BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c87742_g1_i1 len=2053 path=[1:0-2052]

Length=2053
                                                                      Score     E

ref|XP_009788149.1|  PREDICTED: transcription factor bHLH91-like        416   1e-134   
ref|XP_011093423.1|  PREDICTED: transcription factor bHLH91-like        405   9e-130   
ref|XP_009623799.1|  PREDICTED: transcription factor bHLH91-like        389   5e-124   
ref|XP_009800020.1|  PREDICTED: transcription factor bHLH91-like        378   2e-121   
ref|XP_010323236.1|  PREDICTED: transcription factor bHLH91-like        380   1e-120   
ref|XP_006354586.1|  PREDICTED: transcription factor bHLH91-like        379   5e-120   
emb|CDP09313.1|  unnamed protein product                                368   4e-116   
gb|EYU42281.1|  hypothetical protein MIMGU_mgv1a006478mg                362   3e-114   
ref|XP_009589122.1|  PREDICTED: transcription factor bHLH91-like        352   1e-110   
gb|EYU42282.1|  hypothetical protein MIMGU_mgv1a006556mg                350   2e-109   
ref|XP_010661301.1|  PREDICTED: transcription factor bHLH91-like        343   1e-106   
gb|KDP43627.1|  hypothetical protein JCGZ_16914                         343   1e-106   
emb|CAN77001.1|  hypothetical protein VITISV_003899                     342   2e-106   Vitis vinifera
ref|XP_002534354.1|  Transcription factor ICE1, putative                332   6e-102   Ricinus communis
ref|XP_006464331.1|  PREDICTED: transcription factor bHLH91-like ...    327   3e-100   
ref|XP_006445526.1|  hypothetical protein CICLE_v10019669mg             327   3e-99    
gb|KDP43626.1|  hypothetical protein JCGZ_16913                         322   1e-98    
emb|CBI38213.3|  unnamed protein product                                320   5e-98    
ref|XP_009784947.1|  PREDICTED: transcription factor bHLH91-like ...    318   1e-97    
ref|XP_009784938.1|  PREDICTED: transcription factor bHLH91-like ...    318   1e-97    
ref|XP_009784940.1|  PREDICTED: transcription factor bHLH91-like ...    318   1e-97    
ref|XP_007008755.1|  Basic helix-loop-helix DNA-binding superfami...    317   5e-97    
gb|KHG22101.1|  Transcription factor bHLH91 -like protein               315   3e-96    
ref|XP_010278769.1|  PREDICTED: transcription factor bHLH91-like        317   7e-96    
ref|XP_004173553.1|  PREDICTED: transcription factor bHLH91-like        309   6e-94    
ref|XP_002323376.1|  basic helix-loop-helix family protein              310   6e-94    Populus trichocarpa [western balsam poplar]
ref|XP_004139000.1|  PREDICTED: transcription factor bHLH91-like        308   5e-93    
ref|XP_004308623.1|  PREDICTED: transcription factor bHLH91-like        308   6e-93    
ref|XP_011042573.1|  PREDICTED: transcription factor bHLH91-like        307   1e-92    
ref|XP_008345255.1|  PREDICTED: transcription factor bHLH10-like        304   4e-92    
ref|XP_002308327.2|  basic helix-loop-helix family protein              305   1e-91    Populus trichocarpa [western balsam poplar]
ref|XP_009373826.1|  PREDICTED: transcription factor bHLH10-like        299   2e-90    
ref|XP_011046432.1|  PREDICTED: transcription factor bHLH91-like        301   2e-90    
gb|KGN61423.1|  hypothetical protein Csa_2G120400                       302   2e-90    
ref|XP_009373855.1|  PREDICTED: transcription factor bHLH91-like        301   5e-90    
ref|XP_008457164.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    297   1e-88    
ref|XP_010243136.1|  PREDICTED: transcription factor bHLH91-like        296   3e-88    
ref|XP_009623788.1|  PREDICTED: transcription factor bHLH91-like        293   6e-88    
ref|XP_010097712.1|  hypothetical protein L484_023853                   294   7e-88    
ref|XP_008347044.1|  PREDICTED: transcription factor bHLH91-like        296   9e-88    
ref|XP_009361467.1|  PREDICTED: transcription factor bHLH91-like        295   1e-87    
ref|XP_008378661.1|  PREDICTED: transcription factor bHLH10-like        281   3e-84    
ref|XP_008374146.1|  PREDICTED: transcription factor bHLH10-like        281   4e-84    
ref|XP_009788151.1|  PREDICTED: transcription factor bHLH91-like        283   6e-84    
gb|KHN25939.1|  Transcription factor bHLH89                             283   3e-83    
ref|XP_007163873.1|  hypothetical protein PHAVU_L009100g                283   6e-83    
ref|XP_006580839.1|  PREDICTED: transcription factor bHLH10-like        283   4e-82    
ref|XP_010058017.1|  PREDICTED: transcription factor bHLH91-like ...    275   8e-80    
ref|XP_010058018.1|  PREDICTED: transcription factor bHLH91-like ...    274   1e-79    
ref|XP_010543057.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    271   2e-79    
ref|XP_004504639.1|  PREDICTED: transcription factor bHLH91-like        269   3e-78    
ref|XP_006585047.1|  PREDICTED: transcription factor bHLH10-like ...    269   1e-77    
gb|KCW75485.1|  hypothetical protein EUGRSUZ_E04247                     258   3e-77    
ref|XP_003638306.1|  Transcription factor bHLH91                        266   1e-76    
ref|XP_006294262.1|  hypothetical protein CARUB_v10023260mg             260   2e-75    
emb|CAD58593.1|  putative bHLH transcription factor                     258   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|NP_180679.2|  transcription factor bHLH91                           256   9e-74    Arabidopsis thaliana [mouse-ear cress]
gb|ACN21644.1|  putative basic helix-loop-helix protein BHLH14          254   5e-73    Lotus japonicus
ref|XP_002879311.1|  basic helix-loop-helix family protein              253   1e-72    
ref|XP_007156379.1|  hypothetical protein PHAVU_003G281300g             252   1e-72    
ref|XP_010918188.1|  PREDICTED: transcription factor bHLH89-like        253   8e-72    
ref|XP_010414166.1|  PREDICTED: transcription factor bHLH91-like        251   8e-72    
ref|XP_008800057.1|  PREDICTED: transcription factor bHLH91-like        251   4e-71    
emb|CDY15420.1|  BnaC04g42030D                                          249   4e-71    
ref|XP_010510224.1|  PREDICTED: transcription factor bHLH91-like        248   6e-71    
ref|XP_010522155.1|  PREDICTED: transcription factor bHLH10             248   1e-70    
emb|CDY15419.1|  BnaC04g42040D                                          248   1e-70    
ref|XP_009144239.1|  PREDICTED: transcription factor bHLH10-like ...    247   2e-70    
ref|XP_006410252.1|  hypothetical protein EUTSA_v10017830mg             247   2e-70    
ref|XP_009119085.1|  PREDICTED: transcription factor bHLH89             246   2e-70    
ref|XP_009144238.1|  PREDICTED: transcription factor bHLH10-like ...    247   3e-70    
ref|XP_010414163.1|  PREDICTED: transcription factor bHLH10-like ...    246   4e-70    
emb|CDY10784.1|  BnaA05g11520D                                          246   5e-70    
ref|XP_010469749.1|  PREDICTED: transcription factor bHLH91-like        244   1e-69    
emb|CDY47722.1|  BnaA10g04110D                                          243   3e-69    
ref|XP_006410254.1|  hypothetical protein EUTSA_v10016616mg             244   4e-69    
emb|CDY10181.1|  BnaC05g04240D                                          243   5e-69    
ref|XP_009141141.1|  PREDICTED: transcription factor bHLH10             243   9e-69    
ref|XP_002879313.1|  hypothetical protein ARALYDRAFT_482049             243   9e-69    
emb|CDY24747.1|  BnaC04g13520D                                          242   2e-68    
ref|XP_010469746.1|  PREDICTED: transcription factor bHLH10-like ...    243   2e-68    
ref|XP_010469745.1|  PREDICTED: transcription factor bHLH10-like ...    243   2e-68    
gb|KHN15541.1|  Transcription factor bHLH91                             234   3e-68    
gb|AAL55717.1|AF251695_1  putative transcription factor BHLH10          240   1e-67    Arabidopsis thaliana [mouse-ear cress]
ref|NP_180680.2|  transcription factor bHLH10                           240   1e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CDY24749.1|  BnaC04g13540D                                          239   2e-67    
ref|XP_006417951.1|  hypothetical protein EUTSA_v100099920mg            237   2e-67    
ref|XP_010691929.1|  PREDICTED: transcription factor bHLH91-like        241   3e-67    
ref|XP_006854151.1|  hypothetical protein AMTR_s00048p00183690          239   3e-67    
emb|CDY57093.1|  BnaA04g28800D                                          238   4e-67    
emb|CDY15418.1|  BnaC04g42050D                                          238   5e-67    
ref|XP_003638303.1|  Transcription factor bHLH10                        239   5e-67    
ref|XP_006490222.1|  PREDICTED: transcription factor bHLH91-like        234   9e-67    
ref|XP_010510222.1|  PREDICTED: transcription factor bHLH10-like        238   1e-66    
ref|XP_003548659.2|  PREDICTED: transcription factor bHLH91-like        236   1e-66    
ref|XP_006421646.1|  hypothetical protein CICLE_v100069401mg            229   1e-65    
ref|XP_006354670.1|  PREDICTED: transcription factor bHLH89-like        233   2e-65    
gb|KHN37144.1|  Transcription factor bHLH91                             230   2e-65    
ref|XP_010457738.1|  PREDICTED: transcription factor bHLH89-like        232   6e-65    
ref|XP_004229579.1|  PREDICTED: transcription factor bHLH91-like        230   1e-64    
gb|EPS71051.1|  hypothetical protein M569_03716                         223   2e-64    
ref|XP_002892324.1|  basic helix-loop-helix family protein              229   5e-64    
ref|XP_010475345.1|  PREDICTED: transcription factor bHLH89-like        229   6e-64    
ref|XP_010672071.1|  PREDICTED: transcription factor bHLH91-like        230   6e-64    
ref|XP_006294062.1|  hypothetical protein CARUB_v10023056mg             231   7e-64    
ref|XP_009141140.1|  PREDICTED: transcription factor bHLH91-like        229   2e-63    
emb|CDY57092.1|  BnaA04g28790D                                          228   2e-63    
ref|XP_006307566.1|  hypothetical protein CARUB_v10009189mg             227   5e-63    
ref|XP_010059715.1|  PREDICTED: transcription factor bHLH91-like        226   1e-62    
ref|NP_172107.1|  transcription factor bHLH89                           225   2e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009402958.1|  PREDICTED: transcription factor TIP2-like          219   1e-59    
ref|NP_001149299.1|  helix-loop-helix DNA-binding domain containi...    214   6e-58    Zea mays [maize]
ref|XP_008643696.1|  PREDICTED: helix-loop-helix DNA-binding doma...    214   9e-58    
ref|XP_002452697.1|  hypothetical protein SORBIDRAFT_04g030850          213   2e-57    Sorghum bicolor [broomcorn]
ref|XP_004953537.1|  PREDICTED: transcription factor bHLH91-like        213   3e-57    
gb|AAD20666.1|  hypothetical protein                                    209   9e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976676.1|  PREDICTED: transcription factor bHLH91-like        210   2e-56    
ref|XP_006410253.1|  hypothetical protein EUTSA_v10017908mg             202   5e-56    
ref|NP_001053749.1|  Os04g0599300                                       208   9e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010501337.1|  PREDICTED: transcription factor bHLH89             199   1e-55    
ref|XP_006652751.1|  PREDICTED: transcription factor bHLH91-like        207   2e-55    
gb|EEC77916.1|  hypothetical protein OsI_17246                          205   7e-55    Oryza sativa Indica Group [Indian rice]
ref|XP_010240358.1|  PREDICTED: transcription factor bHLH91-like        203   4e-54    
gb|AFW72948.1|  putative HLH DNA-binding domain superfamily protein     202   2e-53    
emb|CDY10785.1|  BnaA05g11510D                                          197   4e-53    
ref|XP_008793418.1|  PREDICTED: transcription factor TIP2-like          197   2e-52    
ref|XP_010938283.1|  PREDICTED: transcription factor TIP2-like          194   2e-51    
ref|XP_002961225.1|  hypothetical protein SELMODRAFT_402928             197   3e-51    
gb|EMT05766.1|  Transcription factor bHLH89                             194   5e-51    
gb|EMT07628.1|  Transcription factor bHLH91                             194   1e-50    
gb|KDO65531.1|  hypothetical protein CISIN_1g043851mg                   187   4e-49    
ref|XP_010414165.1|  PREDICTED: transcription factor bHLH10-like ...    187   5e-49    
ref|XP_007219949.1|  hypothetical protein PRUPE_ppb019685mg             183   9e-49    
ref|XP_010938284.1|  PREDICTED: transcription factor TIP2-like          185   5e-48    
ref|XP_002969202.1|  hypothetical protein SELMODRAFT_410122             189   3e-47    
ref|XP_009417499.1|  PREDICTED: transcription factor TIP2-like          181   1e-46    
ref|XP_004305390.1|  PREDICTED: intron-binding protein aquarius-like    186   1e-45    
ref|XP_002964440.1|  hypothetical protein SELMODRAFT_81013              172   2e-45    
gb|EEE54383.1|  hypothetical protein OsJ_01400                          169   9e-44    Oryza sativa Japonica Group [Japonica rice]
gb|EMS50437.1|  Transcription factor bHLH89                             170   1e-43    
gb|EMT16792.1|  Transcription factor bHLH91                             167   1e-43    
ref|NP_001042795.1|  Os01g0293100                                       171   2e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003567568.1|  PREDICTED: transcription factor TIP2-like          169   4e-43    
ref|NP_001149921.1|  LOC100283549                                       166   4e-42    Zea mays [maize]
emb|CAE03950.1|  OSJNba0093F12.24                                       169   1e-41    Oryza sativa [red rice]
ref|XP_002457706.1|  hypothetical protein SORBIDRAFT_03g011940          164   4e-41    Sorghum bicolor [broomcorn]
ref|XP_006644088.1|  PREDICTED: transcription factor bHLH91-like        162   1e-40    
ref|XP_001784001.1|  predicted protein                                  165   3e-39    
ref|XP_004967599.1|  PREDICTED: transcription factor bHLH91-like        157   8e-39    
gb|EPS57728.1|  hypothetical protein M569_17090                         142   6e-36    
ref|XP_011041996.1|  PREDICTED: transcription factor bHLH89-like        143   3e-35    
ref|XP_002314221.1|  basic helix-loop-helix family protein              140   7e-34    Populus trichocarpa [western balsam poplar]
ref|XP_006585882.1|  PREDICTED: transcription factor bHLH91-like        135   1e-33    
ref|XP_001767478.1|  predicted protein                                  143   7e-32    
ref|XP_002879312.1|  hypothetical protein ARALYDRAFT_902147             124   5e-29    
gb|KFK42944.1|  hypothetical protein AALP_AA1G058900                    121   2e-27    
gb|EEC70458.1|  hypothetical protein OsI_01494                          110   1e-24    Oryza sativa Indica Group [Indian rice]
ref|XP_008670706.1|  PREDICTED: transcription factor bHLH91-like        109   1e-23    
ref|XP_007218278.1|  hypothetical protein PRUPE_ppa008351mg           92.4    6e-17    
ref|XP_002531183.1|  hypothetical protein RCOM_0012680                87.0    5e-16    Ricinus communis
ref|NP_850161.1|  basic helix-loop-helix (bHLH) DNA-binding super...  82.0    1e-14    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247585.1|  PREDICTED: transcription factor bHLH10           77.8    4e-13    
ref|XP_006415166.1|  hypothetical protein EUTSA_v10007075mg           80.5    2e-12    
gb|KHN15898.1|  Transcription factor bHLH14                           78.2    8e-12    
ref|XP_003548195.1|  PREDICTED: transcription factor MYC2-like        78.2    8e-12    
gb|KFK45000.1|  hypothetical protein AALP_AA1G331100                  78.6    8e-12    
ref|XP_010677236.1|  PREDICTED: transcription factor MYC2-like        78.2    1e-11    
ref|XP_010523833.1|  PREDICTED: transcription factor MYC3-like        77.4    1e-11    
ref|XP_010538366.1|  PREDICTED: transcription factor MYC2-like        78.2    1e-11    
ref|XP_009347383.1|  PREDICTED: transcription factor MYC2             78.2    1e-11    
ref|XP_009344509.1|  PREDICTED: transcription factor MYC2-like        77.0    2e-11    
ref|NP_001288107.1|  uncharacterized protein LOC101261048             75.9    6e-11    
ref|XP_008238247.1|  PREDICTED: transcription factor MYC2             75.9    7e-11    
ref|XP_004309579.1|  PREDICTED: transcription factor MYC2-like        75.1    7e-11    
gb|ACO53628.1|  bHLH domain protein                                   75.5    9e-11    Gossypium hirsutum [American cotton]
emb|CDY26910.1|  BnaA05g18020D                                        74.7    9e-11    
ref|XP_008373574.1|  PREDICTED: transcription factor MYC2             75.5    9e-11    
gb|ADL36595.1|  BHLH domain class transcription factor                75.5    1e-10    
ref|XP_010540785.1|  PREDICTED: transcription factor MYC2-like is...  75.1    1e-10    
gb|AFZ93650.1|  transcription factor MYC2                             72.8    1e-10    
emb|CDX73261.1|  BnaC05g28450D                                        74.7    1e-10    
gb|AGZ94899.1|  MYC transcription factor 2                            75.1    1e-10    
ref|XP_004245895.2|  PREDICTED: transcription factor MYC2             75.1    1e-10    
ref|XP_010053253.1|  PREDICTED: transcription factor EGL1-like        75.1    1e-10    
gb|EYU44086.1|  hypothetical protein MIMGU_mgv1a002808mg              75.1    1e-10    
ref|XP_009151447.1|  PREDICTED: transcription factor MYC2             74.7    1e-10    
ref|XP_002303693.2|  hypothetical protein POPTR_0003s14710g           73.9    2e-10    Populus trichocarpa [western balsam poplar]
gb|AGO03813.1|  JAMYC2                                                72.4    2e-10    
gb|ABS11038.1|  MYC                                                   74.3    2e-10    Brassica oleracea var. gemmifera
ref|XP_009384727.1|  PREDICTED: transcription factor MYC3-like        74.3    2e-10    
ref|XP_010478689.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  74.3    2e-10    
ref|XP_002518914.1|  DNA binding protein, putative                    73.6    2e-10    Ricinus communis
ref|XP_004166734.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  73.9    2e-10    
ref|XP_004246085.1|  PREDICTED: transcription factor bHLH14-like      72.8    3e-10    
ref|XP_010461111.1|  PREDICTED: transcription factor MYC2-like        73.6    3e-10    
ref|NP_174541.1|  transcription factor MYC2                           73.6    3e-10    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148475.1|  PREDICTED: transcription factor MYC2-like        73.6    3e-10    
ref|XP_004300239.1|  PREDICTED: transcription factor MYC2-like        73.6    3e-10    
ref|XP_008341963.1|  PREDICTED: transcription factor MYC2-like        73.6    3e-10    
ref|XP_008465979.1|  PREDICTED: transcription factor MYC2-like        73.6    3e-10    
gb|KGN60384.1|  Transcription factor AtMYC2                           73.6    4e-10    
gb|AAL55713.1|AF251691_1  putative transcription factor BHLH6         73.2    4e-10    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004959077.1|  PREDICTED: transcription factor TT8-like         73.2    5e-10    
ref|XP_002893732.1|  ATMYC2                                           73.2    5e-10    
ref|XP_011082365.1|  PREDICTED: transcription factor MYC4-like        73.2    5e-10    
ref|XP_009604694.1|  PREDICTED: transcription factor MYC3-like        72.4    5e-10    
dbj|BAA25078.1|  RD22BP1                                              72.8    5e-10    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385233.1|  PREDICTED: transcription factor EGL1-like        72.8    6e-10    
gb|ABD65632.1|  basic helix-loop-helix (bHLH) family transcriptio...  72.8    6e-10    Brassica oleracea
ref|XP_010559309.1|  PREDICTED: transcription factor MYC4-like        72.8    6e-10    
ref|XP_007210309.1|  hypothetical protein PRUPE_ppa002404mg           72.8    7e-10    
gb|EPS57820.1|  hypothetical protein M569_16997                       72.0    8e-10    
ref|XP_010531704.1|  PREDICTED: transcription factor MYC2-like        72.4    8e-10    
ref|XP_009131125.1|  PREDICTED: transcription factor MYC4-like        69.3    9e-10    
ref|XP_007219048.1|  hypothetical protein PRUPE_ppa004680mg           71.6    9e-10    
gb|ADH04267.1|  MYC1a transcription factor                            72.0    9e-10    
gb|AGQ80897.1|  MYC1                                                  72.0    9e-10    
ref|XP_008670746.1|  PREDICTED: transcription factor SCREAM2-like     71.6    1e-09    
ref|XP_010275210.1|  PREDICTED: transcription factor MYC2-like        72.0    1e-09    
ref|XP_006838603.1|  hypothetical protein AMTR_s00002p00225810        72.0    1e-09    
ref|XP_009780487.1|  PREDICTED: transcription factor MYC2-like        72.0    1e-09    
emb|CAF74711.1|  MYC transcription factor                             72.0    1e-09    Solanum tuberosum [potatoes]
ref|XP_009384126.1|  PREDICTED: transcription factor MYC4-like        72.0    1e-09    
ref|XP_006366244.1|  PREDICTED: transcription factor MYC2-like        72.0    1e-09    
ref|XP_009609942.1|  PREDICTED: transcription factor MYC2-like        72.0    1e-09    
gb|ADH04268.1|  MYC1b transcription factor                            72.0    1e-09    
gb|ACM48567.1|  JAMYC                                                 71.6    1e-09    Taxus cuspidata [ichii]
gb|EPS71023.1|  hypothetical protein M569_03732                       71.2    1e-09    
ref|XP_007039493.1|  Basic helix-loop-helix DNA-binding family pr...  71.2    2e-09    
ref|XP_008441948.1|  PREDICTED: transcription factor MYC4-like        69.7    2e-09    
ref|XP_008799392.1|  PREDICTED: transcription factor MYC2-like        71.2    2e-09    
ref|XP_009401251.1|  PREDICTED: transcription factor MYC4-like        71.2    2e-09    
ref|XP_010919958.1|  PREDICTED: transcription factor MYC4-like        71.2    2e-09    
emb|CDY58502.1|  BnaA06g40330D                                        70.5    2e-09    
gb|KHN04880.1|  Transcription factor MYC2                             70.9    2e-09    
gb|KDP28433.1|  hypothetical protein JCGZ_14204                       70.9    2e-09    
ref|XP_009101493.1|  PREDICTED: transcription factor MYC3             70.9    2e-09    
ref|XP_004248092.1|  PREDICTED: transcription factor MYC3-like        70.5    2e-09    
emb|CDX78808.1|  BnaA01g08750D                                        70.9    2e-09    
ref|XP_009375455.1|  PREDICTED: transcription factor MYC2-like        70.5    2e-09    
ref|XP_011081344.1|  PREDICTED: transcription factor MYC2-like        70.1    3e-09    
emb|CDY44507.1|  BnaC01g10420D                                        70.5    3e-09    
gb|AGL98101.1|  transcription factor MYC2-like protein                70.5    3e-09    
emb|CDX77688.1|  BnaC07g19420D                                        70.1    3e-09    
emb|CDP13028.1|  unnamed protein product                              70.9    3e-09    
gb|KCW71784.1|  hypothetical protein EUGRSUZ_E00277                   70.5    3e-09    
gb|AGL98100.1|  transcription factor MYC2                             70.5    3e-09    
ref|XP_010058170.1|  PREDICTED: transcription factor MYC2             70.5    3e-09    
ref|XP_006303928.1|  hypothetical protein CARUB_v10008586mg           70.5    3e-09    
gb|KEH18600.1|  basic helix loop helix (bHLH) family transcriptio...  69.7    4e-09    
ref|XP_009415103.1|  PREDICTED: transcription factor FAMA-like        67.0    4e-09    
ref|XP_009388411.1|  PREDICTED: transcription factor MYC2             70.1    4e-09    
ref|XP_008370350.1|  PREDICTED: transcription factor MYC2             69.7    5e-09    
ref|XP_009114329.1|  PREDICTED: transcription factor MYC3-like        69.7    5e-09    
ref|XP_010273162.1|  PREDICTED: transcription factor MYC2-like        70.1    5e-09    
ref|XP_002990923.1|  hypothetical protein SELMODRAFT_429338           68.6    5e-09    
ref|XP_011094312.1|  PREDICTED: transcription factor MYC2             69.3    5e-09    
emb|CDY35179.1|  BnaA09g18160D                                        69.7    5e-09    
gb|KDP34321.1|  hypothetical protein JCGZ_12669                       69.7    5e-09    
gb|AAK00453.1|AC060755_23  putative MYC transcription factor          69.7    5e-09    Oryza sativa [red rice]
gb|AAQ14332.1|AF283507_1  MYC2                                        69.7    5e-09    Catharanthus roseus [chatas]
ref|NP_001065478.1|  Os10g0575000                                     69.7    5e-09    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010054972.1|  PREDICTED: transcription factor MYC2             69.3    5e-09    
ref|XP_009800420.1|  PREDICTED: transcription factor MYC2-like        69.7    5e-09    
ref|XP_003528771.1|  PREDICTED: transcription factor MYC2-like        69.3    6e-09    
gb|EEC67493.1|  hypothetical protein OsI_34761                        69.7    6e-09    Oryza sativa Indica Group [Indian rice]
ref|XP_007158304.1|  hypothetical protein PHAVU_002G141500g           69.7    6e-09    
dbj|BAJ91674.1|  predicted protein                                    69.7    6e-09    
ref|XP_002982773.1|  hypothetical protein SELMODRAFT_422169           68.2    6e-09    
ref|XP_011026782.1|  PREDICTED: transcription factor MYC2-like        69.3    6e-09    
ref|XP_006362125.1|  PREDICTED: transcription factor MYC2-like        68.9    6e-09    
dbj|BAJ91022.1|  predicted protein                                    69.7    6e-09    
gb|AAC28907.1|  phaseolin G-box binding protein PG2                   69.3    6e-09    Phaseolus vulgaris [French bean]
ref|XP_007135301.1|  hypothetical protein PHAVU_010G117900g           68.9    6e-09    
ref|XP_009766909.1|  PREDICTED: transcription factor MYC2             68.9    6e-09    
gb|AAD15818.1|  transcription factor MYC7E                            69.3    7e-09    Zea mays [maize]
ref|XP_006352856.1|  PREDICTED: transcription factor MYC2-like        69.3    7e-09    
ref|XP_008658563.1|  PREDICTED: transcription factor MYC4             69.3    7e-09    
ref|XP_011022409.1|  PREDICTED: transcription factor MYC2-like        68.9    7e-09    
ref|XP_010241898.1|  PREDICTED: transcription factor GLABRA 3-lik...  69.3    7e-09    
gb|KDO47348.1|  hypothetical protein CISIN_1g011370mg                 68.6    7e-09    
gb|KGN61317.1|  hypothetical protein Csa_2G080170                     67.8    8e-09    
ref|XP_010241899.1|  PREDICTED: transcription factor GLABRA 3-lik...  69.3    8e-09    
ref|XP_004148739.1|  PREDICTED: transcription factor MYC2-like        69.3    8e-09    
ref|XP_006414178.1|  hypothetical protein EUTSA_v10024688mg           68.9    9e-09    
gb|ABR16436.1|  unknown                                               68.9    9e-09    
gb|AHN63211.1|  transcription factor MYC2                             68.9    9e-09    
gb|KDO44754.1|  hypothetical protein CISIN_1g005651mg                 68.9    1e-08    
gb|AAY90122.1|  basic helix-loop-helix transcription factor protein   68.9    1e-08    
gb|ADH04269.1|  MYC2a transcription factor                            68.9    1e-08    
gb|ADH04263.1|  bHLH2 transcription factor                            68.6    1e-08    
ref|XP_002299425.1|  hypothetical protein POPTR_0001s11400g           68.2    1e-08    
ref|XP_010445298.1|  PREDICTED: transcription factor MYC4-like        68.6    1e-08    
ref|XP_006428423.1|  hypothetical protein CICLE_v10011214mg           68.6    1e-08    
ref|XP_004306627.1|  PREDICTED: transcription factor MYC2-like        68.2    1e-08    
ref|XP_008659898.1|  PREDICTED: transcription factor MYC4-like        68.6    1e-08    
ref|XP_006446948.1|  hypothetical protein CICLE_v10015052mg           67.8    1e-08    
ref|XP_002280253.1|  PREDICTED: transcription factor MYC2-like        68.2    2e-08    
ref|XP_010434608.1|  PREDICTED: transcription factor MYC4-like        68.2    2e-08    
gb|AFY17139.1|  bHLH                                                  67.8    2e-08    
gb|AFK36186.1|  unknown                                               65.9    2e-08    
ref|XP_002868032.1|  basic helix-loop-helix family protein            68.2    2e-08    
ref|XP_009402059.1|  PREDICTED: anthocyanin regulatory Lc protein...  68.2    2e-08    
dbj|BAJ86015.1|  predicted protein                                    68.2    2e-08    
ref|XP_006283348.1|  hypothetical protein CARUB_v10004392mg           67.8    2e-08    
ref|XP_007210206.1|  hypothetical protein PRUPE_ppa016220mg           67.4    2e-08    
ref|NP_199488.1|  JAZ-interacting transcription factor MYC3           67.8    2e-08    
ref|XP_007156435.1|  hypothetical protein PHAVU_003G285700g           67.8    2e-08    
ref|XP_002519814.1|  Transcription factor AtMYC2, putative            67.8    2e-08    
gb|AAB00686.1|  phaseolin G-box binding protein PG1                   67.8    2e-08    
gb|AAL55712.1|AF251690_1  putative transcription factor BHLH5         67.8    2e-08    
gb|EYU26930.1|  hypothetical protein MIMGU_mgv1a023762mg              67.4    2e-08    
ref|XP_010449546.1|  PREDICTED: transcription factor MYC4-like        67.8    2e-08    
ref|XP_009796881.1|  PREDICTED: transcription factor MYC2-like        67.0    2e-08    
gb|KFK28472.1|  hypothetical protein AALP_AA7G000700                  67.4    2e-08    
ref|XP_002266775.1|  PREDICTED: transcription factor MYC2-like        67.4    2e-08    
gb|KHN18804.1|  Transcription factor MYC4                             65.9    2e-08    
gb|KHN37398.1|  Transcription factor ABORTED MICROSPORES              67.4    2e-08    
ref|XP_010068596.1|  PREDICTED: transcription factor ABORTED MICR...  67.4    2e-08    
ref|XP_003535752.1|  PREDICTED: transcription factor ABORTED MICR...  67.4    2e-08    
gb|AIO09733.1|  transcription factor MYC2                             67.4    2e-08    
ref|XP_010494857.1|  PREDICTED: transcription factor MYC3-like        67.4    2e-08    
ref|XP_004301652.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  66.6    3e-08    
ref|XP_006357552.1|  PREDICTED: transcription factor MYC2-like        67.0    3e-08    
ref|XP_009359541.1|  PREDICTED: transcription factor MYC2-like        67.0    3e-08    
ref|XP_009408104.1|  PREDICTED: transcription factor MYC4-like        67.4    3e-08    
ref|XP_011023113.1|  PREDICTED: transcription factor MYC2-like        67.0    3e-08    
ref|XP_009587276.1|  PREDICTED: transcription factor MYC2-like        67.4    3e-08    
ref|XP_008238755.1|  PREDICTED: transcription factor bHLH14-like ...  67.0    3e-08    
ref|XP_008238754.1|  PREDICTED: transcription factor MYC4-like is...  67.0    3e-08    
ref|XP_007209040.1|  hypothetical protein PRUPE_ppa002762mg           67.4    3e-08    
gb|AEG74015.1|  lMYC5                                                 67.0    3e-08    
ref|XP_007040248.1|  Basic helix-loop-helix DNA-binding superfami...  67.0    3e-08    
ref|XP_009360191.1|  PREDICTED: transcription factor MYC2-like        66.6    3e-08    
gb|AEG74014.1|  lMYC4                                                 66.6    3e-08    
ref|XP_001754025.1|  predicted protein                                67.0    3e-08    
ref|XP_007039384.1|  Basic helix-loop-helix DNA-binding family pr...  66.6    3e-08    
gb|KCW64130.1|  hypothetical protein EUGRSUZ_G01783                   67.0    4e-08    
ref|XP_003574381.1|  PREDICTED: transcription factor MYC4-like        67.0    4e-08    
ref|XP_007040251.1|  Basic helix-loop-helix DNA-binding superfami...  66.6    4e-08    
ref|XP_009358714.1|  PREDICTED: transcription factor MYC4-like        66.6    4e-08    
ref|XP_010909228.1|  PREDICTED: transcription factor FAMA             66.2    4e-08    
ref|XP_007040250.1|  Basic helix-loop-helix DNA-binding superfami...  67.0    4e-08    
ref|XP_008370020.1|  PREDICTED: transcription factor MYC2-like        66.6    4e-08    
ref|XP_003528790.1|  PREDICTED: transcription factor bHLH13-like      67.0    4e-08    
ref|XP_008350027.1|  PREDICTED: transcription factor MYC2-like        66.6    4e-08    
ref|XP_010104300.1|  hypothetical protein L484_023250                 67.0    4e-08    
gb|KHM99167.1|  Transcription factor MYC4                             63.9    4e-08    
gb|ADK56287.1|  LMYC1                                                 66.2    4e-08    
ref|XP_010530031.1|  PREDICTED: transcription factor MYC4             66.6    5e-08    
gb|KHN06316.1|  Transcription factor bHLH13                           66.6    5e-08    
ref|XP_007051457.1|  Basic helix-loop-helix DNA-binding family pr...  66.2    5e-08    
emb|CDX84081.1|  BnaC08g07580D                                        66.6    5e-08    
ref|XP_010441550.1|  PREDICTED: transcription factor MYC3-like        66.6    5e-08    
ref|XP_008245386.1|  PREDICTED: transcription factor bHLH14-like      66.2    5e-08    
ref|XP_010058369.1|  PREDICTED: transcription factor MYC2-like        66.2    5e-08    
gb|KEH35685.1|  BHLH transcriptional factor                           66.2    5e-08    
ref|XP_002467448.1|  hypothetical protein SORBIDRAFT_01g028230        66.6    5e-08    
emb|CAF74710.1|  MYC transcription factor                             66.6    5e-08    
ref|XP_008342518.1|  PREDICTED: transcription factor MYC3-like is...  66.2    5e-08    
ref|XP_008342523.1|  PREDICTED: transcription factor MYC3-like is...  66.2    5e-08    
ref|XP_008374121.1|  PREDICTED: transcription factor MYC3-like        66.2    5e-08    
ref|XP_006362123.1|  PREDICTED: transcription factor MYC4-like        65.9    5e-08    
ref|XP_008245385.1|  PREDICTED: transcription factor bHLH14-like ...  66.2    5e-08    
ref|XP_008448683.1|  PREDICTED: transcription factor MYC2-like        66.6    5e-08    
gb|KDP25207.1|  hypothetical protein JCGZ_20363                       66.2    6e-08    
ref|XP_008245384.1|  PREDICTED: transcription factor bHLH14-like ...  65.9    6e-08    
ref|XP_010918535.1|  PREDICTED: transcription factor GLABRA 3         66.2    6e-08    
ref|XP_008796257.1|  PREDICTED: transcription factor MYC4             66.2    6e-08    
ref|XP_009413229.1|  PREDICTED: transcription factor MYC2-like        66.2    6e-08    
ref|XP_002985518.1|  hypothetical protein SELMODRAFT_451590           66.2    6e-08    
ref|XP_002991957.1|  hypothetical protein SELMODRAFT_430203           65.9    7e-08    
gb|KEH35684.1|  BHLH transcriptional factor                           65.9    7e-08    
ref|XP_006439218.1|  hypothetical protein CICLE_v10019730mg           65.9    7e-08    
ref|XP_002529965.1|  DNA binding protein, putative                    65.5    8e-08    
ref|XP_007209110.1|  hypothetical protein PRUPE_ppa005343mg           65.5    8e-08    
gb|KDO76730.1|  hypothetical protein CISIN_1g010053mg                 65.9    8e-08    
gb|ABK94979.1|  unknown                                               65.5    8e-08    
ref|XP_006476285.1|  PREDICTED: transcription factor MYC2-like        65.5    8e-08    
gb|KHG02428.1|  Transcription factor ICE1 -like protein               65.5    8e-08    
ref|XP_002266835.1|  PREDICTED: transcription factor FAMA isoform X1  65.1    9e-08    
emb|CDP03619.1|  unnamed protein product                              65.9    9e-08    
ref|XP_002301432.1|  basic helix-loop-helix family protein            65.5    9e-08    
ref|XP_008775533.1|  PREDICTED: transcription factor FAMA             65.1    1e-07    
ref|XP_002865164.1|  hypothetical protein ARALYDRAFT_916752           65.5    1e-07    
ref|XP_004152861.1|  PREDICTED: transcription factor bHLH14-like      64.3    1e-07    
gb|KHN11490.1|  Transcription factor ABORTED MICROSPORES              65.5    1e-07    
ref|XP_008374122.1|  PREDICTED: transcription factor MYC2-like        65.1    1e-07    
ref|XP_007210224.1|  hypothetical protein PRUPE_ppa015634mg           65.1    1e-07    
gb|EPS60924.1|  hypothetical protein M569_13876                       65.5    1e-07    
ref|XP_006398371.1|  hypothetical protein EUTSA_v10000808mg           65.5    1e-07    
ref|XP_009110613.1|  PREDICTED: transcription factor SCREAM2-like     65.1    1e-07    
ref|XP_008245390.1|  PREDICTED: transcription factor MYC2-like        65.1    1e-07    
ref|XP_009364930.1|  PREDICTED: transcription factor EGL1-like        65.5    1e-07    
gb|ACF05947.1|  MYC1                                                  65.1    1e-07    
ref|XP_010650359.1|  PREDICTED: transcription factor FAMA isoform X2  64.7    1e-07    
emb|CBI17322.3|  unnamed protein product                              64.7    1e-07    
ref|XP_010481417.1|  PREDICTED: transcription factor MYC3             65.5    1e-07    
ref|XP_009590627.1|  PREDICTED: transcription factor bHLH14-like      64.7    1e-07    
ref|XP_006827621.1|  hypothetical protein AMTR_s00009p00242790        65.5    1e-07    
ref|XP_008245836.1|  PREDICTED: transcription factor bHLH14-like ...  65.1    1e-07    
ref|XP_010538501.1|  PREDICTED: transcription factor MYC4-like        65.5    1e-07    
ref|XP_007040253.1|  Basic helix-loop-helix DNA-binding superfami...  64.7    1e-07    
ref|XP_009623534.1|  PREDICTED: transcription factor MYC2-like is...  65.1    1e-07    
gb|ACF19982.1|  MYC2                                                  64.7    1e-07    
ref|XP_004512525.1|  PREDICTED: transcription factor MYC2-like        65.1    1e-07    
gb|AEB35660.1|  MYC2                                                  62.0    1e-07    
ref|XP_008238828.1|  PREDICTED: transcription factor EGL1             65.1    1e-07    
gb|AEB35606.1|  MYC2                                                  62.0    1e-07    
ref|XP_006307455.1|  hypothetical protein CARUB_v10009081mg           64.7    1e-07    
ref|XP_010941241.1|  PREDICTED: transcription factor MYC2-like        65.1    1e-07    
gb|AEB35671.1|  MYC2                                                  62.0    1e-07    
ref|XP_008392582.1|  PREDICTED: transcription factor EGL1-like        65.1    1e-07    
ref|XP_008346662.1|  PREDICTED: transcription factor MYC2-like        64.7    2e-07    
dbj|BAH03388.1|  bHLH transcriptional factor                          65.1    2e-07    
ref|XP_010100678.1|  hypothetical protein L484_023447                 64.7    2e-07    
gb|AEB35595.1|  MYC2                                                  61.6    2e-07    
ref|XP_010935028.1|  PREDICTED: transcription factor MYC4-like        64.7    2e-07    
gb|AEB35649.1|  MYC2                                                  61.6    2e-07    
ref|XP_004230022.1|  PREDICTED: transcription factor MYC2-like is...  64.3    2e-07    
ref|XP_009623539.1|  PREDICTED: transcription factor MYC3-like is...  64.3    2e-07    
dbj|BAE20057.1|  bHLH transcription factor                            64.7    2e-07    
ref|XP_006385657.1|  phaseolin G-box binding protein PG2              64.3    2e-07    
gb|ABR17818.1|  unknown                                               64.7    2e-07    
ref|XP_004510627.1|  PREDICTED: transcription factor bHLH14-like      63.9    2e-07    
ref|XP_004501748.1|  PREDICTED: transcription factor ICE1-like        64.3    2e-07    
gb|AEB35578.1|  MYC2                                                  61.2    2e-07    
ref|XP_004230021.1|  PREDICTED: transcription factor MYC2-like is...  63.9    2e-07    
ref|XP_009380587.1|  PREDICTED: transcription factor ABA-INDUCIBL...  64.3    2e-07    
ref|XP_011028179.1|  PREDICTED: transcription factor MYC2-like        64.3    2e-07    
ref|XP_009387118.1|  PREDICTED: transcription factor FAMA-like        63.9    2e-07    
ref|XP_009776117.1|  PREDICTED: transcription factor MYC2-like        63.9    3e-07    
gb|AIT39751.1|  transcription factor MYC2                             64.3    3e-07    
ref|XP_008245834.1|  PREDICTED: transcription factor bHLH14-like ...  63.9    3e-07    
gb|AEB35568.1|  MYC2                                                  60.8    3e-07    
ref|XP_010056012.1|  PREDICTED: transcription factor MYC2-like        63.9    3e-07    
gb|AAU06823.1|  bHLH transcription factor                             62.8    3e-07    
ref|XP_004292631.1|  PREDICTED: transcription factor ABORTED MICR...  63.9    3e-07    
ref|XP_009370919.1|  PREDICTED: transcription factor MYC2-like        63.9    3e-07    
gb|AET03296.2|  basic helix loop helix (bHLH) family transcriptio...  63.9    3e-07    
ref|XP_003628820.1|  Transcription factor MYC2                        63.9    3e-07    
ref|XP_006606881.1|  PREDICTED: transcription factor ABORTED MICR...  62.8    3e-07    
dbj|BAD81265.1|  bHLH protein -like                                   63.9    3e-07    
gb|AFD29599.1|  DEL61                                                 63.9    3e-07    
ref|NP_193522.1|  transcription factor MYC4                           63.9    3e-07    
emb|CDY34601.1|  BnaC03g57010D                                        63.5    3e-07    
gb|AEB35597.1|  MYC2                                                  60.8    3e-07    
dbj|BAJ33793.1|  unnamed protein product                              63.9    3e-07    
emb|CDY21073.1|  BnaA08g24520D                                        63.5    3e-07    
gb|AEB35570.1|  MYC2                                                  60.8    3e-07    
ref|XP_002529968.1|  transcription factor, putative                   62.4    3e-07    
gb|EAY93035.1|  hypothetical protein OsI_14836                        63.9    3e-07    
ref|NP_001042524.1|  Os01g0235700                                     63.9    3e-07    
gb|AAL55711.1|AF251689_1  putative transcription factor BHLH4         63.9    3e-07    
emb|CAZ40332.1|  putative transcription factor                        63.9    3e-07    
gb|KEH18599.1|  basic helix loop helix (bHLH) family transcriptio...  63.5    3e-07    
ref|XP_011041873.1|  PREDICTED: transcription factor FAMA-like is...  63.2    4e-07    
gb|AEB35674.1|  MYC2                                                  60.5    4e-07    
gb|AEB35592.1|  MYC2                                                  60.5    4e-07    
emb|CDX85167.1|  BnaC07g07390D                                        63.2    4e-07    
ref|XP_010100724.1|  hypothetical protein L484_023493                 63.9    4e-07    
gb|AEB35678.1|  MYC2                                                  60.5    4e-07    
gb|AEB35565.1|  MYC2                                                  60.5    4e-07    
ref|XP_008345582.1|  PREDICTED: transcription factor bHLH14-like      63.5    4e-07    
ref|XP_010456176.1|  PREDICTED: transcription factor bHLH14-like ...  62.8    4e-07    
ref|XP_006343781.1|  PREDICTED: transcription factor MYC2-like        63.2    4e-07    
ref|XP_006417184.1|  hypothetical protein EUTSA_v10007566mg           63.5    4e-07    
gb|AEB35657.1|  MYC2                                                  60.5    4e-07    
ref|XP_002279973.1|  PREDICTED: transcription factor MYC4             63.5    4e-07    
gb|AEB35596.1|  MYC2                                                  60.5    4e-07    
gb|AEB35676.1|  MYC2                                                  60.5    4e-07    
gb|ABD59338.1|  G-box element binding protein                         63.5    4e-07    
gb|AEB35656.1|  MYC2                                                  60.5    4e-07    
gb|AEB35567.1|  MYC2                                                  60.5    4e-07    
ref|XP_001765254.1|  predicted protein                                63.9    4e-07    
ref|XP_006575074.1|  PREDICTED: transcription factor TT8-like iso...  63.5    4e-07    
ref|XP_008790988.1|  PREDICTED: basic helix-loop-helix protein A ...  63.5    4e-07    
ref|XP_007147321.1|  hypothetical protein PHAVU_006G114000g           63.5    4e-07    
gb|EPS59989.1|  hypothetical protein M569_14814                       60.8    5e-07    
ref|XP_008790987.1|  PREDICTED: basic helix-loop-helix protein A ...  63.5    5e-07    
ref|XP_011041874.1|  PREDICTED: transcription factor FAMA-like is...  62.8    5e-07    
ref|XP_010422737.1|  PREDICTED: transcription factor bHLH14-like      62.8    5e-07    
ref|XP_004166899.1|  PREDICTED: transcription factor ATR2-like        62.8    5e-07    
ref|XP_004140617.1|  PREDICTED: transcription factor ATR2-like        62.8    5e-07    
gb|KHN38923.1|  Transcription factor MYC2                             62.8    5e-07    
ref|XP_007208833.1|  hypothetical protein PRUPE_ppa025417mg           62.8    5e-07    
emb|CBI38690.3|  unnamed protein product                              62.4    5e-07    
ref|XP_004146202.1|  PREDICTED: transcription factor MYC4-like        62.8    5e-07    
ref|XP_008233131.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  63.2    5e-07    
ref|XP_004159750.1|  PREDICTED: transcription factor MYC4-like        62.8    5e-07    
ref|XP_009765330.1|  PREDICTED: transcription factor MYC2-like        62.8    6e-07    
ref|XP_008342536.1|  PREDICTED: transcription factor MYC2-like        63.2    6e-07    
gb|AEB35587.1|  MYC2                                                  60.1    6e-07    
ref|XP_006279855.1|  hypothetical protein CARUB_v10028441mg           63.2    6e-07    
ref|XP_006830285.1|  hypothetical protein AMTR_s00121p00026620        62.8    6e-07    
ref|XP_010556617.1|  PREDICTED: transcription factor bHLH14           62.8    6e-07    
ref|XP_003534274.2|  PREDICTED: transcription factor MYC2-like        63.2    6e-07    
ref|XP_008448555.1|  PREDICTED: transcription factor MYC3-like        62.8    6e-07    
ref|XP_009359542.1|  PREDICTED: transcription factor MYC2-like        62.8    6e-07    
gb|AEB35580.1|  MYC2                                                  59.7    6e-07    



