema salsugineum]
 gb|ESQ52808.1| hypothetical protein EUTSA_v10017418mg [Eutrema salsugineum]
Length=127

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 49/92 (53%), Gaps = 11/92 (12%)
 Frame = +3

Query  267  KGNQ---EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            +GNQ   E++ L R+ + E+N   N       L F +++ A  QVVAG  Y+L +   A 
Sbjct  44   RGNQNSGEIESLARFAIQEHNNRQNKV-----LEFKKIVKAREQVVAGTMYHLTLE--AN  96

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
              G    F+A+V VKPW+ N K L  F  SS+
Sbjct  97   EGGQAKNFEAKVWVKPWM-NFKQLQEFKESST  127



>ref|XP_006470502.1| PREDICTED: cysteine proteinase inhibitor-like [Citrus sinensis]
Length=100

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = +3

Query  270  GNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGV  449
             NQE+  L R+ VDE+N   N N     L+F +V++A++QVV+G  Y   I+  AV  G 
Sbjct  15   NNQEIVNLARFAVDEHNKKQNSN-----LQFVKVVSAKQQVVSGTLY--DITLEAVEGGQ  67

Query  450  PHTFDAQVVVKPWLQNSKHLLSFAP  524
               F+A+V  KPW+Q  K L  F P
Sbjct  68   KKLFEAKVWEKPWMQ-FKELKEFNP  91



>ref|XP_009361915.1| PREDICTED: cysteine proteinase inhibitor A-like [Pyrus x bretschneideri]
Length=95

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 44/85 (52%), Gaps = 8/85 (9%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E + L RY VDE+N   N       L F  VL  + QVV+G  +YLKI   A   G    
Sbjct  18   ETENLARYAVDEHNKKENDL-----LEFVRVLDDKVQVVSGTMHYLKIE--ATDGGKKKV  70

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSS  533
            ++A+V VKPW +N K +  F P S 
Sbjct  71   YEAKVWVKPW-ENFKQVQEFKPVSD  94



>gb|AGF33489.1| cysteine proteinase inhibitor [Curcuma alismatifolia]
Length=123

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 8/81 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E+++LGR+ VD++N   N       L F+ V+ A  QVVAG  ++L +  +    G   T
Sbjct  45   EIEQLGRFAVDQHNKKENAL-----LEFARVIKAREQVVAGTLHHLTVEVI--DAGKKKT  97

Query  459  FDAQVVVKPWLQNSKHLLSFA  521
            ++A+V VKPWL N K L  F+
Sbjct  98   YEAKVWVKPWL-NFKELQEFS  117



>ref|XP_006446360.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 ref|XP_006446361.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 ref|XP_006446362.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 ref|XP_006446363.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59600.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59601.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59602.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59603.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
Length=100

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = +3

Query  270  GNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGV  449
             NQE+  L R+ VDE+N   N N     L+F +V++A++QVV+G  Y   I+  AV  G 
Sbjct  15   NNQEIVNLARFAVDEHNKKQNSN-----LQFVKVVSAKQQVVSGTLY--DITLEAVEGGQ  67

Query  450  PHTFDAQVVVKPWLQNSKHLLSFAP  524
               F+A+V  KPW+Q  K L  F P
Sbjct  68   KKLFEAKVWEKPWMQ-FKELKEFNP  91



>ref|XP_008788566.1| PREDICTED: cysteine proteinase inhibitor A-like [Phoenix dactylifera]
Length=105

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 46/82 (56%), Gaps = 8/82 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E++EL R+ V+EY+   N       L F  V+  + QVVAGI YY+ I    +  G    
Sbjct  18   EIEELARFAVEEYDKKANAL-----LEFVRVVKVKEQVVAGIVYYITIE--VIDGGKKKL  70

Query  459  FDAQVVVKPWLQNSKHLLSFAP  524
            ++A+V VKPW++  K L  F+P
Sbjct  71   YEAKVWVKPWMK-FKELQEFSP  91



>ref|XP_010508791.1| PREDICTED: cysteine proteinase inhibitor 3 [Camelina sativa]
Length=126

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 11/92 (12%)
 Frame = +3

Query  267  KGNQ---EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            +GNQ   E++ L R+ + E+N   N       L F++++ A  QVVAG  Y+L +   A 
Sbjct  43   RGNQISGEIESLARFAIQEHNKQQNMV-----LEFTKIVRAREQVVAGTMYHLTLE--AK  95

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
               +  +F+A+V VKPW+ N K L  F  +SS
Sbjct  96   EGDLTKSFEAKVWVKPWM-NFKQLQEFKETSS  126



>emb|CDY14748.1| BnaC04g47450D [Brassica napus]
Length=93

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 11/92 (12%)
 Frame = +3

Query  267  KGNQ---EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            +GNQ   E++ L R+ + ++N   N       L F +++ A  QVVAG  YYL +   A 
Sbjct  10   RGNQNSGEIENLARFAIQQHNNRENKV-----LEFKKIVKAREQVVAGTMYYLTLE--AN  62

Query  438  STGVPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
              G    F+A+V VKPW+ N K L  F  SSS
Sbjct  63   EGGQAKNFEAKVWVKPWM-NFKQLQEFKESSS  93



>gb|ABK22677.1| unknown [Picea sitchensis]
 gb|ABK25151.1| unknown [Picea sitchensis]
 gb|ABK26069.1| unknown [Picea sitchensis]
 gb|ABR17453.1| unknown [Picea sitchensis]
 gb|ACN40099.1| unknown [Picea sitchensis]
 gb|ACN40953.1| unknown [Picea sitchensis]
Length=141

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 8/82 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E  +LGR+ VDE+N   NG+     + F  V+AA+ QVVAG  Y+L I A       P  
Sbjct  51   ETLDLGRFAVDEHNKQQNGD-----ISFRRVVAAQEQVVAGTMYHLTIEAEDGDH--PKL  103

Query  459  FDAQVVVKPWLQNSKHLLSFAP  524
            + A+V VKPW +N K L  F P
Sbjct  104  YKAKVWVKPW-ENFKRLEDFKP  124



>ref|XP_002268378.1| PREDICTED: cysteine proteinase inhibitor A [Vitis vinifera]
 ref|XP_003632227.1| PREDICTED: cysteine proteinase inhibitor A [Vitis vinifera]
Length=124

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 8/82 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E++ L R+ VDE+N   N       L F+ V+   +QVVAG  YY+ +   A   G  + 
Sbjct  41   EIENLARFAVDEHNKKQNTL-----LEFNGVVKVRQQVVAGTIYYITLD--ATDGGKKNK  93

Query  459  FDAQVVVKPWLQNSKHLLSFAP  524
            ++A++ VKPWL N K L  F P
Sbjct  94   YEAKIWVKPWL-NFKELQEFKP  114



>gb|ABK23526.1| unknown [Picea sitchensis]
 gb|ABK24580.1| unknown [Picea sitchensis]
 gb|ABK25596.1| unknown [Picea sitchensis]
 gb|ABK26416.1| unknown [Picea sitchensis]
 gb|ABR16656.1| unknown [Picea sitchensis]
 gb|ACN40019.1| unknown [Picea sitchensis]
 gb|ACN40233.1| unknown [Picea sitchensis]
 gb|ACN40884.1| unknown [Picea sitchensis]
 gb|ACN41060.1| unknown [Picea sitchensis]
Length=141

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 8/82 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E  +LGR+ VDE+N   NG+     + F  V+AA+ QVVAG  Y+L I A       P  
Sbjct  51   ETLDLGRFAVDEHNKQQNGD-----ITFRRVVAAQEQVVAGTMYHLTIEAEDGDH--PKL  103

Query  459  FDAQVVVKPWLQNSKHLLSFAP  524
            + A+V VKPW +N K L  F P
Sbjct  104  YKAKVWVKPW-ENFKRLEDFKP  124



>gb|AAB71505.1| cysteine protease inhibitor [Pyrus communis]
Length=95

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 44/85 (52%), Gaps = 8/85 (9%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E + L RY VDE+N   N       L F  VL  + QVV+G  +YLKI   A   G    
Sbjct  18   ETESLARYAVDEHNKKENDL-----LEFVRVLDDKVQVVSGTMHYLKIE--ATEGGKKKV  70

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSS  533
            ++A+V VKPW +N K +  F P S 
Sbjct  71   YEAKVWVKPW-ENFKQVQEFKPVSD  94