>ref|XP_009788149.1| PREDICTED: transcription factor bHLH91-like [Nicotiana sylvestris]
Length=459

 Score =   416 bits (1069),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 259/398 (65%), Positives = 300/398 (75%), Gaps = 25/398 (6%)
 Frame = -2

Query  1476  MQKLGHE--NQGLS----NWEEL------------GFSHQPQSFQIPMPETPCPPAPDLL  1351
             MQ+L HE  NQGLS    NW E+             F H     Q    + P  P PDLL
Sbjct  65    MQELVHEHNNQGLSCDQSNWGEMSFPPYQNQEDNNNFQHAAHDIQNGHDQQPYLPTPDLL  124

Query  1350  NMfplprcspssllpnpsfsstfltslglfGDLPSSA-ADGASPSTVVCDpsllplnlpp  1174
             NMFPLPR S S    N + +S  LTSLGL GD+   A ADGAS  + + DPSLLPLNLPP
Sbjct  125   NMFPLPRSSISFTNTNTNQASNLLTSLGLLGDINIPATADGASNPSAIYDPSLLPLNLPP  184

Query  1173  qpplLRELFHSLPQGGYGFGASRSSGSLFGEVDER-EVNGAFYQTVDGC-RDFENGVFEL  1000
             QPPLLRELFHSLP G YG    RS+ S F  ++ER +++GA YQ  DG  R F+NG+FE 
Sbjct  185   QPPLLRELFHSLPHG-YGLRNLRSTSSFFNGLEERDQLSGALYQ--DGEERPFDNGIFEF  241

Query  999   TGDMNVLAKNRD-GKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYI  823
             + DMN +AKNRD GK TKHFATERQRRVHLNDKY+AL+ +VPNPSKNDRAS+V DAI YI
Sbjct  242   SADMNGIAKNRDIGKDTKHFATERQRRVHLNDKYKALRSMVPNPSKNDRASIVKDAIEYI  301

Query  822   NELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSW  643
             NELKR V +L+++VEKKRC+R+R+KR KTE   + MDG + K +++VDQSY+G +LRSSW
Sbjct  302   NELKREVHDLELMVEKKRCNRDRIKRQKTEEGGNSMDGSNAKQMDEVDQSYNGNSLRSSW  361

Query  642   LQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSF  463
             LQR+SKNTEVDVR++D EVT+KLVQQKRINCLLF SK LD+LQLDLHHVAGGLIGDYYSF
Sbjct  362   LQRRSKNTEVDVRVVDHEVTIKLVQQKRINCLLFASKVLDDLQLDLHHVAGGLIGDYYSF  421

Query  462   LFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             LFNSKICEGSTVYASAIA KLIEVVD  Y AIAPT SY
Sbjct  422   LFNSKICEGSTVYASAIAKKLIEVVDIQYAAIAPTNSY  459



>ref|XP_011093423.1| PREDICTED: transcription factor bHLH91-like [Sesamum indicum]
 ref|XP_011093424.1| PREDICTED: transcription factor bHLH91-like [Sesamum indicum]
Length=493

 Score =   405 bits (1040),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 246/412 (60%), Positives = 287/412 (70%), Gaps = 40/412 (10%)
 Frame = -2

Query  1482  HFMQKLGHENQGLSNWEELG---------FSHQPQSFQI---------------PMPETP  1375
             H +Q++ H+    SNW+E+            HQP +  +                +PETP
Sbjct  88    HEIQEIVHD----SNWQEMTNFNGENQYHHQHQPPADYVQNGHHHHHQQNFTTGSLPETP  143

Query  1374  CPPAPDLLNM-------fplprcspssllpnpsfsstfltslglfGDLPSSAADGASPST  1216
              P  PDLLNM             + S    N +  S    +        +++ADG+S S 
Sbjct  144   YPTTPDLLNMFPLPRCSPSSLLPNSSITFSNSAHKSPGFLASLGLLGEINTSADGSSASA  203

Query  1215  -VVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTV  1039
               V    LLPLNLPPQPPLLRELFHSLP GGY  GA R+ G+LFG VDER+VN   YQ  
Sbjct  204   GAVVYDPLLPLNLPPQPPLLRELFHSLPHGGYTLGAPRN-GTLFGGVDERDVNVGLYQNG  262

Query  1038  DGCRDFE-NGVFELT-GDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSK  865
             D  R F+ NGVFE T G+++ + KNRDGK TKHFATER RRV LNDKY+AL+KLVPNP+K
Sbjct  263   DHGRSFDHNGVFEFTAGEIDCIGKNRDGKDTKHFATERHRRVLLNDKYQALRKLVPNPTK  322

Query  864   NDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVED  685
             NDRAS+V DAI YINELKRTV ELK  VEKKRC +ER+KR KTE   ++M+G + KSV +
Sbjct  323   NDRASIVGDAIDYINELKRTVTELKGWVEKKRCIKERLKRPKTED-DAVMEGNESKSVGE  381

Query  684   VDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDL  505
             +D  Y+ ++LRSSWL RKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSK LDELQLDL
Sbjct  382   MDNPYNSSSLRSSWLHRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKVLDELQLDL  441

Query  504   HHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             HHVAGGLIGDYYSFLFNSKICEGS VYASA+ANKLIEVVDK Y AI PT+SY
Sbjct  442   HHVAGGLIGDYYSFLFNSKICEGSIVYASAVANKLIEVVDKQYAAIPPTSSY  493



>ref|XP_009623799.1| PREDICTED: transcription factor bHLH91-like [Nicotiana tomentosiformis]
Length=476

 Score =   389 bits (999),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 262/408 (64%), Positives = 304/408 (75%), Gaps = 35/408 (9%)
 Frame = -2

Query  1476  MQKLGHE--NQGLS----NWEELGF---------------------SHQPQSFQIPMPET  1378
             MQ+L HE  NQG+S    NW E+ F                      HQ Q+F   +PE 
Sbjct  72    MQELVHEHNNQGISCDQSNWGEMSFPPYQNQEDNNNFQHVAHDIQNGHQQQNFPNSLPEA  131

Query  1377  PCP-PAPDLLNMfplprcspssllpnpsfsstfltslglfGDLPSSAADGASPSTVVCDp  1201
             P   P PDLLNMFPLPR S S    N + SS  LTSLGL GD+   AADGAS ++ V D 
Sbjct  132   PYNLPTPDLLNMFPLPRSSISFTNTNTTQSSNLLTSLGLLGDINIPAADGASTTSAVYDH  191

Query  1200  sllplnlppqpplLRELFHSLPQGGYGFGASRS-SGSLFGEVDER-EVNGAFYQTVDGC-  1030
             SLLPLNLPPQPPLLRELFHS P   YG G  RS + S F  ++ER +++GA YQ  DG  
Sbjct  192   SLLPLNLPPQPPLLRELFHSFPHD-YGLGNLRSNTSSFFNGLEERDQLSGALYQ--DGEE  248

Query  1029  RDFENGVFELTGDMNVLAKNRD-GKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRA  853
             R F+N +FE + DMN +AKNRD GK TKHFATERQRRVHLNDKY+AL+ +VPNPSKNDRA
Sbjct  249   RPFDNRIFEFSADMNGIAKNRDIGKDTKHFATERQRRVHLNDKYKALRSMVPNPSKNDRA  308

Query  852   SVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQS  673
             S+V DAI YINELKR V +L+++VEKKRC+R+R+KR KT+   + MDG D K +++VDQS
Sbjct  309   SIVKDAIEYINELKREVHDLEVMVEKKRCNRDRIKRQKTKEGGNSMDGTDAKQMDEVDQS  368

Query  672   YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
             Y+G +LRSSWLQR+SKNTEVDVR++DDEVTVK+VQQKRINCLLF SK LD+LQLDLHHVA
Sbjct  369   YNGNSLRSSWLQRRSKNTEVDVRVVDDEVTVKVVQQKRINCLLFASKVLDDLQLDLHHVA  428

Query  492   GGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             GGLIGDYYSFLFNSKICEGSTVYASAIA KLIEVVD  Y AIAPT SY
Sbjct  429   GGLIGDYYSFLFNSKICEGSTVYASAIAKKLIEVVDIQYAAIAPTNSY  476



>ref|XP_009800020.1| PREDICTED: transcription factor bHLH91-like [Nicotiana sylvestris]
Length=363

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 247/353 (70%), Positives = 283/353 (80%), Gaps = 10/353 (3%)
 Frame = -2

Query  1389  MPETPCP-PAPDLLNMfplprcspssllpnpsfsstfltslglfGDLPSSA-ADGASPS-  1219
             +PE P   P PDLLNMFPLPR S S    N + +S  LTSLGL GD+   A ADGAS S 
Sbjct  13    LPEAPYNLPTPDLLNMFPLPRSSISFTNTNTNQASNLLTSLGLLGDINIPATADGASNSN  72

Query  1218  -TVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDER-EVNGAFYQ  1045
              + V DPSLLPLNLPPQPPLLRELFHSLP G YG    RS+ S F  ++ER +++GA YQ
Sbjct  73    SSAVYDPSLLPLNLPPQPPLLRELFHSLPHG-YGLRNLRSTTSFFNGLEERNQLSGALYQ  131

Query  1044  TVDGC-RDFENGVFELTGDMNVLAKNRD-GKGTKHFATERQRRVHLNDKYEALKKLVPNP  871
               DG  R F+NG+FE + DMN +AKNRD GK TKHFATERQRRVHL DKY+AL+ +VPNP
Sbjct  132   --DGEERPFDNGIFEFSADMNGIAKNRDIGKDTKHFATERQRRVHLTDKYKALRSMVPNP  189

Query  870   SKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSV  691
             SKNDRAS+V DAI YINELKR V +L+++VEKKRCSR+R+KR KTE   + MDG D K +
Sbjct  190   SKNDRASIVKDAIEYINELKREVHDLELMVEKKRCSRDRIKRQKTEEGGNSMDGNDSKQM  249

Query  690   EDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQL  511
             ++VDQSY+G +LRSSWLQR+SKNTEVDV ++DDEVT+KLVQQKRINCLLF SK LD+LQL
Sbjct  250   DEVDQSYNGNSLRSSWLQRRSKNTEVDVHVVDDEVTIKLVQQKRINCLLFASKVLDDLQL  309

Query  510   DLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTS  352
             DLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIA KLIEVVD  Y AIAPT S
Sbjct  310   DLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIAKKLIEVVDIQYAAIAPTNS  362



>ref|XP_010323236.1| PREDICTED: transcription factor bHLH91-like [Solanum lycopersicum]
Length=473

 Score =   380 bits (977),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 235/389 (60%), Positives = 270/389 (69%), Gaps = 33/389 (8%)
 Frame = -2

Query  1443  SNWEELGFS-----------------HQPQSFQIPMPETPCPPAPDLLNMfplprcspss  1315
             +NW E+ F                  HQ Q F  P+ ETP    PDLLNMFPLPRC+ SS
Sbjct  94    ANWGEMNFPPYQNQQHNDNGNSNNNFHQ-QDFSNPISETPYLTTPDLLNMFPLPRCTQSS  152

Query  1314  llpnpsfsstfltslglfGDLPSSAADGASPSTVVCDpsllplnlppqpplL--RELFHS  1141
             LLP  S +      L            GAS S+ +CDPS L L L   P     RELFHS
Sbjct  153   LLPQKSPNLLTSLGLIG-----DIDGGGASTSSAICDPSSLLLPLNLPPQPPLLRELFHS  207

Query  1140  LPQGGYGFGASRSSG--SLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVLAKNR  967
              P G YG    RS+   S F  ++E   +   YQ     R F+NG+FE +G MN +AKNR
Sbjct  208   FPHG-YGLRNLRSNNNTSFFNGLEE--TDQGLYQENGETRPFQNGIFEFSGGMNDIAKNR  264

Query  966   DG-KGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELK  790
             DG K TKHFATERQRRVHLNDKY+AL+ +VPNPSKNDRAS+V DAI YINELKR V ELK
Sbjct  265   DGIKETKHFATERQRRVHLNDKYKALRSMVPNPSKNDRASIVKDAIDYINELKRGVNELK  324

Query  789   ILVEKKRCSRERMKRHKTEGCSSM-MDGGDLKSVED-VDQSYSGTTLRSSWLQRKSKNTE  616
             ++ EKKRC+++R+KR KTEG +++ MDG D K + D V+QSY+G +LRSSWLQR+SKNTE
Sbjct  325   LMAEKKRCNKDRIKRQKTEGGTTISMDGSDAKQIMDEVEQSYNGNSLRSSWLQRRSKNTE  384

Query  615   VDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEG  436
             VDVRI+DDEVTVKLVQQKRINCL   SK LD+LQLDLHHVAGGLIGDYYSFLFNSKI EG
Sbjct  385   VDVRIVDDEVTVKLVQQKRINCLFSASKVLDDLQLDLHHVAGGLIGDYYSFLFNSKISEG  444

Query  435   STVYASAIANKLIEVVDKHYTAIAPTTSY  349
             STVYASAIA KLIEVVD  Y AIAPT SY
Sbjct  445   STVYASAIAKKLIEVVDIQYAAIAPTNSY  473



>ref|XP_006354586.1| PREDICTED: transcription factor bHLH91-like [Solanum tuberosum]
Length=471

 Score =   379 bits (972),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 247/396 (62%), Positives = 279/396 (70%), Gaps = 36/396 (9%)
 Frame = -2

Query  1455  NQGLS----NWEELGFS-----------------HQPQSFQIPMPETPCPPAPDLLNMfp  1339
             NQGLS    NW E+ F                  HQ Q F  P+ E P    PDLLNMFP
Sbjct  85    NQGLSCDQSNWGEMNFPPYQNQEHNDNSNNNNNFHQ-QDFSNPISEPPYLTTPDLLNMFP  143

Query  1338  lprcspssllpnpsfsstfltslglfGDLPSSAADGASPSTVVCD--psllplnlppqpp  1165
             LPRCS SSLLP  S +      L            GAS ST + D    +LPLNLPPQPP
Sbjct  144   LPRCSQSSLLPQKSPNLLTSLGLIG-----DIDGGGASTSTAIYDPSSLVLPLNLPPQPP  198

Query  1164  lLRELFHSLPQGGYGFGASRSSG--SLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGD  991
             LLRELFHS P G YG    RS+   S F  ++E++     YQ     R F+NG+FE +  
Sbjct  199   LLRELFHSFPHG-YGLRNLRSNNNTSFFNGLEEQD--QGLYQENGETRPFDNGIFEFSAG  255

Query  990   MNVLAKNRDG-KGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINEL  814
             MN +AKNRDG K TKHFATERQRRVHLNDKY+AL+ +VPNPSKNDRAS+V DAI YINEL
Sbjct  256   MNDIAKNRDGIKETKHFATERQRRVHLNDKYKALRSMVPNPSKNDRASIVKDAIDYINEL  315

Query  813   KRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVED-VDQSYSGTTLRSSWLQ  637
             KR V ELK++VEKKRC+++R+KR KTEG +  MDG D K + D V+QSY+G +LRSSWLQ
Sbjct  316   KRGVNELKLMVEKKRCNKDRIKRQKTEGGTVSMDGTDAKQIMDEVEQSYNGNSLRSSWLQ  375

Query  636   RKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLF  457
             R+SKNTEVDVRI+DDEVTVKLVQQKRINCL F SK LD+LQLDLHHVAGGLIGDYYSFLF
Sbjct  376   RRSKNTEVDVRIVDDEVTVKLVQQKRINCLFFASKVLDDLQLDLHHVAGGLIGDYYSFLF  435

Query  456   NSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             NSKI EGSTVYASAIA KLIEVVD  Y AIAPT SY
Sbjct  436   NSKISEGSTVYASAIAKKLIEVVDIQYAAIAPTNSY  471



>emb|CDP09313.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   368 bits (945),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/237 (77%), Positives = 201/237 (85%), Gaps = 4/237 (2%)
 Frame = -2

Query  1059  GAFYQTVDGCRDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLV  880
             G  +Q  DG R +ENGVFE T D+  L K RDGKG KHF TERQRRV +NDKY+AL+ LV
Sbjct  227   GCLFQDGDG-RSYENGVFEFTADVKCLGKGRDGKGRKHFTTERQRRVQINDKYQALRSLV  285

Query  879   PNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDL  700
             PNPSKNDRASVV DAIGYINELKRTV ELKILVEKKRCSR+R+KRHK E  +   +G  +
Sbjct  286   PNPSKNDRASVVGDAIGYINELKRTVAELKILVEKKRCSRDRIKRHKVEDGA---EGAAV  342

Query  699   KSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDE  520
             K+ +D+DQ Y G++LRSSWL RKSK+TEVDVRIIDDEVTVKLVQQKRINCLLFVSK LDE
Sbjct  343   KTEDDLDQPYDGSSLRSSWLHRKSKSTEVDVRIIDDEVTVKLVQQKRINCLLFVSKVLDE  402

Query  519   LQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             LQLDLHHVAGGLIGDYYSFLFNSKI EGSTVYA AIANKLIEVVDK Y A+ PT+SY
Sbjct  403   LQLDLHHVAGGLIGDYYSFLFNSKISEGSTVYAHAIANKLIEVVDKQYAAVQPTSSY  459



>gb|EYU42281.1| hypothetical protein MIMGU_mgv1a006478mg [Erythranthe guttata]
Length=442

 Score =   362 bits (930),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 235/309 (76%), Gaps = 28/309 (9%)
 Frame = -2

Query  1251  PSSAADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDE  1072
             P+   DG S S  V    LLPLNLPPQPPLLR+LFHSLP      G      SLFG VDE
Sbjct  154   PNVGGDGTSASGSVIYDPLLPLNLPPQPPLLRDLFHSLPNNYTKNGGC----SLFGNVDE  209

Query  1071  REVN------GAFYQTVDGCRDFENGVFELT--GDMNVLAKNRDGKGTKHFATERQRRVH  916
             R+ N      G  YQ        +NGVFE T  G+++ + K+RDGK TKHFATER RR+ 
Sbjct  210   RDNNNNHGNVGLMYQN-------DNGVFEFTAAGEIDCVGKSRDGKDTKHFATERHRRLL  262

Query  915   LNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKT  736
             LNDK++AL+KL+PNPSK+DRAS+V DAI YINELKR+V ELK+LVEKKRCSRERMKR KT
Sbjct  263   LNDKFQALRKLIPNPSKDDRASIVGDAINYINELKRSVAELKLLVEKKRCSRERMKRPKT  322

Query  735   EGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRI  556
             E  +     G+L+S         G++LRSSWLQRKSKNTEVDVRI+DDEVTVKLVQQKRI
Sbjct  323   ENENESNSLGNLES---------GSSLRSSWLQRKSKNTEVDVRIVDDEVTVKLVQQKRI  373

Query  555   NCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHY  376
             NCLLFVSK LDELQLDLHHVAGGLIGDYYSFLFNSKICEGS VYASA+ANKLIEVVDK Y
Sbjct  374   NCLLFVSKVLDELQLDLHHVAGGLIGDYYSFLFNSKICEGSIVYASAVANKLIEVVDKQY  433

Query  375   TAIAPTTSY  349
              AI P++SY
Sbjct  434   AAIPPSSSY  442



>ref|XP_009589122.1| PREDICTED: transcription factor bHLH91-like [Nicotiana tomentosiformis]
Length=400

 Score =   352 bits (903),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 229/295 (78%), Gaps = 10/295 (3%)
 Frame = -2

Query  1242  AADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDEREV  1063
              ADGAS ST + DPSL PLNLPP PPLLREL HSLP G YG G+S + GSLF  + E  V
Sbjct  98    TADGASTSTAIYDPSLFPLNLPPNPPLLRELVHSLPHG-YGLGSS-NFGSLFNGM-EIHV  154

Query  1062  NGAFYQTV-DGCRDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKK  886
             +G  YQ   DG   FENG+FE + D + + K+RD K  KHFAT+RQ+R HLNDKY+AL+ 
Sbjct  155   SGDLYQDAGDGKCPFENGIFEFSADTSCMTKDRDNKEIKHFATDRQKRAHLNDKYKALRS  214

Query  885   LVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG  706
             LVPNPSKNDRAS+V DAI YINELKRTV ELKI+V+KK C R+R KR   E  S  M+  
Sbjct  215   LVPNPSKNDRASIVGDAIMYINELKRTVNELKIMVDKKMCCRDRTKRQNIE--SGPMNSA  272

Query  705   DLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKAL  526
             D+K   +VD S    +LRSSWLQRK+ NTEVDVRI+DDEVTVKLVQQKRINCLLFVSK L
Sbjct  273   DVKLRNEVDPS----SLRSSWLQRKTTNTEVDVRIVDDEVTVKLVQQKRINCLLFVSKVL  328

Query  525   DELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAP  361
             D+LQLDLHHVAGGLIGD YSFLFNSKICEGSTVYA AIANKLIE+VD  YT  +P
Sbjct  329   DDLQLDLHHVAGGLIGDCYSFLFNSKICEGSTVYAIAIANKLIEIVDIQYTETSP  383



>gb|EYU42282.1| hypothetical protein MIMGU_mgv1a006556mg [Erythranthe guttata]
Length=439

 Score =   350 bits (898),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 230/309 (74%), Gaps = 25/309 (8%)
 Frame = -2

Query  1251  PSSAADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDE  1072
             P++  DG S S  V    LLPLNLPPQPP LR+LFHSLP       A     SLFG VDE
Sbjct  148   PNAGGDGTSASGSVIYDPLLPLNLPPQPPSLRDLFHSLPNNY----AKNGGCSLFGNVDE  203

Query  1071  REVN------GAFYQTVDGCRDFENGVFELT--GDMNVLAKNRDGKGTKHFATERQRRVH  916
             R+ N      G  YQ        +NGVFE T  G+++ + KNRDGK  KHFATE+ RRV 
Sbjct  204   RDNNNNHGNVGLMYQN-------DNGVFEFTATGEIDCVGKNRDGKDIKHFATEKHRRVQ  256

Query  915   LNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKT  736
                K++ L+KLVPNP+KNDRAS+V DAI YINELKR+V EL++LVEKKRCSRERMKR K 
Sbjct  257   FKGKFDDLRKLVPNPTKNDRASIVQDAIDYINELKRSVAELQLLVEKKRCSRERMKRPKM  316

Query  735   EGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRI  556
             E   +  +   L ++E      SG++LRSSWLQRKSKNTEVDVRI+DDEVTVKLVQQKRI
Sbjct  317   ENNENENESNSLGNLE------SGSSLRSSWLQRKSKNTEVDVRIVDDEVTVKLVQQKRI  370

Query  555   NCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHY  376
             NCLL+VSK LDELQLDLHHVAGGLIGDYYSFLFNSKICEGS VYASA+ANKLIEVVDK Y
Sbjct  371   NCLLYVSKVLDELQLDLHHVAGGLIGDYYSFLFNSKICEGSIVYASAVANKLIEVVDKQY  430

Query  375   TAIAPTTSY  349
              AI P++SY
Sbjct  431   AAIPPSSSY  439



>ref|XP_010661301.1| PREDICTED: transcription factor bHLH91-like [Vitis vinifera]
Length=456

 Score =   343 bits (881),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 187/268 (70%), Positives = 211/268 (79%), Gaps = 12/268 (4%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGE-VDEREVNGAFYQTVDGCRDFENGVFELTGDMNV  982
             RELF SLP G Y   ASR  GSLFG  +DERE +G  Y   D  R F+NGV + T DM  
Sbjct  183   RELFQSLPHG-YNLPASRV-GSLFGGGMDEREASGGGYGDGDDHRQFDNGVLKFTRDMAC  240

Query  981   LAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV  802
             + K R+GKGTK FATE+QRR HLNDKY AL+ LVPNP+K+DRASVV DAI YI EL RTV
Sbjct  241   IGKGREGKGTKSFATEKQRREHLNDKYNALRSLVPNPTKSDRASVVGDAIEYIRELLRTV  300

Query  801   GELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDV----DQSYSGTTLRSSWLQR  634
              ELK+LVEKKRC RER KRHKTE  S+    GD+KS   +    DQSY+  +LRSSWLQR
Sbjct  301   NELKLLVEKKRCGRERSKRHKTEDEST----GDVKSSSSIKPEPDQSYN-ESLRSSWLQR  355

Query  633   KSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFN  454
             KSK+TEVDVRIIDDEVT+KLVQ+K+INCLLFVSK LDELQLDLHHVAGG +GDYYSFLFN
Sbjct  356   KSKDTEVDVRIIDDEVTIKLVQRKKINCLLFVSKILDELQLDLHHVAGGHVGDYYSFLFN  415

Query  453   SKICEGSTVYASAIANKLIEVVDKHYTA  370
             +KI EGS+VYASAIANKLIEVVD+ Y A
Sbjct  416   TKIYEGSSVYASAIANKLIEVVDRQYAA  443



>gb|KDP43627.1| hypothetical protein JCGZ_16914 [Jatropha curcas]
Length=456

 Score =   343 bits (880),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 239/344 (69%), Gaps = 9/344 (3%)
 Frame = -2

Query  1368  PAPDLLNMfplprcspssllpnpsfsstfltslglfGDLPSSAADGASPSTVVCDpsllp  1189
             P PDLLN+F LPR S          +    T LG  GDLP +  D AS S+++ DP    
Sbjct  118   PPPDLLNLFHLPRSSLLPNSSISFTNPNHTTPLGFVGDLPMT--DTASASSILYDPLFPL  175

Query  1188  lnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGA----FYQTVDGCRDF  1021
                P  P   R+LF SLPQ GY    SR S SLFG V +  V G+     YQ  DG + F
Sbjct  176   NLPPQPPLF-RDLFQSLPQHGYSLPGSRGS-SLFGGVGDDHVEGSGGVNLYQEGDGEQQF  233

Query  1020  ENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVH  841
             +NGV + T DM  + K R G   KHFATERQRR +L DKY+ LK LVPN SK+DRASVV 
Sbjct  234   DNGVLDFTWDMACMGKGRQGGNIKHFATERQRRQNLKDKYDDLKNLVPNSSKSDRASVVG  293

Query  840   DAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGT  661
             DAI YI EL RTV ELKILVEKKR +RER KR K E   S+ +G + K ++D DQS++  
Sbjct  294   DAISYIKELLRTVNELKILVEKKRLARERRKRQKIEE-DSIGNGPESKIIDDPDQSFNNG  352

Query  660   TLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLI  481
              LRSSWLQRKSK+TEVDVRIIDDEVT+KLVQ+K+INCLLFVSK LDELQLDLHHVAGG +
Sbjct  353   ALRSSWLQRKSKDTEVDVRIIDDEVTIKLVQRKKINCLLFVSKVLDELQLDLHHVAGGHV  412

Query  480   GDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             GDYYSFLFNSKI EGS+VYASAIANKLIEVVD+ Y +   T+ Y
Sbjct  413   GDYYSFLFNSKIYEGSSVYASAIANKLIEVVDRQYASTPSTSCY  456



>emb|CAN77001.1| hypothetical protein VITISV_003899 [Vitis vinifera]
Length=456

 Score =   342 bits (878),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 211/268 (79%), Gaps = 12/268 (4%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGE-VDEREVNGAFYQTVDGCRDFENGVFELTGDMNV  982
             RELF SLP G Y   ASR  GSLFG  +DERE +G  Y   D  R F+NGV + T DM  
Sbjct  183   RELFQSLPHG-YNLPASRV-GSLFGGGMDEREASGGGYGDGDDHRQFDNGVLKFTRDMAC  240

Query  981   LAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV  802
             + + R+GKGTK FATE+QRR HLNDKY AL+ LVPNP+K+DRASVV DAI YI EL RTV
Sbjct  241   IGRGREGKGTKSFATEKQRREHLNDKYNALRSLVPNPTKSDRASVVGDAIEYIRELLRTV  300

Query  801   GELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDV----DQSYSGTTLRSSWLQR  634
              ELK+LVEKKRC RER KRHKTE  S+    GD+KS   +    DQSY+  +LRSSWLQR
Sbjct  301   NELKLLVEKKRCGRERSKRHKTEDEST----GDVKSSSSIKPEPDQSYN-ESLRSSWLQR  355

Query  633   KSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFN  454
             KSK+TEVDVRIIDDEVT+KLVQ+K+INCLLFVSK LDELQLDLHHVAGG +GDYYSFLFN
Sbjct  356   KSKDTEVDVRIIDDEVTIKLVQRKKINCLLFVSKILDELQLDLHHVAGGHVGDYYSFLFN  415

Query  453   SKICEGSTVYASAIANKLIEVVDKHYTA  370
             +KI EGS+VYASAIANKLIEVVD+ Y A
Sbjct  416   TKIYEGSSVYASAIANKLIEVVDRQYAA  443



>ref|XP_002534354.1| Transcription factor ICE1, putative [Ricinus communis]
 gb|EEF28027.1| Transcription factor ICE1, putative [Ricinus communis]
Length=469

 Score =   332 bits (850),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 225/314 (72%), Gaps = 18/314 (6%)
 Frame = -2

Query  1257  DLPSSAADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFG--  1084
             DLP   AD AS S+++ DP       P  P   R+LF SLP  GY    S  + SLFG  
Sbjct  162   DLP--MADTASASSILYDPLFHLNLPPQPPLF-RDLFQSLPPHGYSLPGSMVN-SLFGAG  217

Query  1083  -----EVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVLAKNRD-GKGTKHFATERQRR  922
                   V+     G  YQ  DG + F+NGV + T DM  + K RD GK TK FATERQRR
Sbjct  218   VGGDDHVEGSGDGGGIYQDGDGEQQFDNGVLDFTWDMPCMGKGRDAGKKTKPFATERQRR  277

Query  921   VHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRH  742
              HLNDKY+AL+ LVPNP+K DR SVV DAI YI EL RTV ELK+LVEKKRC+RER KR 
Sbjct  278   QHLNDKYKALQNLVPNPTKADRTSVVGDAIDYIKELLRTVNELKLLVEKKRCARERSKRQ  337

Query  741   KTEGCSSMMDGGD----LKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKL  574
             KTE   S+ +G D     K + D DQS++  +LRSSW++RKSK+TEVDVRIIDDEVT+KL
Sbjct  338   KTEE-DSIGNGHDSSCITKPLGDPDQSFNNGSLRSSWIERKSKDTEVDVRIIDDEVTIKL  396

Query  573   VQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIE  394
             VQ+K+INCLLFVSK LDELQLDLHHVAGG IGDYYSFLFN+KI EGS+VYASAIANKLIE
Sbjct  397   VQRKKINCLLFVSKVLDELQLDLHHVAGGHIGDYYSFLFNTKIFEGSSVYASAIANKLIE  456

Query  393   VVDKHYTAIAPTTS  352
             VVD+HY A  P+T+
Sbjct  457   VVDRHY-ASTPSTN  469



>ref|XP_006464331.1| PREDICTED: transcription factor bHLH91-like isoform X1 [Citrus 
sinensis]
 ref|XP_006464332.1| PREDICTED: transcription factor bHLH91-like isoform X2 [Citrus 
sinensis]
Length=460

 Score =   327 bits (838),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/274 (64%), Positives = 210/274 (77%), Gaps = 12/274 (4%)
 Frame = -2

Query  1158  RELFHSLPQGGYGF---GASRSSGSLFGEV-DEREVNGAFYQTVDGCRDFENGVFELTGD  991
             RELF S+P G Y F    +  ++ SLFGE+ DER+  GAFY+  D     +N V E + D
Sbjct  190   RELFQSIPHG-YSFPASASRAAANSLFGEIGDERDATGAFYEDGDVGVHLDNRVLEFSRD  248

Query  990   MNVLAKNRD--GKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINE  817
             +  + + R+  GK TKHFATERQRR  LN K++ALK LVPNP+KNDRASVV DAI YI E
Sbjct  249   LGCIGRRRETAGKPTKHFATERQRREQLNGKFKALKDLVPNPTKNDRASVVGDAIEYIKE  308

Query  816   LKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQ  637
             L RTV ELK+LVEKKRC RER KRH+TE      D G    V+  DQSY+ ++LRSSWLQ
Sbjct  309   LLRTVNELKLLVEKKRCVRERRKRHRTEDD----DEGMKPLVDPADQSYN-SSLRSSWLQ  363

Query  636   RKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLF  457
             RKSK+TEVDVRIIDDEVT+KLVQ+K+I+CLLFVS+ LDELQLDLHHVAGG IGDYYSFLF
Sbjct  364   RKSKDTEVDVRIIDDEVTIKLVQRKKIDCLLFVSRVLDELQLDLHHVAGGHIGDYYSFLF  423

Query  456   NSKICEGSTVYASAIANKLIEVVDKHYTAIAPTT  355
             N+KI EGS+VYA +IANKLIEV+DK Y A+ PT+
Sbjct  424   NTKIYEGSSVYAGSIANKLIEVMDKQYAAVPPTS  457



>ref|XP_006445526.1| hypothetical protein CICLE_v10019669mg [Citrus clementina]
 gb|ESR58766.1| hypothetical protein CICLE_v10019669mg [Citrus clementina]
 gb|KDO85346.1| hypothetical protein CISIN_1g009555mg [Citrus sinensis]
Length=532

 Score =   327 bits (837),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 176/274 (64%), Positives = 210/274 (77%), Gaps = 12/274 (4%)
 Frame = -2

Query  1158  RELFHSLPQGGYGF---GASRSSGSLFGEV-DEREVNGAFYQTVDGCRDFENGVFELTGD  991
             RELF S+P G Y F    +  ++ SLFGE+ DER+  GAFY+  D     +N V E + D
Sbjct  262   RELFQSIPHG-YSFPASASRAAANSLFGEIGDERDATGAFYEDGDVGVHLDNRVLEFSRD  320

Query  990   MNVLAKNRD--GKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINE  817
             +  + + R+  GK TKHFATERQRR  LN K++ALK LVPNP+KNDRASVV DAI YI E
Sbjct  321   LGCIGRRRETAGKPTKHFATERQRREQLNGKFKALKDLVPNPTKNDRASVVGDAIEYIKE  380

Query  816   LKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQ  637
             L RTV ELK+LVEKKRC RER KRH+TE      D G    V+  DQSY+ ++LRSSWLQ
Sbjct  381   LLRTVNELKLLVEKKRCVRERRKRHRTEDD----DEGMKPLVDPADQSYN-SSLRSSWLQ  435

Query  636   RKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLF  457
             RKSK+TEVDVRIIDDEVT+KLVQ+K+I+CLLFVS+ LDELQLDLHHVAGG IGDYYSFLF
Sbjct  436   RKSKDTEVDVRIIDDEVTIKLVQRKKIDCLLFVSRVLDELQLDLHHVAGGHIGDYYSFLF  495

Query  456   NSKICEGSTVYASAIANKLIEVVDKHYTAIAPTT  355
             N+KI EGS+VYA +IANKLIEV+DK Y A+ PT+
Sbjct  496   NTKIYEGSSVYAGSIANKLIEVMDKQYAAVPPTS  529



>gb|KDP43626.1| hypothetical protein JCGZ_16913 [Jatropha curcas]
Length=447

 Score =   322 bits (826),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 232/351 (66%), Gaps = 15/351 (4%)
 Frame = -2

Query  1389  MPETPCPPAPDLLNMfplprcspssllpnpsfsstfltslglfGDLPSSAADGASPSTVV  1210
             +P++   P PDL N+F LPR S          +    T L   GDLP    D AS S+ +
Sbjct  108   LPDSAYTPTPDLRNLFRLPRSSLLPNSSISFTNPNHTTPLSFVGDLP--MTDTASASSSL  165

Query  1209  CDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGA----FYQT  1042
              DP       P  P   R+LF SLP  GY    SR S SLFG V +  V G+     YQ 
Sbjct  166   YDPLFHLNLPPQPPLF-RDLFQSLPPHGYSLPGSRGS-SLFGGVGDDHVEGSGGVNLYQE  223

Query  1041  VDGCRDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKN  862
              DG + F+NGV + T DM  +   R G   KHFATERQRR H+ DKY+ L+ L      N
Sbjct  224   GDGEQQFDNGVLDFTWDMACMGNGRQGGNIKHFATERQRRQHIKDKYDDLRNL------N  277

Query  861   DRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDV  682
             DRASVV DAI YI EL RTV ELKILVEKKRC+RER KR K E   S+ +  + K V+D 
Sbjct  278   DRASVVGDAINYIKELLRTVNELKILVEKKRCARERGKRQKIEE-DSIGNVHESKIVDDP  336

Query  681   DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLH  502
             DQS++  +LRS WLQRKSK+TEVDVRIIDDEVT+KLVQ+K+INCLLFVSK LDELQLDLH
Sbjct  337   DQSFNNGSLRSFWLQRKSKDTEVDVRIIDDEVTIKLVQRKKINCLLFVSKVLDELQLDLH  396

Query  501   HVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             HVAGG +GDYYSFLFNSKI EGS+VYASAIANKLIEVVD+ Y +   T+ Y
Sbjct  397   HVAGGHVGDYYSFLFNSKIYEGSSVYASAIANKLIEVVDRQYASTPSTSCY  447



>emb|CBI38213.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   320 bits (820),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 185/224 (83%), Gaps = 9/224 (4%)
 Frame = -2

Query  1029  RDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRAS  850
             R F+NGV + T DM  + K R+GKGTK FATE+QRR HLNDKY AL+ LVPNP+K+DRAS
Sbjct  202   RQFDNGVLKFTRDMACIGKGREGKGTKSFATEKQRREHLNDKYNALRSLVPNPTKSDRAS  261

Query  849   VVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDV----  682
             VV DAI YI EL RTV ELK+LVEKKRC RER KRHKTE  S+    GD+KS   +    
Sbjct  262   VVGDAIEYIRELLRTVNELKLLVEKKRCGRERSKRHKTEDEST----GDVKSSSSIKPEP  317

Query  681   DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLH  502
             DQSY+  +LRSSWLQRKSK+TEVDVRIIDDEVT+KLVQ+K+INCLLFVSK LDELQLDLH
Sbjct  318   DQSYN-ESLRSSWLQRKSKDTEVDVRIIDDEVTIKLVQRKKINCLLFVSKILDELQLDLH  376

Query  501   HVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTA  370
             HVAGG +GDYYSFLFN+KI EGS+VYASAIANKLIEVVD+ Y A
Sbjct  377   HVAGGHVGDYYSFLFNTKIYEGSSVYASAIANKLIEVVDRQYAA  420



>ref|XP_009784947.1| PREDICTED: transcription factor bHLH91-like isoform X3 [Nicotiana 
sylvestris]
Length=399

 Score =   318 bits (815),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 192/325 (59%), Positives = 227/325 (70%), Gaps = 40/325 (12%)
 Frame = -2

Query  1242  AADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDEREV  1063
              ADGAS ST +  PSL PLNLPP  PL+REL HS            + GSLF  +D  EV
Sbjct  92    TADGASTSTAIYGPSLFPLNLPPNSPLIRELVHS------------TFGSLFNGMDT-EV  138

Query  1062  NGAFYQTV-DGCRDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKK  886
             +G  YQ   +G   F+NG+FE + D + + K+R+ K  KHFA +RQ+RVHLNDKY+AL+ 
Sbjct  139   SGDLYQDAGEGKSRFDNGIFEFSADTSCMTKDRENKEIKHFAADRQKRVHLNDKYKALRS  198

Query  885   LVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG  706
             LVPNP+KNDRAS+V DAI YINELKRTV ELKILV+KK C R+R+KR K    S  M+  
Sbjct  199   LVPNPTKNDRASIVGDAIMYINELKRTVNELKILVDKKMCCRDRIKRQK----SGPMNSA  254

Query  705   DLKSVEDVDQS----------------YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKL  574
             D+K   +VD+S                   ++LRSSWLQRK+ NTEVDVRI+DDEVTVKL
Sbjct  255   DVKLRNEVDRSSLRSSWLQRKTTNTNEVDRSSLRSSWLQRKTTNTEVDVRIVDDEVTVKL  314

Query  573   VQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIE  394
             VQ KRINCLLFVSK LD+LQLDLHHVAGGLIGD YSFLFNSKICEGSTVYA AIANKLIE
Sbjct  315   VQPKRINCLLFVSKVLDDLQLDLHHVAGGLIGDCYSFLFNSKICEGSTVYAIAIANKLIE  374

Query  393   VVDKHYTAIAPTTSY*DGSHSMSDC  319
             +VD   T I+P  +    S  + DC
Sbjct  375   IVD---TEISPCNT---TSTPLQDC  393



>ref|XP_009784938.1| PREDICTED: transcription factor bHLH91-like isoform X1 [Nicotiana 
sylvestris]
Length=403

 Score =   318 bits (815),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 222/311 (71%), Gaps = 37/311 (12%)
 Frame = -2

Query  1242  AADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDEREV  1063
              ADGAS ST +  PSL PLNLPP  PL+REL HS            + GSLF  +D  EV
Sbjct  92    TADGASTSTAIYGPSLFPLNLPPNSPLIRELVHS------------TFGSLFNGMDT-EV  138

Query  1062  NGAFYQTV-DGCRDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKK  886
             +G  YQ   +G   F+NG+FE + D + + K+R+ K  KHFA +RQ+RVHLNDKY+AL+ 
Sbjct  139   SGDLYQDAGEGKSRFDNGIFEFSADTSCMTKDRENKEIKHFAADRQKRVHLNDKYKALRS  198

Query  885   LVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG  706
             LVPNP+KNDRAS+V DAI YINELKRTV ELKILV+KK C R+R+KR K    S  M+  
Sbjct  199   LVPNPTKNDRASIVGDAIMYINELKRTVNELKILVDKKMCCRDRIKRQK----SGPMNSA  254

Query  705   DLKSVEDVDQS----------------YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKL  574
             D+K   +VD+S                   ++LRSSWLQRK+ NTEVDVRI+DDEVTVKL
Sbjct  255   DVKLRNEVDRSSLRSSWLQRKTTNTNEVDRSSLRSSWLQRKTTNTEVDVRIVDDEVTVKL  314

Query  573   VQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIE  394
             VQ KRINCLLFVSK LD+LQLDLHHVAGGLIGD YSFLFNSKICEGSTVYA AIANKLIE
Sbjct  315   VQPKRINCLLFVSKVLDDLQLDLHHVAGGLIGDCYSFLFNSKICEGSTVYAIAIANKLIE  374

Query  393   VVDKHYTAIAP  361
             +VD   T I+P
Sbjct  375   IVD---TEISP  382



>ref|XP_009784940.1| PREDICTED: transcription factor bHLH91-like isoform X2 [Nicotiana 
sylvestris]
Length=401

 Score =   318 bits (815),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 222/311 (71%), Gaps = 37/311 (12%)
 Frame = -2

Query  1242  AADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDEREV  1063
              ADGAS ST +  PSL PLNLPP  PL+REL HS            + GSLF  +D  EV
Sbjct  92    TADGASTSTAIYGPSLFPLNLPPNSPLIRELVHS------------TFGSLFNGMDT-EV  138