>emb|CDY42150.1| BnaC05g40690D [Brassica napus]
Length=203

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            EV+ L R+ VDE+N   N       L F+ V+ A+ QVVAG  ++L +  V    G    
Sbjct  18   EVESLARFAVDEHNKKENSL-----LEFARVVKAKEQVVAGTMHHLTLEIV--EAGKKKL  70

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSS  533
            ++A+V VKPWL N K L  F P+S 
Sbjct  71   YEAKVWVKPWL-NFKELQEFKPASD  94



>ref|NP_001288858.1| cysteine proteinase inhibitor 6-like [Brassica rapa]
 gb|ABK78689.1| cysteine proteinase inhibitor [Brassica rapa]
Length=202

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 8/89 (9%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            + + EV+ L R+ VDE+N   N       L F+ V+ A+ QVVAG  ++L +  V    G
Sbjct  14   QNSDEVESLARFAVDEHNKKENVL-----LEFARVVKAKEQVVAGTMHHLTLEIV--EAG  66

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSSS  533
                ++A+V VKPWL N K L  F P+S 
Sbjct  67   KKKLYEAKVWVKPWL-NFKELQEFKPASD  94



>ref|XP_006407331.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum]
 dbj|BAJ34340.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48784.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum]
Length=234

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 10/96 (10%)
 Frame = +3

Query  267  KGNQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTG  446
            + + EV+ L R+ VDE+N   N       L F+ V+ A+ QVVAG  ++L +  V    G
Sbjct  47   QNSDEVESLARFAVDEHNKKENAL-----LEFARVVKAKEQVVAGTLHHLTLEIV--EAG  99

Query  447  VPHTFDAQVVVKPWLQNSKHLLSFAPSSSYLLPAAT  554
                ++A+V VKPWL N K L  F P+S    PA T
Sbjct  100  KKKLYEAKVWVKPWL-NFKELQEFKPASDA--PAIT  132



>gb|KCW50301.1| hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis]
Length=218

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 8/80 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            EV+ LGR+ VDE+N   NG      L F+ V+ A  QVVAG  ++L I AV    G    
Sbjct  56   EVESLGRFAVDEHNSKENGL-----LEFARVVKAHEQVVAGTLHHLTIEAV--DAGKKKL  108

Query  459  FDAQVVVKPWLQNSKHLLSF  518
            ++A++ V+PW+ NSK L  F
Sbjct  109  YEAKIWVRPWM-NSKELQEF  127



>gb|AEQ54767.1| cysteine proteinase inhibitor CPI-2 [Coffea canephora]
 emb|CDP09706.1| unnamed protein product [Coffea canephora]
Length=98

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 13/93 (14%)
 Frame = +3

Query  267  KGNQ---EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAV  437
            KGN+   E++ L ++ VD+YN   N       L F +V+ ++ QVVAG  YYL I    V
Sbjct  11   KGNENSLEIESLAKFAVDDYNKKQNAL-----LEFQKVINSKEQVVAGTVYYLTIE---V  62

Query  438  STGVPHT-FDAQVVVKPWLQNSKHLLSFAPSSS  533
              G     ++A+V VKPWL N K +  F P++ 
Sbjct  63   KDGNEKKLYEAKVWVKPWL-NFKEVQEFKPAAG  94



>emb|CAH57545.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E+  L R+ VDE+N   N       L F+ V+ A+ QVVAG  ++L I A+ V  G    
Sbjct  53   EIDGLARFAVDEHNKKENAI-----LEFARVVKAKEQVVAGTMHHLTIEAIEV--GKKKL  105

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSS  533
            ++A+V VKPWL N K L  F  +S 
Sbjct  106  YEAKVWVKPWL-NFKELHEFKDASD  129



>ref|XP_010031030.1| PREDICTED: cysteine proteinase inhibitor 12 [Eucalyptus grandis]
 gb|KCW50300.1| hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis]
Length=239

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 10/92 (11%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            EV+ LGR+ VDE+N   NG      L F+ V+ A  QVVAG  ++L I AV    G    
Sbjct  56   EVESLGRFAVDEHNSKENGL-----LEFARVVKAHEQVVAGTLHHLTIEAV--DAGKKKL  108

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSSYLLPAAT  554
            ++A++ V+PW+ NSK L  F  +    +PA T
Sbjct  109  YEAKIWVRPWM-NSKELQEFKHAGD--VPAFT  137