Query  1062  NGAFYQTV-DGCRDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKK  886
             +G  YQ   +G   F+NG+FE + D + + K+R+ K  KHFA +RQ+RVHLNDKY+AL+ 
Sbjct  139   SGDLYQDAGEGKSRFDNGIFEFSADTSCMTKDRENKEIKHFAADRQKRVHLNDKYKALRS  198

Query  885   LVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG  706
             LVPNP+KNDRAS+V DAI YINELKRTV ELKILV+KK C R+R+KR K    S  M+  
Sbjct  199   LVPNPTKNDRASIVGDAIMYINELKRTVNELKILVDKKMCCRDRIKRQK----SGPMNSA  254

Query  705   DLKSVEDVDQS----------------YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKL  574
             D+K   +VD+S                   ++LRSSWLQRK+ NTEVDVRI+DDEVTVKL
Sbjct  255   DVKLRNEVDRSSLRSSWLQRKTTNTNEVDRSSLRSSWLQRKTTNTEVDVRIVDDEVTVKL  314

Query  573   VQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIE  394
             VQ KRINCLLFVSK LD+LQLDLHHVAGGLIGD YSFLFNSKICEGSTVYA AIANKLIE
Sbjct  315   VQPKRINCLLFVSKVLDDLQLDLHHVAGGLIGDCYSFLFNSKICEGSTVYAIAIANKLIE  374

Query  393   VVDKHYTAIAP  361
             +VD   T I+P
Sbjct  375   IVD---TEISP  382



>ref|XP_007008755.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007008756.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY17565.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY17566.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=430

 Score =   317 bits (813),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 205/388 (53%), Positives = 246/388 (63%), Gaps = 56/388 (14%)
 Frame = -2

Query  1485  PHFMQKLGHENQGLSNWE--ELGFSHQPQSFQIPMPETPCPPAPDLLNMfplprcspssl  1312
             P   Q+L ++    SNW+  +  F+  P S     PE   P  PDLLN+F LPRCS    
Sbjct  86    PQLTQELSYDQ---SNWDADQQSFNMVPSSSS---PEAAYPATPDLLNLFHLPRCSF---  136

Query  1311  lpnpsfsstfltslglfGDLPSSAA--DGASPSTVVCDpsllplnlppqpplLRELFHSL  1138
                                LP+S+   + A  S+VV DP       P  P   REL  SL
Sbjct  137   -------------------LPNSSISFESAPASSVVYDPLFHLNLPPQPPVF-RELLQSL  176

Query  1137  PQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVLA----KN  970
             P G Y   A           D+RE +G      DG    +NG+ E    +++      +N
Sbjct  177   PHG-YTLPA-----------DDREASGGGGLYHDG----DNGILEFNRGISMAGHGKGRN  220

Query  969   RDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELK  790
             R GK TKHFATER+RRVHLNDKY+AL+ +VPNPSK DRAS+V DAI YI EL RTV ELK
Sbjct  221   RAGKTTKHFATERERRVHLNDKYKALRNMVPNPSKTDRASIVGDAINYIKELVRTVNELK  280

Query  789   ILVEKKRCSRERMKRHKTEGCSSMMDGGDL--KSVEDVDQSYSGTTLRSSWLQRKSKNTE  616
             +LVEKKRC + R KR KTE   S  D GD+  K + D DQ Y+ ++LRSSWLQRKSK+TE
Sbjct  281   LLVEKKRCGQGRSKRLKTEDAGSAADAGDVECKPLGDPDQCYN-SSLRSSWLQRKSKDTE  339

Query  615   VDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEG  436
             VDVRIIDDEVT+KLVQ+K+INCLLFVS+ LDELQLDLHHVAGG +GDYYSFLFN+KI EG
Sbjct  340   VDVRIIDDEVTIKLVQRKKINCLLFVSRLLDELQLDLHHVAGGHVGDYYSFLFNTKIYEG  399

Query  435   STVYASAIANKLIEVVDKHYTAIAPTTS  352
             S+VYASAIANKLIE VD+ Y A  PT+S
Sbjct  400   SSVYASAIANKLIEGVDRQYAAAPPTSS  427



>gb|KHG22101.1| Transcription factor bHLH91 -like protein [Gossypium arboreum]
Length=425

 Score =   315 bits (808),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 197/366 (54%), Positives = 237/366 (65%), Gaps = 59/366 (16%)
 Frame = -2

Query  1407  QSFQIPM----PETPCPPAPDLLNMfplprcspssllpnpsfsstfltslglfGDLPSSA  1240
             QSF + +    P+   PP PDLLN+F LP                          LP+S+
Sbjct  101   QSFNMLLSSSSPKAAYPPTPDLLNLFHLPPKCSF---------------------LPNSS  139

Query  1239  A--DGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDERE  1066
                + AS S+VVCDP       P  P   REL  SLP G Y   A           DE+E
Sbjct  140   ISFESASASSVVCDPLFHLNLTPQPPVF-RELLQSLPHG-YTLPA-----------DEKE  186

Query  1065  VNGAFYQTVDGCRDFENGVFELTGDMNVLA--KNRD--GKGTKHFATERQRRVHLNDKYE  898
             +            D +NG+ E T D++++A  K RD  GK TKHFATER+RRVHLNDK++
Sbjct  187   LY----------HDGDNGILEFTRDISMVAHSKGRDKAGKTTKHFATERERRVHLNDKFQ  236

Query  897   ALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSM  718
             AL+ +VP+P+KNDRAS+V DAI YI EL RTV ELK++VEKKRC ++R KR KTE  ++ 
Sbjct  237   ALRTMVPSPTKNDRASIVGDAIDYIKELLRTVRELKLVVEKKRCGQDRSKRLKTEETATA  296

Query  717   MDGGD----LKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINC  550
              D GD    L  + D DQ Y+ T LRSSWLQRKSKN+EVDVR+IDDEVT+KLVQ+K+INC
Sbjct  297   ADAGDGECKLLGLGDPDQCYN-TCLRSSWLQRKSKNSEVDVRVIDDEVTIKLVQRKKINC  355

Query  549   LLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTA  370
             LLFVS+ LDELQLDLHHVAGG IGDYYSFLFN+KI EGS+VYASAIAN LI VVDK   A
Sbjct  356   LLFVSRLLDELQLDLHHVAGGNIGDYYSFLFNTKIYEGSSVYASAIANNLINVVDKQDAA  415

Query  369   IAPTTS  352
              AP TS
Sbjct  416   AAPPTS  421



>ref|XP_010278769.1| PREDICTED: transcription factor bHLH91-like [Nelumbo nucifera]
Length=518

 Score =   317 bits (813),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 172/270 (64%), Positives = 201/270 (74%), Gaps = 8/270 (3%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVL  979
             RELFHSLPQ  Y F  SR+  S FG + EREV G  YQ  DG R FEN V +   +M+ L
Sbjct  250   RELFHSLPQN-YSFPGSRND-SFFGGLGEREVAGGVYQDGDG-RQFENPVLDFRREMSCL  306

Query  978   AKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVG  799
                 + KG  HFATERQRR  LN+K++AL+ LVPNP+K DRAS+V DAI YI EL RTV 
Sbjct  307   GNGGEAKGANHFATERQRREQLNEKFKALRLLVPNPTKADRASIVGDAIDYIKELLRTVD  366

Query  798   ELKILVEKKRCSRERMKRHKTE--GCSSMMDGG--DLKSVEDVDQSYSGTTLRSSWLQRK  631
             ELK+LV+KKR  R   K+ KTE  G   M       L +V D +QS++G+ LRSSWLQRK
Sbjct  367   ELKVLVDKKRSGRRGNKKLKTENEGAGDMESSSVKPLGTVTDKEQSFNGS-LRSSWLQRK  425

Query  630   SKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNS  451
             SK+TEVDVRIIDDEVT+KL+Q+KR+NCLLFVSK LDELQLDL HVAGG IGDYYSFLFN+
Sbjct  426   SKDTEVDVRIIDDEVTIKLIQRKRMNCLLFVSKTLDELQLDLLHVAGGNIGDYYSFLFNT  485

Query  450   KICEGSTVYASAIANKLIEVVDKHYTAIAP  361
             KI EGS+VYASAIA KLIEVVD+ Y A+ P
Sbjct  486   KIYEGSSVYASAIAKKLIEVVDRQYAALPP  515



>ref|XP_004173553.1| PREDICTED: transcription factor bHLH91-like [Cucumis sativus]
Length=412

 Score =   309 bits (791),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 216/409 (53%), Positives = 261/409 (64%), Gaps = 43/409 (11%)
 Frame = -2

Query  1485  PHFMQKLGHENQGL-----SNW-----EELGFSH---QPQSFQIPMPETPCPPAPDLLN-  1348
             P F Q+L  ++  +     SNW     +E+GF+H   Q Q     +P TP    PDLLN 
Sbjct  14    PGFDQELTSDSNPMLCLDQSNWVGTQIQEMGFNHNHVQSQFSDSAIPPTPYTQPPDLLNF  73

Query  1347  MfplprcspssllpnpsfsstfltslglfGDLPSS-AADGASPSTVVCDpsllplnlppq  1171
             +   P    S+       +          GDLP   A + +S S  +    L  LNLPPQ
Sbjct  74    LNMPPTARCSNNSSISFSNLHTPAMGAFLGDLPPGDAPNSSSTSLSILYDPLFHLNLPPQ  133

Query  1170  pplLRELFHSLPQGGYGFGASRS---SGSLF---GEVDEREVNGAFYQTVDGCRDFENGV  1009
             PPL RELFHSLP G YG  A+ S    GSLF    E+ ERE     Y+  DG     +GV
Sbjct  134   PPLFRELFHSLPHG-YGMPAASSRGRGGSLFPEGSEIVEREGTAGVYEDGDG-----SGV  187

Query  1008  FELTGDM-NVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
              E + DM + + K RDGK TKHFATERQRRV LNDKY+AL+ LVP P+KNDRAS+V DAI
Sbjct  188   LEFSRDMADCIGKRRDGKMTKHFATERQRRVQLNDKYKALRSLVPIPTKNDRASIVGDAI  247

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG-----DLKSVEDV--DQS  673
              YI EL R V ELK+LVEKKR SRER KR +T     +  GG     + K  E V  DQ 
Sbjct  248   NYIQELLREVKELKLLVEKKRSSRERSKRVRT--AEEIEQGGGSESSNAKGGEGVVEDQR  305

Query  672   YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
             Y+   LRSSWLQRK+K+TEVDVRI+DDEVTVKLVQ+K +NCLL VSK L++LQLDLHHVA
Sbjct  306   YN---LRSSWLQRKTKDTEVDVRIVDDEVTVKLVQRK-LNCLLLVSKLLEDLQLDLHHVA  361

Query  492   GGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHY--TAIAPTTS  352
             GG IGDYYSFLFN+KI EGS+VYASAIANK++E VD+ Y  T+I+P T+
Sbjct  362   GGHIGDYYSFLFNTKIYEGSSVYASAIANKVMEAVDRQYNNTSISPLTN  410



>ref|XP_002323376.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEF05137.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=467

 Score =   310 bits (795),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 174/278 (63%), Positives = 198/278 (71%), Gaps = 20/278 (7%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFG------EVDEREVNGAFYQTVDGCRDFENGVFELT  997
             REL  SLP  GY          LFG       VD +   G  YQ  DG  D  +GVFE T
Sbjct  193   RELVQSLPPHGYTLPTP-----LFGGGQGDDHVDGQSGGGLSYQ--DG--DHGDGVFEFT  243

Query  996   GDMNVLAK--NRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYI  823
              +M  + K   + GK TKHFATERQRR HLN KY AL+ LVPNPSKNDRASVV +AI YI
Sbjct  244   DEMACIGKGIKKTGKVTKHFATERQRREHLNGKYTALRNLVPNPSKNDRASVVGEAIDYI  303

Query  822   NELKRTVGELKILVEKKRCSRERMKRHKTE--GCSSMMDGGDLKSVEDVDQSYSGTTLRS  649
              EL RTV ELK+LVEKKRC RER K  KTE  G   ++D  D+K VE    +YS  +LRS
Sbjct  304   KELLRTVQELKLLVEKKRCGRERSKWRKTEDDGGVEVLDNSDIK-VEPDQSAYSNGSLRS  362

Query  648   SWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYY  469
             SWLQRKSK+TEVDVR+I+DEVT+KLVQ+KR+NCLL+VSK LDELQLDLHH AGGLIGDYY
Sbjct  363   SWLQRKSKDTEVDVRLIEDEVTIKLVQRKRVNCLLYVSKVLDELQLDLHHAAGGLIGDYY  422

Query  468   SFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTT  355
             SFLFN+KI EGS VYASAIAN+LIEVVD+ Y +   T 
Sbjct  423   SFLFNTKINEGSCVYASAIANRLIEVVDRQYASSTTTV  460



>ref|XP_004139000.1| PREDICTED: transcription factor bHLH91-like [Cucumis sativus]
Length=480

 Score =   308 bits (790),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 216/409 (53%), Positives = 259/409 (63%), Gaps = 43/409 (11%)
 Frame = -2

Query  1485  PHFMQKLGHENQGL-----SNW-----EELGFSH---QPQSFQIPMPETPCPPAPDLLN-  1348
             P F Q+L  ++  +     SNW     +E+GF+H   Q Q     +P TP    PDLLN 
Sbjct  82    PGFDQELTSDSNPMLCLDQSNWVGTQIQEMGFNHNHVQSQFSDSAIPPTPYTQPPDLLNF  141

Query  1347  MfplprcspssllpnpsfsstfltslglfGDLPSS-AADGASPSTVVCDpsllplnlppq  1171
             +   P    S+       +          GDLP   A + +S S  +    L  LNLPPQ
Sbjct  142   LNMPPTARCSNNSSISFSNLHTPAMGAFLGDLPPGDAPNSSSTSLSILYDPLFHLNLPPQ  201

Query  1170  pplLRELFHSLPQGGYGFGASRS---SGSLF---GEVDEREVNGAFYQTVDGCRDFENGV  1009
             PPL RELFHSLP G YG  A+ S    GSLF    E+ ERE     Y+  DG     +GV
Sbjct  202   PPLFRELFHSLPHG-YGMPAASSRGRGGSLFPEGSEIVEREGTAGVYEDGDG-----SGV  255

Query  1008  FELTGDM-NVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
              E + DM + + K RDGK TKHFATERQRRV LNDKY+AL+ LVP P+KNDRAS+V DAI
Sbjct  256   LEFSRDMADCIGKRRDGKMTKHFATERQRRVQLNDKYKALRSLVPIPTKNDRASIVGDAI  315

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRHKTE-------GCSSMMDGGDLKSVEDVDQS  673
              YI EL R V ELK+LVEKKR SRER KR +T        G  S    G    VE  DQ 
Sbjct  316   NYIQELLREVKELKLLVEKKRSSRERSKRVRTAEEIEQGGGSESSNAKGGEGVVE--DQR  373

Query  672   YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
             Y+   LRSSWLQRK+K+TEVDVRI+DDEVTVKLVQ+K +NCLL VSK L++LQLDLHHVA
Sbjct  374   YN---LRSSWLQRKTKDTEVDVRIVDDEVTVKLVQRK-LNCLLLVSKLLEDLQLDLHHVA  429

Query  492   GGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHY--TAIAPTTS  352
             GG IGDYYSFLFN+KI EGS+VYASAIANK++E VD+ Y  T+I+P T+
Sbjct  430   GGHIGDYYSFLFNTKIYEGSSVYASAIANKVMEAVDRQYNNTSISPLTN  478



>ref|XP_004308623.1| PREDICTED: transcription factor bHLH91-like [Fragaria vesca subsp. 
vesca]
Length=465

 Score =   308 bits (788),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 173/282 (61%), Positives = 200/282 (71%), Gaps = 29/282 (10%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFG----EVDEREVNGAFYQTVDGCRD-FENGVFELTG  994
             REL  SLP G       R+  SLF     EVD            DG R  FENGV E + 
Sbjct  201   RELLQSLPHG-----YKRNGSSLFSNGGDEVD------------DGSRQLFENGVLEFSK  243

Query  993   DMNVLAKNRDG-KGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINE  817
             +M    + R G KGTKHFATERQRRV LNDK+ AL++LVPNP+K DRASVV DAI YI E
Sbjct  244   EMKPFGRGRGGNKGTKHFATERQRRVQLNDKFSALRELVPNPTKPDRASVVGDAIDYIQE  303

Query  816   LKRTVGELKILVEKKRCSRERMKRHKTE---GCSSMMDGGDLKSV--EDVDQSYSGTTLR  652
             LKRTV ELK+LVEKKRC RER KRHKTE   G     +  ++K +   D D SY+  +LR
Sbjct  304   LKRTVSELKLLVEKKRCGRERSKRHKTEQDIGARDDDESCNMKPLGDPDHDHSYNNGSLR  363

Query  651   SSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDY  472
             SSWLQRKSK+TEVDVRIIDDEVT+KLVQ+K+IN LL VSK LDELQL+LHH AGG IG+ 
Sbjct  364   SSWLQRKSKDTEVDVRIIDDEVTIKLVQRKKINLLLSVSKLLDELQLELHHAAGGHIGNS  423

Query  471   YSFLFNSKICEGSTVYASAIANKLIEVVDKHY-TAIAPTTSY  349
             YSFLFN+K+ EGS++YASAIANKLI+ VD+ Y  AI PT SY
Sbjct  424   YSFLFNTKMYEGSSLYASAIANKLIDTVDRQYAAAIPPTNSY  465



>ref|XP_011042573.1| PREDICTED: transcription factor bHLH91-like [Populus euphratica]
Length=467

 Score =   307 bits (787),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 170/277 (61%), Positives = 199/277 (72%), Gaps = 18/277 (6%)
 Frame = -2

Query  1158  RELFHSLPQGGYG-----FGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTG  994
             REL  SLP  GY      FG  +    + G++      G  YQ  DG  D  +G+FE T 
Sbjct  193   RELVQSLPPQGYTLPTPLFGGGQGDDHVDGQIG----GGLSYQ--DG--DHGDGIFEFTD  244

Query  993   DMNVLAK--NRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYIN  820
             +M  + K   + GK TKHFATERQRR HLN KY AL+ LVPNPSKNDRASVV +AI YI 
Sbjct  245   EMACIGKGIRKTGKVTKHFATERQRREHLNGKYTALRNLVPNPSKNDRASVVGEAIDYIK  304

Query  819   ELKRTVGELKILVEKKRCSRERMKRHKTE--GCSSMMDGGDLKSVEDVDQSYSGTTLRSS  646
             EL RTV ELK+LVEKKRC RER K  KTE  G   ++D  ++K VE    +YS  +LRSS
Sbjct  305   ELLRTVQELKLLVEKKRCGRERSKWRKTEEDGGVDVLDNSNIK-VEPDQSAYSNGSLRSS  363

Query  645   WLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYS  466
             WLQRKSK+TEVDVR+I+DEVT+KLVQ+KR+NCLL+VSK LDELQLDLHH AGGLIGDYYS
Sbjct  364   WLQRKSKDTEVDVRLIEDEVTIKLVQRKRVNCLLYVSKVLDELQLDLHHAAGGLIGDYYS  423

Query  465   FLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTT  355
             FLFN+KI EGS VYASA+ANKLIEVVD+ Y +   T 
Sbjct  424   FLFNTKINEGSCVYASAVANKLIEVVDRQYASSTTTV  460



>ref|XP_008345255.1| PREDICTED: transcription factor bHLH10-like [Malus domestica]
 ref|XP_008354804.1| PREDICTED: transcription factor bHLH10-like [Malus domestica]
Length=411

 Score =   304 bits (778),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 203/366 (55%), Positives = 244/366 (67%), Gaps = 19/366 (5%)
 Frame = -2

Query  1407  QSFQIPMPETPCPPAPDLLNMfplprcspssllpnpsfsstfltslglfG-----DLPSS  1243
             Q F      TP P  PDLLN+F LPRCSPSSLL N S + T              DLPS+
Sbjct  52    QQFPDGTTSTPYPQPPDLLNLFSLPRCSPSSLLQNSSITFTNTLPKTSTSFGFLGDLPSA  111

Query  1242  AADGASPSTVVCDpsllplnlppqpplLRELFHSLPQG----GYGFGASRSSGSLFGEVD  1075
                    ++ V    LL LNLPPQPP+ REL  SLP G    G G G+  SSG      D
Sbjct  112   VDTPLGTASSVLYDPLLHLNLPPQPPMFRELLQSLPHGYTLPGSGNGSLFSSGG-----D  166

Query  1074  EREVNGAF----YQTVDGCRDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLND  907
             ERE +G      + T++G   FENGV E + +M  + + R+ KG+KH A +R RR  LND
Sbjct  167   EREGSGGGIYPDHGTINGSI-FENGVMEFSREMGSIGRGRNLKGSKHLAIDRGRRQQLND  225

Query  906   KYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGC  727
             K+  L+ L+PNP+KNDRAS+V DAIGYINEL RTV ELK+LVEKKRC  ER KRHKTE  
Sbjct  226   KFFTLRSLIPNPTKNDRASIVGDAIGYINELLRTVDELKLLVEKKRCGTERSKRHKTEQD  285

Query  726   SSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCL  547
                 D       E  DQSY+  +LRSSWLQRKSK+TEVD+RII DEVT+KLVQ+K+IN L
Sbjct  286   GGAGDENCNAKSEPHDQSYNNGSLRSSWLQRKSKDTEVDIRIIHDEVTIKLVQRKKINLL  345

Query  546   LFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
             L VS+ LDELQLDLHHVAGG IG+ YSFLFN+K+ EGS +YASAIA K IEV+D+ Y+A+
Sbjct  346   LSVSRLLDELQLDLHHVAGGHIGNSYSFLFNTKMYEGSCLYASAIAGKFIEVLDRQYSAV  405

Query  366   APTTSY  349
              PT+SY
Sbjct  406   PPTSSY  411



>ref|XP_002308327.2| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE91850.2| basic helix-loop-helix family protein [Populus trichocarpa]
Length=462

 Score =   305 bits (780),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 169/268 (63%), Positives = 195/268 (73%), Gaps = 10/268 (4%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGE-VDEREVNGAFYQTVDGCRDFENGVFELTGDMNV  982
             REL HSLP  GYG  A    G   G+ VD     G  YQ  DG     +GVFE T +M  
Sbjct  191   RELVHSLPPHGYGLPAPLFGGGQGGDHVDGLSGGGLSYQ--DGGHG--DGVFEFTAEMAC  246

Query  981   LAK--NRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKR  808
             + K   + GK TKHFATERQRR HLN KY AL+ LVPNPSKNDRASVV DAI YI EL R
Sbjct  247   IGKGIRKSGKVTKHFATERQRREHLNGKYTALRNLVPNPSKNDRASVVGDAINYIKELLR  306

Query  807   TVGELKILVEKKRCSRERMKRHKTE--GCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQR  634
             TV ELK+LVEKKR  RER+KR K E  G   +++  + K VE    +Y+  +LRSSWLQR
Sbjct  307   TVEELKLLVEKKRNGRERIKRRKPEEDGGVDVLENSNTK-VEQDQSTYNNGSLRSSWLQR  365

Query  633   KSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFN  454
             KSK+TEVDVR+I+DEVT+KLVQ+K++NCLL VSK LDELQLDLHH AGGLIGDYYSFLFN
Sbjct  366   KSKHTEVDVRLIEDEVTIKLVQRKKVNCLLSVSKVLDELQLDLHHAAGGLIGDYYSFLFN  425

Query  453   SKICEGSTVYASAIANKLIEVVDKHYTA  370
             +KI EGS VYAS IANKL+EVVD+ Y +
Sbjct  426   TKINEGSCVYASGIANKLLEVVDRQYAS  453



>ref|XP_009373826.1| PREDICTED: transcription factor bHLH10-like [Pyrus x bretschneideri]
 ref|XP_009373851.1| PREDICTED: transcription factor bHLH10-like [Pyrus x bretschneideri]
Length=415

 Score =   299 bits (766),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/279 (59%), Positives = 200/279 (72%), Gaps = 15/279 (5%)
 Frame = -2

Query  1158  RELFHSLPQG----GYGFGASRSSGSLFGEVDEREVNGAF----YQTVDGCRDFENGVFE  1003
             REL  SLP G    G G G+  SSG      DERE +G      + T++G   FENGV E
Sbjct  143   RELHQSLPHGYTLPGSGNGSLFSSGG-----DEREGSGGGIYPDHGTINGSI-FENGVME  196

Query  1002  LTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYI  823
              + +M  + + R+ KG+KH A +R RR  LNDK+  L+ L+PNP+KNDRAS+V DAIGYI
Sbjct  197   FSREMGSIGRGRNLKGSKHLAIDRGRRQQLNDKFFTLRSLIPNPTKNDRASIVGDAIGYI  256

Query  822   NELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLK-SVEDVDQSYSGTTLRSS  646
             NEL RTV ELK+LVEKKR  RER KRHKTE      D  +     E  DQSY+  +LRSS
Sbjct  257   NELLRTVDELKLLVEKKRRGRERSKRHKTEQDGGAGDDENCNVKFEPRDQSYNNGSLRSS  316

Query  645   WLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYS  466
             WLQRKSK+TEVD+RII DEVT+KLVQ+K+IN LL VS+ LDELQLDLHHVAGG IG+ YS
Sbjct  317   WLQRKSKDTEVDIRIIHDEVTIKLVQKKKINLLLSVSRLLDELQLDLHHVAGGHIGNSYS  376

Query  465   FLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             FLFN+K+ EGS +YASAIA K IEV+D+ Y+A+ PT+SY
Sbjct  377   FLFNTKMYEGSCLYASAIAGKFIEVLDRQYSAVPPTSSY  415



>ref|XP_011046432.1| PREDICTED: transcription factor bHLH91-like [Populus euphratica]
Length=463

 Score =   301 bits (771),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 173/279 (62%), Positives = 199/279 (71%), Gaps = 13/279 (5%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGE-VDEREVNGAFYQTVDGCRDFENGVFELTGDMNV  982
             REL HSLP  GYG  A    G   G+ VD     G  YQ  DG     +GVFE T +M  
Sbjct  192   RELVHSLPPHGYGLPAPLFGGGQGGDHVDGLSGGGLSYQ--DGGHG--DGVFEFTAEMAC  247

Query  981   LAK--NRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKR  808
             + K   + GK TKHFATERQRR HLN KY AL+ LVPNPSKNDRASVV DAI YI EL R
Sbjct  248   IGKGIRKSGKVTKHFATERQRREHLNGKYTALRNLVPNPSKNDRASVVGDAINYIKELLR  307

Query  807   TVGELKILVEKKRCSRERMKRHKTE--GCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQR  634
             TV ELK+LVEK+R  RER+KR KTE  G   +++  + K VE     Y+  +LRSSWLQR
Sbjct  308   TVEELKLLVEKRRNGRERIKRRKTEEDGGVDVLENSNTK-VEQDQSRYNNGSLRSSWLQR  366

Query  633   KSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFN  454
             KSK+TEVDVR+I+DEVT+KLVQ+K++NCLL VSK LDELQLDLHH AGGLIGDYYSFLFN
Sbjct  367   KSKHTEVDVRLIEDEVTIKLVQRKKVNCLLSVSKVLDELQLDLHHAAGGLIGDYYSFLFN  426

Query  453   SKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY*DGS  337
             +KI EGS VYAS IANKL+EVVD  +   A +TS   GS
Sbjct  427   TKINEGSCVYASGIANKLLEVVDGQH---ASSTSVPAGS  462



>gb|KGN61423.1| hypothetical protein Csa_2G120400 [Cucumis sativus]
Length=495

 Score =   302 bits (773),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 215/422 (51%), Positives = 262/422 (62%), Gaps = 54/422 (13%)
 Frame = -2

Query  1485  PHFMQKLGHENQGL-----SNW-----EELGFSH---QPQSFQIPMPETPCPPAPDLLN-  1348
             P F Q+L  ++  +     SNW     +E+GF+H   Q Q     +P TP    PDLLN 
Sbjct  82    PGFDQELTSDSNPMLCLDQSNWVGTQIQEMGFNHNHVQSQFSDSAIPPTPYTQPPDLLNF  141

Query  1347  MfplprcspssllpnpsfsstfltslglfGDLPSS-AADGASPSTVVCDpsllplnlppq  1171
             +   P    S+       +          GDLP   A + +S S  +    L  LNLPPQ
Sbjct  142   LNMPPTARCSNNSSISFSNLHTPAMGAFLGDLPPGDAPNSSSTSLSILYDPLFHLNLPPQ  201

Query  1170  pplLRELFHSLPQGGYGFGASRS---SGSLF---GEVDEREVNGAFYQTVDGCRDFENGV  1009
             PPL RELFHSLP G YG  A+ S    GSLF    E+ ERE     Y+  DG     +GV
Sbjct  202   PPLFRELFHSLPHG-YGMPAASSRGRGGSLFPEGSEIVEREGTAGVYEDGDG-----SGV  255

Query  1008  FELTGDM-NVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
              E + DM + + K RDGK TKHFATERQRRV LNDKY+AL+ LVP P+KNDRAS+V DAI
Sbjct  256   LEFSRDMADCIGKRRDGKMTKHFATERQRRVQLNDKYKALRSLVPIPTKNDRASIVGDAI  315

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRHKT------------------EGCSSMMDGG  706
              YI EL R V ELK+LVEKKR SRER KR +T                   G +  ++  
Sbjct  316   NYIQELLREVKELKLLVEKKRSSRERSKRVRTAEEIEQGGGSGGGGGGGGGGGAWDVESS  375

Query  705   DLKSVEDV--DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSK  532
             + K  E V  DQ Y+   LRSSWLQRK+K+TEVDVRI+DDEVTVKLVQ+K +NCLL VSK
Sbjct  376   NAKGGEGVVEDQRYN---LRSSWLQRKTKDTEVDVRIVDDEVTVKLVQRK-LNCLLLVSK  431

Query  531   ALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHY--TAIAPT  358
              L++LQLDLHHVAGG IGDYYSFLFN+KI EGS+VYASAIANK++E VD+ Y  T+I+P 
Sbjct  432   LLEDLQLDLHHVAGGHIGDYYSFLFNTKIYEGSSVYASAIANKVMEAVDRQYNNTSISPL  491

Query  357   TS  352
             T+
Sbjct  492   TN  493



>ref|XP_009373855.1| PREDICTED: transcription factor bHLH91-like [Pyrus x bretschneideri]
 ref|XP_009373874.1| PREDICTED: transcription factor bHLH91-like [Pyrus x bretschneideri]
Length=512

 Score =   301 bits (772),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 219/315 (70%), Gaps = 15/315 (5%)
 Frame = -2

Query  1257  DLPSSA-ADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGE  1081
             DLPS+      +PS+V+ DP L     P  P   REL  SLP G Y    S  +GSLFG 
Sbjct  201   DLPSAVDTPQGTPSSVLYDPLLHLNLPPQPPLF-RELLQSLPHG-YTLPGS-GNGSLFGS  257

Query  1080  V-DERE-VNGAFYQTVDGC--RDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHL  913
               D+RE   G      DG   R F++GV + + DM      RD K TKHFATERQRR  L
Sbjct  258   GGDDREGSGGGVLYDPDGSLGRQFDSGVLKFSRDMASNGIGRDLKRTKHFATERQRRQQL  317

Query  912   NDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTE  733
             N K++ LK LVPNP+KNDRAS+V DAI YINEL RTV ELK+LVEKKRC RER+KRHKTE
Sbjct  318   NGKFDILKNLVPNPTKNDRASIVGDAIEYINELLRTVEELKLLVEKKRCGRERIKRHKTE  377

Query  732   ----GCSSMMDGGDLKSV-EDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQ  568
                   ++  +  +++ + E  DQSY+  +LRSSWLQRKSK+TEVD+RIIDDEVT+KLVQ
Sbjct  378   HDGAAAAADDESCNIQPLGEPHDQSYNNGSLRSSWLQRKSKDTEVDIRIIDDEVTIKLVQ  437

Query  567   QKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVV  388
             +K+IN LLFVS+ LDELQLDLHHVAGG IG+ YSF FN+K+ EGS +YASAIA KLIEV+
Sbjct  438   RKKINLLLFVSRLLDELQLDLHHVAGGHIGNSYSFFFNTKMYEGSCLYASAIAGKLIEVL  497

Query  387   DKHYTA--IAPTTSY  349
             D  Y A  + PT SY
Sbjct  498   DGQYAAAVLPPTNSY  512



>ref|XP_008457164.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH91-like 
[Cucumis melo]
Length=497

 Score =   297 bits (761),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 208/403 (52%), Positives = 251/403 (62%), Gaps = 49/403 (12%)
 Frame = -2

Query  1443  SNW-----EELGFSH---QPQSFQIPMPETPCPPAPDLLN-Mfplprcspssllpnpsfs  1291
             SNW     +E+GF+H   Q Q     +P TP    PDLLN +   P    S+       +
Sbjct  103   SNWVGTQIQEMGFNHNHIQSQFSDSAIPPTPYTQPPDLLNFLNMPPTARCSNNSSISFSN  162

Query  1290  stfltslglfGDLPSS-AADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFG  1114
                       GDLP     + +S S  +    L  LNLPPQPPL RELFHSLP G YG  
Sbjct  163   LHTSAMGAFLGDLPPGDTPNSSSTSLSILYDPLFHLNLPPQPPLFRELFHSLPHG-YGMP  221

Query  1113  ASRSSG-----SLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDM-NVLAKNRDGKGT  952
             A+ S G     S   E+ ERE     Y+  DG     +GV E + DM + + K RDGK T
Sbjct  222   AASSRGRGGVCSEGSEIVEREGTAGVYEDGDG-----SGVLEFSRDMADCIGKRRDGKMT  276

Query  951   KHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKK  772
             KHFATERQRRV LNDKY+AL+ LVP P+KNDRAS+V DAI YI EL R V ELK+LVEKK
Sbjct  277   KHFATERQRRVQLNDKYKALRSLVPIPTKNDRASIVGDAINYIQELLREVKELKLLVEKK  336

Query  771   RCSRERMKRHKT-------------------EGCSSMMDGGDLKSVEDV--DQSYSGTTL  655
             R SRER KR +T                    G +  ++  + K  E V  DQ Y+   L
Sbjct  337   RSSRERSKRVRTAEEIEQGGGGGGGGGGGGSGGGAWDVESSNAKGGEGVVEDQRYN---L  393

Query  654   RSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
             RSSWLQRK+K+TEVDVRI+DDEVTVKLVQ+K +NCLL VSK L++LQLDLHHVAGG IGD
Sbjct  394   RSSWLQRKTKDTEVDVRIVDDEVTVKLVQRK-LNCLLLVSKLLEDLQLDLHHVAGGHIGD  452

Query  474   YYSFLFNSKICEGSTVYASAIANKLIEVVDKHY--TAIAPTTS  352
             YYSFLFN+KI EGS+VYASAIANK++E VD+ Y  T+I+P T+
Sbjct  453   YYSFLFNTKIYEGSSVYASAIANKVMEAVDRQYNNTSISPLTN  495



>ref|XP_010243136.1| PREDICTED: transcription factor bHLH91-like [Nelumbo nucifera]
 ref|XP_010243137.1| PREDICTED: transcription factor bHLH91-like [Nelumbo nucifera]
 ref|XP_010243138.1| PREDICTED: transcription factor bHLH91-like [Nelumbo nucifera]
 ref|XP_010243139.1| PREDICTED: transcription factor bHLH91-like [Nelumbo nucifera]
Length=507

 Score =   296 bits (759),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 221/304 (73%), Gaps = 11/304 (4%)
 Frame = -2

Query  1257  DLPSSAADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEV  1078
             +LP++  DG   +T + D   L LNLPPQPPL RELFH LPQ  Y    SR      G +
Sbjct  209   ELPTT--DGTVAATSLYDHPPLHLNLPPQPPLFRELFH-LPQN-YNLPGSRGGSFF-GGL  263

Query  1077  DEREVNGAFYQTVDGCRDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYE  898
             DEREV+   YQ  D  R FEN V +   +MN L K  + +G  HFATERQRR  LN+K++
Sbjct  264   DEREVSCGVYQDGDD-RQFENSVLDFRREMNGLGKGGEARGAHHFATERQRREQLNEKFK  322

Query  897   ALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEG-CSS  721
             AL+ LVPNP+K DRAS+V DAI YI EL RTV ELKILVEKKRC R   K+ KT+   + 
Sbjct  323   ALRLLVPNPTKADRASIVGDAIDYIKELLRTVDELKILVEKKRCGRGGSKKLKTDDEAAG  382

Query  720   MMDGGDLK---SVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINC  550
              M+G  +K   ++ D +QS++G+ LRSSWLQRKSK+TEVDVRIIDDEVT+KL+Q+K++NC
Sbjct  383   DMEGSSMKKHGTLTDREQSFNGS-LRSSWLQRKSKDTEVDVRIIDDEVTIKLIQRKKVNC  441

Query  549   LLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTA  370
             LL VSK LDELQLDL HVAGG IGDYYSFLFN+KI EGS+VYASAIA KLIEVVD+ + A
Sbjct  442   LLVVSKILDELQLDLLHVAGGNIGDYYSFLFNTKIYEGSSVYASAIAKKLIEVVDRQHAA  501

Query  369   IAPT  358
               P+
Sbjct  502   FPPS  505



>ref|XP_009623788.1| PREDICTED: transcription factor bHLH91-like [Nicotiana tomentosiformis]
Length=432

 Score =   293 bits (751),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 158/273 (58%), Positives = 195/273 (71%), Gaps = 34/273 (12%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGE-VDEREVNGAFYQTVDGCRDFENGVFELTGDMNV  982
             +ELF   P G YG G+S  +GS F   V E EV GA Y         + G F    D+N 
Sbjct  185   KELFQLSPHGSYGLGSS-GTGSFFSHGVAEEEVTGALYH--------DAGSF----DINY  231

Query  981   LAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV  802
              AK R+GK  KH A+E+QRRVH +DK++AL+ L+PNPSKNDRA+++ DAIGYIN LK  V
Sbjct  232   AAKKREGKDIKHHASEKQRRVHFSDKFQALRALIPNPSKNDRATIIADAIGYINMLKTKV  291

Query  801   GELKILVEKKRCSRERMKRHKTE----GCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQR  634
              ELK  VEKK    ER+KR +TE    G +++M+  +           +   +RSSWLQ+
Sbjct  292   NELKNEVEKK----ERVKRQRTEDGSCGFNTVMEAAE-----------NHVNMRSSWLQK  336

Query  633   KSKNTEVDVRIIDDEVTVKLVQQ-KRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLF  457
             KSKNTEVDVRI+DDEVTVKLVQQ KR+NCLLFVSKA DE QLD+HHV+GGLIGD+YS+LF
Sbjct  337   KSKNTEVDVRIMDDEVTVKLVQQQKRMNCLLFVSKAFDEFQLDIHHVSGGLIGDHYSYLF  396

Query  456   NSKICEGSTVYASAIANKLIEVVDKHYTAIAPT  358
             NSKICEGSTVYASAIANK+IE++DK +  IAP+
Sbjct  397   NSKICEGSTVYASAIANKVIEILDKEHAPIAPS  429



>ref|XP_010097712.1| hypothetical protein L484_023853 [Morus notabilis]
 gb|EXB70667.1| hypothetical protein L484_023853 [Morus notabilis]
Length=447

 Score =   294 bits (752),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 169/280 (60%), Positives = 202/280 (72%), Gaps = 22/280 (8%)
 Frame = -2

Query  1158  RELFHSLPQGGYGF-GASRSS-GSLF---GEVDEREVNGAFYQTVDGCRDFENGVFELTG  994
             +ELF SLP G   F  ASR++ GSLF   G++ ERE +   Y   +G + FENGV E   
Sbjct  177   KELFQSLPNGYNTFPSASRNNNGSLFSTSGDI-EREGSAGIYGP-EGLQ-FENGVLEFAR  233

Query  993   DMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINEL  814
             D   + + RDG+ TKHFA+ER RR  + D Y  L+ LVPNP+KNDRASVV DAI YI EL
Sbjct  234   DGAQIERGRDGRVTKHFASERHRRDQMRDTYTTLRNLVPNPTKNDRASVVGDAIEYIKEL  293

Query  813   KRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVE------DVDQSYSGTTLR  652
             +RTV ELKILVEKKR SRE +KR KTE       GGD+  VE      D DQSY+    R
Sbjct  294   RRTVNELKILVEKKRRSRESIKRQKTEEDI----GGDVGDVENCHIKMDPDQSYT----R  345

Query  651   SSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDY  472
             SSWLQRKSK+TEVDVRII+DEVTVKL+Q+K+IN LL  S+ LDELQLDL HVAGG +GD 
Sbjct  346   SSWLQRKSKDTEVDVRIIEDEVTVKLIQRKKINLLLIASRVLDELQLDLRHVAGGHVGDT  405

Query  471   YSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTS  352
             YSFLFN+KI EGS++YASAIA+KLI+V+D+ Y AI P TS
Sbjct  406   YSFLFNTKIYEGSSLYASAIADKLIDVLDRQYAAILPPTS  445



>ref|XP_008347044.1| PREDICTED: transcription factor bHLH91-like [Malus domestica]
Length=511

 Score =   296 bits (757),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 167/281 (59%), Positives = 198/281 (70%), Gaps = 15/281 (5%)
 Frame = -2

Query  1158  RELFHSLPQG----GYGFGASRSSGSLFGEVDEREVNGAFYQTVDGC-RDFENGVFELTG  994
             REL  SLP G    G G G+  SSG   G+  E    G  Y       R F++GV E + 
Sbjct  234   RELLQSLPHGYTLPGSGNGSLFSSG---GDDREGSGGGVLYDPDRSLGRQFDSGVLEFSR  290

Query  993   DMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINEL  814
             DM      RD K TKHFATERQRR  LN K++ LK LVPNP+KNDRAS+V DAI YINEL
Sbjct  291   DMASNGIGRDLKRTKHFATERQRRQQLNGKFDILKDLVPNPTKNDRASIVGDAIEYINEL  350

Query  813   KRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGD----LKSV-EDVDQSYSGTTLRS  649
              RTV ELK+LVEK RC RER+KR+KTE   +   G D    ++ + E  DQSY+  +LRS
Sbjct  351   LRTVEELKLLVEKNRCGRERIKRYKTEHDGAAAAGDDESCNIQPLGEPHDQSYNNGSLRS  410

Query  648   SWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYY  469
             SWLQRKSK+TEVD+RIIDDEVT+KLVQ+K+IN LLFVS+ LDELQLDLHHVAGG IG+ Y
Sbjct  411   SWLQRKSKDTEVDIRIIDDEVTIKLVQRKKINLLLFVSRLLDELQLDLHHVAGGQIGNSY  470

Query  468   SFLFNSKICEGSTVYASAIANKLIEVVDKHYTA--IAPTTS  352
             SF FN+K+ EGS +YASAIA KLIEV+D+ Y A  + PT S
Sbjct  471   SFFFNTKMYEGSCLYASAIAGKLIEVLDRQYAAAVLPPTNS  511



>ref|XP_009361467.1| PREDICTED: transcription factor bHLH91-like [Pyrus x bretschneideri]
Length=513

 Score =   295 bits (756),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 175/284 (62%), Positives = 210/284 (74%), Gaps = 19/284 (7%)
 Frame = -2

Query  1158  RELFHSLPQG----GYGFGASRSSGSLFGEVDEREVNGA---FYQTVDGC--RDFENGVF  1006
             REL  SLP G    G G G+  SSG      DERE +G    +    DG   R F++GV 
Sbjct  235   RELLQSLPHGYTLPGSGNGSLFSSGG-----DEREGSGGGVLYDPDPDGSLGRQFDSGVL  289

Query  1005  ELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGY  826
             E + +M    + RD KGTKHFATERQRR  LN KY+ LK LVPNP+KNDRAS++ DAI Y
Sbjct  290   EFSREMASNGRGRDLKGTKHFATERQRRQQLNGKYDILKTLVPNPTKNDRASILGDAIDY  349

Query  825   INELKRTVGELKILVEKKRCSRERMKRHKTE--GCSSMMDGG-DLKSV-EDVDQSYSGTT  658
             INEL RTV ELK+LVEKKRC RER+KRHKTE  G S+  D   ++K + E  DQSYS  +
Sbjct  350   INELLRTVDELKLLVEKKRCGRERIKRHKTEHDGSSAGDDENCNVKPLGEHHDQSYSSGS  409

Query  657   LRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIG  478
             LRSSWLQRKSK+T+VD+RIIDDEVT+KLVQ+K+IN LLFV++ LDELQLDLHHVAGG IG
Sbjct  410   LRSSWLQRKSKDTQVDIRIIDDEVTIKLVQRKKINLLLFVARILDELQLDLHHVAGGHIG  469

Query  477   DYYSFLFNSKICEGSTVYASAIANKLIEVVDKHY-TAIAPTTSY  349
             + YSFLFN+K+ EGS +YASAIA KLIEV+D+ Y  A+ PT+SY
Sbjct  470   NSYSFLFNTKMYEGSCLYASAIAGKLIEVLDRQYAAAVPPTSSY  513



>ref|XP_008378661.1| PREDICTED: transcription factor bHLH10-like [Malus domestica]
Length=355

 Score =   281 bits (720),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 155/273 (57%), Positives = 196/273 (72%), Gaps = 14/273 (5%)
 Frame = -2

Query  1146  HSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRD---FENGVFELTGDMNVLA  976
             ++LP  G G G+  SSG      DERE +G      DG      FE+GV E + +M  + 
Sbjct  90    YTLP--GSGNGSLFSSGG-----DEREGSGGGIYPDDGTITESFFEDGVMEFSREMGSIG  142

Query  975   KNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
             + R+ K +K+ A +R RR  LNDK+  L+ L+PN ++ND+AS+V DAIGYINEL RTV E
Sbjct  143   RGRNRKESKNLAIDRVRRQQLNDKFFTLRNLIPNXTQNDKASIVGDAIGYINELLRTVDE  202

Query  795   LKILVEKKRCSRERMKRHKTE---GCSSMMDGGDLKSV-EDVDQSYSGTTLRSSWLQRKS  628
             LK+LVEKKRC RER+ RHKTE   G +   +  ++K   E  DQSY+  +LRSSWLQRKS
Sbjct  203   LKLLVEKKRCGRERINRHKTEQDXGAAGDDESCNIKPXGEPHDQSYNNGSLRSSWLQRKS  262

Query  627   KNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSK  448
             K TEVD+RII+DEVT+KLVQ+K+IN LLFVS+ LDELQLDLHHVAGG IG+ YSFLFN+K
Sbjct  263   KYTEVDIRIIEDEVTIKLVQRKKINLLLFVSRLLDELQLDLHHVAGGQIGNSYSFLFNTK  322

Query  447   ICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             + EGS +YASAIA K IEV+D  Y+A+ PT SY
Sbjct  323   MYEGSCLYASAIAGKFIEVLDGQYSAVPPTGSY  355



>ref|XP_008374146.1| PREDICTED: transcription factor bHLH10-like [Malus domestica]
Length=355

 Score =   281 bits (718),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 196/273 (72%), Gaps = 14/273 (5%)
 Frame = -2

Query  1146  HSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRD---FENGVFELTGDMNVLA  976
             ++LP  G G G+  SSG      DERE +G      DG      FE+GV E + +M  + 
Sbjct  90    YTLP--GSGNGSLFSSGG-----DEREGSGGGIYPDDGTITESFFEDGVMEFSREMGSIG  142

Query  975   KNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
             + R+ K +K+ A +R RR  LNDK+  L+ L+PN ++ND+AS+V DAIGYINEL RTV E
Sbjct  143   RGRNRKESKNLAIDRVRRQQLNDKFFTLRNLIPNXTQNDKASIVGDAIGYINELLRTVDE  202

Query  795   LKILVEKKRCSRERMKRHKTE---GCSSMMDGGDLKSV-EDVDQSYSGTTLRSSWLQRKS  628
             LK+LVEKKRC RER+ RHKTE   G +   +  ++K   E  DQSY+  +LRSSWLQRKS
Sbjct  203   LKLLVEKKRCGRERINRHKTEQDXGAAGDDESCNIKPXGEPHDQSYNNGSLRSSWLQRKS  262

Query  627   KNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSK  448
             K TEV++RII+DEVT+KLVQ+K+IN LLFVS+ LDELQLDLHHVAGG IG+ YSFLFN+K
Sbjct  263   KYTEVBIRIIEDEVTIKLVQRKKINLLLFVSRLLDELQLDLHHVAGGQIGNSYSFLFNTK  322

Query  447   ICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             + EGS +YASAIA K IEV+D  Y+A+ PT SY
Sbjct  323   MYEGSCLYASAIAGKFIEVLDGQYSAVPPTGSY  355



>ref|XP_009788151.1| PREDICTED: transcription factor bHLH91-like [Nicotiana sylvestris]
Length=418

 Score =   283 bits (723),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 156/262 (60%), Positives = 188/262 (72%), Gaps = 27/262 (10%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGE-VDEREVNGAFYQTVDGCRDFENGVFELTGDMNV  982
             +ELF   P G YG G+S  +GSLF   V E EV GA Y         + G F    D+  
Sbjct  170   KELFRLSPHGSYGLGSS-GTGSLFSHGVAEEEVTGALYH--------DAGSF----DIKS  216

Query  981   LAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV  802
              A+ R+GK  KH  +E+QRRVH +DK++AL+ L+PNPSKNDRA+++ DAIGYIN LK  V
Sbjct  217   AARKREGKDIKHHTSEKQRRVHFSDKFQALRALIPNPSKNDRATIIADAIGYINMLKTKV  276

Query  801   GELKILVEKKRCSRERMKRHKTEGCSSMMDGG-DLKSVEDVDQSYSGTTLRSSWLQRKSK  625
              ELK  VEKK    ER+KR +TE      DG    K+V   + + +   +RSSWLQ+KSK
Sbjct  277   NELKNEVEKK----ERVKRQRTE------DGSCGFKTVM-AEAAENNVNIRSSWLQKKSK  325

Query  624   NTEVDVRIIDDEVTVKLVQQ-KRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSK  448
             NTEVDVRI+DDEVTVKLVQQ KR+NCLLFVSKA DE QLDLHHV+GGLIGD+YS+LFNSK
Sbjct  326   NTEVDVRIMDDEVTVKLVQQQKRMNCLLFVSKAFDEFQLDLHHVSGGLIGDHYSYLFNSK  385

Query  447   ICEGSTVYASAIANKLIEVVDK  382
             ICEG TVYASAIANK+IEV+DK
Sbjct  386   ICEGCTVYASAIANKVIEVLDK  407



>gb|KHN25939.1| Transcription factor bHLH89 [Glycine soja]
Length=507

 Score =   283 bits (725),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 191/271 (70%), Gaps = 19/271 (7%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVL  979
             RELF SLP+G Y    +  +GSLF   DE E +G+           + GV E       +
Sbjct  255   RELFQSLPRG-YSLPTNSRNGSLFAGGDEMEGDGS---------QLDMGVLEFNRVTPSV  304

Query  978   AKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVG  799
              K R GK TKHFATE+QRR  LN KY+ L+ L+P+P+K DRASVV DAI YI EL RTV 
Sbjct  305   GKGRGGKATKHFATEKQRREQLNGKYKILRNLIPSPTKIDRASVVGDAIDYIRELIRTVN  364

Query  798   ELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNT  619
             ELK+LVEKKR ++ER KR KTE  +   +  ++K   D D       +R+SWLQRKSK++
Sbjct  365   ELKLLVEKKRYAKERYKRPKTEDAA---ESCNIKPFGDPDGG-----IRTSWLQRKSKDS  416

Query  618   EVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICE  439
             EVDVRIIDD+VT+KL Q+K+INCLLFVSK LDELQL+LHHVAGG +G+Y SFLFNSKI E
Sbjct  417   EVDVRIIDDDVTIKLFQRKKINCLLFVSKVLDELQLELHHVAGGHVGEYCSFLFNSKIME  476

Query  438   GSTVYASAIANKLIEVVDKHYTAIAP-TTSY  349
             GS+VYASAIAN++I+V+D  YTA  P T SY
Sbjct  477   GSSVYASAIANRVIDVLDSQYTAAVPHTNSY  507



>ref|XP_007163873.1| hypothetical protein PHAVU_L009100g [Phaseolus vulgaris]
 ref|XP_007163874.1| hypothetical protein PHAVU_L009100g [Phaseolus vulgaris]
 ref|XP_007163875.1| hypothetical protein PHAVU_L009100g [Phaseolus vulgaris]
 gb|ESW35867.1| hypothetical protein PHAVU_L009100g [Phaseolus vulgaris]
 gb|ESW35868.1| hypothetical protein PHAVU_L009100g [Phaseolus vulgaris]
 gb|ESW35869.1| hypothetical protein PHAVU_L009100g [Phaseolus vulgaris]
Length=513

 Score =   283 bits (724),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 158/271 (58%), Positives = 191/271 (70%), Gaps = 19/271 (7%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVL  979
             RELF SLP+G Y    +  +GSLFG  DE E +G+           + GV E       +
Sbjct  261   RELFQSLPRG-YSLPTNSRNGSLFGG-DEIEGDGS---------QLDMGVLEFNRVTPSV  309

Query  978   AKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVG  799
             +K R GK TKHFATE+QRR  LN KY+ L+ L+PNP+K DRASVV DAI YI EL RTV 
Sbjct  310   SKGRGGKATKHFATEKQRREQLNGKYKILRNLIPNPTKIDRASVVGDAIDYIRELIRTVN  369

Query  798   ELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNT  619
             ELK+LVEKKR  RER KR KTE      +  ++K   D D       +R+SWLQRKSK++
Sbjct  370   ELKLLVEKKRYGRERCKRPKTE--EDAAESCNIKPFGDPDGG-----IRTSWLQRKSKDS  422

Query  618   EVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICE  439
             EVDVRIIDD+VT+KL Q+K+INCLLFVSK LDELQL+LHHVAGG +G+Y SFLFNSKI E
Sbjct  423   EVDVRIIDDDVTIKLFQRKKINCLLFVSKVLDELQLELHHVAGGHVGEYCSFLFNSKIIE  482

Query  438   GSTVYASAIANKLIEVVDKHYTAIAP-TTSY  349
             GS+VYASAIAN++I+V+D  YTA  P T SY
Sbjct  483   GSSVYASAIANRVIDVLDCQYTASVPHTNSY  513



>ref|XP_006580839.1| PREDICTED: transcription factor bHLH10-like [Glycine max]
Length=589

 Score =   283 bits (723),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 153/269 (57%), Positives = 189/269 (70%), Gaps = 17/269 (6%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVL  979
             RELF SLP+G Y    +  +GSLF   DE E +G+           + GV E       +
Sbjct  336   RELFQSLPRG-YSLPTNSRNGSLFAGGDEMEGDGS---------QLDMGVLEFNRVTPSV  385

Query  978   AKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVG  799
              K R GK TKHFATE+QRR  LN KY+ L+ L+P+P+K DRASVV DAI YI EL RTV 
Sbjct  386   GKGRGGKATKHFATEKQRREQLNGKYKILRNLIPSPTKIDRASVVGDAIDYIRELIRTVN  445

Query  798   ELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNT  619
             ELK+LVEKKR ++ER KR KTE      +  ++K   D D       +R+SWLQRKSK++
Sbjct  446   ELKLLVEKKRYAKERYKRPKTE--EDAAESCNIKPFGDPDGG-----IRTSWLQRKSKDS  498

Query  618   EVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICE  439
             EVDVRIIDD+VT+KL Q+K+INCLLFVSK LDELQL+LHHVAGG +G+Y SFLFNSKI E
Sbjct  499   EVDVRIIDDDVTIKLFQRKKINCLLFVSKVLDELQLELHHVAGGHVGEYCSFLFNSKIME  558

Query  438   GSTVYASAIANKLIEVVDKHYTAIAPTTS  352
             GS+VYASAIAN++I+V+D  YTA  P T+
Sbjct  559   GSSVYASAIANRVIDVLDSQYTAAVPHTN  587



>ref|XP_010058017.1| PREDICTED: transcription factor bHLH91-like isoform X1 [Eucalyptus 
grandis]
Length=513

 Score =   275 bits (702),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 165/301 (55%), Positives = 193/301 (64%), Gaps = 36/301 (12%)
 Frame = -2

Query  1158  RELFHSLPQGG---YGFGASRSSGSLFG---EVDEREVNG---------AFYQTVDGCRD  1024
             RELF SLP GG   Y       S SL G    ++  E  G           Y   DG   
Sbjct  215   RELFQSLPNGGACGYNGLPLAGSSSLLGGGNNIERGETEGDEGNNMGMTMMYCEEDGGHQ  274

Query  1023  F---ENGVFELTGDMNV----------LAKNRDGKGTKHFATERQRRVHLNDKYEALKKL  883
             F   +NGVF+   DM            + K R GK TK + TER RR  +N KY+ALKKL
Sbjct  275   FVENDNGVFKFGSDMMADMEGCRVKVKMGKRRRGKVTKPYTTERDRRSQINVKYDALKKL  334

Query  882   VPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGD  703
             +P+P+K DRAS+V DAI YI EL RTV ELK+L EKKR   ER KR K E      DG +
Sbjct  335   IPSPTKGDRASIVGDAIDYIKELLRTVNELKLLAEKKRWGIERSKRQKVE--EEGFDG-E  391

Query  702   LKSVED----VDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVS  535
             +    +    VDQS++  TLRSSWLQRKSK TEVDVRII+DEVT+KLVQ+K+INCLL VS
Sbjct  392   ISITPNPGNPVDQSFN-RTLRSSWLQRKSKVTEVDVRIIEDEVTIKLVQRKKINCLLHVS  450

Query  534   KALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTT  355
             + LDELQLDLHHVAGG IG++YSFL N+KICEGSTVYASAIA+KLIEVVD+ Y A  P  
Sbjct  451   RVLDELQLDLHHVAGGHIGEHYSFLLNTKICEGSTVYASAIASKLIEVVDRQYAATPPPC  510

Query  354   S  352
             S
Sbjct  511   S  511



>ref|XP_010058018.1| PREDICTED: transcription factor bHLH91-like isoform X2 [Eucalyptus 
grandis]
Length=502

 Score =   274 bits (700),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 165/301 (55%), Positives = 193/301 (64%), Gaps = 36/301 (12%)
 Frame = -2

Query  1158  RELFHSLPQGG---YGFGASRSSGSLFG---EVDEREVNG---------AFYQTVDGCRD  1024
             RELF SLP GG   Y       S SL G    ++  E  G           Y   DG   
Sbjct  204   RELFQSLPNGGACGYNGLPLAGSSSLLGGGNNIERGETEGDEGNNMGMTMMYCEEDGGHQ  263

Query  1023  F---ENGVFELTGDMNV----------LAKNRDGKGTKHFATERQRRVHLNDKYEALKKL  883
             F   +NGVF+   DM            + K R GK TK + TER RR  +N KY+ALKKL
Sbjct  264   FVENDNGVFKFGSDMMADMEGCRVKVKMGKRRRGKVTKPYTTERDRRSQINVKYDALKKL  323

Query  882   VPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGD  703
             +P+P+K DRAS+V DAI YI EL RTV ELK+L EKKR   ER KR K E      DG +
Sbjct  324   IPSPTKGDRASIVGDAIDYIKELLRTVNELKLLAEKKRWGIERSKRQKVE--EEGFDG-E  380

Query  702   LKSVED----VDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVS  535
             +    +    VDQS++  TLRSSWLQRKSK TEVDVRII+DEVT+KLVQ+K+INCLL VS
Sbjct  381   ISITPNPGNPVDQSFN-RTLRSSWLQRKSKVTEVDVRIIEDEVTIKLVQRKKINCLLHVS  439

Query  534   KALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTT  355
             + LDELQLDLHHVAGG IG++YSFL N+KICEGSTVYASAIA+KLIEVVD+ Y A  P  
Sbjct  440   RVLDELQLDLHHVAGGHIGEHYSFLLNTKICEGSTVYASAIASKLIEVVDRQYAATPPPC  499

Query  354   S  352
             S
Sbjct  500   S  500



>ref|XP_010543057.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH91-like 
[Tarenaya hassleriana]
Length=437

 Score =   271 bits (693),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 185/402 (46%), Positives = 238/402 (59%), Gaps = 63/402 (16%)
 Frame = -2

Query  1494  QGDPHFMQKLGHENQ-GLSNWEE------------LGFSHQPQSFQIPMPETPCPPAPDL  1354
             Q   H + ++ H++  G SNW+E             GF   P +    + E P PP PDL
Sbjct  79    QNTNHLIHQMIHDSSFGQSNWDEGPQDFVVDDHQNSGFGMNPSA---QLSEHPNPPTPDL  135

Query  1353  LNMfplprcspssllpnpsfsstfltslglfGDLP-SSAADGASPSTVVCDpsllplnlp  1177
             L++  LPRCS S  L   S  S           LP SS +D  + S V  DP   PL   
Sbjct  136   LSLLHLPRCSGSVSLLPHSSIS-----------LPTSSLSDIMAASCVTYDPPXPPL---  181

Query  1176  pqpplLRELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGC-RDFENGVFEL  1000
                         +P   Y    S  +G L G  ++RE   A     DG    F++G+ E 
Sbjct  182   ------------IPTNEY----SPQAGFLLGMENQREAANAGVLYTDGNGTQFDSGILEF  225

Query  999   TGDMN-VLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYI  823
             T D++  + K R  +  KHF TER+RR H ND++EALKKL+PNP+K DRAS++ +AI YI
Sbjct  226   TKDISGCIRKGRGSRKNKHFTTERERRSHYNDRFEALKKLIPNPTKTDRASILGEAIEYI  285

Query  822   NELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTT----L  655
              EL R V ELK LVEKKRC     KR KTE         D+++ E+  + Y+ +     L
Sbjct  286   QELLRRVSELKYLVEKKRCGN---KRQKTEE-------EDIENPENKPEIYNSSNSNNSL  335

Query  654   RSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
             R SWLQR+SK TEVDVRIIDDEVT+K+VQ+K+INCLLFVSK LD+LQLDLHHVAGG IG+
Sbjct  336   RCSWLQRRSKVTEVDVRIIDDEVTIKVVQKKKINCLLFVSKVLDQLQLDLHHVAGGQIGE  395

Query  474   YYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             +YSFLFN+KI EGST+YASAIA+++IEVVDK Y +  P  +Y
Sbjct  396   HYSFLFNTKIYEGSTIYASAIASRVIEVVDKQYMSALPVNNY  437



>ref|XP_004504639.1| PREDICTED: transcription factor bHLH91-like [Cicer arietinum]
Length=480

 Score =   269 bits (688),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 189/269 (70%), Gaps = 17/269 (6%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVL  979
             RELF SLP+G Y    S  +GSLFG  DE E +G+           + GV E       +
Sbjct  227   RELFQSLPRG-YSLPTSSRNGSLFGGGDEMEGDGS---------QLDMGVLEFNRVTASV  276

Query  978   AKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVG  799
              K R GK TKHFATE+QRR  LN KY+ L+ L+PNP+K DRASVV DAI YI EL RT  
Sbjct  277   GKGRRGKATKHFATEKQRREQLNGKYKILRSLIPNPTKVDRASVVGDAIEYIRELVRTKN  336

Query  798   ELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNT  619
             EL +LVE+KR  RE  KR KTE  ++  +  ++K   D D S     +R+SWLQRKSK++
Sbjct  337   ELTLLVERKRHGREMSKRLKTEDDAA--ESCNIKPFGDADGS-----IRTSWLQRKSKDS  389

Query  618   EVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICE  439
             EVDVRIID++VT+KL+Q+K++NCLLFVSK LDELQL+L HVAGGL+G+Y+SFL NSK+ E
Sbjct  390   EVDVRIIDNDVTIKLIQRKKVNCLLFVSKVLDELQLELCHVAGGLVGEYFSFLLNSKVIE  449

Query  438   GSTVYASAIANKLIEVVDKHYTAIAPTTS  352
             GS+VYASAIAN++I+V+D  Y A+ P  S
Sbjct  450   GSSVYASAIANRVIDVLDTQYAAVVPNLS  478



>ref|XP_006585047.1| PREDICTED: transcription factor bHLH10-like isoform X1 [Glycine 
max]
 ref|XP_006585048.1| PREDICTED: transcription factor bHLH10-like isoform X2 [Glycine 
max]
 gb|KHN28921.1| Transcription factor bHLH91 [Glycine soja]
Length=521

 Score =   269 bits (687),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 191/271 (70%), Gaps = 16/271 (6%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVL  979
             RELF SLP+G Y    +  +GSLFG  DE E +G+  Q   G  +F       +     +
Sbjct  266   RELFQSLPRG-YSLPTNSRNGSLFGGGDEMEGDGS--QLDMGVLEFNRVTLTPS-----V  317

Query  978   AKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVG  799
              K R GK TKHFATE+QRR  LN KY+ L+ L+P+P+K DRASVV DAI YI EL RTV 
Sbjct  318   GKGRRGKATKHFATEKQRREQLNGKYKILRNLIPSPTKTDRASVVGDAIDYIRELIRTVN  377

Query  798   ELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNT  619
             ELK+LVEKKR +++R KR KTE      +  ++K   D D       +R+SWLQRKSK++
Sbjct  378   ELKLLVEKKRYAKDRCKRPKTE--EDAAESCNIKPFGDPDGG-----IRTSWLQRKSKDS  430

Query  618   EVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICE  439
             EVDVRIIDD+VT+KL Q+K+INCLLFVSK LDELQL+LHHVAGG +G+Y SFLFNSKI E
Sbjct  431   EVDVRIIDDDVTIKLFQRKKINCLLFVSKVLDELQLELHHVAGGHVGEYCSFLFNSKIME  490

Query  438   GSTVYASAIANKLIEVVDKHYTAIAP-TTSY  349
             GS+VYASAIAN++I+V+D  Y A  P T SY
Sbjct  491   GSSVYASAIANRVIDVLDSQYAAAVPHTNSY  521



>gb|KCW75485.1| hypothetical protein EUGRSUZ_E04247 [Eucalyptus grandis]
Length=225

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 163/214 (76%), Gaps = 8/214 (4%)
 Frame = -2

Query  981  LAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV  802
            + K R GK TK + TER RR  +N KY+ALKKL+P+P+K DRAS+V DAI YI EL RTV
Sbjct  14   MGKRRRGKVTKPYTTERDRRSQINVKYDALKKLIPSPTKGDRASIVGDAIDYIKELLRTV  73

Query  801  GELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVED----VDQSYSGTTLRSSWLQR  634
             ELK+L EKKR   ER KR K E      DG ++    +    VDQS++  TLRSSWLQR
Sbjct  74   NELKLLAEKKRWGIERSKRQKVE--EEGFDG-EISITPNPGNPVDQSFN-RTLRSSWLQR  129

Query  633  KSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFN  454
            KSK TEVDVRII+DEVT+KLVQ+K+INCLL VS+ LDELQLDLHHVAGG IG++YSFL N
Sbjct  130  KSKVTEVDVRIIEDEVTIKLVQRKKINCLLHVSRVLDELQLDLHHVAGGHIGEHYSFLLN  189

Query  453  SKICEGSTVYASAIANKLIEVVDKHYTAIAPTTS  352
            +KICEGSTVYASAIA+KLIEVVD+ Y A  P  S
Sbjct  190  TKICEGSTVYASAIASKLIEVVDRQYAATPPPCS  223



>ref|XP_003638306.1| Transcription factor bHLH91 [Medicago truncatula]
 gb|KEH31430.1| basic helix loop helix (BHLH) DNA-binding family protein [Medicago 
truncatula]
Length=486

 Score =   266 bits (679),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 203/302 (67%), Gaps = 21/302 (7%)
 Frame = -2

Query  1257  DLPSSAADGASPSTVVCDpsllplnlppqpplLRELFHSLPQGGYGFGASRSSGSLFGEV  1078
             DLP  ++D  S S+V+ DP       P  P L RELF SLP+G Y    +  +GSLFG  
Sbjct  204   DLPIGSSDNTSGSSVLYDPLYPLNLPPQPPAL-RELFQSLPRG-YSMPTNSRNGSLFGGG  261

Query  1077  DEREVNGAFYQTVDGCRDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYE  898
             DE E +G              GV E       + K R GK TKHFATE+QRR  LN KY+
Sbjct  262   DEMEGDGD------------MGVLEFNRVTASVGKGRGGKATKHFATEKQRREQLNGKYK  309

Query  897   ALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSM  718
              L+ L+P+P+K DRASVV DAI YI EL RTV ELK+LVEKKR  RE  KR KTE  ++ 
Sbjct  310   ILRDLIPSPTKTDRASVVGDAIEYIRELIRTVNELKLLVEKKRHGREMCKRLKTEDDAA-  368

Query  717   MDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFV  538
              +  ++K   D D S     +R+SWLQRKSK++EVDVRIIDD+VT+KL Q+K++NCLLFV
Sbjct  369   -ESCNIKPFGDPDGS-----IRTSWLQRKSKDSEVDVRIIDDDVTIKLFQRKKVNCLLFV  422

Query  537   SKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPT  358
             SK LDELQL+LHHVAGG +G+Y SFLFNSK+ EGS+VYASAIAN++I+V+D  Y A  P 
Sbjct  423   SKVLDELQLELHHVAGGHVGEYCSFLFNSKVNEGSSVYASAIANRVIDVMDTQYAAGLPH  482

Query  357   TS  352
              S
Sbjct  483   IS  484



>ref|XP_006294262.1| hypothetical protein CARUB_v10023260mg, partial [Capsella rubella]
 gb|EOA27160.1| hypothetical protein CARUB_v10023260mg, partial [Capsella rubella]
Length=430

 Score =   260 bits (665),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/283 (51%), Positives = 183/283 (65%), Gaps = 18/283 (6%)
 Frame = -2

Query  1152  LFH-SLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVLA  976
             LFH +LP       A+  SG L G +D    +      V    + ++G+ E + +  +  
Sbjct  151   LFHLNLPPQPPLIPANDYSGFLLG-IDNNATSQRDDSNVGNEINIDSGIIEFSKE--IRR  207

Query  975   KNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
             K R  +  + F TER+RR HLN++YEALK L+PNPSK DRAS++ D I YINEL+R V E
Sbjct  208   KGRGKRKNRPFTTERERRCHLNERYEALKLLIPNPSKGDRASILQDGIDYINELRRRVSE  267

Query  795   LKILVEKKRCSRER-------------MKRHKTEGCSSMMDGGDLKSVEDV-DQSYSGTT  658
             LK LVE+KRC   +             +  H  E      +  + K   DV DQ  S  +
Sbjct  268   LKYLVERKRCGGRQQNNEVDNNNNNNNLDGHINEDDVDDDENMNKKPESDVTDQCSSNNS  327

Query  657   LRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIG  478
             LR SWLQRKSK +EVDVRI+DDEVT+K+VQ+K+INCLL VSK LD LQLDLHHVAGG IG
Sbjct  328   LRCSWLQRKSKASEVDVRIVDDEVTIKVVQKKKINCLLLVSKVLDHLQLDLHHVAGGQIG  387

Query  477   DYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             ++YSFLFN+KI EGST+YASAIAN++IEVVDKHY A  P  +Y
Sbjct  388   EHYSFLFNTKIYEGSTIYASAIANRVIEVVDKHYMASLPINNY  430



>emb|CAD58593.1| putative bHLH transcription factor [Arabidopsis thaliana]
Length=428

 Score =   258 bits (658),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 169/243 (70%), Gaps = 24/243 (10%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             F++G+ E + +  +  K R  +  K F TER+RR HLN++YEALK L+P+PSK DRAS++
Sbjct  192   FDSGIIEFSKE--IRRKGRGKRKNKPFTTERERRCHLNERYEALKLLIPSPSKGDRASIL  249

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG--------------  706
              D I YINEL+R V ELK LVE+KRC      RHK        +                
Sbjct  250   QDGIDYINELRRRVSELKYLVERKRCG----GRHKNNEVDDNNNNKNLDDHGNEDDDDDD  305

Query  705   ---DLKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFV  538
                + K   DV DQ  S  +LR SWLQRKSK TEVDVRI+DDEVT+K+VQ+K+INCLL V
Sbjct  306   ENMEKKPESDVIDQCSSNNSLRCSWLQRKSKVTEVDVRIVDDEVTIKVVQKKKINCLLLV  365

Query  537   SKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPT  358
             SK LD+LQLDLHHVAGG IG++YSFLFN+KI EGST+YASAIAN++IEVVDKHYTA  P 
Sbjct  366   SKVLDQLQLDLHHVAGGQIGEHYSFLFNTKIYEGSTIYASAIANRVIEVVDKHYTASLPN  425

Query  357   TSY  349
             ++Y
Sbjct  426   SNY  428



>ref|NP_180679.2| transcription factor bHLH91 [Arabidopsis thaliana]
 sp|Q8GX46.1|BH091_ARATH RecName: Full=Transcription factor bHLH91; AltName: Full=Basic 
helix-loop-helix protein 91; Short=AtbHLH91; Short=bHLH 91; 
AltName: Full=Transcription factor EN 25; AltName: Full=bHLH 
transcription factor bHLH091 [Arabidopsis thaliana]
 dbj|BAC43050.1| putative bHLH transcription factor bHLH091 [Arabidopsis thaliana]
 gb|AAP80176.1| At2g31210 [Arabidopsis thaliana]
 gb|AEC08508.1| transcription factor bHLH91 [Arabidopsis thaliana]
Length=428

 Score =   256 bits (653),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 168/243 (69%), Gaps = 24/243 (10%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             F++G+ E + +  +  K R  +  K F TER+RR HLN++YEALK L+P+PSK DRAS++
Sbjct  192   FDSGIIEFSKE--IRRKGRGKRKNKPFTTERERRCHLNERYEALKLLIPSPSKGDRASIL  249

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG--------------  706
              D I YINEL+R V ELK LVE+KRC      RHK        +                
Sbjct  250   QDGIDYINELRRRVSELKYLVERKRCG----GRHKNNEVDDNNNNKNLDDHGNEDDDDDD  305

Query  705   ---DLKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFV  538
                + K   DV DQ  S  +LR SWLQRKSK TEVDVRI+DDEVT+K+VQ+K+INCLL V
Sbjct  306   ENMEKKPESDVIDQCSSNNSLRCSWLQRKSKVTEVDVRIVDDEVTIKVVQKKKINCLLLV  365

Query  537   SKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPT  358
             SK LD+LQLDLHHVAGG IG++YSFLFN+KI EGST+YASAIAN++IEVVDKHY A  P 
Sbjct  366   SKVLDQLQLDLHHVAGGQIGEHYSFLFNTKIYEGSTIYASAIANRVIEVVDKHYMASLPN  425

Query  357   TSY  349
             ++Y
Sbjct  426   SNY  428



>gb|ACN21644.1| putative basic helix-loop-helix protein BHLH14 [Lotus japonicus]
Length=443

 Score =   254 bits (650),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 150/284 (53%), Positives = 186/284 (65%), Gaps = 32/284 (11%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVL  979
             RELF SLP+G Y    S    SLFG  DE E +G+           + GV +   D   +
Sbjct  175   RELFQSLPRG-YRLPTSSRDDSLFGGGDEMEGDGS---------QLDMGVLDFNRDTASV  224

Query  978   AKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSK--------NDRASVVHDAIGYI  823
              K R+GKG K FATE+ RR  LN KY+ L+ L+PNP+K         DRASVV DAI YI
Sbjct  225   GKGREGKGAKPFATEKDRREQLNGKYKILRSLIPNPTKLIGWVLFKPDRASVVGDAIEYI  284

Query  822   NELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSW  643
              EL RTV ELK+LVEKKR  RER KR K E  +   +  ++K   D D       +R+SW
Sbjct  285   RELIRTVNELKLLVEKKRHERERCKRPKNEEDAE--ESCNIKPFGDPD-----GYIRTSW  337

Query  642   LQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSF  463
             LQRKSK++EVDVRIIDD+VT+K  Q+K+INCLLFVSK LDELQL+LHH+AGG +G+Y+SF
Sbjct  338   LQRKSKDSEVDVRIIDDDVTIKFFQRKKINCLLFVSKVLDELQLELHHLAGGHVGEYWSF  397

Query  462   LFNSK-------ICEGSTVYASAIANKLIEVVDKHYTAIAPTTS  352
             LFNSK       + EGS+VYASAIAN++I+V+D  Y A  P TS
Sbjct  398   LFNSKRPVSLTQVIEGSSVYASAIANRVIDVLDSQYAAAVPQTS  441



>ref|XP_002879311.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55570.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=430

 Score =   253 bits (646),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 167/239 (70%), Gaps = 24/239 (10%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             F++G+ E + +  +  K R  +  K F TER+RR HLN++YEALK L+PNPSK DRAS++
Sbjct  195   FDSGIIEFSKE--IRRKGRGKRKNKPFTTERERRCHLNERYEALKLLIPNPSKGDRASIL  252

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG--------------  706
              D I YINEL+R V ELK LVE+KRC      RHK     + ++                
Sbjct  253   QDGIDYINELRRRVSELKYLVERKRCG----GRHKNNELDNNINNNNSNDHDNDEDDIDD  308

Query  705   ---DLKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFV  538
                + K   DV DQ  S  +LR SWLQRKSK TEVDVRI+DDEVT+K+VQ+K+INCLL V
Sbjct  309   ENMEKKPESDVVDQCSSNNSLRCSWLQRKSKVTEVDVRIVDDEVTIKVVQKKKINCLLLV  368

Query  537   SKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAP  361
             SK LD+LQLDL+HVAGG IG++YSFLFN+KI EGST+YASAIAN++IEVVDKHY A  P
Sbjct  369   SKVLDQLQLDLYHVAGGQIGEHYSFLFNTKIYEGSTIYASAIANRVIEVVDKHYMAALP  427



>ref|XP_007156379.1| hypothetical protein PHAVU_003G281300g [Phaseolus vulgaris]
 gb|ESW28373.1| hypothetical protein PHAVU_003G281300g [Phaseolus vulgaris]
Length=416

 Score =   252 bits (644),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 173/226 (77%), Gaps = 15/226 (7%)
 Frame = -2

Query  1029  RDFENGVFELTGDMNVLAKNRDGKGTKHFA---TERQRRVHLNDKYEALKKLVPNPSKND  859
             +DF NGV ELT D   + K R GK TK F    TERQRRV L+ K++ALK+L+PNPSK+D
Sbjct  196   QDFGNGVVELTQD---VGKKRGGKRTKQFTSTTTERQRRVDLSSKFDALKELIPNPSKSD  252

Query  858   RASVVHDAIGYINELKRTVGELKILVEKKRCSRER---MKRHKTEGCSSMMDGGDLKSVE  688
             RASVV DAI YI ELKRTV ELK+LVEKKR  ++R   M RHK E      +G +  +++
Sbjct  253   RASVVGDAINYIRELKRTVDELKLLVEKKRHEKQRVVVMMRHKVE-----TEGQEDSNLD  307

Query  687   DVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLD  508
               D SY+  +LRSSW+QRK+K+TEVDVRI+D+EVT+KLVQ+K+++CL+ VS+ LD+L LD
Sbjct  308   PDDGSYN-ESLRSSWIQRKNKDTEVDVRIVDNEVTIKLVQRKKMDCLVHVSQVLDQLNLD  366

Query  507   LHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTA  370
             L HVAGG IGD+ S+LFN+K+C+GS VYASAIANKLI+V+D    A
Sbjct  367   LQHVAGGHIGDFCSYLFNTKMCDGSCVYASAIANKLIQVMDTSLVA  412



>ref|XP_010918188.1| PREDICTED: transcription factor bHLH89-like [Elaeis guineensis]
Length=493

 Score =   253 bits (645),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 184/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVL  979
             ++LFHSLPQ  YG       G     V      G  +Q +DG R F++ V +   +M  L
Sbjct  228   KDLFHSLPQN-YGLFCGVDEGEAMVGVGGGIGGGHVFQEMDG-RQFDSTVLDYRREMGGL  285

Query  978   AKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVG  799
              K   G+   +FATERQRR  LN+KY+AL+ LVPNP+K+DRAS+V DAI YI EL RT+ 
Sbjct  286   GK---GEVKPNFATERQRREQLNEKYKALRSLVPNPTKSDRASIVGDAIEYIKELLRTIE  342

Query  798   ELKILVEKKRCSRERMKRHKTEG-CSSMMDGGDLKSVE-DVDQSYSGTTLRSSWLQRKSK  625
             ELK+LV KKR  RER+K    E   ++ M+   ++ +  D D  ++G  LRSSWLQR+SK
Sbjct  343   ELKLLVGKKRHGRERIKMMTMEDEGTADMESSSMRPLRVDNDHPFNGA-LRSSWLQRRSK  401

Query  624   NTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKI  445
              + VDVRIIDDEV +KL+Q+K+ NCLL+++K  DELQL+L H +GG IGD+YSFLFN+KI
Sbjct  402   ESTVDVRIIDDEVYIKLIQKKKANCLLYIAKVFDELQLELIHASGGNIGDHYSFLFNTKI  461

Query  444   CEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             CEGS+ YA AIA K++EVVD+   A+    S+
Sbjct  462   CEGSSAYAGAIAKKVLEVVDRQQPALTFPASF  493



>ref|XP_010414166.1| PREDICTED: transcription factor bHLH91-like [Camelina sativa]
 ref|XP_010414167.1| PREDICTED: transcription factor bHLH91-like [Camelina sativa]
Length=432

 Score =   251 bits (640),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 167/239 (70%), Gaps = 19/239 (8%)
 Frame = -2

Query  1026  DFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASV  847
             + ++G+ E + +  +  K R  +  + F TER+RR HLN++YEALK L+P+PSK DRAS+
Sbjct  200   NIDSGIIEFSKE--IRRKGRGKRKNRPFTTERERRCHLNERYEALKLLIPSPSKGDRASI  257

Query  846   VHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMM------------DGGD  703
             + D I YINEL+R V ELK LVE+KRC      RH+     +              +  +
Sbjct  258   LQDGIDYINELRRRVSELKYLVERKRCG----GRHQNNEVDNNNLDDQNNEDDVDDENMN  313

Query  702   LKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKAL  526
              K   DV DQ  S  +LR SWLQRKSK +EVDVRI+DDEVT+K+VQ+K+INCLL VSK L
Sbjct  314   KKPESDVTDQCSSNNSLRCSWLQRKSKASEVDVRIVDDEVTIKVVQKKKINCLLLVSKVL  373

Query  525   DELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             D LQL+LHHVAGG IG++YSFLFN+KI EGST+YASAIAN++IEVVDKHY A  P  +Y
Sbjct  374   DHLQLELHHVAGGQIGEHYSFLFNTKIYEGSTIYASAIANRVIEVVDKHYMASLPINNY  432



>ref|XP_008800057.1| PREDICTED: transcription factor bHLH91-like [Phoenix dactylifera]
Length=494

 Score =   251 bits (640),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 144/281 (51%), Positives = 184/281 (65%), Gaps = 26/281 (9%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREV---------NGAFYQTVDGCRDFENGVF  1006
             R+LFHSLPQ  YG         LF  VDERE           G  +Q +D  R F++ V 
Sbjct  229   RDLFHSLPQN-YG---------LFCGVDEREAMVGVGGGIGGGHVFQDMDE-RQFDSAVL  277

Query  1005  ELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGY  826
             +   +M  L K   G     FATERQRR  LN+KY+AL+ LVPNP+K+DRAS+V DAI Y
Sbjct  278   DYRREMGGLGK---GGVKPSFATERQRREQLNEKYQALRLLVPNPTKSDRASIVGDAIEY  334

Query  825   INELKRTVGELKILVEKKRCSRERMKRHKTE--GCSSMMDGGDLKSVEDVDQSYSGTTLR  652
             I EL RTV ELK+LV KKR  RER+K  K E  G + M         +D D  ++G  LR
Sbjct  335   IKELLRTVEELKLLVGKKRHGRERIKMMKMEDEGTADMESSSMRPLRDDNDHPFNGA-LR  393

Query  651   SSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDY  472
             SSWLQR+SK + VDVRIIDDEV +KL+Q+K+ NCLL++++ LDELQL+L H +GG IGD+
Sbjct  394   SSWLQRRSKESIVDVRIIDDEVYIKLIQKKKANCLLYIAEVLDELQLELIHASGGNIGDH  453

Query  471   YSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             YSF+FN+KICEGS+ YA AIA K++EVVD+    +    S+
Sbjct  454   YSFIFNTKICEGSSTYAGAIAKKVLEVVDRQQPVLTLPASF  494



>emb|CDY15420.1| BnaC04g42030D [Brassica napus]
Length=441

 Score =   249 bits (636),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 164/239 (69%), Gaps = 20/239 (8%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             F++G+ E +   N+  K R  +  K F TER+RR HLN++YEALK L+PNPSK DRAS++
Sbjct  209   FDSGIIEFSK--NIRRKRRGKQKNKPFTTERERRCHLNERYEALKLLIPNPSKGDRASIL  266

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMM-------------DGGD  703
              D I YINEL+R V ELK LVE+KRC      RH+                     +  +
Sbjct  267   QDGIDYINELRRRVSELKFLVERKRCG----GRHQNNNEVENNNNLDDLNIVDDDDENME  322

Query  702   LKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKAL  526
              K+  DV DQ  S  TLR SWLQRKSK TEVDVRI+DDEVT+K+VQ+++INCLL V+K +
Sbjct  323   KKTESDVIDQCSSNNTLRCSWLQRKSKLTEVDVRIVDDEVTIKVVQKRKINCLLVVTKVI  382

Query  525   DELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             D L LDLHHV+GG IG++YSFL N+KI EGST+YASAIANK+IEVVD+H  A  P  +Y
Sbjct  383   DHLHLDLHHVSGGQIGEHYSFLLNTKINEGSTIYASAIANKVIEVVDQHNMAALPINNY  441



>ref|XP_010510224.1| PREDICTED: transcription factor bHLH91-like [Camelina sativa]
Length=433

 Score =   248 bits (634),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 140/284 (49%), Positives = 180/284 (63%), Gaps = 22/284 (8%)
 Frame = -2

Query  1152  LFH-SLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVLA  976
             L+H +LP       AS  SG L G              V    + ++G+ E + +  +  
Sbjct  156   LYHLNLPPQPPLIPASDYSGFLLGIDTNITTQRDDDSNVGNEINIDSGIIEFSKE--IRR  213

Query  975   KNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
             K R  +  + F TER+RR HLN++YEALK L+P+PSK DRAS++ D I YINEL+R V E
Sbjct  214   KGRGKRKNRPFTTERERRCHLNERYEALKLLIPSPSKGDRASILQDGIDYINELRRRVSE  273

Query  795   LKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSV---------------EDVDQSYSGT  661
             LK LVE+KRC      RH+     +  +  D ++                E  DQ  S  
Sbjct  274   LKYLVERKRCG----GRHQNNEVDNNNNNLDGQNDEDDVDDENMNKKPESEVTDQCSSNN  329

Query  660   TLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLI  481
             +LR SWLQRKSK +EVDVRI+DDEVT+K+VQ+K+INCLL VSK LD LQL+LHHVAGG I
Sbjct  330   SLRCSWLQRKSKASEVDVRIVDDEVTIKVVQKKKINCLLLVSKVLDHLQLELHHVAGGQI  389

Query  480   GDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             G++YSFLFN+KI EGST+YASAIAN++IEVVDKHY A  P  +Y
Sbjct  390   GEHYSFLFNTKIYEGSTIYASAIANRVIEVVDKHYMASLPINNY  433



>ref|XP_010522155.1| PREDICTED: transcription factor bHLH10 [Tarenaya hassleriana]
 ref|XP_010522156.1| PREDICTED: transcription factor bHLH10 [Tarenaya hassleriana]
Length=438

 Score =   248 bits (633),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 176/260 (68%), Gaps = 16/260 (6%)
 Frame = -2

Query  1110  SRSSGSLFGEVDEREVNG-AFYQTVDGCRDFENGVFELTGDMNVLAKNRDGKGT---KHF  943
             SR    L G  D+ + +G   Y   +   +F+NG+ E   D+     NR G+G+   K F
Sbjct  189   SRDQSQLLGVDDQIDADGGVMYAGGNNHGEFDNGILEFNTDI----VNRKGQGSGKKKPF  244

Query  942   ATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCS  763
              TER+RR+H  D++  LK L+P+P+K DRAS+V DAI YI EL  T+ E K+LVEKKR  
Sbjct  245   PTERERRIHFKDRFLELKHLLPSPTKGDRASIVADAIEYIKELLGTIEEFKLLVEKKRFG  304

Query  762   RERMKRHKTEGCSSMMDGGDLKSVEDVDQSY--SGTTLRSSWLQRKSKNTEVDVRIIDDE  589
             +   KR + E      +  + K + DVDQS      +LR SWL+R+SK TEVDVRIIDDE
Sbjct  305   KHWSKRARIE------EDSENKPLSDVDQSSFNHNNSLRCSWLRRRSKVTEVDVRIIDDE  358

Query  588   VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIA  409
             V +KLVQ+K+INCLL VSK LD+LQLDLHHVAGG IG++YSFLFN+KI EGS+VYASAIA
Sbjct  359   VIIKLVQKKKINCLLMVSKVLDQLQLDLHHVAGGQIGEHYSFLFNTKIYEGSSVYASAIA  418

Query  408   NKLIEVVDKHYTAIAPTTSY  349
             + L+EVV++ Y +  PT  +
Sbjct  419   DTLMEVVEQQYMSAFPTDGF  438



>emb|CDY15419.1| BnaC04g42040D [Brassica napus]
Length=445

 Score =   248 bits (633),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 165/247 (67%), Gaps = 28/247 (11%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             F++G+ E +   N+  K R  +  K F TER+RR HLN++YEALK L+PNPSK DRAS++
Sbjct  205   FDSGIIEFSK--NIRRKRRGKQKNKPFTTERERRCHLNERYEALKLLIPNPSKGDRASIL  262

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHK---------------------TEGC  727
              D I YINEL+R V ELK LVE+KRC      RHK                      +  
Sbjct  263   QDGIDYINELRRRVSELKFLVERKRCG----GRHKDNNEVDNSNNNNLDDLNIVNDEDDE  318