>emb|CDY08429.1| BnaA05g26650D [Brassica napus]
Length=229

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            EV+ L R+ VDE+N   N       L F+ V+ A+ QVVAG  ++L +  V    G    
Sbjct  44   EVESLARFAVDEHNKKENSL-----LEFARVVKAKEQVVAGTMHHLTLEIV--EAGKKKL  96

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSS  533
            ++A+V VKPWL N K L  F P+S 
Sbjct  97   YEAKVWVKPWL-NFKELQEFKPASD  120



>gb|KCW50299.1| hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis]
Length=240

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 9/92 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            EV+ LGR+ VDE+N           L F+ V+ A  QVVAG  ++L I AV    G    
Sbjct  56   EVESLGRFAVDEHNSKEVNGL----LEFARVVKAHEQVVAGTLHHLTIEAV--DAGKKKL  109

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSSYLLPAAT  554
            ++A++ V+PW+ NSK L  F  +    +PA T
Sbjct  110  YEAKIWVRPWM-NSKELQEFKHAGD--VPAFT  138



>ref|XP_008786873.1| PREDICTED: cysteine proteinase inhibitor 12-like [Phoenix dactylifera]
Length=202

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 8/82 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E++EL R+ V+E+N   N       L F  V+  + QVVAGI YY+ I   A+  G    
Sbjct  18   EIEELARFAVEEHNKKANTL-----LEFVRVVKVKEQVVAGIIYYITIE--AIEGGKKKL  70

Query  459  FDAQVVVKPWLQNSKHLLSFAP  524
            ++A+V VKPW++  K L  F+P
Sbjct  71   YEAKVWVKPWMK-FKELQEFSP  91



>emb|CAH57531.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E+  L R+ VDE+N   N       L F+ V+ A+ QVVAG  ++L I A+    G    
Sbjct  53   EIDGLARFAVDEHNKKENAI-----LEFARVVKAKEQVVAGTMHHLTIEAI--EAGKKKL  105

Query  459  FDAQVVVKPWLQNSKHLLSFAPSSS  533
            ++A+V VKPWL N K L  F  +S 
Sbjct  106  YEAKVRVKPWL-NFKELHEFKDASD  129



>emb|CAN78115.1| hypothetical protein VITISV_031522 [Vitis vinifera]
 emb|CBI24312.3| unnamed protein product [Vitis vinifera]
Length=101

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 45/82 (55%), Gaps = 8/82 (10%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E++ L R+ VDE+N   N       L F+ V+   +QVVAG  YY+ +   A   G  + 
Sbjct  18   EIENLARFAVDEHNKKQNTL-----LEFNGVVKVRQQVVAGTIYYITLD--ATDGGKKNK  70

Query  459  FDAQVVVKPWLQNSKHLLSFAP  524
            ++A++ VKPWL N K L  F P
Sbjct  71   YEAKIWVKPWL-NFKELQEFKP  91



>gb|ADK13078.1| phytocystatin 5-3 [Brassica rapa subsp. pekinensis]
Length=120

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 10/89 (11%)
 Frame = +3

Query  273  NQEVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISA---VAVS-  440
            N  + E+G + V EYN           L+F EV++ E Q+VAG+ Y L ++A   VA++ 
Sbjct  37   NAHIVEIGEFAVSEYNKQSKSG-----LKFVEVVSGESQIVAGMNYRLILAANEGVAIAG  91

Query  441  TGVPHTFDAQVVVKPWLQNSKHLLSFAPS  527
             G    ++A V  KPWL+ S +L SF P+
Sbjct  92   NGESKKYEAVVWEKPWLK-SMNLTSFKPA  119



>emb|CBI32827.3| unnamed protein product [Vitis vinifera]
Length=201

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 15/92 (16%)
 Frame = +3

Query  279  EVQELGRYCVDEYniningnggdggLRFSEVLAAERQVVAGIKYYLKISAVAVSTGVPHT  458
            E++ + R+ V E+N N N       L F++VL A+ QVVAG  YYL +   A+  G    
Sbjct  18   EIESIARFAVQEHNKNQNAL-----LEFAKVLKAKEQVVAGKIYYLTLE--AIDAGKKKI  70

Query  459  FDAQVVVKPWL--------QNSKHLLSFAPSS  530
            ++A+V VKPW+        ++S+   SFAPS 
Sbjct  71   YEAKVWVKPWMNFKELQEFKHSQETKSFAPSD  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2290717995426