Query  726   SSMMDGGDLKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINC  550
                 +  D K+  DV DQ  S  TLR SWLQRKSK TEVDVRI+DDEVT+K+VQ+++INC
Sbjct  319   DDDDENMDKKTESDVIDQCSSNNTLRCSWLQRKSKLTEVDVRIVDDEVTIKVVQKRKINC  378

Query  549   LLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTA  370
             LL V+K +D L LDLHHV+GG IG++YSFL N+KI EGST+YASAIANK+IEVVD+H  A
Sbjct  379   LLVVTKVIDHLHLDLHHVSGGQIGEHYSFLLNTKINEGSTIYASAIANKVIEVVDQHNMA  438

Query  369   IAPTTSY  349
               P  +Y
Sbjct  439   ALPINNY  445



>ref|XP_009144239.1| PREDICTED: transcription factor bHLH10-like isoform X2 [Brassica 
rapa]
Length=432

 Score =   247 bits (631),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/288 (48%), Positives = 182/288 (63%), Gaps = 24/288 (8%)
 Frame = -2

Query  1152  LFH-SLPQGGYGFGASRSSGSLFGEVDERE---------VNGAFYQTVDGCRDFENGVFE  1003
             LFH + P         R+S    G  D+ +         +N  +Y+  +    F+NGV E
Sbjct  149   LFHLNFPLQTRDQSQQRNSSCFLGVEDQIQMDANGGGGGINMMYYEGDNNNDGFDNGVIE  208

Query  1002  LTGDMNVLAKNRDGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
              +   N    NR G+G+   + F TER+RRVH ND++  LK L+PNP+KNDRAS+V +AI
Sbjct  209   FSSGGN----NRKGRGSGKSRTFPTERERRVHFNDRFSDLKSLIPNPTKNDRASIVGEAI  264

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRH-----KTEGCSSMMDGGDLKSVEDVDQS--  673
              YI EL RT+ +LK+LVEKK+  R R K+      + E      D    +   + DQS  
Sbjct  265   DYIKELLRTIEDLKMLVEKKKFGRFRSKKRARVGGEEEEEEEEGDNVVYRPKSEGDQSCF  324

Query  672   YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
              +   LR SWL+RKSK TEVDVRIIDDEVT+K+VQ+K+INCLLF ++ LD+LQLDLHHVA
Sbjct  325   SNNKALRCSWLKRKSKVTEVDVRIIDDEVTIKVVQKKKINCLLFTTRVLDQLQLDLHHVA  384

Query  492   GGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             GG IG++YSFLFN+KICEGS VYAS IA+ ++EVV+K Y    P   Y
Sbjct  385   GGQIGEHYSFLFNTKICEGSCVYASGIADTVMEVVEKQYMEAVPANGY  432



>ref|XP_006410252.1| hypothetical protein EUTSA_v10017830mg [Eutrema salsugineum]
 gb|ESQ51705.1| hypothetical protein EUTSA_v10017830mg [Eutrema salsugineum]
Length=441

 Score =   247 bits (631),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 166/236 (70%), Gaps = 13/236 (6%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             F++G+ E + +  +  K R  +  K F TER+RR HLN++YEALK L+P+PSK DRAS++
Sbjct  208   FDSGIIEFSKE--IRRKRRGKQKNKPFTTERERRCHLNERYEALKMLIPSPSKGDRASIL  265

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG----------DLKS  694
              D I YINEL+R V ELK LVE+KRC   R   +  +  +++ D            + K 
Sbjct  266   QDGIDYINELRRRVSELKYLVERKRCGGRRKNNNAVDNNNNLDDRINEDDDDDENMEKKP  325

Query  693   VEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDEL  517
               DV DQ  S  +LR SWLQ KSK TEVDVRI+DDEVT+K+VQ+ +INCLL VSK LD+L
Sbjct  326   ESDVIDQCSSNNSLRCSWLQMKSKVTEVDVRIVDDEVTIKVVQKMKINCLLVVSKVLDQL  385

Query  516   QLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
              LDLHHVAGG IG++YSFL N+KI EGST+YASAIAN++IEVVDKHY A  P  +Y
Sbjct  386   HLDLHHVAGGQIGEHYSFLLNTKIYEGSTIYASAIANRVIEVVDKHYMAALPINNY  441



>ref|XP_009119085.1| PREDICTED: transcription factor bHLH89 [Brassica rapa]
Length=427

 Score =   246 bits (629),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 180/264 (68%), Gaps = 24/264 (9%)
 Frame = -2

Query  1137  PQGGYGFGASRSSGSLFGEVDEREVNGA---FYQTVDGCRDFENGVFELTGDMNVLAKNR  967
             P     F     SG+L G  D+ E NG     Y   +   + ENG+            NR
Sbjct  162   PLYHLNFPMQPPSGTLLGVEDQTEFNGVNSLIYAEENN--NTENGL------------NR  207

Query  966   DGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
              G+G+   K F TER+RRVH  D++  LK L+PNP+KNDRAS+V +AI +I EL RT+ E
Sbjct  208   KGRGSRKRKVFPTERERRVHFKDRFGDLKNLIPNPTKNDRASIVGEAIDHIKELLRTIEE  267

Query  795   LKILVEKKRCSRERMKRHKTE-GCSSMMDGGDLKSVEDVDQ---SYSGTTLRSSWLQRKS  628
              K+L+EKKR +R+R KR + E G   + D       E V+Q   +   ++LR SWL+RKS
Sbjct  268   FKMLLEKKRITRQRNKRGRIEIGEEDVGDENYNAQSEVVEQCLVNKKNSSLRCSWLKRKS  327

Query  627   KNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSK  448
             K TEVDVRIIDDEVT+K+VQ+K+INCLLFVSK +D+LQLDLHHVAG  IG+++SFLFN+K
Sbjct  328   KFTEVDVRIIDDEVTIKIVQKKKINCLLFVSKVIDQLQLDLHHVAGAQIGEHHSFLFNTK  387

Query  447   ICEGSTVYASAIANKLIEVVDKHY  376
             ICEGS+VYASAIA++++EV++KHY
Sbjct  388   ICEGSSVYASAIADRVMEVLEKHY  411



>ref|XP_009144238.1| PREDICTED: transcription factor bHLH10-like isoform X1 [Brassica 
rapa]
Length=454

 Score =   247 bits (631),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 138/288 (48%), Positives = 182/288 (63%), Gaps = 24/288 (8%)
 Frame = -2

Query  1152  LFH-SLPQGGYGFGASRSSGSLFGEVDERE---------VNGAFYQTVDGCRDFENGVFE  1003
             LFH + P         R+S    G  D+ +         +N  +Y+  +    F+NGV E
Sbjct  171   LFHLNFPLQTRDQSQQRNSSCFLGVEDQIQMDANGGGGGINMMYYEGDNNNDGFDNGVIE  230

Query  1002  LTGDMNVLAKNRDGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
              +   N    NR G+G+   + F TER+RRVH ND++  LK L+PNP+KNDRAS+V +AI
Sbjct  231   FSSGGN----NRKGRGSGKSRTFPTERERRVHFNDRFSDLKSLIPNPTKNDRASIVGEAI  286

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRH-----KTEGCSSMMDGGDLKSVEDVDQS--  673
              YI EL RT+ +LK+LVEKK+  R R K+      + E      D    +   + DQS  
Sbjct  287   DYIKELLRTIEDLKMLVEKKKFGRFRSKKRARVGGEEEEEEEEGDNVVYRPKSEGDQSCF  346

Query  672   YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
              +   LR SWL+RKSK TEVDVRIIDDEVT+K+VQ+K+INCLLF ++ LD+LQLDLHHVA
Sbjct  347   SNNKALRCSWLKRKSKVTEVDVRIIDDEVTIKVVQKKKINCLLFTTRVLDQLQLDLHHVA  406

Query  492   GGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             GG IG++YSFLFN+KICEGS VYAS IA+ ++EVV+K Y    P   Y
Sbjct  407   GGQIGEHYSFLFNTKICEGSCVYASGIADTVMEVVEKQYMEAVPANGY  454



>ref|XP_010414163.1| PREDICTED: transcription factor bHLH10-like isoform X1 [Camelina 
sativa]
 ref|XP_010414164.1| PREDICTED: transcription factor bHLH10-like isoform X1 [Camelina 
sativa]
Length=444

 Score =   246 bits (629),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 159/228 (70%), Gaps = 7/228 (3%)
 Frame = -2

Query  1011  VFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
             V E      V  K R  + + +  TER+RRVH ND+++ LK L+PNP+K+DRAS+V +AI
Sbjct  217   VLEFNTTGVVTRKRRRSQKSNNSPTERERRVHFNDRFQDLKSLIPNPTKSDRASIVGEAI  276

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGD---LKSVEDVDQS----  673
              YI EL RT+ E K+LVEKKR  R R K+    G     +  D    K   +VDQS    
Sbjct  277   DYIKELLRTIEEFKMLVEKKRFGRFRSKKKARRGEDQQQEEEDTVNYKPQSEVDQSCFSK  336

Query  672   YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
              +  +LR SWL+RKSK TEVDVRIIDDEVT+KLVQ+K+INCLLF +K LD+LQLDLHHVA
Sbjct  337   NNNNSLRCSWLKRKSKVTEVDVRIIDDEVTIKLVQKKKINCLLFTTKVLDQLQLDLHHVA  396

Query  492   GGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             GG IG+YYSFLFN+KICEGS +YAS IA+ ++EVV+K Y    P+  Y
Sbjct  397   GGQIGEYYSFLFNTKICEGSCLYASGIADTVMEVVEKQYMEAVPSNGY  444



>emb|CDY10784.1| BnaA05g11520D [Brassica napus]
Length=454

 Score =   246 bits (629),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 138/288 (48%), Positives = 181/288 (63%), Gaps = 24/288 (8%)
 Frame = -2

Query  1152  LFH-SLPQGGYGFGASRSSGSLFGEVDERE---------VNGAFYQTVDGCRDFENGVFE  1003
             LFH + P         R+S    G  D+ +         +N  +Y+  +    F+NGV E
Sbjct  171   LFHLNFPLQTRDQSQQRNSSCFLGVEDQIQMDANGGGGGINMMYYEGDNNNDGFDNGVIE  230

Query  1002  LTGDMNVLAKNRDGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
              +   N    NR G+G+   + F TER+RRVH ND++  LK L+PNP+KNDRAS+V +AI
Sbjct  231   FSSGGN----NRKGRGSGKSRTFPTERERRVHFNDRFSDLKSLIPNPTKNDRASIVGEAI  286

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRHK-----TEGCSSMMDGGDLKSVEDVDQS--  673
              YI EL RT+ +LK+LVEKK+  R R K+        E      D    +   + DQS  
Sbjct  287   DYIKELLRTIEDLKMLVEKKKFGRFRSKKRARVGGEEEEEEEEGDNVVYRPKSEGDQSCF  346

Query  672   YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
              +   LR SWL+RKSK TEVDVRIIDDEVT+K+VQ+K+INCLLF ++ LD+LQLDLHHVA
Sbjct  347   SNNKALRCSWLKRKSKVTEVDVRIIDDEVTIKVVQKKKINCLLFTTRVLDQLQLDLHHVA  406

Query  492   GGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             GG IG++YSFLFN+KICEGS VYAS IA+ ++EVV+K Y    P   Y
Sbjct  407   GGQIGEHYSFLFNTKICEGSCVYASGIADTVMEVVEKQYMEAVPANGY  454



>ref|XP_010469749.1| PREDICTED: transcription factor bHLH91-like [Camelina sativa]
Length=412

 Score =   244 bits (624),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 165/239 (69%), Gaps = 19/239 (8%)
 Frame = -2

Query  1026  DFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASV  847
             + ++G+ E + +  +  K R  +  + F TER+RR HLN++YEALK L+P+PSK DRAS+
Sbjct  180   NIDSGIIEFSKE--IRRKGRGKRKNRPFTTERERRCHLNERYEALKLLIPSPSKGDRASI  237

Query  846   VHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMM------------DGGD  703
             + D I YINEL+R V ELK LVE+KR       RH+     +              +  +
Sbjct  238   LQDGIDYINELRRRVSELKYLVERKRYG----GRHQNNEVDNNNLDDQNNEDDVDDENMN  293

Query  702   LKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKAL  526
              K   DV DQ  S  +LR SWLQRKSK +EVDVRI+DDEVT+K+ Q+K+INCLL VSK L
Sbjct  294   KKPESDVTDQCSSNNSLRCSWLQRKSKASEVDVRIVDDEVTIKVAQKKKINCLLLVSKVL  353

Query  525   DELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             D LQL+LHHVAGG IG++YSFLFN+KI EGST+YASAIAN++IEVVDKHY A  P  +Y
Sbjct  354   DHLQLELHHVAGGQIGEHYSFLFNTKIYEGSTIYASAIANRVIEVVDKHYMASLPINNY  412



>emb|CDY47722.1| BnaA10g04110D [Brassica napus]
Length=425

 Score =   243 bits (621),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 179/264 (68%), Gaps = 24/264 (9%)
 Frame = -2

Query  1137  PQGGYGFGASRSSGSLFGEVDEREVNGA---FYQTVDGCRDFENGVFELTGDMNVLAKNR  967
             P     F     SG+L G  D+ E NG     Y   +   + ENG+            NR
Sbjct  160   PLYHLNFPMQPPSGTLLGVEDQTEFNGVNSLIYAEENN--NTENGL------------NR  205

Query  966   DGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
              G+G+   K F TER+RRVH  D++  LK L+PNP+KNDRAS+V +AI +I EL RT+ E
Sbjct  206   KGRGSRKRKIFPTERERRVHFKDRFGDLKNLIPNPTKNDRASIVGEAIDHIKELLRTIEE  265

Query  795   LKILVEKKRCSRERMKRHKTE-GCSSMMDGGDLKSVEDVDQ---SYSGTTLRSSWLQRKS  628
              K+L+EKKR +R+R KR + E G   + D       E V+Q   +   ++LR SWL+RKS
Sbjct  266   FKMLLEKKRITRQRNKRGRIEIGEEDVGDENYNAQSEVVEQCLVNKKNSSLRCSWLKRKS  325

Query  627   KNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSK  448
             K TEVDVRIIDDEVT+K+VQ+K+INCLLFVSK +D+LQLDLHHVAG  IG+++SFLFN+K
Sbjct  326   KFTEVDVRIIDDEVTIKIVQKKKINCLLFVSKVIDQLQLDLHHVAGAQIGEHHSFLFNTK  385

Query  447   ICEGSTVYASAIANKLIEVVDKHY  376
             ICEGS+VYASAIA++++EV++K Y
Sbjct  386   ICEGSSVYASAIADRVMEVLEKQY  409



>ref|XP_006410254.1| hypothetical protein EUTSA_v10016616mg [Eutrema salsugineum]
 gb|ESQ51707.1| hypothetical protein EUTSA_v10016616mg [Eutrema salsugineum]
Length=463

 Score =   244 bits (623),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 164/238 (69%), Gaps = 19/238 (8%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRA  853
             F+NGVFE          NR G+G+   + F TER+RRVH ND++  LK L+PNP+KNDRA
Sbjct  232   FDNGVFEFNS-----GGNRKGRGSGKSRTFPTERERRVHFNDRFFDLKNLIPNPTKNDRA  286

Query  852   SVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVE-----  688
             S+V +AI YI EL RT+ E K+LVEKK+  + R K+ K           +  +V      
Sbjct  287   SIVGEAIDYIKELLRTIEEFKMLVEKKKIGKFRSKK-KARTGGEEDQEQEEDTVSYRPQS  345

Query  687   DVDQS-----YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALD  523
             +VDQS      +  +LR SWL+RKSK TEVDVRIIDDEVT+KLVQ+K++NCLLF ++ LD
Sbjct  346   EVDQSCFNKKSNNNSLRCSWLKRKSKVTEVDVRIIDDEVTIKLVQKKKVNCLLFTTRVLD  405

Query  522   ELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             +LQLDLHHVAGG IG++YSFLFN+KICEGS VYAS IA+ ++EVV+K Y    P   Y
Sbjct  406   QLQLDLHHVAGGQIGEHYSFLFNTKICEGSCVYASGIADTVMEVVEKQYMEAVPINGY  463



>emb|CDY10181.1| BnaC05g04240D [Brassica napus]
Length=425

 Score =   243 bits (620),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 176/264 (67%), Gaps = 24/264 (9%)
 Frame = -2

Query  1137  PQGGYGFGASRSSGSLFGEVDEREVNGA---FYQTVDGCRDFENGVFELTGDMNVLAKNR  967
             P     F     SG+L G  D+ E NG     Y   +     ENG+            NR
Sbjct  160   PLYHLNFPLQPPSGTLLGVEDQTEFNGVNSLIYAEENNTT--ENGL------------NR  205

Query  966   DGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
              G+G+   K F TER+RRVH  D++  LK L+PNP+KNDRAS+V +AI +I EL RT+ E
Sbjct  206   KGRGSRKRKVFPTERERRVHFKDRFGDLKNLIPNPTKNDRASIVGEAIDHIKELLRTIEE  265

Query  795   LKILVEKKRCSRERMKRHKTE-GCSSMMDGGDLKSVEDVDQ---SYSGTTLRSSWLQRKS  628
              K+L+EKKR +R+R KR + E G   + D       E V+Q   +     LR SWL+RKS
Sbjct  266   FKMLLEKKRITRQRNKRGRIEVGEEDVGDENYNAQSEVVEQCLVNKKNNALRCSWLKRKS  325

Query  627   KNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSK  448
             K TEVDVRIIDDEVT+K+VQ+K+INCLLFVSK +D+LQLDLHHVAG  IG+++SFLFN+K
Sbjct  326   KFTEVDVRIIDDEVTIKIVQKKKINCLLFVSKVIDQLQLDLHHVAGAQIGEHHSFLFNTK  385

Query  447   ICEGSTVYASAIANKLIEVVDKHY  376
             ICEGS+VYASAIA++++EV++K Y
Sbjct  386   ICEGSSVYASAIADRVMEVLEKQY  409



>ref|XP_009141141.1| PREDICTED: transcription factor bHLH10 [Brassica rapa]
Length=441

 Score =   243 bits (620),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 161/236 (68%), Gaps = 12/236 (5%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             FE+G FE     N       GK ++ F TER+RRVH ND++  LK L+PNP+K+DRAS+V
Sbjct  207   FESGAFEFGNGGNNRRGRGSGK-SRTFPTERERRVHFNDRFFDLKNLIPNPTKSDRASIV  265

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEG------CSSMMDGGDLKSVEDV  682
              +AI YI EL RT+ E K+LVEKK+  + R K+    G           D    +   +V
Sbjct  266   GEAIDYIKELLRTIEEFKMLVEKKKFGKFRSKKKAKTGGEEDLEVEQEEDNVSYRPQSEV  325

Query  681   DQS-----YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDEL  517
             DQS      +  +LR SWL+RKSK TEVDVRIIDDEVT+K+VQ+K+INCLLF +K LD+L
Sbjct  326   DQSCFNKKNNNKSLRCSWLKRKSKVTEVDVRIIDDEVTIKVVQKKKINCLLFTTKVLDQL  385

Query  516   QLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             +LDLHHVAGG IG++YSFLFN+KICEGS VYAS IA+ ++EVV+K Y    PT  Y
Sbjct  386   KLDLHHVAGGQIGEHYSFLFNTKICEGSCVYASGIADTVMEVVEKQYMEAVPTNGY  441



>ref|XP_002879313.1| hypothetical protein ARALYDRAFT_482049 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55572.1| hypothetical protein ARALYDRAFT_482049 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   243 bits (620),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 157/222 (71%), Gaps = 10/222 (5%)
 Frame = -2

Query  984  VLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRT  805
            V  K R  + ++ F TER+RRVH ND++  LK L+PNP+K  RAS+V +AI YI EL RT
Sbjct  229  VTRKGRGSRKSRTFPTERERRVHFNDRFFDLKNLIPNPTKIGRASIVGEAIDYIKELLRT  288

Query  804  VGELKILVEKKRCSRERMKRH------KTEGCSSMMDGGDLKSVEDVDQS----YSGTTL  655
            + E K+LVEKKRC R R K+         E      D  + K   +VDQS     + T+L
Sbjct  289  IEEFKMLVEKKRCGRFRSKKRARVGEGGGEDQEEEEDTVNYKPQSEVDQSGFNKNNNTSL  348

Query  654  RSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            R SWL+RKSK TE+DVRIIDDEVT+KLVQ+K+INCLLF +K LD+LQLDLHHVAGG IG+
Sbjct  349  RCSWLKRKSKVTEIDVRIIDDEVTIKLVQKKKINCLLFTTKVLDQLQLDLHHVAGGQIGE  408

Query  474  YYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
            +YSFLFN+KICEGS VYAS IA+ ++EVV+K Y    PT  Y
Sbjct  409  HYSFLFNTKICEGSCVYASGIADTVMEVVEKQYMEAVPTNGY  450



>emb|CDY24747.1| BnaC04g13520D [Brassica napus]
Length=436

 Score =   242 bits (617),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 169/253 (67%), Gaps = 14/253 (6%)
 Frame = -2

Query  1077  DEREVNGAFYQTVDGCR--DFENGVFELTGDMNVLAKNRDGKGT---KHFATERQRRVHL  913
             D++  N  F    D  +   F+NGV E +   N    NR G+G+   + F TER+RRVH 
Sbjct  188   DQQRNNSCFLGVEDQIQMDGFDNGVIEFSSGGN----NRKGRGSGKSRTFPTERERRVHF  243

Query  912   NDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMK---RH  742
             ND++  LK L+PNP+KNDRAS+V +AI YI EL RT+ +LK+LVEKK   R R K   R 
Sbjct  244   NDRFSDLKSLIPNPTKNDRASIVGEAIDYIKELLRTIEDLKMLVEKKNFGRFRSKKRARV  303

Query  741   KTEGCSSMMDGGDLKSVEDVDQSY--SGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQ  568
               E      D    +   +V+QS   +   LR SWL+RKSK TEVDVRIIDDEVT+K+VQ
Sbjct  304   GGEEEEQEGDNVVYRPKSEVEQSCFNNNKALRCSWLRRKSKVTEVDVRIIDDEVTIKVVQ  363

Query  567   QKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVV  388
             +K+INCLLF ++ LD+LQLDL HVAGG IG++YSFLFN+KICEGS VYAS IA+ ++EVV
Sbjct  364   KKKINCLLFTTRVLDQLQLDLQHVAGGQIGEHYSFLFNTKICEGSCVYASGIADTVMEVV  423

Query  387   DKHYTAIAPTTSY  349
             +K Y    P   Y
Sbjct  424   EKQYMEAVPANGY  436



>ref|XP_010469746.1| PREDICTED: transcription factor bHLH10-like isoform X2 [Camelina 
sativa]
 ref|XP_010469747.1| PREDICTED: transcription factor bHLH10-like isoform X2 [Camelina 
sativa]
Length=459

 Score =   243 bits (619),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 158/227 (70%), Gaps = 6/227 (3%)
 Frame = -2

Query  1011  VFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
             V E      V  K R  K +    TER+RRVH +D+++ LK L+PNP+K+DRAS+V +AI
Sbjct  233   VLEFNTTGVVTRKRRRSKKSNTSPTERERRVHFHDRFQDLKSLIPNPTKSDRASIVGEAI  292

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRHKTEG---CSSMMDGGDLKSVEDVDQS---Y  670
              YI EL RT+ E K+LVEKKR  R R K+    G        D  + K   +VDQS    
Sbjct  293   DYIKELLRTIEEFKMLVEKKRFGRFRSKKKARRGEDQHEEEEDTVNYKPQSEVDQSCFNK  352

Query  669   SGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAG  490
             +  +LR SWL+RKSK TEVDVRIIDDEVT+KLVQ+K+INCLLF +K LD+LQLDLHHVAG
Sbjct  353   NNNSLRCSWLKRKSKVTEVDVRIIDDEVTIKLVQKKKINCLLFTTKVLDQLQLDLHHVAG  412

Query  489   GLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             G IG++YSFLFN+KICEGS VYAS IA+ ++EVV+K Y    P+  Y
Sbjct  413   GQIGEHYSFLFNTKICEGSCVYASGIADTVMEVVEKQYMEAVPSNGY  459



>ref|XP_010469745.1| PREDICTED: transcription factor bHLH10-like isoform X1 [Camelina 
sativa]
Length=470

 Score =   243 bits (619),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 158/227 (70%), Gaps = 6/227 (3%)
 Frame = -2

Query  1011  VFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
             V E      V  K R  K +    TER+RRVH +D+++ LK L+PNP+K+DRAS+V +AI
Sbjct  244   VLEFNTTGVVTRKRRRSKKSNTSPTERERRVHFHDRFQDLKSLIPNPTKSDRASIVGEAI  303

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRHKTEG---CSSMMDGGDLKSVEDVDQS---Y  670
              YI EL RT+ E K+LVEKKR  R R K+    G        D  + K   +VDQS    
Sbjct  304   DYIKELLRTIEEFKMLVEKKRFGRFRSKKKARRGEDQHEEEEDTVNYKPQSEVDQSCFNK  363

Query  669   SGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAG  490
             +  +LR SWL+RKSK TEVDVRIIDDEVT+KLVQ+K+INCLLF +K LD+LQLDLHHVAG
Sbjct  364   NNNSLRCSWLKRKSKVTEVDVRIIDDEVTIKLVQKKKINCLLFTTKVLDQLQLDLHHVAG  423

Query  489   GLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             G IG++YSFLFN+KICEGS VYAS IA+ ++EVV+K Y    P+  Y
Sbjct  424   GQIGEHYSFLFNTKICEGSCVYASGIADTVMEVVEKQYMEAVPSNGY  470



>gb|KHN15541.1| Transcription factor bHLH91 [Glycine soja]
Length=236

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 171/229 (75%), Gaps = 19/229 (8%)
 Frame = -2

Query  1038  DGCRDFENGVFELTGDMNVLAKNRDGKGTKHFA---TERQRRVHLNDKYEALKKLVPNPS  868
             D  +DF NG+ + T     + K R GK TK F    TERQRRV L+ K++ALK+L+PNPS
Sbjct  17    DDIQDFGNGLVDFT--QQEVGKRRGGKRTKQFTSTTTERQRRVDLSSKFDALKELIPNPS  74

Query  867   KNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRER-MKRHK--TEGCSSMMDGGDLK  697
             K+DRASVV DAI YI ELKRTV ELK+LVEKKR  ++R M RHK  TEG SS +D  +  
Sbjct  75    KSDRASVVGDAINYIRELKRTVEELKLLVEKKRLEKQRVMMRHKVETEGESSNLDPAE--  132

Query  696   SVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDEL  517
                     YS  +LRSSW+QRK+K+TEVDVRI+D+EVT+KLVQ+K+I+CL+ VS  LD+L
Sbjct  133   --------YS-ESLRSSWIQRKTKDTEVDVRIVDNEVTIKLVQRKKIDCLVHVSHLLDQL  183

Query  516   QLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTA  370
              LDL HVAGG IGD+ S+LFN+KICEGS++YASAIANKLI+V+D    A
Sbjct  184   NLDLQHVAGGHIGDFCSYLFNTKICEGSSIYASAIANKLIQVMDTSLAA  232



>gb|AAL55717.1|AF251695_1 putative transcription factor BHLH10 [Arabidopsis thaliana]
 gb|AAD20667.1| unknown protein [Arabidopsis thaliana]
Length=447

 Score =   240 bits (613),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 156/223 (70%), Gaps = 11/223 (5%)
 Frame = -2

Query  984  VLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRT  805
            V  K R  + ++   TER+RRVH ND++  LK L+PNP+K DRAS+V +AI YI EL RT
Sbjct  225  VTRKGRGSRKSRTSPTERERRVHFNDRFFDLKNLIPNPTKIDRASIVGEAIDYIKELLRT  284

Query  804  VGELKILVEKKRCSRERMKRH-------KTEGCSSMMDGGDLKSVEDVDQSY----SGTT  658
            + E K+LVEKKRC R R K+          E      D  + K   +VDQS     +  +
Sbjct  285  IEEFKMLVEKKRCGRFRSKKRARVGEGGGGEDQEEEEDTVNYKPQSEVDQSCFNKNNNNS  344

Query  657  LRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIG  478
            LR SWL+RKSK TEVDVRIIDDEVT+KLVQ+K+INCLLF +K LD+LQLDLHHVAGG IG
Sbjct  345  LRCSWLKRKSKVTEVDVRIIDDEVTIKLVQKKKINCLLFTTKVLDQLQLDLHHVAGGQIG  404

Query  477  DYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
            ++YSFLFN+KICEGS VYAS IA+ L+EVV+K Y    P+  Y
Sbjct  405  EHYSFLFNTKICEGSCVYASGIADTLMEVVEKQYMEAVPSNGY  447



>ref|NP_180680.2| transcription factor bHLH10 [Arabidopsis thaliana]
 sp|Q84TK1.1|BH010_ARATH RecName: Full=Transcription factor bHLH10; AltName: Full=Basic 
helix-loop-helix protein 10; Short=AtbHLH10; Short=bHLH 10; 
AltName: Full=Transcription factor EN 23; AltName: Full=bHLH 
transcription factor bHLH010 [Arabidopsis thaliana]
 gb|AAO64131.1| putative bHLH protein [Arabidopsis thaliana]
 gb|AAP40433.1| putative bHLH protein [Arabidopsis thaliana]
 dbj|BAF00507.1| putative transcription factor BHLH10 [Arabidopsis thaliana]
 gb|AEC08511.1| transcription factor bHLH10 [Arabidopsis thaliana]
Length=458

 Score =   240 bits (613),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 156/223 (70%), Gaps = 11/223 (5%)
 Frame = -2

Query  984  VLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRT  805
            V  K R  + ++   TER+RRVH ND++  LK L+PNP+K DRAS+V +AI YI EL RT
Sbjct  236  VTRKGRGSRKSRTSPTERERRVHFNDRFFDLKNLIPNPTKIDRASIVGEAIDYIKELLRT  295

Query  804  VGELKILVEKKRCSRERMKRH-------KTEGCSSMMDGGDLKSVEDVDQSY----SGTT  658
            + E K+LVEKKRC R R K+          E      D  + K   +VDQS     +  +
Sbjct  296  IEEFKMLVEKKRCGRFRSKKRARVGEGGGGEDQEEEEDTVNYKPQSEVDQSCFNKNNNNS  355

Query  657  LRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIG  478
            LR SWL+RKSK TEVDVRIIDDEVT+KLVQ+K+INCLLF +K LD+LQLDLHHVAGG IG
Sbjct  356  LRCSWLKRKSKVTEVDVRIIDDEVTIKLVQKKKINCLLFTTKVLDQLQLDLHHVAGGQIG  415

Query  477  DYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
            ++YSFLFN+KICEGS VYAS IA+ L+EVV+K Y    P+  Y
Sbjct  416  EHYSFLFNTKICEGSCVYASGIADTLMEVVEKQYMEAVPSNGY  458



>emb|CDY24749.1| BnaC04g13540D [Brassica napus]
Length=431

 Score =   239 bits (609),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 157/215 (73%), Gaps = 6/215 (3%)
 Frame = -2

Query  975  KNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
            K R  +  K F TER+RR HLND++EALK L+P+P+K DRAS++ D I YI EL+R V E
Sbjct  213  KGRGKQKNKPFTTERERRCHLNDRFEALKLLIPSPTKADRASILQDGIDYIKELQRRVSE  272

Query  795  LKILVEKKRCS-RERMKRHKTEGCSSMMDGGD---LKSVE-DV-DQSYSGTTLRSSWLQR  634
            LK LVE+K+C  R     + ++ C +     D   +K +E DV DQ  S  +LR SWLQR
Sbjct  273  LKYLVERKKCGGRHNNNNNNSDDCINEDTNDDENIVKKLESDVRDQCSSNNSLRCSWLQR  332

Query  633  KSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFN  454
            KSK TEVDVRI+DDEVT+K+ Q+K+INCLL VSK LD+L LDLHHVAGG IG++Y FL N
Sbjct  333  KSKVTEVDVRIVDDEVTIKVFQKKKINCLLVVSKVLDQLHLDLHHVAGGQIGEHYCFLLN  392

Query  453  SKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
            +KI EGST+YASA+ANK+IEVVD+H+ A  P   +
Sbjct  393  TKINEGSTIYASAVANKVIEVVDQHHMAALPINKF  427



>ref|XP_006417951.1| hypothetical protein EUTSA_v100099920mg, partial [Eutrema salsugineum]
 gb|ESQ36304.1| hypothetical protein EUTSA_v100099920mg, partial [Eutrema salsugineum]
Length=374

 Score =   237 bits (604),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 180/259 (69%), Gaps = 19/259 (7%)
 Frame = -2

Query  1101  SGSLFG--EVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVLAKNRDGKGT---KHFAT  937
             +G+L G  E D+ E NG     VD     ++ ++    +   +  NR G+G+   K F T
Sbjct  119   NGALLGVLEDDQMESNG-----VD-----DHLIYAEENNNTEIGLNRKGRGSRKRKIFPT  168

Query  936   ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
             ER+RRVH  D++  LK L+PNP+KNDRAS+V +AI YI EL RT+ +LK+L+E+KR  + 
Sbjct  169   ERERRVHFKDRFGDLKSLIPNPTKNDRASIVGEAIDYIKELLRTIEDLKMLMEQKRIIKN  228

Query  756   RMKRHKTEG-CSSMMDGGDLKSVEDVDQ---SYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
             R KR + E      +DG      E V+Q   + +  +LR SWL+RKSK TEVDVRIIDDE
Sbjct  229   RNKRVRIEEEGDDFVDGKYKAQSEVVEQCLINKNNNSLRCSWLKRKSKFTEVDVRIIDDE  288

Query  588   VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIA  409
             VT+K+VQ+K+INCLLFVSK +D+LQLD+HHVAG  IG+++SFLFN+KICEGS+VYASAIA
Sbjct  289   VTIKIVQKKKINCLLFVSKVIDQLQLDIHHVAGAQIGEHHSFLFNTKICEGSSVYASAIA  348

Query  408   NKLIEVVDKHYTAIAPTTS  352
             ++++EV++K Y     T +
Sbjct  349   DRVMEVLEKQYMEALSTNN  367



>ref|XP_010691929.1| PREDICTED: transcription factor bHLH91-like [Beta vulgaris subsp. 
vulgaris]
Length=538

 Score =   241 bits (616),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 184/269 (68%), Gaps = 28/269 (10%)
 Frame = -2

Query  1101  SGSLFGEVDERE---VNGAFYQTVDGCRDFE-NGVFELTGDMNVLAKNRDGKGTKHFATE  934
             + SLFG +D+ E   +NG      DG      NGVFE           + GK  K+F TE
Sbjct  268   TSSLFGGMDDVEGNTINGIAGIYQDGDHHIHGNGVFEFG-----KGDGKGGKCPKNFVTE  322

Query  933   RQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRER  754
             RQRR + NDKY+ L+ LVPN +K DRAS+VHDAI YI EL+ TVGELK+L+E+KR S+ER
Sbjct  323   RQRRQNFNDKYQTLRGLVPNQTKGDRASIVHDAISYIKELRTTVGELKLLLEEKRMSKER  382

Query  753   MKRHK----------------TEGCSSMMDGGDLKSVEDVDQSYSGTT---LRSSWLQRK  631
             +KRHK                 +  S+ +DG       D D+ + G+T   LRSSW+QRK
Sbjct  383   IKRHKPDNHQDTTGGTSTNGGVDNLSNGVDGAAAVVKPDPDEEFKGSTAIQLRSSWIQRK  442

Query  630   SKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNS  451
              K+TEVDVRI+DD+VT+KLVQ+K+INCLL VS+ LD+L LDL HVAGG +GDYYS+LFNS
Sbjct  443   CKDTEVDVRIVDDDVTIKLVQRKKINCLLTVSRNLDDLHLDLRHVAGGHVGDYYSYLFNS  502

Query  450   KICEGSTVYASAIANKLIEVVDKHYTAIA  364
             KICEGS+VYASAIANKLIEVV++ Y A +
Sbjct  503   KICEGSSVYASAIANKLIEVVERQYAATS  531



>ref|XP_006854151.1| hypothetical protein AMTR_s00048p00183690 [Amborella trichopoda]
 gb|ERN15618.1| hypothetical protein AMTR_s00048p00183690 [Amborella trichopoda]
Length=476

 Score =   239 bits (611),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 146/273 (53%), Positives = 185/273 (68%), Gaps = 18/273 (7%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQT--VDGCRDFENGVFELTGDMN  985
             R+LF +LP   Y   + + +G  FG VDE+E  G  YQ   V+G R + N V E  G  N
Sbjct  213   RDLFTTLPHN-YHMPSPKGNG-YFG-VDEKE--GTMYQEGGVEG-RQYGNTVLEF-GRKN  265

Query  984   VLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRT  805
                K   G+GTK F TER RR +LN K+  L+ LVPNP+K DRAS+V DA  YI EL RT
Sbjct  266   SKGK---GRGTKPFTTERDRREYLNKKFSTLRSLVPNPTKADRASIVGDATEYIKELLRT  322

Query  804   VGELKILVEKKRCSRERMKRHKTEGCSSM-MDGGDLKSVEDV---DQSYSGTTLRSSWLQ  637
             V ELKILVEKKRC  +R K+ KT+G S + ++    K+ +D    ++ ++G+ LRSSWLQ
Sbjct  323   VDELKILVEKKRCGGDRSKKVKTDGESCVNIENSSSKNPDDQTDRERKFNGS-LRSSWLQ  381

Query  636   RKSKN-TEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFL  460
             R SK  T VDVRI+DDE  +KL Q+KR NCLL+VSK LDELQL++ HV G  IGD Y F+
Sbjct  382   RTSKEGTLVDVRIVDDEANIKLTQRKRRNCLLYVSKILDELQLEIIHVTGANIGDNYIFM  441

Query  459   FNSKICEGSTVYASAIANKLIEVVDKHYTAIAP  361
             FN+KI EGS VYASAIA+KL+EVVD+ Y   +P
Sbjct  442   FNTKIHEGSCVYASAIASKLMEVVDRQYPPFSP  474



>emb|CDY57093.1| BnaA04g28800D [Brassica napus]
Length=442

 Score =   238 bits (608),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 162/236 (69%), Gaps = 12/236 (5%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             FE+G F+ +   N       GK ++ F TER+RRVH ND++  LK L+PNP+K+DRAS+V
Sbjct  208   FESGAFDFSNGGNNRRGRGSGK-SRTFPTERERRVHFNDRFFDLKNLIPNPTKSDRASIV  266

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEG------CSSMMDGGDLKSVEDV  682
              +AI YI EL RT+ E K+LVEKK+  + R K+    G           D    +   +V
Sbjct  267   GEAIDYIKELLRTIEEFKMLVEKKKFGKFRSKKKAKTGGEEDLEVEQEEDNVSYRPQSEV  326

Query  681   DQSY-----SGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDEL  517
             DQS      +  +LR SWL+RKSK TEVDVRIIDDEVT+K+VQ+K+INCLLF +K LD+L
Sbjct  327   DQSCFNKKNNNKSLRCSWLKRKSKVTEVDVRIIDDEVTIKVVQKKKINCLLFTTKVLDQL  386

Query  516   QLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             +LDLHHVAGG IG++YSFLFN+KICEGS VYAS IA+ ++EVV+K Y    PT  Y
Sbjct  387   KLDLHHVAGGQIGEHYSFLFNTKICEGSCVYASGIADTVMEVVEKQYMEAVPTNGY  442



>emb|CDY15418.1| BnaC04g42050D [Brassica napus]
Length=448

 Score =   238 bits (608),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 162/236 (69%), Gaps = 12/236 (5%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             FE+G FE     N       GK ++ F TER+RRVH ND++  LK L+PNP+K+DRAS+V
Sbjct  214   FESGAFEFGNGGNNRRGRGSGK-SRTFPTERERRVHFNDRFFDLKNLIPNPTKSDRASIV  272

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRH-KTEGCSSMM-----DGGDLKSVEDV  682
              +AI YI EL RT+ E K+LVEKK+  + R K+  KT G   +      D    +   +V
Sbjct  273   GEAIDYIKELLRTIEEFKMLVEKKKFGKFRSKKKPKTCGEEDLEQEQEGDNVSYRPQSEV  332

Query  681   DQSY-----SGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDEL  517
             DQS         +LR SWL+RKSK TEVDVRIIDDEVT+K+VQ+K+INCLLF +K LD+L
Sbjct  333   DQSCFNMKNKNKSLRCSWLKRKSKVTEVDVRIIDDEVTIKVVQKKKINCLLFTTKVLDQL  392

Query  516   QLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             +LDLHHVAGG IG++YSFLFN+KICE S VYAS IA+ ++EVV+K Y    PT  Y
Sbjct  393   KLDLHHVAGGQIGEHYSFLFNTKICEESCVYASGIADTVMEVVEKQYMEAVPTNGY  448



>ref|XP_003638303.1| Transcription factor bHLH10 [Medicago truncatula]
Length=483

 Score =   239 bits (610),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 155/201 (77%), Gaps = 7/201 (3%)
 Frame = -2

Query  963  GKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKIL  784
            GK T+H  TE+QRR  L  +Y+ L+ L+PN +K+DRASVV DAI Y+ EL RTV ELK+L
Sbjct  286  GKATEHLTTEKQRREQLKGRYKILRSLIPNSTKDDRASVVGDAIEYLRELIRTVNELKLL  345

Query  783  VEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVR  604
            VEKKR   E  KRHKTE  ++  +   +K   D D S     +R+SWLQRKSK++EVDVR
Sbjct  346  VEKKRHEIEICKRHKTEDYAA--ESCHMKPFGDPDGS-----IRTSWLQRKSKDSEVDVR  398

Query  603  IIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
            IIDD+VT+KL Q+K++NCLLFVSK LDELQL+L+HVAGG +G+Y SFLFNSK+ EGS+V+
Sbjct  399  IIDDDVTIKLFQRKKVNCLLFVSKVLDELQLELNHVAGGHVGEYCSFLFNSKVIEGSSVH  458

Query  423  ASAIANKLIEVVDKHYTAIAP  361
            ASAIAN++I+V+D  Y A+ P
Sbjct  459  ASAIANRVIDVLDTQYAAVVP  479



>ref|XP_006490222.1| PREDICTED: transcription factor bHLH91-like [Citrus sinensis]
Length=355

 Score =   234 bits (598),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 153/208 (74%), Gaps = 13/208 (6%)
 Frame = -2

Query  963  GKGTKHFATERQRRVHLNDKYEALKKLVPNPS-KNDRASVVHDAIGYINELKRTVGELKI  787
            GK  K   +ERQRRV +NDK+  L+ LVPNP+ K DRASVV DA  YI EL+R++ ELK 
Sbjct  149  GKAKKPIISERQRRVEMNDKFAVLRNLVPNPNNKGDRASVVGDACEYIKELQRSINELKS  208

Query  786  LVEKKRCSRE---RMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTE  616
            LVE+KR +RE     +RH  EGC       D+K    VD + + + LRSSWLQRKSK+ E
Sbjct  209  LVERKRFAREIRSNNERHNIEGCDH-----DMKPAPLVDPNNTAS-LRSSWLQRKSKDIE  262

Query  615  VDVRIIDDEVTVKLVQQKRI-NCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICE  439
            VDVRI+DDEVTVK++Q+K+I NCLLF+SK  DE+QLDL HVAGG IGDYYSFL NSKI E
Sbjct  263  VDVRIVDDEVTVKILQRKKIDNCLLFLSKVFDEMQLDLQHVAGGHIGDYYSFLLNSKIHE  322

Query  438  GSTVYASAIANKLIEVVDKHYTA--IAP  361
            GS VYA AI NKLIEV+D+ Y A  IAP
Sbjct  323  GSCVYAGAIVNKLIEVMDRQYAAASIAP  350



>ref|XP_010510222.1| PREDICTED: transcription factor bHLH10-like [Camelina sativa]
 ref|XP_010510223.1| PREDICTED: transcription factor bHLH10-like [Camelina sativa]
Length=474

 Score =   238 bits (608),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 156/228 (68%), Gaps = 7/228 (3%)
 Frame = -2

Query  1011  VFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
             V E      V  K R  + +    TER+RRVH ND+++ LK L+PNP+K DRAS+V +AI
Sbjct  247   VLEFNTTGAVTRKGRRSQKSNTSPTERERRVHFNDRFQDLKSLIPNPTKIDRASIVGEAI  306

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG---DLKSVEDVDQSY---  670
              YI EL RT+ E K+LVEKKR  R R K+    G     +     + K   +VDQS    
Sbjct  307   DYIKELLRTIEEFKMLVEKKRFGRFRSKKKARVGEDEQEEEEDTVNYKPQSEVDQSCFNK  366

Query  669   -SGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
              +  +LR SWL+RKSK TEVDVRIIDDEVT+KLVQ+K+INCLLF +K LD+L LDLHHVA
Sbjct  367   NNNNSLRCSWLKRKSKVTEVDVRIIDDEVTIKLVQKKKINCLLFTTKVLDQLHLDLHHVA  426

Query  492   GGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             GG IG++YSFLFN+KICEGS VYAS IA+ ++EVV+K Y    P+  Y
Sbjct  427   GGQIGEHYSFLFNTKICEGSCVYASGIADTVMEVVEKQYMEAVPSNGY  474



>ref|XP_003548659.2| PREDICTED: transcription factor bHLH91-like [Glycine max]
Length=389

 Score =   236 bits (601),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 172/231 (74%), Gaps = 19/231 (8%)
 Frame = -2

Query  1038  DGCRDFENGVFELTGDMNVLAKNRDGKGTKHFA---TERQRRVHLNDKYEALKKLVPNPS  868
             D  +DF NG+ + T     + K R GK TK F    TERQRRV L+ K++ALK+L+PNPS
Sbjct  170   DDIQDFGNGLVDFT--QQEVGKRRGGKRTKQFTSTTTERQRRVDLSSKFDALKELIPNPS  227

Query  867   KNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRER-MKRHK--TEGCSSMMDGGDLK  697
             K+DRASVV DAI YI ELKRTV ELK+LVEKKR  ++R M RHK  TEG SS +D  +  
Sbjct  228   KSDRASVVGDAINYIRELKRTVEELKLLVEKKRLEKQRVMMRHKVETEGESSNLDPAE--  285

Query  696   SVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDEL  517
                     YS  +LRSSW+QRK+K+TEVDVRI+D+EVT+KLVQ+K+I+CL+ VS  LD+L
Sbjct  286   --------YS-ESLRSSWIQRKTKDTEVDVRIVDNEVTIKLVQRKKIDCLVHVSHLLDQL  336

Query  516   QLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIA  364
              LDL HVAGG IGD+ S+LFN+KICEGS++YASAIANKLI+V+D    A +
Sbjct  337   NLDLQHVAGGHIGDFCSYLFNTKICEGSSIYASAIANKLIQVMDTSLAAAS  387



>ref|XP_006421646.1| hypothetical protein CICLE_v100069401mg, partial [Citrus clementina]
 gb|ESR34886.1| hypothetical protein CICLE_v100069401mg, partial [Citrus clementina]
Length=267

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 152/210 (72%), Gaps = 13/210 (6%)
 Frame = -2

Query  963  GKGTKHFATERQRRVHLNDKYEALKKLVPNPS-KNDRASVVHDAIGYINELKRTVGELKI  787
            GK  K   +ERQRRV +NDK+  L+ LVPNP+ K DRASVV DA  YI EL+R++ ELK 
Sbjct  61   GKAKKPIISERQRRVEMNDKFAVLRNLVPNPNNKGDRASVVGDACEYIKELQRSINELKP  120

Query  786  LVEKKRCSRE---RMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTE  616
            LVE+KR +RE     +RH  EGC       D+K    VD + + + LRSSWLQRKSK+ E
Sbjct  121  LVERKRFAREIRSNNERHNIEGCDH-----DMKPAPLVDPNNTAS-LRSSWLQRKSKDIE  174

Query  615  VDVRIIDDEVTVKLVQQKRI-NCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICE  439
            +DVRI+DDEVTVK++Q+K+I N LLF+SK  DE+QLDL HVAGG IGDYYSFL NSKI E
Sbjct  175  IDVRIVDDEVTVKILQRKKIDNSLLFLSKVFDEMQLDLQHVAGGHIGDYYSFLLNSKIHE  234

Query  438  GSTVYASAIANKLIEVVDKHYTA--IAPTT  355
            GS VYA AI NKLIE++D+ Y A  IAP  
Sbjct  235  GSCVYAGAIVNKLIEIMDRQYAAASIAPIN  264



>ref|XP_006354670.1| PREDICTED: transcription factor bHLH89-like [Solanum tuberosum]
Length=393

 Score =   233 bits (593),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 140/278 (50%), Positives = 180/278 (65%), Gaps = 30/278 (11%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGE-VDEREVNGAFYQTVDGCRDFENGVFELTGDMNV  982
             +ELFH  P G      S  +GSLF    D+ EV G  Y   DG         EL+GDM +
Sbjct  131   KELFHLSPHGSSYGLGSSGTGSLFSHGHDQEEVTGNLYH--DG------SFHELSGDMMI  182

Query  981   ----LAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINEL  814
                 + K   GK  KH A+E+QRRVH +DK++AL+ L+PNPSKNDRA+++ DAIGYI+EL
Sbjct  183   NSAAIKKRELGKEIKHHASEKQRRVHFSDKFQALRTLIPNPSKNDRATIIADAIGYIHEL  242

Query  813   KRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVE-DVDQSYSGTTLRSSWLQ  637
             K  V EL I V+ K+   ER+KR +     SM++  D   +E + D         ++W  
Sbjct  243   KMRVNELMIQVDLKK---ERIKRQR-----SMVEEDDAVIMEANQDDQQVMMNKSTNWHH  294

Query  636   R----KSKNTEVDVRIIDDEVTVKLVQQKRI----NCLLFVSKALDELQLDLHHVAGGLI  481
             +    K+ +TE+DVRI++DEV VKLVQQK+I    NCLL VSK LDELQLDL HVAGGLI
Sbjct  295   QIKSSKNTSTEIDVRIMEDEVIVKLVQQKQILKGVNCLLLVSKTLDELQLDLKHVAGGLI  354

Query  480   GDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
             GD+YS+L NSKICEG TVYAS +ANK+IEV+DK +  I
Sbjct  355   GDHYSYLLNSKICEGCTVYASVVANKVIEVLDKKHAEI  392



>gb|KHN37144.1| Transcription factor bHLH91 [Glycine soja]
Length=322

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 174/229 (76%), Gaps = 16/229 (7%)
 Frame = -2

Query  1038  DGCRDFENGVFELTGDMNVLAKNRDGKGTKHFA---TERQRRVHLNDKYEALKKLVPNPS  868
             +G + F NGV + T D   + K R GK TK F    TE+QRRV L+ K++ALK+L+PNPS
Sbjct  100   EGIQGFGNGVVDFTQD---VGKKRGGKRTKQFTSTITEKQRRVDLSSKFDALKELIPNPS  156

Query  867   KNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERM---KRHKTEGCSSMMDGGDLK  697
             K+DR SVV DAI YI ELKRTV ELK+LVEKKR  ++R+   +RH+ E      D GD  
Sbjct  157   KSDRVSVVGDAINYIRELKRTVEELKLLVEKKRHDKQRVMMRRRHEVEA-----DEGDFS  211

Query  696   SVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDEL  517
             ++++ DQ YS  +LRSSW++RKSK+T VDVRI+D+EVT+KLVQ+K+I+CL+ VS  LD+L
Sbjct  212   NLQEPDQ-YS-ESLRSSWIRRKSKDTVVDVRIVDNEVTIKLVQRKKIDCLVHVSHLLDQL  269

Query  516   QLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTA  370
              LDL HVAGG IGD+ S+LFN+KICEGS++YASAIA+KLI+V+D  + A
Sbjct  270   NLDLQHVAGGHIGDFCSYLFNTKICEGSSLYASAIAHKLIQVMDTSFAA  318



>ref|XP_010457738.1| PREDICTED: transcription factor bHLH89-like [Camelina sativa]
Length=429

 Score =   232 bits (592),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 174/263 (66%), Gaps = 24/263 (9%)
 Frame = -2

Query  1152  LFHSLPQGGYGFGASRSSGSLFG-EVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVLA  976
             LFH        F     +G+  G + D+ E N    Q V+   D EN       D+ +  
Sbjct  171   LFH------LNFPLQHPNGTFLGVDQDQAETN----QGVNLLYDEENNNL----DVGLNR  216

Query  975   KNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
             K R  K  K F TER+RRVH  D++  L+ L+PNP+KNDRAS+V +AI YI EL RT+ E
Sbjct  217   KGRGSKKRKIFPTERERRVHFKDRFGDLRSLIPNPTKNDRASIVGEAIDYIKELLRTIDE  276

Query  795   LKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSY---SGTTLRSSWLQRKSK  625
              K+LVEKKR     +KR K EG   ++D       E V+QS        LR SWL+RKSK
Sbjct  277   FKMLVEKKR-----IKRLKREG-DDVVDENFKAQSEVVEQSSINKKNNALRCSWLKRKSK  330

Query  624   NTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKI  445
              TEVDVRIIDDEVT+K+VQ+K+IN LLFVSK +D+LQLDLHHVAG  IG+++SFLFN+KI
Sbjct  331   FTEVDVRIIDDEVTIKIVQKKKINSLLFVSKVIDQLQLDLHHVAGAQIGEHHSFLFNTKI  390

Query  444   CEGSTVYASAIANKLIEVVDKHY  376
             C+GS+VYASAIA++++EV++K Y
Sbjct  391   CKGSSVYASAIADRVMEVLEKQY  413



>ref|XP_004229579.1| PREDICTED: transcription factor bHLH91-like [Solanum lycopersicum]
Length=392

 Score =   230 bits (587),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 179/277 (65%), Gaps = 28/277 (10%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGE-VDEREVNGAFYQTVDGCRDFENGVFELTGDMNV  982
             +ELFH  P G      S  +GSLF    D+ EV G  Y   DG         ELTGDM +
Sbjct  130   KELFHLSPHGSSYGLGSSGTGSLFSLGHDQEEVTGNLYH--DG------SFHELTGDMMI  181

Query  981   ----LAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINEL  814
                 + K   GK  KH A+E+QRRVH +DK++AL+ L+PNPSKN+RA+++ DAIGYI+EL
Sbjct  182   NSAAIKKRILGKDIKHHASEKQRRVHFSDKFQALRTLIPNPSKNNRATIIADAIGYIDEL  241

Query  813   KRTVGELKILVEKKRCSRERMKRHKTE----GCSSMMDGGDLKSVEDVDQSYSGTTLRSS  646
             K  V ELK+ V+ K+   ER+KR ++     G   M D  D + V     +     ++SS
Sbjct  242   KMRVNELKVQVDIKK---ERIKRRRSMVEEYGAVIMEDNQDDQQVMMNKSTNWHHQIKSS  298

Query  645   WLQRKSKNTEVDVRIIDDEVTVKLVQQKR----INCLLFVSKALDELQLDLHHVAGGLIG  478
                 K+ NTEVDVRI++DEV VK VQ K+    +NCLL VSKALDELQLDL HVAGGLIG
Sbjct  299   ----KNSNTEVDVRIMEDEVIVKFVQHKQMLKGVNCLLLVSKALDELQLDLQHVAGGLIG  354

Query  477   DYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
             D+YS+L NSKICEG TVYAS IANK+I+V+DK +  I
Sbjct  355   DHYSYLLNSKICEGCTVYASVIANKVIDVLDKEHADI  391



>gb|EPS71051.1| hypothetical protein M569_03716, partial [Genlisea aurea]
Length=196

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 149/217 (69%), Gaps = 23/217 (11%)
 Frame = -2

Query  1011  VFEL-TGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDA  835
             VFE  +G+M+    + DG+ TKH   E+QRR  + D +EAL+KL+PNP+KNDRAS++ DA
Sbjct  1     VFEFKSGEMD----HSDGRNTKHLGPEKQRRELIKDNFEALRKLIPNPTKNDRASIMGDA  56

Query  834   IGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTL  655
             I YINELK+T  ELK L++KKR  +ER+KR   E  S   D                   
Sbjct  57    INYINELKKTASELKALLQKKRSEKERVKRANCENISLETDPNS----------------  100

Query  654   RSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRIN-CLLFVSKALDELQLDLHHVAGGLIG  478
               SWLQRKS NTEVDVRII D+VTVKLV  KRI  CL+ VSK  DE QLDLH VAGG+IG
Sbjct  101   -CSWLQRKSYNTEVDVRIIMDQVTVKLVHHKRIKCCLVLVSKIFDEFQLDLHDVAGGVIG  159

Query  477   DYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
             D+YSFLFNSKICEG+ V AS++ANKLIEV+++    +
Sbjct  160   DHYSFLFNSKICEGAIVKASSLANKLIEVMEEQCAVV  196



>ref|XP_002892324.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68583.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   229 bits (585),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 159/222 (72%), Gaps = 15/222 (7%)
 Frame = -2

Query  972  NRDGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV  802
            NR G+G+   K F TER+RRVH  D++  LK L+PNP+KNDRAS+V +AI YI EL RT+
Sbjct  207  NRKGRGSRKRKVFPTERERRVHFKDRFGDLKNLIPNPTKNDRASIVGEAIDYIKELLRTI  266

Query  801  GELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQ---SYSGTTLRSSWLQRK  631
             E K+LVEKKR      K+   EG   ++D       E V+Q   +     LR SWL+RK
Sbjct  267  DEFKLLVEKKRT-----KQRNREG-DDVIDENFKAQSEVVEQCLINKKNNALRCSWLKRK  320

Query  630  SKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNS  451
            SK TEVDVRIIDD+VT+K+VQ+K+INCL+FVSK +D+LQLDLHHVAG  IG+++SFLFN+
Sbjct  321  SKFTEVDVRIIDDDVTIKIVQKKKINCLVFVSKVVDQLQLDLHHVAGAQIGEHHSFLFNA  380

Query  450  KICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY*DGSHSMS  325
            KICEGS+VYASAIA++++EV++K Y     T    +G H  S
Sbjct  381  KICEGSSVYASAIADRVMEVLEKQYMEALSTN---NGYHCYS  419



>ref|XP_010475345.1| PREDICTED: transcription factor bHLH89-like [Camelina sativa]
Length=425

 Score =   229 bits (585),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 155/205 (76%), Gaps = 12/205 (6%)
 Frame = -2

Query  972  NRDGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV  802
            NR G+G+   K F TER+RRVH  D++  LKKL+PNP+K+DRAS+V +AI YI EL RT+
Sbjct  211  NRKGRGSRKRKIFPTERERRVHFKDRFGDLKKLIPNPTKSDRASIVGEAIDYIKELLRTI  270

Query  801  GELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSY---SGTTLRSSWLQRK  631
             E K+LVEKKR     +K+   EG   ++D       E V+QS        LR SWL+RK
Sbjct  271  DEFKLLVEKKR-----IKQRNREG-DDVVDENFKAQSEVVEQSSINKKNNALRCSWLKRK  324

Query  630  SKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNS  451
            SK TEVDVRIIDDEVT+K+VQ+K+IN LLFVSK +D+LQLDLHHVAG  IG+++SFLFN+
Sbjct  325  SKFTEVDVRIIDDEVTIKIVQKKKINSLLFVSKVIDQLQLDLHHVAGAQIGEHHSFLFNT  384

Query  450  KICEGSTVYASAIANKLIEVVDKHY  376
            KICEGS+VYASAIA++++EV++K Y
Sbjct  385  KICEGSSVYASAIADRVMEVLEKQY  409



>ref|XP_010672071.1| PREDICTED: transcription factor bHLH91-like [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score =   230 bits (586),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 185/276 (67%), Gaps = 31/276 (11%)
 Frame = -2

Query  1131  GGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELT-GDMNVLAKNRDGKG  955
             GG     + +S +LFG +++   N  ++          NGVFE   GD  V       K 
Sbjct  191   GGNDHVGNGNSSALFGALEDG--NHHYFHG-------NNGVFEFCKGDDKV------SKS  235

Query  954   TKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEK  775
              K  A+E+QRR +  DKY  LK L+PN +K DRAS++ DAI +I+EL+RTV ELK+LVEK
Sbjct  236   PKSSASEKQRRQNFTDKYTDLKNLIPNQTKTDRASIILDAITHIHELRRTVKELKLLVEK  295

Query  774   KRCSRERMKRHKT------EGCSSMMDGGDLKSVEDVDQSYSG---TTLRSSWLQRKSKN  622
             KR  + RMKRHK+       G S+  DG  +    D D  + G     LRSSW+QRK K+
Sbjct  296   KRIFKNRMKRHKSTTEDTHSGGSNCNDGAAVVK-PDPDGDFDGLAPNQLRSSWIQRKCKD  354

Query  621   TEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKIC  442
             T+VDVRI+DD+VT+KLVQ+K+INCLL VS+ LDELQLDL HVAGG +GDYYS+LFNSKIC
Sbjct  355   TQVDVRIVDDDVTIKLVQRKKINCLLSVSRNLDELQLDLRHVAGGCVGDYYSYLFNSKIC  414

Query  441   EGSTVYASAIANKLIEVVDKHYTA-----IAPTTSY  349
             +GS+VYASAIANKLIEVV+K Y A     +APT S+
Sbjct  415   DGSSVYASAIANKLIEVVEKGYAAASVGVVAPTNSF  450



>ref|XP_006294062.1| hypothetical protein CARUB_v10023056mg, partial [Capsella rubella]
 gb|EOA26960.1| hypothetical protein CARUB_v10023056mg, partial [Capsella rubella]
Length=503

 Score =   231 bits (589),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 158/229 (69%), Gaps = 11/229 (5%)
 Frame = -2

Query  1002  LTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYI  823
             L  +  V  K R  K +    TER+RRVH ND++  LKKL+PNP+K DRAS+V +AI YI
Sbjct  275   LEFNTGVTRKTRRSKKSTTSPTERERRVHFNDRFLDLKKLIPNPTKIDRASIVGEAIDYI  334

Query  822   NELKRTVGELKILVEKKRCSRERMKRH------KTEGCSSMMDGGDLKSVEDVDQS----  673
              EL RT+ E K+LVEKKR  R R K+       + E      D  + K   ++DQS    
Sbjct  335   KELLRTIEEFKMLVEKKRFGRFRSKKKARVGQGEGEDQEEEEDTVNYKPQSEIDQSCFNK  394

Query  672   YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
              +  +LR SWL+RKSK TEVDVRIIDDEVT+KLVQ+K+INCLL  +K LD+LQLDLHHVA
Sbjct  395   NNNNSLRCSWLKRKSKITEVDVRIIDDEVTIKLVQKKKINCLLLTTKVLDQLQLDLHHVA  454

Query  492   GGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYT-AIAPTTSY  349
             GG IG++YSFLFN+KICEGS VYAS IA+ ++E+V+K Y  A  P+  Y
Sbjct  455   GGQIGEHYSFLFNTKICEGSCVYASGIADTVMEIVEKQYMEAAVPSNGY  503



>ref|XP_009141140.1| PREDICTED: transcription factor bHLH91-like [Brassica rapa]
Length=445

 Score =   229 bits (583),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 166/247 (67%), Gaps = 28/247 (11%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             F++G+ E +   N+  K R  +  K F TER+RR HLN++YEALK L+PNPSK DRAS++
Sbjct  205   FDSGIIEFSK--NIRRKRRGKQKNKPFTTERERRCHLNERYEALKLLIPNPSKGDRASIL  262

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHK---------------------TEGC  727
              D I YINEL+R V ELK LVE+KRC      RHK                      +  
Sbjct  263   QDGIDYINELQRRVSELKYLVERKRCG----GRHKDNNEVDNSNNNNLDDLNIVNDEDDE  318

Query  726   SSMMDGGDLKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINC  550
                 +  D K+  DV DQ  S  +LR SWLQRKSK TEVDVRI+DDEVT+K++Q+++INC
Sbjct  319   DDDDENMDKKTESDVIDQCSSNNSLRCSWLQRKSKVTEVDVRIVDDEVTIKVIQKRKINC  378

Query  549   LLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTA  370
             LL V+K LD L LDLHHV+GG IG++YSFL N+KI EGST+YASAIANK+IEVVD+HY A
Sbjct  379   LLVVTKVLDHLHLDLHHVSGGQIGEHYSFLLNTKINEGSTIYASAIANKVIEVVDQHYMA  438

Query  369   IAPTTSY  349
               P  +Y
Sbjct  439   ALPINNY  445



>emb|CDY57092.1| BnaA04g28790D [Brassica napus]
Length=434

 Score =   228 bits (581),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 164/232 (71%), Gaps = 9/232 (4%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             F++G+ E +   N+  K R  +  K F TER+RR HLN++YEALK L+PNPSK DRAS++
Sbjct  205   FDSGIIEFSK--NIRRKRRGKQKNKPFTTERERRCHLNERYEALKLLIPNPSKGDRASIL  262

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKR------HKTEGCSSMMDGGDLKSVEDV  682
              D I YINEL+R V ELK LVE+KR +            +  +      +  D K+  DV
Sbjct  263   QDGIDYINELQRRVSELKYLVERKRYNSNNNNLDDLNIVNDEDDEDDDDENMDKKTESDV  322

Query  681   -DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDL  505
              DQ  S  +LR SWLQRKSK TEVDVRI+DDEVT+K++Q+++INCLL V+K LD L LDL
Sbjct  323   IDQCSSNNSLRCSWLQRKSKVTEVDVRIVDDEVTIKVIQKRKINCLLVVTKVLDHLHLDL  382

Query  504   HHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY  349
             HHV+GG IG++YSFL N+KI EGST+YASAIANK+IEVVD+HY A  P  +Y
Sbjct  383   HHVSGGQIGEHYSFLLNTKINEGSTIYASAIANKVIEVVDQHYMAALPINNY  434



>ref|XP_006307566.1| hypothetical protein CARUB_v10009189mg, partial [Capsella rubella]
 gb|EOA40464.1| hypothetical protein CARUB_v10009189mg, partial [Capsella rubella]
Length=433

 Score =   227 bits (579),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 152/203 (75%), Gaps = 9/203 (4%)
 Frame = -2

Query  975  KNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
            K R  +  K F TER+RRVH  D++  LK L+PNP+K+DRAS+V +AI YI EL RT+ E
Sbjct  221  KGRGSRKRKVFPTERERRVHFKDRFGDLKSLIPNPTKHDRASIVGEAIDYIKELLRTIDE  280

Query  795  LKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQ---SYSGTTLRSSWLQRKSK  625
             K+LVEKKR     +K+   EG   ++D       E V+Q   +     LR SWL+RKSK
Sbjct  281  FKLLVEKKR-----IKQRNREG-DDVVDENFKAQSEVVEQCLINKKNNALRCSWLKRKSK  334

Query  624  NTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKI  445
             TEVDVRIIDDEVT+K+VQ+K+INCLLFVSK +D+LQLDLHHVAG  IG+++SFLFN+KI
Sbjct  335  FTEVDVRIIDDEVTIKIVQKKKINCLLFVSKVIDQLQLDLHHVAGAQIGEHHSFLFNTKI  394

Query  444  CEGSTVYASAIANKLIEVVDKHY  376
            CEGS+VYASAIA++++EV++K Y
Sbjct  395  CEGSSVYASAIADRVMEVLEKQY  417



>ref|XP_010059715.1| PREDICTED: transcription factor bHLH91-like [Eucalyptus grandis]
 gb|KCW75484.1| hypothetical protein EUGRSUZ_E04246 [Eucalyptus grandis]
Length=459

 Score =   226 bits (577),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 165/240 (69%), Gaps = 20/240 (8%)
 Frame = -2

Query  1020  ENGVFELT--GDMNVLAKNRDG-KGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRAS  850
             + GV E+   G+   + K R G K TKHFA ER RR  LN+KY AL+ L+PNP+K DRAS
Sbjct  219   DEGVLEMMEGGNRVKIGKRRGGNKLTKHFAAERDRRTQLNEKYVALRNLIPNPTKFDRAS  278

Query  849   VVHDAIGYINELKRTVGELKILVEKKRCSRE-RMKRHKT-------------EGCSSMMD  712
             +V DA  YI EL   V EL +++E+KR  RE + KR +              +G SS+  
Sbjct  279   IVGDATEYIKELLILVKELNLILERKRWGRESKCKRRRVAIEEEEEEAEEAVDGESSITA  338

Query  711   GGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSK  532
                L  +   D S++GT LRSS +QRKSK TEV+VRI++DEV +KLVQ+K+INCLL V++
Sbjct  339   VTPLGDL--ADWSFNGT-LRSSCIQRKSKVTEVNVRIVNDEVMIKLVQRKKINCLLHVTR  395

Query  531   ALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTS  352
              LDELQLDLHHV+GG IG++YSFL NSKICEGSTVYAS IA+K+I++VD+ Y A  P  S
Sbjct  396   VLDELQLDLHHVSGGHIGEHYSFLLNSKICEGSTVYASTIASKVIDIVDRQYYAATPPPS  455



>ref|NP_172107.1| transcription factor bHLH89 [Arabidopsis thaliana]
 ref|NP_973769.1| transcription factor bHLH89 [Arabidopsis thaliana]
 sp|Q9LND0.1|BH089_ARATH RecName: Full=Transcription factor bHLH89; AltName: Full=Basic 
helix-loop-helix protein 89; Short=AtbHLH89; Short=bHLH 89; 
AltName: Full=Transcription factor EN 24; AltName: Full=bHLH 
transcription factor bHLH089 [Arabidopsis thaliana]
 gb|AAF80214.1|AC025290_3 Contains a weak similarity to a myc-like regulatory R gene product 
from Pennisetum glaucum gb|U11446 and contains a helix-loop-helix 
DNA-binding PF|00010 domain [Arabidopsis thaliana]
 gb|AAM10962.1|AF488619_1 putative bHLH transcription factor [Arabidopsis thaliana]
 gb|AAO42264.1| putative bHLH protein [Arabidopsis thaliana]
 gb|AEE27953.1| transcription factor bHLH89 [Arabidopsis thaliana]
 gb|AEE27954.1| transcription factor bHLH89 [Arabidopsis thaliana]
Length=420

 Score =   225 bits (574),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 157/215 (73%), Gaps = 13/215 (6%)
 Frame = -2

Query  972  NRDGKGTKH---FATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV  802
            NR G+G+K    F TER+RRVH  D++  LK L+PNP+KNDRAS+V +AI YI EL RT+
Sbjct  206  NRKGRGSKKRKIFPTERERRVHFKDRFGDLKNLIPNPTKNDRASIVGEAIDYIKELLRTI  265

Query  801  GELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQ---SYSGTTLRSSWLQRK  631
             E K+LVEKKR     +K+   EG   ++D       E V+Q   +     LR SWL+RK
Sbjct  266  DEFKLLVEKKR-----VKQRNREG-DDVVDENFKAQSEVVEQCLINKKNNALRCSWLKRK  319

Query  630  SKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNS  451
            SK T+VDVRIIDDEVT+K+VQ+K+INCLLFVSK +D+L+LDLHHVAG  IG+++SFLFN+
Sbjct  320  SKFTDVDVRIIDDEVTIKIVQKKKINCLLFVSKVVDQLELDLHHVAGAQIGEHHSFLFNA  379

Query  450  KICEGSTVYASAIANKLIEVVDKHYT-AIAPTTSY  349
            KI EGS+VYASAIA++++EV+ K Y  A++    Y
Sbjct  380  KISEGSSVYASAIADRVMEVLKKQYMEALSANNGY  414



>ref|XP_009402958.1| PREDICTED: transcription factor TIP2-like [Musa acuminata subsp. 
malaccensis]
Length=490

 Score =   219 bits (558),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 138/271 (51%), Positives = 176/271 (65%), Gaps = 25/271 (9%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDERE--VNGAF-----YQTVDGCRDFENGVFEL  1000
             ++LF SLPQ  YG         LF  VDERE  V GA      +Q +D  R    G+   
Sbjct  226   KDLFSSLPQN-YG---------LFCGVDEREAMVGGAIGGGNVFQEMDLRRYDGIGLDYD  275

Query  999   TGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYIN  820
               +M  L K   G+G   FATERQRR  LN+KY+AL+ L+PNP+K DRAS+V DAI +I 
Sbjct  276   RREMGGLGK---GEGKTSFATERQRREQLNEKYKALRLLIPNPTKADRASIVGDAIEHIK  332

Query  819   ELKRTVGELKILVEKKRCSRERMKRHKTEG-CSSMMDGGDLK--SVEDVDQSYSGTTLRS  649
             EL RTV ELK+LVEKKR  RER K  K E   ++ M+   ++  SVE  D    G  LRS
Sbjct  333   ELLRTVEELKVLVEKKRHGRERRKILKMEDEATADMESSSIRPLSVERDDPLSGG--LRS  390

Query  648   SWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYY  469
             S LQR+ K+  VDVRIIDDEV +KL Q+K+ NCLL  +KALDEL LDL HVAGG +GD++
Sbjct  391   SLLQRRYKDGAVDVRIIDDEVNIKLTQKKKPNCLLDAAKALDELHLDLAHVAGGNVGDHH  450

Query  468   SFLFNSKICEGSTVYASAIANKLIEVVDKHY  376
              ++FN+KI EGS+VYA A+ANK + V++  +
Sbjct  451   VYMFNTKISEGSSVYAGAVANKFLRVLEGQH  481



>ref|NP_001149299.1| helix-loop-helix DNA-binding domain containing protein [Zea mays]
 gb|ACG34915.1| helix-loop-helix DNA-binding domain containing protein [Zea mays]
Length=473

 Score =   214 bits (545),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 169/266 (64%), Gaps = 22/266 (8%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDERE-------VNGAFYQTVDGCRDFENGVFEL  1000
             ++L+HSLPQ  YG         LF   DER+       V+G  +Q +DG R F++ +   
Sbjct  212   KDLYHSLPQN-YG---------LFTSDDERDGMVGVPGVSGNIFQEIDG-RQFDSPIL--  258

Query  999   TGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYIN  820
              G          GKG  +FATER+RR   N KY AL+ L PNP+KNDRAS+V DAI YIN
Sbjct  259   -GSRKQKGGFGKGKGKANFATERERRXQFNVKYGALRSLFPNPTKNDRASIVGDAIEYIN  317

Query  819   ELKRTVGELKILVEKKRCSRERMKRHKT-EGCSSMMDGGDLKSVEDVDQSYSGTTLRSSW  643
             EL RTV ELKIL+EKKR S +R K  K  E  +   +   ++ V D   +    T+RSSW
Sbjct  318   ELNRTVKELKILLEKKRNSADRRKILKLDEEAADDGESSSMQPVSDDQXNQMNGTIRSSW  377

Query  642   LQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSF  463
             +QR+SK  +VDVRI+DDE+ +K  ++KR N LL  +K L+E  L+L HV GG+IGD++ F
Sbjct  378   VQRRSKECDVDVRIVDDEINIKFTEKKRANSLLCAAKVLEEFHLELIHVVGGIIGDHHIF  437

Query  462   LFNSKICEGSTVYASAIANKLIEVVD  385
             +FN+KI +GS+VYA A+A KL+E V+
Sbjct  438   MFNTKIPKGSSVYACAVAKKLLEAVE  463



>ref|XP_008643696.1| PREDICTED: helix-loop-helix DNA-binding domain containing protein 
isoform X1 [Zea mays]
Length=473

 Score =   214 bits (544),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 169/266 (64%), Gaps = 22/266 (8%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDERE-------VNGAFYQTVDGCRDFENGVFEL  1000
             ++L+HSLPQ  YG         LF   DER+       V+G  +Q +DG R F++ +   
Sbjct  212   KDLYHSLPQN-YG---------LFTSDDERDGMVGVPGVSGNIFQEIDG-RQFDSPIL--  258

Query  999   TGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYIN  820
              G          GKG  +FATER+RR   N KY AL+ L PNP+KNDRAS+V DAI YIN
Sbjct  259   -GSRKQKGGFGKGKGKANFATERERREQFNVKYGALRSLFPNPTKNDRASIVGDAIEYIN  317

Query  819   ELKRTVGELKILVEKKRCSRERMKRHKT-EGCSSMMDGGDLKSVEDVDQSYSGTTLRSSW  643
             EL RTV ELKIL+EKKR S +R K  K  E  +   +   ++ V D   +    T+RSSW
Sbjct  318   ELNRTVKELKILLEKKRNSADRRKILKLDEEAADDGESSSMQPVSDDQNNQMNGTIRSSW  377

Query  642   LQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSF  463
             +QR+SK  +VDVRI+DDE+ +K  ++KR N LL  +K L+E  L+L HV GG+IGD++ F
Sbjct  378   VQRRSKECDVDVRIVDDEINIKFTEKKRANSLLCAAKVLEEFHLELIHVVGGIIGDHHIF  437

Query  462   LFNSKICEGSTVYASAIANKLIEVVD  385
             +FN+KI +GS+VYA A+A KL+E V+
Sbjct  438   MFNTKIPKGSSVYACAVAKKLLEAVE  463



>ref|XP_002452697.1| hypothetical protein SORBIDRAFT_04g030850 [Sorghum bicolor]
 gb|EES05673.1| hypothetical protein SORBIDRAFT_04g030850 [Sorghum bicolor]
Length=473

 Score =   213 bits (542),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 170/261 (65%), Gaps = 12/261 (5%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVL  979
             ++L+HSLPQ    +G   S     G V    V+G  +Q +DG R F++ V    G     
Sbjct  212   KDLYHSLPQN---YGIFTSDDERDGMVGVAGVSGNIFQEIDG-RQFDSPVL---GTRRQK  264

Query  978   AKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVG  799
                  GKG  +FATER+RR  LN KY AL+ L PNP+KNDRAS+V DAI YINEL RTV 
Sbjct  265   GGFGKGKGKANFATERERREQLNVKYGALRSLFPNPTKNDRASIVGDAIDYINELNRTVK  324

Query  798   ELKILVEKKRCSRERMKRHKTEGCSSMMDGGD---LKSVEDVDQSYSGTTLRSSWLQRKS  628
             ELKIL+EKKR S +R K  K +  ++  D G+   ++ V D   +     +RSSW+QR+S
Sbjct  325   ELKILLEKKRNSTDRRKILKLDDEAA--DDGESSSMQPVSDDQNNQMNGAIRSSWVQRRS  382

Query  627   KNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSK  448
             K  +VDVRI+DDE+ +K  ++KR N LL  +K L+E +L+L HV GG+IGD++ F+FN+K
Sbjct  383   KECDVDVRIVDDEINIKFTEKKRANSLLCAAKVLEEFRLELIHVVGGIIGDHHIFMFNTK  442

Query  447   ICEGSTVYASAIANKLIEVVD  385
             I +GS+VYA A+A KL+E V+
Sbjct  443   IPKGSSVYACAVAKKLLEAVE  463



>ref|XP_004953537.1| PREDICTED: transcription factor bHLH91-like [Setaria italica]
Length=475

 Score =   213 bits (541),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 174/274 (64%), Gaps = 26/274 (9%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDERE-------VNGAFYQTVDGCRDFENGVFEL  1000
             ++L+HSLPQ  YG         LF   DER+       V+G  +Q +DG R FEN +   
Sbjct  214   KDLYHSLPQN-YG---------LFTSDDERDGMIGIPGVSGNTFQEIDG-RQFENSIL--  260

Query  999   TGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYIN  820
              G          GKG  +FATER+RR  LN KY AL+ L PNP+KNDRAS+V DAI YIN
Sbjct  261   -GSRRQKGGLGKGKGKANFATERERREQLNVKYGALRSLFPNPTKNDRASIVGDAIEYIN  319

Query  819   ELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGD---LKSVEDVDQSYSGTTLRS  649
             EL RT+ +L+IL+EKKR S +R K+ K +  ++  D G+   ++ V D   +     +RS
Sbjct  320   ELNRTLKQLRILMEKKRNSTDRRKKLKLDDEAA--DDGESSSMQPVSDDQNNQMNGPIRS  377

Query  648   SWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYY  469
             SW+QR+SK  +VDVRI+DDE+ +K  ++KR N LL  +K L+E  L+L HV GG+IGD++
Sbjct  378   SWVQRRSKECDVDVRIVDDEINIKFTEKKRANSLLCAAKVLEEFHLELIHVVGGIIGDHH  437

Query  468   SFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
              F+FN+KI +GS+VY  A+A KL+E ++    A+
Sbjct  438   IFMFNTKIPKGSSVYVCAVAKKLLEAIEMKNQAL  471



>gb|AAD20666.1| hypothetical protein [Arabidopsis thaliana]
Length=399

 Score =   209 bits (531),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 142/213 (67%), Gaps = 24/213 (11%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             F++G+ E + +  +  K R  +  K F TER+RR HLN++YEALK L+P+PSK DRAS++
Sbjct  192   FDSGIIEFSKE--IRRKGRGKRKNKPFTTERERRCHLNERYEALKLLIPSPSKGDRASIL  249

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG--------------  706
              D I YINEL+R V ELK LVE+KRC      RHK        +                
Sbjct  250   QDGIDYINELRRRVSELKYLVERKRCG----GRHKNNEVDDNNNNKNLDDHGNEDDDDDD  305

Query  705   ---DLKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFV  538
                + K   DV DQ  S  +LR SWLQRKSK TEVDVRI+DDEVT+K+VQ+K+INCLL V
Sbjct  306   ENMEKKPESDVIDQCSSNNSLRCSWLQRKSKVTEVDVRIVDDEVTIKVVQKKKINCLLLV  365

Query  537   SKALDELQLDLHHVAGGLIGDYYSFLFNSKICE  439
             SK LD+LQLDLHHVAGG IG++YSFLFN+K+ +
Sbjct  366   SKVLDQLQLDLHHVAGGQIGEHYSFLFNTKVSD  398



>ref|XP_004976676.1| PREDICTED: transcription factor bHLH91-like [Setaria italica]
Length=464

 Score =   210 bits (534),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 165/265 (62%), Gaps = 24/265 (9%)
 Frame = -2

Query  1155  ELFHSLPQGGYGFGASRSSGSLFGEVDEREVN------GAFYQTVDGCRDFENGVFELTG  994
             ++ HSLPQ  YG         LF   DEREV       G  +Q VD  R F++ V E   
Sbjct  206   DICHSLPQN-YG---------LFPGEDEREVMIGAGSLGDLFQEVDD-RQFDS-VLECRR  253

Query  993   DMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINEL  814
                  +K   GKG  +FATER+RR  LN KY  L+ L PNP+KNDRAS+V DAI YI+EL
Sbjct  254   GKGEFSK---GKGKANFATERERREQLNVKYRTLRMLFPNPTKNDRASIVGDAIEYIDEL  310

Query  813   KRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDG--GDLKSVEDVDQSYSGTTLRSSWL  640
              RTV ELKILVE+KR    + KR K +   +  DG    +K + D   +     +RSSW+
Sbjct  311   NRTVKELKILVEQKRHGNNKEKRIKLDH-QAAADGESSSVKPIRDDQDNQLIGAIRSSWV  369

Query  639   QRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFL  460
             QR+SK   VDVRI+DDEV +KL ++K+ N L   +K LDE QLDL H  GG+IGD++ F+
Sbjct  370   QRRSKECHVDVRIVDDEVNIKLTEKKKDNSLFHAAKVLDEFQLDLIHAVGGVIGDHHIFM  429

Query  459   FNSKICEGSTVYASAIANKLIEVVD  385
             FN+K+ EGS+VYA A+A +L+E VD
Sbjct  430   FNTKVPEGSSVYACAVAKRLLEAVD  454



>ref|XP_006410253.1| hypothetical protein EUTSA_v10017908mg [Eutrema salsugineum]
 gb|ESQ51706.1| hypothetical protein EUTSA_v10017908mg [Eutrema salsugineum]
Length=253

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 154/236 (65%), Gaps = 20/236 (8%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRA  853
              ++G+ + + ++      R G+G    K F TER++  HL +++ ALK L+P+PSK DR 
Sbjct  20    LDSGIIDFSQEIR-----RGGRGKQSYKSFTTEREKGSHLIERFHALKMLIPSPSKGDRV  74

Query  852   SVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMM-----------DGG  706
             S++ + I YI EL+R V ELK LVE+KRCS   +  +  +  ++             +  
Sbjct  75    SILQNGIDYIIELRRLVSELKYLVERKRCSGRHINNNALDNNNNNNSNDHLNDDDGNENM  134

Query  705   DLKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKA  529
             + K   DV DQ  S  +LR SWLQRKS+ TEVDV I+DDE T+K+VQ+K+INCLL VSK 
Sbjct  135   EKKPESDVIDQCSSHNSLRCSWLQRKSEVTEVDVMILDDEATIKVVQKKKINCLLVVSKV  194

Query  528   LDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAP  361
             LD+L LDL +VAGG IG++YSFL  +KI EGST+ ASAIAN++IE VDKHY    P
Sbjct  195   LDQLHLDLLYVAGGQIGEHYSFLLKTKIHEGSTISASAIANRVIEAVDKHYMVALP  250



>ref|NP_001053749.1| Os04g0599300 [Oryza sativa Japonica Group]
 emb|CAE03466.2| OSJNBa0083N12.3 [Oryza sativa Japonica Group]
 dbj|BAF15663.1| Os04g0599300 [Oryza sativa Japonica Group]
 gb|EEE61606.1| hypothetical protein OsJ_16023 [Oryza sativa Japonica Group]
Length=464

 Score =   208 bits (529),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 165/275 (60%), Gaps = 31/275 (11%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRS---------SGSLFGEVDEREVNGAFYQTVDGCRDFENGVF  1006
             +++ HSLPQ  YG   S           SG LF E+D+R+     + +V  CR  +    
Sbjct  206   KDICHSLPQN-YGLFPSEDERDVIIGVGSGDLFQEIDDRQ-----FDSVLECRRGKGEFG  259

Query  1005  ELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGY  826
             +  G  N             FATER+RR  LN K+  L+ L PNP+KNDRAS+V DAI Y
Sbjct  260   KGKGKAN-------------FATERERREQLNVKFRTLRMLFPNPTKNDRASIVGDAIEY  306

Query  825   INELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDG--GDLKSVEDVDQSYSGTTLR  652
             I+EL RTV ELKILVE+KR    R K  K +   +  DG    ++ V D   +     +R
Sbjct  307   IDELNRTVKELKILVEQKRHGNNRRKVLKLDQ-EAAADGESSSMRPVRDDQDNQLHGAIR  365

Query  651   SSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDY  472
             SSW+QR+SK   VDVRI+DDEV +KL ++K+ N LL  +K LDE QL+L HV GG+IGD+
Sbjct  366   SSWVQRRSKECHVDVRIVDDEVNIKLTEKKKANSLLHAAKVLDEFQLELIHVVGGIIGDH  425

Query  471   YSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
             + F+FN+K+ EGS VYA A+A KL++ VD  + A+
Sbjct  426   HIFMFNTKVSEGSAVYACAVAKKLLQAVDVQHQAL  460



>ref|XP_010501337.1| PREDICTED: transcription factor bHLH89, partial [Camelina sativa]
Length=185

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 137/183 (75%), Gaps = 10/183 (5%)
 Frame = -2

Query  885  LVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGG  706
            L+PNP+K+DRAS+V +AI YI EL RT+ E K+LVEKKR     +K+   EG   ++D  
Sbjct  3    LIPNPTKSDRASIVGEAIDYIKELLRTIDEFKLLVEKKR-----IKQRNREG-DDVVDEN  56

Query  705  DLKSVEDVDQSY---SGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVS  535
                 E V+QS        LR SWL+RKSK TEVDVRIIDDEVT+K+VQ+K+IN LLFVS
Sbjct  57   FKAQSEVVEQSSINKKNNALRCSWLKRKSKFTEVDVRIIDDEVTIKIVQKKKINSLLFVS  116

Query  534  KALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYT-AIAPT  358
            K +D+LQLDLHHVAG  IG+++SFLFN+KICEGS+VYASAIA++++EV++K Y  A++  
Sbjct  117  KVIDQLQLDLHHVAGAQIGEHHSFLFNTKICEGSSVYASAIADRVMEVLEKQYVEALSMI  176

Query  357  TSY  349
              Y
Sbjct  177  NGY  179



>ref|XP_006652751.1| PREDICTED: transcription factor bHLH91-like [Oryza brachyantha]
Length=465

 Score =   207 bits (527),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 165/277 (60%), Gaps = 33/277 (12%)
 Frame = -2

Query  1158  RELFHSLPQGGYGF-----------GASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENG  1012
             +++ HSLPQ  YG            G     G LF ++D+R+     + +V  CR  +  
Sbjct  205   KDICHSLPQN-YGLFPSEDERDVIIGVGSVGGDLFQDIDDRQ-----FDSVLECRRGKGE  258

Query  1011  VFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
               ++             KG  +FATER+RR  LN K+  L+ L PNP+KNDRAS+V DAI
Sbjct  259   YGKV-------------KGKANFATERERREQLNVKFRTLRMLFPNPTKNDRASIVGDAI  305

Query  831   GYINELKRTVGELKILVEKKR--CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTT  658
              YI+EL RTV ELKILVE+KR   +R +M +   E              +D+D    G  
Sbjct  306   EYIDELNRTVKELKILVEQKRHGNNRRKMVKLDQEAAGDGESSSTKTLRDDLDNQLHGA-  364

Query  657   LRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIG  478
             +RSSW+QR+SK   VDVRI+DDEV +KL ++K+ N LL  +K LDE QL+L HV GG+IG
Sbjct  365   IRSSWVQRRSKECHVDVRIVDDEVNIKLTEKKKTNSLLHAAKVLDEFQLELIHVVGGIIG  424

Query  477   DYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
             D++ F+FN+K+ EGS VYA A+A +L++ V+  + AI
Sbjct  425   DHHIFMFNTKVSEGSAVYACAVAKRLLQAVEMQHQAI  461



>gb|EEC77916.1| hypothetical protein OsI_17246 [Oryza sativa Indica Group]
Length=464

 Score =   205 bits (522),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 120/275 (44%), Positives = 165/275 (60%), Gaps = 31/275 (11%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRS---------SGSLFGEVDEREVNGAFYQTVDGCRDFENGVF  1006
             +++ HSLPQ  YG   S           SG LF E+D+R+     + +V  CR  +    
Sbjct  206   KDICHSLPQN-YGLFPSEDERDVIIGVGSGDLFQEIDDRQ-----FDSVLECRRGKGEFG  259

Query  1005  ELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGY  826
             +  G  N             FATER+RR  LN K+  L+ L PNP+KNDRAS+V DAI Y
Sbjct  260   KGKGKAN-------------FATERERREQLNVKFRTLRMLFPNPTKNDRASIVGDAIEY  306

Query  825   INELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDG--GDLKSVEDVDQSYSGTTLR  652
             I+EL RTV ELKILVE+KR    R K  K +   +  DG    ++ V D   +     +R
Sbjct  307   IDELNRTVKELKILVEQKRHGNNRRKVLKLDQ-EAAADGESSSMRPVRDDQDNQLHGAIR  365

Query  651   SSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDY  472
             SSW+QR+SK   VDVRI+DDEV +KL ++K+ N LL  +K LDE QL+L HV GG+IGD+
Sbjct  366   SSWVQRRSKECHVDVRIVDDEVNIKLTEKKKANSLLHAAKVLDEFQLELIHVVGGIIGDH  425

Query  471   YSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
             + F+FN+K+ +GS VYA A+A +L++ VD  + A+
Sbjct  426   HIFMFNTKVSDGSAVYACAVAKRLLQAVDVQHQAL  460



>ref|XP_010240358.1| PREDICTED: transcription factor bHLH91-like [Brachypodium distachyon]
Length=465

 Score =   203 bits (517),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 170/277 (61%), Gaps = 33/277 (12%)
 Frame = -2

Query  1158  RELFHSLPQGGYGF-----------GASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENG  1012
             +++ HSLPQ  YG            G     G +F ++D+R+     + TV  CR  +  
Sbjct  205   KDICHSLPQN-YGLFPGEDEREVMIGVGSVGGDIFQDIDDRQ-----FDTVLECRRGKGE  258

Query  1011  VFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
               +  G  N             FATER+RR  LN KY+ LK L PNP+K+DRASVV DAI
Sbjct  259   FGKGKGKAN-------------FATERERREQLNVKYKTLKDLFPNPTKSDRASVVGDAI  305

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRHKT-EGCSSMMDGGDLKSV-EDVDQSYSGTT  658
              YI+EL RTV ELKILVE+K    +R K  K  E  ++  +   +K + +D D  + GT 
Sbjct  306   EYIDELNRTVKELKILVEQKWHGNKRTKIIKLDEEVAADGESSSMKPMRDDQDNQFDGT-  364

Query  657   LRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIG  478
             +RSSW+QR+SK   +DVRI+++EV +KL ++K++N LL  ++ LDE QL+L H  GG+IG
Sbjct  365   IRSSWVQRRSKECHIDVRIVENEVNIKLTEKKKVNSLLHAARVLDEFQLELIHAVGGIIG  424

Query  477   DYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
             D++ F+FN+K+ EGS+VYA A+A +L++ VD  + AI
Sbjct  425   DHHIFMFNTKVSEGSSVYACAVAKRLLQAVDAQHQAI  461



>gb|AFW72948.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=491

 Score =   202 bits (514),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 169/284 (60%), Gaps = 40/284 (14%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDERE-------VNGAFYQTVDGCRDFENGVFEL  1000
             ++L+HSLPQ  YG         LF   DER+       V+G  +Q +DG R F++ +   
Sbjct  212   KDLYHSLPQN-YG---------LFTSDDERDGMVGVPGVSGNIFQEIDG-RQFDSPIL--  258

Query  999   TGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSK---------------  865
              G          GKG  +FATER+RR   N KY AL+ L PNP+K               
Sbjct  259   -GSRKQKGGFGKGKGKANFATERERREQFNVKYGALRSLFPNPTKKNSLSTVTKISRTFT  317

Query  864   ---NDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKT-EGCSSMMDGGDLK  697
                NDRAS+V DAI YINEL RTV ELKIL+EKKR S +R K  K  E  +   +   ++
Sbjct  318   IFQNDRASIVGDAIEYINELNRTVKELKILLEKKRNSADRRKILKLDEEAADDGESSSMQ  377

Query  696   SVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDEL  517
              V D   +    T+RSSW+QR+SK  +VDVRI+DDE+ +K  ++KR N LL  +K L+E 
Sbjct  378   PVSDDQNNQMNGTIRSSWVQRRSKECDVDVRIVDDEINIKFTEKKRANSLLCAAKVLEEF  437

Query  516   QLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVD  385
              L+L HV GG+IGD++ F+FN+KI +GS+VYA A+A KL+E V+
Sbjct  438   HLELIHVVGGIIGDHHIFMFNTKIPKGSSVYACAVAKKLLEAVE  481



>emb|CDY10785.1| BnaA05g11510D [Brassica napus]
Length=347

 Score =   197 bits (501),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 143/232 (62%), Gaps = 29/232 (13%)
 Frame = -2

Query  1023  FENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVV  844
             F+ G+ E +    +  K R  +  K F TER+RR HLN+++EALK L+P+P+K DRAS++
Sbjct  134   FDGGIIEFSK--KIRRKGRGKQKIKPFTTERERRCHLNERFEALKLLIPSPTKADRASIL  191

Query  843   HDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMM------DGGDLKSVED-  685
              D I YI EL+R V ELK LVE+K+C       +        +      D   +K +E  
Sbjct  192   QDGIDYIKELQRRVSELKYLVERKKCGGRHNNNNNNNNSDDCINEDTNDDENIVKKLESD  251

Query  684   -VDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLD  508
              +DQ  S  +LR SWLQRKSK                   +K+INCLL VSK LD+L LD
Sbjct  252   VLDQCPSNNSLRCSWLQRKSK-------------------KKKINCLLVVSKVLDQLHLD  292

Query  507   LHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTS  352
             LHHVAGG IG++YSFL N+KI EGST+YASAIANK+IEVVD+H+ A  P  +
Sbjct  293   LHHVAGGQIGEHYSFLLNTKINEGSTIYASAIANKVIEVVDQHHLAALPINN  344



>ref|XP_008793418.1| PREDICTED: transcription factor TIP2-like [Phoenix dactylifera]
Length=417

 Score =   197 bits (501),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 155/237 (65%), Gaps = 8/237 (3%)
 Frame = -2

Query  1056  AFYQTVDGCRDFENGVFELTGDMNVLAKNRDGKGTK-----HFATERQRRVHLNDKYEAL  892
              F+   +G  + E+G     G      K + G   +         E+QRR  +  KY+ L
Sbjct  178   GFFPGSNGVGELEDGYAGQLGRQQSDKKRKKGVSRQVEEAGSLKNEKQRRERITKKYDDL  237

Query  891   KKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKT-EGCSSMM  715
             K L+P+ +K DRAS++ DA  YINEL RTV ELKILV +KR  RE  K+    +G    +
Sbjct  238   KSLIPDSTKQDRASIIADATDYINELLRTVKELKILVAEKRHRREWGKKLIVGDGVDGDV  297

Query  714   DGGDLKS-VEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFV  538
             +   +K  ++D D+++ G+ LRSSW+QRKS+ T VDVRII+DEV +KL Q+K+++CL+ V
Sbjct  298   ESSSIKPFIDDGDRAFRGS-LRSSWIQRKSRETFVDVRIIEDEVYIKLTQRKKMDCLVVV  356

Query  537   SKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
             S+ LDELQL+L H++GG IGD + F+FN+KI EGS+VYASAIA KLIEV+D  Y  +
Sbjct  357   SQVLDELQLELLHLSGGNIGDSHIFIFNTKIHEGSSVYASAIAKKLIEVLDVPYPPL  413



>ref|XP_010938283.1| PREDICTED: transcription factor TIP2-like [Elaeis guineensis]
Length=424

 Score =   194 bits (494),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 140/192 (73%), Gaps = 3/192 (2%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
            E+QRR  +  KY+ LK L+PN +K DRAS++ DA  Y+NEL RT+ ELKILV +KR  RE
Sbjct  230  EKQRRERIAKKYDDLKSLIPNSTKQDRASIIADATDYVNELLRTLKELKILVAEKRHRRE  289

Query  756  RMKRHKT-EGCSSMMDGGDLKSVE-DVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVT  583
              K+    +G    ++   +K +  D D+++ G+ LRSSW+QRKS+ T VDVRI +DEV 
Sbjct  290  WGKKLIMGDGVDGDVESSSMKPLMGDGDRAFRGS-LRSSWIQRKSRETFVDVRITEDEVY  348

Query  582  VKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANK  403
            +KL Q+K++NCL+ VSK LDELQL+L H++GG IGD + F+FN+KI EGS+VYASA+A K
Sbjct  349  IKLTQRKKMNCLVVVSKVLDELQLELLHLSGGNIGDSHIFIFNTKIHEGSSVYASAVAKK  408

Query  402  LIEVVDKHYTAI  367
            LIEV+D  Y  +
Sbjct  409  LIEVLDVQYPPL  420



>ref|XP_002961225.1| hypothetical protein SELMODRAFT_402928 [Selaginella moellendorffii]
 gb|EFJ38764.1| hypothetical protein SELMODRAFT_402928 [Selaginella moellendorffii]
Length=529

 Score =   197 bits (500),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 120/286 (42%), Positives = 171/286 (60%), Gaps = 38/286 (13%)
 Frame = -2

Query  1158  RELFHSLPQGG-----YGFGASRSSGSLFGEVDEREVNGA-----FYQTVDGCRDFENGV  1009
             R L H+LP           G  R  G L  ++++R+ +G       + ++   RDF  G 
Sbjct  252   RHLLHTLPHASDHHLSSKSGIMRPPGLL--DLEDRDTSGGHEEGRLFPSLFEKRDFTFG-  308

Query  1008  FELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIG  829
                        K  + +G  HFATERQRR +LN+KY+ L+ LVPNPSK DRAS+V DAI 
Sbjct  309   -----------KGAENRGINHFATERQRREYLNEKYQTLRSLVPNPSKADRASIVADAIE  357

Query  828   YINELKRTVGELKILVEKKR--CSRERMKR---HKTEG-------CSSMMDGGDLKSVED  685
             Y+ ELKRTV EL++LVE+KR   ++ R K    + +EG        SS +  G  +  ++
Sbjct  358   YVKELKRTVQELQLLVEEKRRGSNKRRCKASPDNPSEGGGVTDMESSSAIQPGGTRVSKE  417

Query  684   VDQSYSGTTLRSSWLQRKSK-NTEVDVRIIDDEVTVKLVQQKRIN-CLLFVSKALDELQL  511
                   G+ LRSSWLQR S+  T++DVRI+DDEV +KL Q++R N  LL V ++L+EL L
Sbjct  418   TTFLGDGSQLRSSWLQRTSQMGTQIDVRIVDDEVNIKLTQRRRRNYVLLAVLRSLNELHL  477

Query  510   DLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYT  373
             DL H  G  IG+++ F+FN+KI EG++ +A  +A KLI+ VD+H T
Sbjct  478   DLLHANGASIGEHHIFMFNTKIMEGTSTFAGQVATKLIDAVDRHIT  523



>gb|EMT05766.1| Transcription factor bHLH89 [Aegilops tauschii]
Length=459

 Score =   194 bits (494),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 117/274 (43%), Positives = 166/274 (61%), Gaps = 31/274 (11%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDERE-------VNGAFYQTVDGCRDFENGVFEL  1000
             ++L+HSLPQ    FG       LF   DER+         G   Q +DG R F       
Sbjct  203   KDLYHSLPQS---FG-------LFSSDDERDRAMGVVGAAGNILQEIDG-RQFG------  245

Query  999   TGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYIN  820
             +  +    K   GK   +FATE++RR  +N KY AL+ L+P+P+KNDRAS+V DAI YIN
Sbjct  246   SPKLGRSKKGGFGKAKANFATEKERREQINVKYGALRSLLPSPTKNDRASIVGDAIEYIN  305

Query  819   ELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGD---LKSVEDVDQSYSGTTLRS  649
             EL RT+ EL  LVE    ++ RMKR K +  +   D G+   L+ V+D   S     +RS
Sbjct  306   ELNRTLKELTSLVEGD--TKHRMKRLKLDDAAC--DNGESSSLQQVKDDQDSQLNGAIRS  361

Query  648   SWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYY  469
             SW+QR+SK   VDVRI+ +E+ +K  ++K+ N LL  +K +DE +L+L HV GG+IGD  
Sbjct  362   SWIQRRSKECHVDVRIVGNEINIKFTEKKKTNSLLCAAKVIDEFRLELIHVVGGVIGDQR  421

Query  468   SFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
              F+FN+KI EGS+VYASA+A+KL+  ++  + A+
Sbjct  422   IFMFNTKISEGSSVYASALASKLLRAMEMEHLAV  455



>gb|EMT07628.1| Transcription factor bHLH91 [Aegilops tauschii]
Length=480

 Score =   194 bits (492),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 170/274 (62%), Gaps = 26/274 (9%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREV-------NGAFYQTVDGCRDFENGVFEL  1000
             +++ HSLPQ  YG         LF   DER+V        G  +Q +D  R FE  V E 
Sbjct  219   KDICHSLPQN-YG---------LFPSEDERDVMLGVGSVGGDLFQDMDD-RQFET-VLE-  265

Query  999   TGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYIN  820
                     +   GKG  +FATER+RR  LN KY+ L+ L PNP+KNDRASVV DAI YI+
Sbjct  266   --GRRGKGEFGKGKGKANFATERERREQLNVKYKTLRMLFPNPTKNDRASVVGDAIEYID  323

Query  819   ELKRTVGELKILVEKKR--CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSS  646
             EL RTV ELKILVE+K    +R R+++   E  +   +   ++ + D   +     +RSS
Sbjct  324   ELNRTVKELKILVEQKWHGTNRRRIRKLDEEAAAD-GESSSMRPMRDEQDNQLDGAIRSS  382

Query  645   WLQRKSKNTEVDVRIIDDEVTVKLVQQKRIN-CLLFVSKALDELQLDLHHVAGGLIGDYY  469
             W+QR+S+   VDVRI+++E+ +KL ++K+ N  LL V+K LDE  L++ HV GG+IGD+Y
Sbjct  383   WVQRRSRECHVDVRIVENEINIKLTEKKKANSSLLHVAKVLDEFHLEIIHVVGGIIGDHY  442

Query  468   SFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
              F+FN+K+ EGS+VYA A+A ++++ VD  + A+
Sbjct  443   IFMFNTKVTEGSSVYACAVAKRILQAVDAQHQAL  476



>gb|KDO65531.1| hypothetical protein CISIN_1g043851mg [Citrus sinensis]
Length=387

 Score =   187 bits (475),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 141/241 (59%), Gaps = 47/241 (20%)
 Frame = -2

Query  963  GKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKI-  787
            GK  K   +ERQRRV +NDK+  L+ LVPNP+   R  ++  ++  +N L + +    I 
Sbjct  149  GKAKKPIISERQRRVEMNDKFAVLRNLVPNPNNKVRIYLI-SSVKVVNLLIKNMVNFLII  207

Query  786  ----------------LVEKKRCSRERM--------------------KRHKTEGCSSMM  715
                            LV   +  R+R                     +RH  EGC    
Sbjct  208  CTNNKLRVIEHRWWEMLVSTSKSFRDRSMSSNHLWSEKDLQEKLGATNERHNIEGCDH--  265

Query  714  DGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRI-NCLLFV  538
               D+K    VD + + + LRSSWLQRKSK+ EVDVRI+DDEVTVK++Q+K+I NCLLF+
Sbjct  266  ---DMKPAPLVDPNNTAS-LRSSWLQRKSKDIEVDVRIVDDEVTVKILQRKKIDNCLLFL  321

Query  537  SKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTA--IA  364
            SK  DE+QLDL HVAGG IGDYYSFL NSKI EGS VYA AI NKLIEV+D+ Y A  IA
Sbjct  322  SKVFDEMQLDLQHVAGGHIGDYYSFLLNSKIHEGSCVYAGAIVNKLIEVMDRQYAAASIA  381

Query  363  P  361
            P
Sbjct  382  P  382



>ref|XP_010414165.1| PREDICTED: transcription factor bHLH10-like isoform X2 [Camelina 
sativa]
Length=402

 Score =   187 bits (475),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 125/184 (68%), Gaps = 7/184 (4%)
 Frame = -2

Query  1011  VFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAI  832
             V E      V  K R  + + +  TER+RRVH ND+++ LK L+PNP+K+DRAS+V +AI
Sbjct  217   VLEFNTTGVVTRKRRRSQKSNNSPTERERRVHFNDRFQDLKSLIPNPTKSDRASIVGEAI  276

Query  831   GYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGD---LKSVEDVDQS----  673
              YI EL RT+ E K+LVEKKR  R R K+    G     +  D    K   +VDQS    
Sbjct  277   DYIKELLRTIEEFKMLVEKKRFGRFRSKKKARRGEDQQQEEEDTVNYKPQSEVDQSCFSK  336

Query  672   YSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
              +  +LR SWL+RKSK TEVDVRIIDDEVT+KLVQ+K+INCLLF +K LD+LQLDLHHVA
Sbjct  337   NNNNSLRCSWLKRKSKVTEVDVRIIDDEVTIKLVQKKKINCLLFTTKVLDQLQLDLHHVA  396

Query  492   GGLI  481
             GG I
Sbjct  397   GGQI  400



>ref|XP_007219949.1| hypothetical protein PRUPE_ppb019685mg, partial [Prunus persica]
 gb|EMJ21148.1| hypothetical protein PRUPE_ppb019685mg, partial [Prunus persica]
Length=294

 Score =   183 bits (465),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 132/211 (63%), Gaps = 32/211 (15%)
 Frame = -2

Query  1071  REVNGAFYQT--VDGCRDFENGVFELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYE  898
             RE+  + + +  ++  R FENGV E + +M  + + R+ +  K FATE+QRRV LN KY 
Sbjct  74    RELYQSLFSSDGINNGRQFENGVLEFSREMGSIGRGREVERIKDFATEKQRRVQLNGKYS  133

Query  897   ALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSM  718
             AL+ LVPNP+K                          LVEKKRC RER   H+TE     
Sbjct  134   ALRYLVPNPTK--------------------------LVEKKRCGRER---HQTEQDGGA  164

Query  717   MDGGDLKSVEDV-DQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLF  541
              DG   K + D  DQSY+  +LRSSWL+RK K+TEVD+RIIDDEV++ LVQ K++N LL+
Sbjct  165   GDGESCKPLGDPQDQSYNNGSLRSSWLRRKYKDTEVDIRIIDDEVSINLVQTKKVNSLLY  224

Query  540   VSKALDELQLDLHHVAGGLIGDYYSFLFNSK  448
             VSK LDELQLDLHH  GG IG+ YS LFN+K
Sbjct  225   VSKLLDELQLDLHHAEGGHIGNSYSCLFNTK  255



>ref|XP_010938284.1| PREDICTED: transcription factor TIP2-like [Elaeis guineensis]
Length=441

 Score =   185 bits (470),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 142/213 (67%), Gaps = 33/213 (15%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSK------------------NDRASVVHDAIGYINELK  811
            E+QRR  +  KY+ LK L+PN +K                   DRAS++ DA  Y+NEL 
Sbjct  229  EKQRRERIAKKYDDLKSLIPNSTKVNDVGFSHLFAKNILNLKQDRASIIADATDYVNELL  288

Query  810  RTVGELKILVEKKRCSRERMKRHKTEGCSSMMDG--GDLKS------VEDVDQSYSGTTL  655
            RT+ ELKILV +KR  RE  K+        M DG  GD++S      ++D D+++ G  L
Sbjct  289  RTLKELKILVAEKRHRREWGKK------LIMGDGVDGDVESSSTKPLMDDGDRAFRGP-L  341

Query  654  RSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            RSSW+QRKS+ T VDVRII+DEV +KL Q+K++NCL+ VSK LDELQL+L H++GG IGD
Sbjct  342  RSSWIQRKSRETFVDVRIIEDEVYIKLTQRKKMNCLVVVSKVLDELQLELLHLSGGNIGD  401

Query  474  YYSFLFNSKICEGSTVYASAIANKLIEVVDKHY  376
             + F+FN+KI EGS+VYASA+A KLIEV+D  Y
Sbjct  402  SHVFIFNTKIHEGSSVYASAVAKKLIEVLDVQY  434



>ref|XP_002969202.1| hypothetical protein SELMODRAFT_410122 [Selaginella moellendorffii]
 gb|EFJ29290.1| hypothetical protein SELMODRAFT_410122 [Selaginella moellendorffii]
Length=885

 Score =   189 bits (480),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 168/283 (59%), Gaps = 38/283 (13%)
 Frame = -2

Query  1158  RELFHSLPQGG-----YGFGASRSSGSLFGEVDEREVNGA-----FYQTVDGCRDFENGV  1009
             R L H+LP           G  R  G L  ++++R+ +G       + ++   RDF  G 
Sbjct  219   RHLLHTLPHASDHHLSSKSGIMRPPGLL--DLEDRDTSGGHEEGRLFPSLFEKRDFTFG-  275

Query  1008  FELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIG  829
                        K  + +G  HFATERQRR +LN+KY+ L+ LVPNPSK DRAS+V DAI 
Sbjct  276   -----------KGAENRGINHFATERQRREYLNEKYQTLRSLVPNPSKADRASIVADAIE  324

Query  828   YINELKRTVGELKILVEKKR--CSRERMKR---HKTEG-------CSSMMDGGDLKSVED  685
             Y+ ELKRTV EL++LVE+KR   ++ R K    + +EG        SS +  G  +  ++
Sbjct  325   YVKELKRTVQELQLLVEEKRRGSNKRRCKASPDNPSEGGGATDMESSSAIQPGGTRVSKE  384

Query  684   VDQSYSGTTLRSSWLQRKSK-NTEVDVRIIDDEVTVKLVQQKRIN-CLLFVSKALDELQL  511
                   G+ LRSSWLQR S+  T++DVRI+DDEV +KL Q++R N  LL V ++L+EL L
Sbjct  385   TTFLGDGSQLRSSWLQRTSQMGTQIDVRIVDDEVNIKLTQRRRRNYVLLAVLRSLNELHL  444

Query  510   DLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDK  382
             DL H  G  IG+++ F+FN+KI EG++ +A  +A KLI+ + K
Sbjct  445   DLLHANGASIGEHHIFMFNTKIMEGTSTFAGQVATKLIDALGK  487



>ref|XP_009417499.1| PREDICTED: transcription factor TIP2-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score =   181 bits (458),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 159/264 (60%), Gaps = 23/264 (9%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMNVL  979
             RE+  S P    GF A+ S GS           G  Y  V G  D   G  +L    +V 
Sbjct  143   REVLGSFPHAA-GFFAAGSRGS-----------GESY--VIGTEDGRGG--QLLESPHVR  186

Query  978   AKNRDGK--GTKH--FATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELK  811
              K + G   G K      E+QRR  L  K+E LK L+PN +K DRAS+V D I YINEL 
Sbjct  187   NKRQQGAPWGMKQGGLKNEKQRRERLGKKFEDLKSLIPNSTKPDRASIVADTIEYINELL  246

Query  810   RTVGELKILVEKKRCSRERMKRHKT--EGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQ  637
             RTV ELKILVEKKR  RER ++  T  +    M        ++D D++  G  LRSSWLQ
Sbjct  247   RTVDELKILVEKKRRWRERARKTATGDQAAGDMESSSITPPMDDADRASKGV-LRSSWLQ  305

Query  636   RKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLF  457
             R+SK+T VDVRI+DDE  +KL ++K +NC+L V+K LDEL L+L H++GG +G  + F+ 
Sbjct  306   RRSKDTFVDVRIVDDEANIKLTRRKMMNCMLIVAKVLDELHLELLHLSGGNVGYSHIFMI  365

Query  456   NSKICEGSTVYASAIANKLIEVVD  385
             N+KI EGS+VYASAIA KLIE +D
Sbjct  366   NTKIHEGSSVYASAIAKKLIEAMD  389



>ref|XP_004305390.1| PREDICTED: intron-binding protein aquarius-like [Fragaria vesca 
subsp. vesca]
Length=2151

 Score =   186 bits (473),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 165/295 (56%), Gaps = 52/295 (18%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLFGEVDEREVNGAFYQTVDGCRDFENGVFELTGDMN--  985
             REL  SLP   Y  G   +   LF      E +G+        + FENGV E + +M   
Sbjct  410   RELLQSLPHR-YNLGGPSNGSILFSNGRNEEEHGS-------RQLFENGVMEFSKEMKPC  461

Query  984   ---VLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINEL  814
                        KGTK   TE +RRV  N +Y AL++LVPNP+K+DRAS+V DAI YI EL
Sbjct  462   GRGRGRGRGGNKGTK--LTEHERRVKTNRQYTALRELVPNPTKSDRASIVGDAIDYIQEL  519

Query  813   KRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGD---LKSVEDVDQSYSGT-TLRSS  646
             +RTV ELK+LVEKKR +RER KRHKTE      D  +   +K + D D  +S   +LRSS
Sbjct  520   RRTVSELKLLVEKKRYARERSKRHKTEKDIVAGDNDESCNMKPLGDPDHDHSNNESLRSS  579

Query  645   WLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYS  466
             WLQRKSK+T                            + LDEL L+LHH +GG IG+ YS
Sbjct  580   WLQRKSKDT----------------------------EVLDELLLELHHASGGHIGNSYS  611

Query  465   FLFNSKICEGSTVYASAIANKLIEVVDKHYTAIAPTTSY*DGSHSMSDCVITGWY  301
             FLFN+K+ EGS +YASAIANKLIE +D+ Y AI PT      + +M+    TG Y
Sbjct  612   FLFNTKMYEGSCLYASAIANKLIEALDRQYAAIPPT-----NNSAMTRVYGTGAY  661



>ref|XP_002964440.1| hypothetical protein SELMODRAFT_81013 [Selaginella moellendorffii]
 gb|EFJ34773.1| hypothetical protein SELMODRAFT_81013 [Selaginella moellendorffii]
Length=250

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 127/191 (66%), Gaps = 10/191 (5%)
 Frame = -2

Query  984  VLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRT  805
              AK  + +G  HFATERQRR +LN+KY+ L+ LVPNPSK DRAS+V DAI Y+ ELKRT
Sbjct  34   TFAKGAESRGINHFATERQRREYLNEKYQTLRSLVPNPSKADRASIVADAIDYVKELKRT  93

Query  804  VGELKILV-EKKRCSRERMKRHK-------TEGCSSMMDGGDLKSVEDVDQSYSGTTLRS  649
            V EL++LV EK+R S +R K           E  ++M   G  +  ++      G+ LRS
Sbjct  94   VQELQLLVEEKRRGSNKRCKASPDDPSATDVESTTAMQQPGGTRVSKETTFLGDGSQLRS  153

Query  648  SWLQRKSK-NTEVDVRIIDDEVTVKLVQQKRIN-CLLFVSKALDELQLDLHHVAGGLIGD  475
            SWLQR S+  T +DVRI+DDEV +KL Q++R N  LL V ++LDEL+LDL H  G  IG+
Sbjct  154  SWLQRTSQMGTHIDVRIVDDEVNIKLTQRRRRNYVLLAVLRSLDELRLDLLHANGASIGE  213

Query  474  YYSFLFNSKIC  442
            ++ F+FN+K+ 
Sbjct  214  HHIFMFNTKVV  224



>gb|EEE54383.1| hypothetical protein OsJ_01400 [Oryza sativa Japonica Group]
Length=301

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 132/199 (66%), Gaps = 14/199 (7%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
            E+QRR+ L +KY AL  L+PN +K DRA+V+ DAI YI EL RTV EL +LVEKKR  RE
Sbjct  104  EKQRRLRLTEKYNALMLLIPNRTKEDRATVISDAIEYIQELGRTVEELTLLVEKKRRRRE  163

Query  756  RMKRHKTEGCSSMMDGGDLKSVEDVD-------------QSYSGTTLRSSWLQRKSKNTE  616
                      SS++ G D ++ E  +                    +RS+++QR+SK T 
Sbjct  164  MQGDVVDAATSSVVAGMD-QAAESSEGEVMAAAAMGAVAPPPRQAPIRSTYIQRRSKETF  222

Query  615  VDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEG  436
            VDVRI++D+V +KL +++R  CL   S+ALD+L+LDL H++GG IGD + ++FN+KI  G
Sbjct  223  VDVRIVEDDVNIKLTKRRRDGCLAAASRALDDLRLDLVHLSGGKIGDCHIYMFNTKIHSG  282

Query  435  STVYASAIANKLIEVVDKH  379
            S V+ASA+A++LIEVVD++
Sbjct  283  SPVFASAVASRLIEVVDEY  301



>gb|EMS50437.1| Transcription factor bHLH89 [Triticum urartu]
Length=350

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 132/192 (69%), Gaps = 7/192 (4%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
            E+QRR  L++K+ AL  L+PN +K DRA+V++DAI YI EL RTV EL +LVEKKR  RE
Sbjct  160  EKQRRQRLSEKFTALMLLIPNRTKEDRATVIYDAIEYIQELGRTVEELTLLVEKKRGRRE  219

Query  756  RMKRHKTEGCSSMMDG------GDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIID  595
              +    +   +++ G      G++ +            +RS+++QR+SK T VDVRI++
Sbjct  220  H-QGDVVDPAPTLVAGDGECSAGEVAAAVMPAMPAPPQPIRSTYIQRRSKETFVDVRIVE  278

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASA  415
            DEV +KL +++R  CL   S+ALD+L LDL H++GG IGD + ++FN+KI  GS V+ASA
Sbjct  279  DEVNIKLTKRRRDGCLAAASRALDDLHLDLVHLSGGKIGDCHIYMFNTKIHPGSPVFASA  338

Query  414  IANKLIEVVDKH  379
            +A+KLIEVVD++
Sbjct  339  VASKLIEVVDEY  350



>gb|EMT16792.1| Transcription factor bHLH91 [Aegilops tauschii]
Length=268

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 127/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
            E+QRR  L++K+ AL  L+PN +K DRA+V++DAI YI EL RTV EL +LVEKKR  RE
Sbjct  82   EKQRRQRLSEKFTALMLLIPNRTKEDRATVIYDAIEYIQELGRTVEELTLLVEKKRGRRE  141

Query  756  RMKRHKTEGCSSMMDGGDLKSVE-DVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTV  580
                        +   G+  + E           +RS+++QR+SK T VDVRI++DEV +
Sbjct  142  HQGDVVDPAPLVVAGEGECSAGELRAPPPPPPQPIRSTYIQRRSKETFVDVRIVEDEVNI  201

Query  579  KLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKL  400
            KL +++R  CL   S+ALD+L LDL H++GG IGD + ++FN+KI  GS V+ASA+A+KL
Sbjct  202  KLTKRRRDGCLAAASRALDDLHLDLVHLSGGKIGDCHIYMFNTKIHPGSPVFASAVASKL  261

Query  399  IEVVDKH  379
            IEVVD++
Sbjct  262  IEVVDEY  268



>ref|NP_001042795.1| Os01g0293100 [Oryza sativa Japonica Group]
 sp|Q5JNS0.1|TIP2_ORYSJ RecName: Full=Transcription factor TIP2; AltName: Full=Basic 
helix-loop-helix protein TIP2; AltName: Full=TDR INTERACTING 
PROTEIN2 [Oryza sativa Japonica Group]
 dbj|BAD86887.1| putative bHLH transcription factor [Oryza sativa Japonica Group]
 dbj|BAF04709.1| Os01g0293100 [Oryza sativa Japonica Group]
Length=379

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 131/198 (66%), Gaps = 12/198 (6%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
            E+QRR+ L +KY AL  L+PN +K DRA+V+ DAI YI EL RTV EL +LVEKKR  RE
Sbjct  182  EKQRRLRLTEKYNALMLLIPNRTKEDRATVISDAIEYIQELGRTVEELTLLVEKKRRRRE  241

Query  756  RMKRHKTEGCSSMMDGGDLKSVEDVDQSYSG------------TTLRSSWLQRKSKNTEV  613
                      SS++ G D  +     +  +               +RS+++QR+SK T V
Sbjct  242  MQGDVVDAATSSVVAGMDQAAESSEGEVMAAAAMGAVAPPPRQAPIRSTYIQRRSKETFV  301

Query  612  DVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGS  433
            DVRI++D+V +KL +++R  CL   S+ALD+L+LDL H++GG IGD + ++FN+KI  GS
Sbjct  302  DVRIVEDDVNIKLTKRRRDGCLAAASRALDDLRLDLVHLSGGKIGDCHIYMFNTKIHSGS  361

Query  432  TVYASAIANKLIEVVDKH  379
             V+ASA+A++LIEVVD++
Sbjct  362  PVFASAVASRLIEVVDEY  379



>ref|XP_003567568.1| PREDICTED: transcription factor TIP2-like [Brachypodium distachyon]
Length=366

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 131/197 (66%), Gaps = 11/197 (6%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
            E+QRR+ L +KY AL  L+PN +K DRA+V+ DAI YI EL RTV EL +LV KKR    
Sbjct  170  EKQRRLRLTEKYTALMLLIPNRTKEDRATVISDAIEYIQELGRTVEELTLLVGKKRRRNG  229

Query  756  RMKRHKTEG-----CSSMMDGGDLKSVEDVDQSYSGTTL------RSSWLQRKSKNTEVD  610
              + H  +G       ++   G+L    +  +      L      RS+++QRKSK T VD
Sbjct  230  AGEHHLHQGDVVDAAPAVGAAGELVLAAESSEGEVQAPLAALQPIRSTYIQRKSKETFVD  289

Query  609  VRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGST  430
            VRI++DEV +KL +++R  CL   S+ALD+L+LDL H++GG IGD + ++FN+KI +GS 
Sbjct  290  VRIVEDEVNIKLTKRRRDGCLAAASRALDDLRLDLVHLSGGKIGDCHIYMFNTKIHQGSP  349

Query  429  VYASAIANKLIEVVDKH  379
            V+ASA+A+KLIEVVD++
Sbjct  350  VFASAVASKLIEVVDEY  366



>ref|NP_001149921.1| LOC100283549 [Zea mays]
 ref|XP_008655013.1| PREDICTED: LOC100283549 isoform X1 [Zea mays]
 ref|XP_008655014.1| PREDICTED: LOC100283549 isoform X1 [Zea mays]
 ref|XP_008655015.1| PREDICTED: LOC100283549 isoform X1 [Zea mays]
 ref|XP_008655016.1| PREDICTED: LOC100283549 isoform X1 [Zea mays]
 ref|XP_008655017.1| PREDICTED: LOC100283549 isoform X1 [Zea mays]
 gb|ACG37205.1| DNA binding protein [Zea mays]
 gb|ACN29089.1| unknown [Zea mays]
 gb|ACN29270.1| unknown [Zea mays]
 gb|ACN35803.1| unknown [Zea mays]
 gb|AFW79451.1| putative HLH DNA-binding domain superfamily protein isoform 1 
[Zea mays]
 gb|AFW79452.1| putative HLH DNA-binding domain superfamily protein isoform 2 
[Zea mays]
 gb|AFW79453.1| putative HLH DNA-binding domain superfamily protein isoform 3 
[Zea mays]
 gb|AFW79454.1| putative HLH DNA-binding domain superfamily protein isoform 4 
[Zea mays]
 gb|AIB05182.1| bHLH transcription factor, partial [Zea mays]
Length=365

 Score =   166 bits (421),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
            E+QRR+ L +KY AL  L+PN +K DRA+V+ DAI YI EL RTV EL +LVEKKR  RE
Sbjct  175  EKQRRLRLTEKYTALMHLIPNVTKTDRATVISDAIEYIQELGRTVEELTLLVEKKRRRRE  234

Query  756  -RMKRHKTEGCSSMMDGGDLKSVE----DVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDD  592
             +         + +   G+ +S E        +     +RS+++QR+SK+T VDVRI+++
Sbjct  235  LQGDVVDAAPAAVVAAAGEAESSEGEVAPPPPAVPRQPIRSTYIQRRSKDTSVDVRIVEE  294

Query  591  EVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAI  412
            +V +KL +++R  CL   S+ALD+L+LDL H++GG IGD   ++FN+KI +GS+V+ASA+
Sbjct  295  DVNIKLTKRRRDGCLAAASRALDDLRLDLVHLSGGKIGDCQIYMFNTKIHKGSSVFASAV  354

Query  411  ANKLIEVVDKH  379
            A +L+EVVD++
Sbjct  355  AGRLMEVVDEY  365



>emb|CAE03950.1| OSJNba0093F12.24 [Oryza sativa Japonica Group]
Length=535

 Score =   169 bits (427),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = -2

Query  876  NPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDG--GD  703
            +P++NDRAS+V DAI YI+EL RTV ELKILVE+KR    R K  K +   +  DG    
Sbjct  361  HPNQNDRASIVGDAIEYIDELNRTVKELKILVEQKRHGNNRRKVLKLDQ-EAAADGESSS  419

Query  702  LKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALD  523
            ++ V D   +     +RSSW+QR+SK   VDVRI+DDEV +KL ++K+ N LL  +K LD
Sbjct  420  MRPVRDDQDNQLHGAIRSSWVQRRSKECHVDVRIVDDEVNIKLTEKKKANSLLHAAKVLD  479

Query  522  ELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
            E QL+L HV GG+IGD++ F+FN+K+ EGS VYA A+A KL++ VD  + A+
Sbjct  480  EFQLELIHVVGGIIGDHHIFMFNTKVSEGSAVYACAVAKKLLQAVDVQHQAL  531



>ref|XP_002457706.1| hypothetical protein SORBIDRAFT_03g011940 [Sorghum bicolor]
 gb|EES02826.1| hypothetical protein SORBIDRAFT_03g011940 [Sorghum bicolor]
Length=379

 Score =   164 bits (415),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 131/198 (66%), Gaps = 12/198 (6%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
            E+QRR  L +KY AL  L+PN +K DRA+V+ DAI YI EL RTV EL +LVEKKR  RE
Sbjct  182  EKQRRQRLTEKYTALMHLIPNVTKPDRATVISDAIEYIQELGRTVEELTLLVEKKRRRRE  241

Query  756  ------------RMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEV  613
                         +      G  +    G++        +     +RS+++QR+SK+T V
Sbjct  242  LQGDVVDAAPTAVVVAAAATGGEAESSEGEVAPPPPPPAAVQRQPIRSTYIQRRSKDTSV  301

Query  612  DVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGS  433
            DVRI++++V +KL +++R  CL   S+ALD+L+LDL H++GG IGD + ++FN+KI +GS
Sbjct  302  DVRIVEEDVNIKLTKRRRDGCLAAASRALDDLRLDLVHLSGGKIGDCHIYMFNTKIHKGS  361

Query  432  TVYASAIANKLIEVVDKH  379
            +V+ASA+A++L+EVVD++
Sbjct  362  SVFASAVASRLMEVVDEY  379



>ref|XP_006644088.1| PREDICTED: transcription factor bHLH91-like [Oryza brachyantha]
Length=370

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 132/204 (65%), Gaps = 26/204 (13%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
            E+QRR  L +KY AL  L+PN +K DRA+V+ DAI YI EL RTV EL +LVEKKR    
Sbjct  175  EKQRRQRLTEKYNALMLLIPNRTKEDRATVISDAIEYIQELGRTVEELTLLVEKKR----  230

Query  756  RMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTT------------------LRSSWLQRK  631
              +R + +G   ++D      + +  +S  G                    +RS+++QR+
Sbjct  231  --RRGELQG--DVVDVAPSAVLLEAAESSEGEVAAATTAAAGGGAPVPRQLIRSTYIQRR  286

Query  630  SKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNS  451
            SK T VDVRI++D+V +KL +++R  CL   S+ALD+L+LDL H++GG IGD + ++FN+
Sbjct  287  SKETFVDVRIVEDDVNIKLTKRRRDGCLAAASRALDDLRLDLVHLSGGKIGDCHIYMFNT  346

Query  450  KICEGSTVYASAIANKLIEVVDKH  379
            KI  GS V+ASA+A++LIEVVD++
Sbjct  347  KIHPGSPVFASAVASRLIEVVDEY  370



>ref|XP_001784001.1| predicted protein [Physcomitrella patens]
 gb|EDQ51169.1| predicted protein [Physcomitrella patens]
Length=966

 Score =   165 bits (418),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 139/216 (64%), Gaps = 29/216 (13%)
 Frame = -2

Query  960  KGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILV  781
            +G  HFATERQRR +LN+KY+ L+ LVPNP+K DRAS+V DAI Y+ ELKRTV EL++LV
Sbjct  748  RGVNHFATERQRREYLNEKYQTLRSLVPNPTKADRASIVADAIEYVKELKRTVQELQLLV  807

Query  780  EKKR-----CSRERMKRH-----------KTEGCSS----MMDGGDLKSVEDVDQSYSGT  661
            ++KR      S  + +R             TE  S+    M  G D  S +       G+
Sbjct  808  QEKRRAAGDSSGGKRRRSMDDADNYAGSCTTENASNGHLVMQKGNDTFSTD-------GS  860

Query  660  TLRSSWLQRKSKN-TEVDVRIIDDEVTVKLVQQKRINCLLF-VSKALDELQLDLHHVAGG  487
             LRSSWLQR S+N T VDVRI+ DEVT+K+ Q++  NCL+F V   L ELQLDL   +G 
Sbjct  861  QLRSSWLQRTSQNGTHVDVRIVHDEVTIKVNQRRGKNCLVFDVIAVLQELQLDLLQASGA  920

Query  486  LIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKH  379
             IG++  FLFN+KI EGS+ +A  IA KL++ +D+H
Sbjct  921  TIGEHDVFLFNTKILEGSSTFAGYIAVKLLDALDRH  956



>ref|XP_004967599.1| PREDICTED: transcription factor bHLH91-like [Setaria italica]
Length=356

 Score =   157 bits (396),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 124/193 (64%), Gaps = 7/193 (4%)
 Frame = -2

Query  936  ERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRE  757
            E+QRR  L +KY AL  L+PN +K+DRA+V+ DAI YI EL RTV EL +LVEKKR   E
Sbjct  164  EKQRRQRLTEKYNALMLLIPNRTKDDRATVISDAIEYIQELGRTVEELTLLVEKKRRRME  223

Query  756  -------RMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRII  598
                             ++         V     +     +RS+++QR+SK+T VDVRI+
Sbjct  224  LQGDVVDAAPAVAVAAAAAGEAESSEGEVAPPPPAVQRQPIRSTYIQRRSKDTSVDVRIV  283

Query  597  DDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYAS  418
            +++V +KL +++R  CL   S+ALD+L+L+L H++GG IGD + ++FN+KI   S V+AS
Sbjct  284  EEDVNIKLTKRRRDGCLAAASRALDDLRLELVHLSGGKIGDCHIYMFNTKIHPSSPVFAS  343

Query  417  AIANKLIEVVDKH  379
            A+A++L+EVVD +
Sbjct  344  AVASRLMEVVDDY  356



>gb|EPS57728.1| hypothetical protein M569_17090, partial [Genlisea aurea]
Length=145

 Score =   142 bits (359),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 91/146 (62%), Positives = 109/146 (75%), Gaps = 11/146 (8%)
 Frame = -2

Query  981  LAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV  802
            + +NR+    KHFATE+ RRV LNDKYEALKKL+PNP+K DRAS V DAI YI ELKRTV
Sbjct  6    MVRNRN---RKHFATEKHRRVLLNDKYEALKKLIPNPTKTDRASTVADAINYIQELKRTV  62

Query  801  GELKILVEKKRCSRERM-----KRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQ  637
             ELK+L+EKKR +RER       RH T   + +   GD  +  + D S S ++LR+SWLQ
Sbjct  63   AELKVLLEKKRAARERRRSDDENRHVTTVAAPIQ--GDNDACNNGDSSSS-SSLRTSWLQ  119

Query  636  RKSKNTEVDVRIIDDEVTVKLVQQKR  559
            RKSK+TEVDVRIIDDEVTVK+VQQKR
Sbjct  120  RKSKHTEVDVRIIDDEVTVKVVQQKR  145



>ref|XP_011041996.1| PREDICTED: transcription factor bHLH89-like [Populus euphratica]
Length=237

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 134/217 (62%), Gaps = 18/217 (8%)
 Frame = -2

Query  1002  LTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPS-KNDRASVVHDAIGY  826
             +T   +V+ + +       FA E QRR  LN+ Y+ L+ L+ NPS K DRA+V+ DAI Y
Sbjct  23    MTSCTDVIQEQQGTASLISFAIELQRRGQLNENYKTLRNLIKNPSTKEDRATVIRDAIKY  82

Query  825   INELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTL---  655
             + +L RTV ELK LVEK      R+K+  T G   +      +S      SY+ +++   
Sbjct  83    VIQLIRTVYELKQLVEK-----NRIKKLDTIGGVDVFTPVVRES--QYSHSYNDSSIGPS  135

Query  654   ---RSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRIN--CLLFVSKALDELQLDLHHVAG  490
                + SW+QRKSK+TE+DVR+I DEVT+K++ +++ N  CLLFVS+ LDELQ+DLH V+ 
Sbjct  136   FSKKHSWVQRKSKDTEIDVRLIGDEVTIKVLHRRKKNNYCLLFVSRVLDELQMDLHFVSS  195

Query  489   GLIG-DYYSFLFNSKICEG-STVYASAIANKLIEVVD  385
               IG +   F F +KI  G S+  A  +A+KLIEV+D
Sbjct  196   CYIGYETNYFQFKTKINGGSSSANAHTVASKLIEVLD  232



>ref|XP_002314221.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE88176.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=238

 Score =   140 bits (352),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 125/198 (63%), Gaps = 17/198 (9%)
 Frame = -2

Query  945  FATERQRRVHLNDKYEALKKLVPNPS-KNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            FA E QRR  LND Y+ L+ L+ NPS K DRA+V+ DAI YI +L RTV ELK LVEK R
Sbjct  42   FAIELQRRGQLNDNYKTLRDLIKNPSTKEDRATVIRDAIKYIIQLIRTVYELKQLVEKTR  101

Query  768  CSRERMKRHKTEGCSSMMDGGDLK------SVEDVDQSYSGTTLRSSWLQRKSKNTEVDV  607
                  K+  T G   +     ++      S  DV    S +   SS +QRKSK+TE+DV
Sbjct  102  G-----KKLDTIGGVDVFTKPVVRKSQYSHSYNDVSSGPSFSKKHSS-VQRKSKDTEIDV  155

Query  606  RIIDDEVTVKLVQQKRIN--CLLFVSKALDELQLDLHHVAGGLIG-DYYSFLFNSKICEG  436
            RII DEVT+K++++++ N  CLLFVS+ LDEL +DLH V+   IG + Y F F +KI  G
Sbjct  156  RIIGDEVTIKVLRRRKKNDYCLLFVSRVLDELHMDLHFVSSCYIGYETYYFQFKTKINGG  215

Query  435  -STVYASAIANKLIEVVD  385
             S+  A  IA+KLIEV+D
Sbjct  216  PSSDNAHTIADKLIEVLD  233



>ref|XP_006585882.1| PREDICTED: transcription factor bHLH91-like [Glycine max]
Length=127

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 102/127 (80%), Gaps = 7/127 (6%)
 Frame = -2

Query  750  KRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLV  571
            +RH+ E      D GD  ++++ DQ YS   LRSSW++RKSK+TEVDVRI+D+EVT+KLV
Sbjct  4    RRHEGEA-----DEGDFSTLQEPDQ-YS-ENLRSSWIRRKSKDTEVDVRIVDNEVTIKLV  56

Query  570  QQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEV  391
            Q+K+I+CL+ VS  LD+L LDL HVAGG IGD+ S+LFN+KICEGS++YASAIA+KLI+V
Sbjct  57   QRKKIDCLVHVSHLLDQLNLDLQHVAGGHIGDFCSYLFNTKICEGSSLYASAIAHKLIQV  116

Query  390  VDKHYTA  370
            +D  + A
Sbjct  117  MDTSFAA  123



>ref|XP_001767478.1| predicted protein [Physcomitrella patens]
 gb|EDQ67802.1| predicted protein [Physcomitrella patens]
Length=1153

 Score =   143 bits (360),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 103/254 (41%), Positives = 146/254 (57%), Gaps = 27/254 (11%)
 Frame = -2

Query  1152  LFHSLPQGGYGFGASRSSGSLFGEVD-EREVNGAFYQTVDGCRDFENGVFELTGDMNVLA  976
              FH+L +G     +     +   ++D EREV       + G    +N V+    ++   +
Sbjct  504   FFHNLSRGNTPEASRHGGPATLVDLDQEREV-------LSG----KNIVYGSKRELGAAS  552

Query  975   KNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
                + +G  HFATERQRR +LN+KY+ L+ LVPNP+K DRAS+V DAI Y+ ELKRTV E
Sbjct  553   AKGEPRGVNHFATERQRREYLNEKYQTLRSLVPNPTKADRASIVADAIEYVKELKRTVQE  612

Query  795   LKILVEKKRCS---RERMKRHKTEGCSSMMDG---------GDLKSVEDVDQ-SYSGTTL  655
             L++LV++KR +       KR ++   +    G         G L   +  D  S  G+ L
Sbjct  613   LQLLVQEKRRAAGDSSGAKRRRSLDATDTYPGACTPENASNGHLVMQKGNDTFSADGSQL  672

Query  654   RSSWLQRKSKN-TEVDVRIIDDEVTVKLVQQKRINCLLF-VSKALDELQLDLHHVAGGLI  481
             RSSWLQR S+N T VDVRI+ DEVT+K+ Q++   CL+F V   L ELQLDL   +G  I
Sbjct  673   RSSWLQRTSQNGTHVDVRIVHDEVTIKVNQRRGKTCLVFDVISVLQELQLDLLQASGATI  732

Query  480   GDYYSFLFNSKICE  439
             G++  FLFN+K  +
Sbjct  733   GEHDVFLFNTKASQ  746



>ref|XP_002879312.1| hypothetical protein ARALYDRAFT_902147 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55571.1| hypothetical protein ARALYDRAFT_902147 [Arabidopsis lyrata subsp. 
lyrata]
Length=179

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 96/162 (59%), Gaps = 20/162 (12%)
 Frame = -2

Query  984  VLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRT  805
            V  K R  + ++ F TER+RRVH ND+   LK L+PNP+K  +AS+V D I YINEL+R 
Sbjct  19   VTRKGRGSRKSRTFPTERERRVHFNDRIFELKNLIPNPTKGGKASIVQDGIVYINELRRL  78

Query  804  VGELKILVEKKRCSRERMKRHKT--------------EGCSSMMDGGDLKSVEDVDQSYS  667
            V ELK LVEKKRC      RHK                  S M    D +++E   +  S
Sbjct  79   VSELKSLVEKKRCG----GRHKNIDSRNTIYVTGEIEHPFSKMRLNHDEENME--KKPES  132

Query  666  GTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLF  541
                + SWL+R SK  +V VR+IDDEVT+K+VQ+K+INCL F
Sbjct  133  DMIDQCSWLERNSKVIQVYVRVIDDEVTIKVVQKKKINCLFF  174



>gb|KFK42944.1| hypothetical protein AALP_AA1G058900 [Arabis alpina]
Length=241

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 98/170 (58%), Gaps = 47/170 (28%)
 Frame = -2

Query  882  VPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGD  703
            +P P K DRAS+V  AI YI EL R + E+K+LVE+K+                      
Sbjct  109  IPIPIKKDRASIVKYAIEYIKELLRAIEEIKVLVERKK----------------------  146

Query  702  LKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKR-INCLLFVSKAL  526
                                + RKS   E DV+I+ DEVT+K+ Q+K+ INCLLFVSK +
Sbjct  147  --------------------VHRKSDLAEFDVQIVKDEVTIKIEQKKKDINCLLFVSKVI  186

Query  525  DELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHY  376
            D+LQL+L+HVAG    + + FLF +KICEG+ V+A+ IA+ ++EVV+K Y
Sbjct  187  DQLQLELYHVAG----EEHKFLFKAKICEGTRVHANVIADTIVEVVEKEY  232



>gb|EEC70458.1| hypothetical protein OsI_01494 [Oryza sativa Indica Group]
Length=137

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  657  LRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIG  478
            +RS+++QR+SK T VDVRI++D+V +KL +++R  CL   S+ALD+L+LDL H++GG IG
Sbjct  45   IRSTYIQRRSKETFVDVRIVEDDVNIKLTKRRRDGCLAAASRALDDLRLDLVHLSGGKIG  104

Query  477  DYYSFLFNSKICEGSTVYASAIANKLIEVVDKH  379
            D + ++FN+KI  GS V+ASA+A++LIEVVD++
Sbjct  105  DCHIYMFNTKIHPGSPVFASAVASRLIEVVDEY  137



>ref|XP_008670706.1| PREDICTED: transcription factor bHLH91-like [Zea mays]
 gb|ACG46121.1| hypothetical protein [Zea mays]
Length=170

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  657  LRSSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIG  478
            +RS+++QR+SK+T VDVRI++++V +KL +++R  CL   S+ALD+L+LDL H++GG IG
Sbjct  78   IRSTYIQRRSKDTSVDVRIVEEDVNIKLTKRRRDGCLAAASRALDDLRLDLVHLSGGKIG  137

Query  477  DYYSFLFNSKICEGSTVYASAIANKLIEVVDKH  379
            D   ++FN+KI +GS+V+ASA+A +L+EVVD++
Sbjct  138  DCQIYMFNTKIHKGSSVFASAVAGRLMEVVDEY  170



>ref|XP_007218278.1| hypothetical protein PRUPE_ppa008351mg [Prunus persica]
 gb|EMJ19477.1| hypothetical protein PRUPE_ppa008351mg [Prunus persica]
Length=336

 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 63/101 (62%), Gaps = 5/101 (5%)
 Frame = -2

Query  1158  RELFHSLPQGGYGFGASRSSGSLF--GEVDEREVNGAFYQT-VDGCRDFENGVFELTGDM  988
             REL  SLP G Y    SR+ GSLF  G  D   + G  Y   ++  R FENGV E + +M
Sbjct  200   RELLQSLPHG-YSLPGSRN-GSLFSSGGDDREGIGGGVYSDGINNGRQFENGVLEFSREM  257

Query  987   NVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSK  865
               + + RD KGTKHFATE+ RRV LN KY AL+ LVPNP+K
Sbjct  258   GSIGRGRDVKGTKHFATEKHRRVQLNGKYSALRDLVPNPTK  298



>ref|XP_002531183.1| hypothetical protein RCOM_0012680 [Ricinus communis]
 gb|EEF31198.1| hypothetical protein RCOM_0012680 [Ricinus communis]
Length=155

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  546  LFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIANKLIEVVDKHYTAI  367
             ++  ++  +QLDLHHV GG IGDYYSFLFN+KI E S+VY SAIANKLI+VVDKHY + 
Sbjct  90   FYILFSIGLVQLDLHHVVGGQIGDYYSFLFNTKIFEESSVYVSAIANKLIDVVDKHYAST  149

Query  366  APTTSY  349
              T+ Y
Sbjct  150  LFTSCY  155



>ref|NP_850161.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein 
[Arabidopsis thaliana]
 gb|AEC08509.1| basic helix-loop-helix (bHLH) DNA-binding superfamily protein 
[Arabidopsis thaliana]
Length=129

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -2

Query  975  KNRDGKGTKH---FATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRT  805
            K  +GKG+K    F TER+RR   ND++  LK L+PNP+K   AS+V D I YINEL+R 
Sbjct  12   KAEEGKGSKKSRTFLTERERRALFNDRFFDLKNLIPNPTKGGEASIVQDGIVYINELQRL  71

Query  804  VGELKILVEKKRC  766
            V ELK LVEKK+C
Sbjct  72   VSELKYLVEKKKC  84



>ref|XP_010247585.1| PREDICTED: transcription factor bHLH10 [Nelumbo nucifera]
Length=126

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  939  TERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSR  760
            +++QRR  LN+K++AL+ L PNP+K DRAS+V DAI YI E+ R V ELKILVEKKR   
Sbjct  59   SKKQRREQLNEKFKALRLLFPNPTKADRASIVGDAIDYIKEILRIVDELKILVEKKRWGE  118

Query  759  ERMK  748
             R K
Sbjct  119  RREK  122



>ref|XP_006415166.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
 gb|ESQ33519.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
Length=624

 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 83/158 (53%), Gaps = 14/158 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V + +    + +
Sbjct  452  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIK  511

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K H+  G  +   GGDL S              S  +  K    E++V+II  +
Sbjct  512  TQLEEVK-HELAGRKASAGGGDLAS-------------SSPMMGIKPVGMEIEVKIIGWD  557

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  558  AMIRVESSKRNHPAARLMTALMDLELEVNHASMSVVND  595



>gb|KHN15898.1| Transcription factor bHLH14 [Glycine soja]
Length=465

 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 86/159 (54%), Gaps = 12/159 (8%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN S+ D+AS++ DA+ YINELK  + +L     + +
Sbjct  288  HVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVAYINELKAKIEDL-----ESQ  342

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
              R+  K+ KTE   ++ +     +   VDQS SG+ L    L       EVDVRI+  +
Sbjct  343  QPRDSNKKMKTEMTDTLDNQSATTTSTVVDQSGSGSRLGLGPL-----GLEVDVRIVGPD  397

Query  588  VTVKLVQQKRINCL-LFVSKALDELQLDLHHVAGGLIGD  475
              V+ VQ + +N     +  AL +L+  +HH +   + D
Sbjct  398  AMVR-VQSENVNHPGARLMGALRDLEFQVHHASMSCVND  435



>ref|XP_003548195.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=466

 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 86/159 (54%), Gaps = 12/159 (8%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN S+ D+AS++ DA+ YINELK  + +L     + +
Sbjct  289  HVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVAYINELKAKIEDL-----ESQ  343

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
              R+  K+ KTE   ++ +     +   VDQS SG+ L    L       EVDVRI+  +
Sbjct  344  QPRDSNKKMKTEMTDTLDNQSATTTSTVVDQSGSGSRLGLGPL-----GLEVDVRIVGPD  398

Query  588  VTVKLVQQKRINCL-LFVSKALDELQLDLHHVAGGLIGD  475
              V+ VQ + +N     +  AL +L+  +HH +   + D
Sbjct  399  AMVR-VQSENVNHPGARLMGALRDLEFQVHHASMSCVND  436



>gb|KFK45000.1| hypothetical protein AALP_AA1G331100 [Arabis alpina]
Length=610

 Score = 78.6 bits (192),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 82/158 (52%), Gaps = 16/158 (10%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V + +    + R
Sbjct  440  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKVTKTESEKTQIR  499

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K    E  +S  +GGDL +                    K+   E++V+II  +
Sbjct  500  NQLEEVKSELAERKAS-ANGGDLTATTTA---------------IKAVGMEIEVKIIGWD  543

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  AL EL+L+++H +  ++ D
Sbjct  544  AMIRVESSKRNHPAARLMSALMELELEVNHASMSVVND  581



>ref|XP_010677236.1| PREDICTED: transcription factor MYC2-like [Beta vulgaris subsp. 
vulgaris]
Length=649

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 90/179 (50%), Gaps = 27/179 (15%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  + + ++      
Sbjct  467  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKAKLQDFEV------  520

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSK----------NT  619
                     + EG  S ++G  LK      Q  S   L  S+L++++K          + 
Sbjct  521  ---------EKEGLVSQVEG--LKKELGGSQPQSQQQLAPSYLEKETKAVLGVKQQLVDL  569

Query  618  EVDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKIC  442
            E+DV+II  E  +++   K+ +    +  AL EL+LD+ H +  ++ D        K+C
Sbjct  570  EIDVKIIGWEAMIRVNSNKKNHPAARLMAALMELELDVTHASVSVVNDLMIQQATVKMC  628



>ref|XP_010523833.1| PREDICTED: transcription factor MYC3-like [Tarenaya hassleriana]
Length=418

 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 80/152 (53%), Gaps = 19/152 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGEL--KILVEK  775
            H   ERQRR  LN ++ AL+ +VP  S+ D+AS++ DA+ YINELKR + EL  K+  + 
Sbjct  246  HIEAERQRREKLNHRFYALRSVVPRVSRMDKASLLSDAVSYINELKRKIDELESKLKPDN  305

Query  774  KRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIID  595
            KR   E M    T G S+  D   +K+  +   S  G +             EVDV+I+ 
Sbjct  306  KRVKLEEM----TTGLSN--DQSGIKNASEALVSKRGYS-----------KVEVDVKIVG  348

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHH  499
            DE  +++  +     +  ++ AL EL+L + H
Sbjct  349  DEAVIRVQTENLSYPVAALTAALRELKLKIRH  380



>ref|XP_010538366.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=613

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 83/158 (53%), Gaps = 14/158 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  + +++    +  
Sbjct  441  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLQKVESEKTQVE  500

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
            C  E +   K E      + G    V DV  SYS  + R+          E++V+II  +
Sbjct  501  CQVESL---KGELAGQNANAG---VVGDVGDSYSSVSKRT--------GVEIEVKIIGWD  546

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR      +  AL +L+L+++H +  ++ D
Sbjct  547  AMIRIESSKRNYPAARLMSALRDLELEVNHASMSVVND  584



>ref|XP_009347383.1| PREDICTED: transcription factor MYC2 [Pyrus x bretschneideri]
Length=687

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 88/175 (50%), Gaps = 15/175 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +  ++   E+ +
Sbjct  509  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQ  568

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E M  H    C      G + S E++    S           K  + ++DV+II  +
Sbjct  569  KQLESMNNHLP--CKDSRSSGSIMSEEELKGCSS-----------KLLDMDIDVKIIGRD  615

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              +++   K+ +    +  AL EL +D+HH +  ++ D    +  + +  GS +Y
Sbjct  616  AMIRIQCCKKNHPAARLMAALKELDMDVHHASVSVVNDL--MIQQATVKMGSRIY  668



>ref|XP_009344509.1| PREDICTED: transcription factor MYC2-like, partial [Pyrus x bretschneideri]
Length=461

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 15/176 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +  ++   E+ +
Sbjct  283  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQ  342

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E M  H    C      G + S E++    S           K  + ++DV+II  +
Sbjct  343  KQLESMNNHLP--CKDSRSSGSIMSEEELKGCSS-----------KLLDMDIDVKIIGRD  389

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYA  421
              +++   K+ +    +  AL EL +D+HH +  ++ D    +  + +  GS +Y 
Sbjct  390  AMIRIQCCKKNHPAARLMAALKELDMDVHHASVSVVNDL--MIQQATVKMGSRIYT  443



>ref|NP_001288107.1| uncharacterized protein LOC101261048 [Solanum lycopersicum]
 gb|AIC63945.1| MYC1 [Solanum lycopersicum]
Length=630

 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 95/190 (50%), Gaps = 24/190 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V    +  E+ R
Sbjct  458  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELR  517

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +++  T   SS               +YS +   +     K  + ++DV++I  +
Sbjct  518  SQIECLRKELTNKGSS---------------NYSASPPLNQ--DVKIVDMDIDVKVIGWD  560

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYAS---  418
              +++   K+ +    +  AL +L LD+HH +  ++ D    +  + +  GS +YA    
Sbjct  561  AMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDL--MIQQATVKMGSRLYAQEQL  618

Query  417  --AIANKLIE  394
              A+ +K+ E
Sbjct  619  RIALTSKIAE  628



>ref|XP_008238247.1| PREDICTED: transcription factor MYC2 [Prunus mume]
Length=685

 Score = 75.9 bits (185),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 93/177 (53%), Gaps = 19/177 (11%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +  ++   +K+ 
Sbjct  509  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKAKLQTVE--SDKED  566

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSK--NTEVDVRIID  595
              ++    ++  GC       D  S+ D D       L+ S  Q  SK  + ++DV+II 
Sbjct  567  LQKQLESMNQDLGCK------DSSSLSDQD-------LKMSKHQASSKLIDLDIDVKIIG  613

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
             +  +++   K+ +    +  +L EL LD+HH +  ++ D    +  + +  GS +Y
Sbjct  614  WDAMIRIQCCKKNHPAARLMASLKELDLDVHHASISVVNDL--MIQQATVKMGSRIY  668



>ref|XP_004309579.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score = 75.1 bits (183),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 105/221 (48%), Gaps = 34/221 (15%)
 Frame = -2

Query  1098  GSLFGEVDERE--VNGAFYQTVDGCRDFENGVF--ELTGDMNVLAKNRDGKGTK-----H  946
              ++F E D++E    G   +TV+      +     E T    +  + +  KG +     H
Sbjct  223   NTMFPESDQKEWTTQGGRKETVNNLSGSSSDSGPSENTSSTRLRKRRKSDKGERDSPINH  282

Query  945   FATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRC  766
                ERQRR  LN ++ AL+ +VPN SK D+AS++ DA+ YIN LK  + EL+  +  +  
Sbjct  283   VEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYINNLKTKIEELEAKIHAQP-  341

Query  765   SRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEV  586
                  K+HK    SS+M    L         YS  T  +S   R +  TEVDV+I+  E 
Sbjct  342   -----KKHK----SSVMSDNTL--------DYSQMT--NSLTYRAAAATEVDVKIVGSEA  382

Query  585   TVKLV---QQKRINCLLFVSKALDELQLDLHHVAGGLIGDY  472
              +++     +   N  L    AL +L+L +HH +   + D+
Sbjct  383   MIRVRCPDDEDYPNARLM--NALKDLELHIHHASISSVNDF  421



>gb|ACO53628.1| bHLH domain protein [Gossypium hirsutum]
Length=674

 Score = 75.5 bits (184),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 94/188 (50%), Gaps = 22/188 (12%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN K+ AL+ +VPN SK D+AS++ DAI YINELK  +    +  E+ +
Sbjct  500  HVEAERQRREKLNQKFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQSADLEKEEMQ  559

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K++ +       D  DLK       +++G  L          + E++V+II  +
Sbjct  560  SQLEALKKNLSSKAPPPHD-QDLKI-----SNHTGNKL---------IDLEIEVKIIGWD  604

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYA----  421
              +++   K+ +    +  AL EL LD+HH +  ++ D      N K+  GS  +     
Sbjct  605  AMIQIQCSKKNHPAAKLMVALKELDLDVHHASVSVVKDLMIQQANVKM--GSRFFTQEQL  662

Query  420  -SAIANKL  400
             SA+  KL
Sbjct  663  KSALTTKL  670



>emb|CDY26910.1| BnaA05g18020D [Brassica napus]
Length=443

 Score = 74.7 bits (182),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 83/158 (53%), Gaps = 15/158 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V + +    + +
Sbjct  272  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIK  331

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K       +S   GGDL S      S S T +       K    E++V+II  +
Sbjct  332  TQLEEVKMELAGRKASA--GGDLSS------SCSMTAI-------KPVGMEIEVKIIGWD  376

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  377  AMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVND  414



>ref|XP_008373574.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=689

 Score = 75.5 bits (184),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 91/178 (51%), Gaps = 21/178 (12%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +  ++   E+ +
Sbjct  511  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKXKLQTVETDKEELQ  570

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSK---NTEVDVRII  598
               E M +             DL S    D   SG+T+    ++  S    + ++DV+II
Sbjct  571  KQLESMNK-------------DLPS---KDSRSSGSTVXEHEMKGSSSKLLDMDIDVKII  614

Query  597  DDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              +  +++   K+ +    +  AL EL L++HH +  ++ D    +  + +  GS +Y
Sbjct  615  GRDAMIRIQCCKKNHPAARLMAALKELDLEVHHASVSVVNDL--MIQQATVKAGSRIY  670



>gb|ADL36595.1| BHLH domain class transcription factor [Malus domestica]
Length=691

 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 91/178 (51%), Gaps = 21/178 (12%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +  ++   E+ +
Sbjct  513  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQ  572

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSK---NTEVDVRII  598
               E M +             DL S    D   SG+T+    ++  S    + ++DV+II
Sbjct  573  KQLESMNK-------------DLPS---KDSRSSGSTMSEHEMKGSSSKLLDMDIDVKII  616

Query  597  DDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              +  +++   K+ +    +  AL EL L++HH +  ++ D    +  + +  GS +Y
Sbjct  617  GRDAMIRIQCCKKNHPAARLMAALKELDLEVHHASVSVVNDL--MIQQATVKAGSRIY  672



>ref|XP_010540785.1| PREDICTED: transcription factor MYC2-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540787.1| PREDICTED: transcription factor MYC2-like isoform X2 [Tarenaya 
hassleriana]
Length=603

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 82/158 (52%), Gaps = 13/158 (8%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +   +    + +
Sbjct  430  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQRAESDKTQFQ  489

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
            C  E +KR +  G  +  + G L + +                  K    E++V+II+ +
Sbjct  490  CQLENLKR-ELAGRHANANAGILDASDSSSAV------------SKPIGMEIEVKIIEWD  536

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  AL EL+L+++H +  ++ D
Sbjct  537  AMIRIESSKRNHPAARLMTALKELELEVNHASVSVVND  574



>gb|AFZ93650.1| transcription factor MYC2, partial [Euphorbia lathyris]
Length=272

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 91/196 (46%), Gaps = 38/196 (19%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YI ELK              
Sbjct  99   HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIKELKS-------------  145

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSW--------LQRKSKNTEV  613
                  K   TE     ++    K VE + + +S    RS          +  KS   ++
Sbjct  146  ------KLQNTESDKEELE----KQVESMKKEFSKKDTRSGTPPPDQELKMSNKSIEMDI  195

Query  612  DVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGS  433
            DV+II  +V +++   K+ +    +  AL EL LD+HH +  ++ D    +  + +  GS
Sbjct  196  DVKIIGWDVMIRIQCSKKNHPAARLMAALKELDLDVHHASVSVVNDL--MIQQATVKMGS  253

Query  432  TVYAS-----AIANKL  400
              Y       A++NK+
Sbjct  254  RFYTHEQLRVALSNKV  269



>emb|CDX73261.1| BnaC05g28450D [Brassica napus]
Length=443

 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 83/158 (53%), Gaps = 15/158 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V + +    + +
Sbjct  272  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIK  331

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K       +S   GGDL S      S S T +       K    E++V+II  +
Sbjct  332  TQLEEVKMELAGRKASA--GGDLSS------SCSLTAI-------KPVGMEIEVKIIGWD  376

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  377  AMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVND  414



>gb|AGZ94899.1| MYC transcription factor 2 [Solanum lycopersicum]
Length=689

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 79/158 (50%), Gaps = 14/158 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +   +   E  +
Sbjct  514  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLK  573

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K+             DLK       S++G          K  + ++DV+II  +
Sbjct  574  SQIEDLKKESRRPGPPPPPNQDLKM-----SSHTGG---------KIVDVDIDVKIIGWD  619

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   K+ +    +  AL EL LD+HH +  ++ D
Sbjct  620  AMIRIQCNKKNHPAARLMAALMELDLDVHHASVSVVND  657



>ref|XP_004245895.2| PREDICTED: transcription factor MYC2 [Solanum lycopersicum]
Length=689

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 79/158 (50%), Gaps = 14/158 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +   +   E  +
Sbjct  514  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLK  573

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K+             DLK       S++G          K  + ++DV+II  +
Sbjct  574  SQIEDLKKESRRPGPPPPPNQDLKM-----SSHTGG---------KIVDVDIDVKIIGWD  619

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   K+ +    +  AL EL LD+HH +  ++ D
Sbjct  620  AMIRIQCNKKNHPAARLMAALMELDLDVHHASVSVVND  657



>ref|XP_010053253.1| PREDICTED: transcription factor EGL1-like [Eucalyptus grandis]
 gb|KCW77513.1| hypothetical protein EUGRSUZ_D01841 [Eucalyptus grandis]
Length=637

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 104/217 (48%), Gaps = 13/217 (6%)
 Frame = -2

Query  1029  RDFENGV---FELTGDMNVLAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKND  859
             R ++N +    E  G+  V     D  G  H   ER+++  +ND+   LK +VP+ SK D
Sbjct  403   RMYDNALQSPLEDGGENGVWRPEADEIGLNHAILERKQKEKINDRLGVLKSMVPSVSKVD  462

Query  858   RASVVHDAIGYINELKRTVGELK---ILVEKKRCSRER---MKRHKTEGCSSMMDGGDLK  697
             + S++ D I Y+ EL+R V EL+   I +E +  SR +   M    ++ C + + G   K
Sbjct  463   KLSILDDTIAYLRELQRKVEELESWGIGMEVEAKSRRKPHDMVERTSDNCGTHVTGSGKK  522

Query  696   SVEDVDQSYSGTTLR---SSWLQRKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKAL  526
              V +  ++ +  ++    +S +QR      + V+I D  V +++    R   LL +   +
Sbjct  523   PVRNKRKASNIDSMELETNSVVQRDVSADNLTVKINDRTVLIEMRCSSREGVLLEIINEV  582

Query  525   DELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASA  415
             + L LD H V    I    S    SK   GSTV ++A
Sbjct  583   NNLHLDSHSVQSSTIDGILSLTIKSKFT-GSTVMSAA  618



>gb|EYU44086.1| hypothetical protein MIMGU_mgv1a002808mg [Erythranthe guttata]
Length=635

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 83/158 (53%), Gaps = 18/158 (11%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +  +++      
Sbjct  466  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKLQNVEL------  519

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
              ++ ++R      SSM         +  D+ YS     SS   +   + E+DV+II  +
Sbjct  520  -DKDELRRQLESSSSSMQ--------KKKDKEYSSAKEESS---KGIVDMEIDVKIIGWD  567

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   K+ +    +  AL EL LD+HH +  ++ D
Sbjct  568  AMIRVQCSKKNHPAAKMMVALRELDLDVHHASVSVVND  605



>ref|XP_009151447.1| PREDICTED: transcription factor MYC2 [Brassica rapa]
Length=605

 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 83/158 (53%), Gaps = 15/158 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V + +    + +
Sbjct  434  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIK  493

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K       +S   GGDL S      S S T +       K    E++V+II  +
Sbjct  494  TQLEEVKMELAGRKASA--GGDLSS------SCSMTAI-------KPVGMEIEVKIIGWD  538

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  539  AMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVND  576



>ref|XP_002303693.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
 gb|EEE78672.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
Length=465

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 82/157 (52%), Gaps = 22/157 (14%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK DRAS++ DA+ YI ELKR V EL+  ++   
Sbjct  290  HVEAERQRRERLNHRFYALRSVVPNVSKMDRASLLADAVNYIKELKRKVNELEANLQVVS  349

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTL----RSSWLQRKSKNTEVDVRI  601
                  K+ K   C+++ D          +QS S +T+    R       +   EVDV+I
Sbjct  350  ------KKSKISSCANIYD----------NQSTSTSTMVNHIRPPPNYMSNNAVEVDVKI  393

Query  600  IDDEVTVKLVQQKRINC-LLFVSKALDELQLDLHHVA  493
            +  E  ++ VQ   IN     +  AL EL+  +HH++
Sbjct  394  LGSEGLIR-VQSPDINYPAARLMDALRELEFPVHHLS  429



>gb|AGO03813.1| JAMYC2 [Taxus cuspidata]
Length=304

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 14/164 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DA+ YINEL+  V EL+       
Sbjct  115  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSKVQELE-------  167

Query  768  CSRERMKRH----KTEGCSSM--MDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDV  607
              R+ ++ H    K E  SS     G +    +D+  S S       +  ++    ++DV
Sbjct  168  TERKELESHVEATKKELLSSHSGFSGANFGFAKDLSSS-SRVPDSKGFGTKQCPGLDLDV  226

Query  606  RIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            R++  E  V++   K+ +    +  A  EL+L++HH +   + +
Sbjct  227  RVLGAEAMVRIQSGKKNHPAARLMTAFQELELEVHHASVSTVNE  270



>gb|ABS11038.1| MYC [Brassica oleracea var. gemmifera]
Length=610

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 83/158 (53%), Gaps = 15/158 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V + +    + +
Sbjct  439  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIK  498

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K       +S   GGDL S      S S T +       K    E++V+II  +
Sbjct  499  TQLEEVKMELAGRKASA--GGDLSS------SCSLTAI-------KPVGMEIEVKIIGWD  543

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  544  AMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVND  581



>ref|XP_009384727.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=696

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 79/165 (48%), Gaps = 30/165 (18%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVG-------ELK  790
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DA+ YINEL+  +        +L+
Sbjct  519  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSKLQALEANKEDLQ  578

Query  789  ILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVD  610
              ++  +  RE     + E     M+GG                        +    E++
Sbjct  579  AQIQGLKKERESAPTQRPESNLKTMNGGG-----------------------RCHGVEIE  615

Query  609  VRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            V+++  E  ++L  QKR +    +  AL +L L++H+ +  ++ D
Sbjct  616  VKLLGSEALIRLQSQKRNHPAAVLMAALQDLDLEVHYASVSVVKD  660



>ref|XP_010478689.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2-like 
[Camelina sativa]
Length=626

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 82/163 (50%), Gaps = 25/163 (15%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV-----GELKIL  784
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V      +L+I 
Sbjct  455  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIK  514

Query  783  VEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVR  604
             + +    E   R  + GC      GD+ S              S+    K    E++V+
Sbjct  515  NQLEEVKLELAGRKASAGC------GDMSS--------------STCSSIKPVGMEIEVK  554

Query  603  IIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            II  +  +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  555  IIGWDAMIRVESSKRNHPAARLMAALMDLELEVNHASMSVVND  597



>ref|XP_002518914.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43447.1| DNA binding protein, putative [Ricinus communis]
Length=479

 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 93/188 (49%), Gaps = 18/188 (10%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN+++ AL+ +VPN SK D+AS++ DA+ YI ELK  V ELK  V+   
Sbjct  306  HVEAERQRRERLNNRFYALRSVVPNVSKMDKASLLADAVTYIQELKAKVDELKTQVQLVS  365

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
                  K+ K  G +++ D     S+  +D+    +++       ++K  EVDVRI+  E
Sbjct  366  ------KKSKISG-NNVFDNNSTSSM--IDRHLMTSSI------YRAKEMEVDVRIVGSE  410

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGST---VYAS  418
              +++           +  A+ EL+  +HH +   I D         I +G T   V  +
Sbjct  411  AMIRVRSPDIDYPAARLMNAIRELEFQVHHASISSIKDVVLQDIVVSIRDGLTSEEVVRT  470

Query  417  AIANKLIE  394
            AI   L++
Sbjct  471  AIIQSLMQ  478



>ref|XP_004166734.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC4-like 
[Cucumis sativus]
Length=686

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 89/176 (51%), Gaps = 8/176 (5%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINEL+   G+L+     K 
Sbjct  502  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELR---GKLQTAESDK-  557

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               +  K+  +     M        +   +Q      ++SS +      T++DV+II  +
Sbjct  558  --EDLQKQLDSVKKMMMSSSSKDSCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWD  615

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYA  421
              +++   K+ +    +  AL+EL LD++H +  ++ D    +  + +  GS +Y 
Sbjct  616  AMIRIQSSKKNHPAARLMAALEELDLDINHASISVVNDL--MIQQATVKMGSRLYT  669



>ref|XP_004246085.1| PREDICTED: transcription factor bHLH14-like [Solanum lycopersicum]
Length=387

 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 87/164 (53%), Gaps = 24/164 (15%)
 Frame = -2

Query  975  KNRDGKGT---KHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRT  805
            K R  K T    H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DA+ YINELK  
Sbjct  204  KKRARKSTTAKNHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLADAVTYINELKAK  263

Query  804  VGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSK  625
            V ELK  +E    +++ +++      S+++DG ++              + SS++     
Sbjct  264  VEELKAKIEV--STKKLIQKRNCVSSSAVVDGTNI-----------NININSSFVD----  306

Query  624  NTEVDVRIIDDEVTVKLVQQKRIN--CLLFVSKALDELQLDLHH  499
              EV+V+II  E  ++ V+   +N  C   ++  L EL+  +HH
Sbjct  307  GMEVEVKIIGVEAMIR-VRSPNVNYPCARLMN-VLRELEFQIHH  348



>ref|XP_010461111.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=623

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 82/163 (50%), Gaps = 25/163 (15%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV-----GELKIL  784
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V      +L+I 
Sbjct  452  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIK  511

Query  783  VEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVR  604
             + +    E   R  + GC      GD+ S              S+    K    E++V+
Sbjct  512  NQLEEVKLELAGRKASAGC------GDVSS--------------STCSSIKPVGMEIEVK  551

Query  603  IIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            II  +  +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  552  IIGWDAMIRVESSKRNHPAARLMAALMDLELEVNHASMSVVND  594



>ref|NP_174541.1| transcription factor MYC2 [Arabidopsis thaliana]
 sp|Q39204.2|MYC2_ARATH RecName: Full=Transcription factor MYC2; Short=AtMYC2; AltName: 
Full=Basic helix-loop-helix protein 6; Short=AtbHLH6; Short=bHLH 
6; AltName: Full=Protein JASMONATE INSENSITIVE 1; AltName: 
Full=R-homologous Arabidopsis protein 1; Short=RAP-1; 
AltName: Full=Transcription factor EN 38; AltName: Full=Z-box 
binding factor 1 protein; AltName: Full=bHLH transcription 
factor bHLH006; AltName: Full=rd22BP1 [Arabidopsis thaliana]
 gb|AAF25980.1|AC017118_17 F6N18.4 [Arabidopsis thaliana]
 gb|AAK59788.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 gb|AAO23607.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 emb|CAH58735.1| Z-box binding factor 1 protein [Arabidopsis thaliana]
 emb|CAA67885.2| bHLH protein [Arabidopsis thaliana]
 gb|AEE31513.1| transcription factor MYC2 [Arabidopsis thaliana]
Length=623

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 87/160 (54%), Gaps = 20/160 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V  +K   EK +
Sbjct  453  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKV--VKTESEKLQ  510

Query  768  CSRERMKRHKTE--GCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIID  595
              + +++  K E  G  +   GGD+ S        S +++       K    E++V+II 
Sbjct  511  I-KNQLEEVKLELAGRKASASGGDMSS--------SCSSI-------KPVGMEIEVKIIG  554

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
             +  +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  555  WDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVND  594



>ref|XP_004148475.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
Length=688

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 89/176 (51%), Gaps = 8/176 (5%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINEL+   G+L+     K 
Sbjct  504  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELR---GKLQTAESDK-  559

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               +  K+  +     M        +   +Q      ++SS +      T++DV+II  +
Sbjct  560  --EDLQKQLDSVKKMMMSSSSKDSCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWD  617

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYA  421
              +++   K+ +    +  AL+EL LD++H +  ++ D    +  + +  GS +Y 
Sbjct  618  AMIRIQSSKKNHPAARLMAALEELDLDINHASISVVNDL--MIQQATVKMGSRLYT  671



>ref|XP_004300239.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=682

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 90/175 (51%), Gaps = 20/175 (11%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YI ELK         ++   
Sbjct  511  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKTK-------LQTTE  563

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
              +E M++ + E  S  +   + +S   +DQ   G+T        K  + ++DV+I+  +
Sbjct  564  SDKEDMQK-QVETLSKELQ--ESRSCSGLDQELKGST--------KLIDLDIDVKILGWD  612

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              +++   K+ +    +  AL EL LD+HH +  ++ D    +  + +  GS +Y
Sbjct  613  ARIQIQCSKKNHPAARLMAALMELDLDVHHASVSVVNDL--MIQQATVRMGSRIY  665



>ref|XP_008341963.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=688

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 89/175 (51%), Gaps = 15/175 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +  ++   E+ +
Sbjct  510  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKLKLQTVETDKEELQ  569

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E M  +K   C      G + S +++    S           K  + ++DV+II  +
Sbjct  570  NQLESM--NKDLPCKDSRSSGSIMSEDELKGCSS-----------KLLDMDIDVKIIGRD  616

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              +++   K+ +    +  AL EL +D+H+ +  ++ D    +  + +  GS +Y
Sbjct  617  AMIRIQCCKKNHPAARLMAALKELDMDVHYASVSVVNDL--MIQQATVKMGSRIY  669



>ref|XP_008465979.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=689

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 89/176 (51%), Gaps = 8/176 (5%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINEL+   G+L+     K 
Sbjct  506  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELR---GKLQTAESDK-  561

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               +  K+  +     M        V   +Q      ++SS +      T++DV+II  +
Sbjct  562  --EDLQKQLDSVKKMMMSSSSKDSCVSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWD  619

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYA  421
              +++   K+ +    +  AL+EL LD++H +  ++ D    +  + +  GS +Y 
Sbjct  620  AMIRIQSSKKNHPAARLMAALEELDLDINHASISVVNDL--MIQQATVKMGSRLYT  673



>gb|KGN60384.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=679

 Score = 73.6 bits (179),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 89/176 (51%), Gaps = 8/176 (5%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINEL+   G+L+     K 
Sbjct  495  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELR---GKLQTAESDK-  550

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               +  K+  +     M        +   +Q      ++SS +      T++DV+II  +
Sbjct  551  --EDLQKQLDSVKKMMMSSSSKDSCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWD  608

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYA  421
              +++   K+ +    +  AL+EL LD++H +  ++ D    +  + +  GS +Y 
Sbjct  609  AMIRIQSSKKNHPAARLMAALEELDLDINHASISVVNDL--MIQQATVKMGSRLYT  662



>gb|AAL55713.1|AF251691_1 putative transcription factor BHLH6 [Arabidopsis thaliana]
Length=623

 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 87/160 (54%), Gaps = 20/160 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V  +K   EK +
Sbjct  453  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKV--VKTESEKLQ  510

Query  768  CSRERMKRHKTE--GCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIID  595
              + +++  K E  G  +   GGD+ S        S +++       K    E++V+II 
Sbjct  511  I-KNQLEEVKLELAGRRASASGGDMSS--------SCSSI-------KPVGMEIEVKIIG  554

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
             +  +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  555  WDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVND  594



>ref|XP_004959077.1| PREDICTED: transcription factor TT8-like [Setaria italica]
Length=672

 Score = 73.2 bits (178),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 95/187 (51%), Gaps = 17/187 (9%)
 Frame = -2

Query  975  KNRDGKG-------TKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINE  817
            ++R G+G         H   ERQRR  LN+++  L+ LVP  +K DRAS++ D I Y+ +
Sbjct  472  RSRRGQGQAQAELSASHVLKERQRREKLNERFIILRSLVPFVTKMDRASILGDTIEYVKQ  531

Query  816  LKRTVGELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQ  637
            L+R + +L+ L    R S+E  KR ++   ++M +      V  V+ S S +T   +   
Sbjct  532  LRRRIQDLESL----RASKE--KRAQSTSSATMAEA--WSKVRAVEASSSCST-SGAGRP  582

Query  636  RKSKNTEVDVRIIDDEVTVKLVQQKRINCLLFVSKALD-ELQLDLHHVAGGLIGDYYSFL  460
                +TEV V II+ +  V+L   +R   LL V +AL  EL L++  V     GD     
Sbjct  583  ASVASTEVQVSIIESDALVELRCPRRDGLLLRVMQALHRELGLEVTSVQASSAGDVLLVE  642

Query  459  FNSKICE  439
              +K+ E
Sbjct  643  LRAKVKE  649



>ref|XP_002893732.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69991.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score = 73.2 bits (178),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 87/160 (54%), Gaps = 20/160 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V  +K   EK +
Sbjct  455  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKV--VKTESEKIQ  512

Query  768  CSRERMKRHKTE--GCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIID  595
              + +++  K E  G  +   GGD+ S        S +++       K    E++V+II 
Sbjct  513  I-KNQLEEVKLELAGRKASASGGDMSS--------SCSSI-------KPVGMEIEVKIIG  556

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
             +  +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  557  WDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVND  596



>ref|XP_011082365.1| PREDICTED: transcription factor MYC4-like [Sesamum indicum]
Length=670

 Score = 73.2 bits (178),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 83/162 (51%), Gaps = 23/162 (14%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V  ++   E+ R
Sbjct  496  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQSVESDKEELR  555

Query  768  CSRERMKRHKTEGCSSMMDGGDLKS----VEDVDQSYSGTTLRSSWLQRKSKNTEVDVRI  601
               E +K+         +   D++S      D++ S +              + ++DV+I
Sbjct  556  SQLELVKKE--------LGTKDMRSAPPPAHDLNMSSNVKV-----------DMDIDVKI  596

Query  600  IDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            I  +  +++   K+ +    +  AL EL LD+HH +  ++ D
Sbjct  597  IGWDAMIRVQCSKKNHPAAKLMLALRELDLDVHHASVSVVND  638



>ref|XP_009604694.1| PREDICTED: transcription factor MYC3-like [Nicotiana tomentosiformis]
Length=489

 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 88/161 (55%), Gaps = 3/161 (2%)
 Frame = -2

Query  954  TKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEK  775
            + H   ERQRR  LN ++ AL+ +VP+ +K D+AS++ DA+ YINELK  V +L++ +  
Sbjct  301  SNHVEAERQRREKLNHRFYALRSVVPHVTKMDKASLLSDAVEYINELKAKVDDLELQLNN  360

Query  774  KRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIID  595
            K  S++++K    +  +         +   VDQ    +   SS+    +   EV+V+I+ 
Sbjct  361  KSESKKKLKVESMDSTTLDNQSTTTTTTTSVDQIRPNSNSTSSF-GPNNLTVEVEVKILG  419

Query  594  DEVTVKLVQQKRINC-LLFVSKALDELQLDLHHVAGGLIGD  475
             +  ++ VQ + +N     + +AL +L+L +HH +   + D
Sbjct  420  PDAMIR-VQSENVNYPSARLMRALQDLELHVHHASISSVND  459



>dbj|BAA25078.1| RD22BP1 [Arabidopsis thaliana]
Length=623

 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 87/160 (54%), Gaps = 20/160 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V  +K   EK +
Sbjct  453  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKV--VKTESEKLQ  510

Query  768  CSRERMKRHKTE--GCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIID  595
              + +++  K E  G  +   GGD+ S        S +++       K    E++V+II 
Sbjct  511  I-KNQLEEVKLELAGRKASPSGGDMSS--------SCSSI-------KPVGMEIEVKIIG  554

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
             +  +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  555  WDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVND  594



>ref|XP_009385233.1| PREDICTED: transcription factor EGL1-like [Musa acuminata subsp. 
malaccensis]
Length=622

 Score = 72.8 bits (177),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 90/177 (51%), Gaps = 14/177 (8%)
 Frame = -2

Query  963  GKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKIL  784
            G    H  +ER+RR  LN+K+  L+ L+P+ SK D+ASV+ D I Y+ +L+R V EL   
Sbjct  442  GARASHVLSERKRREKLNEKFLVLRSLIPSVSKVDKASVLDDTIEYLKDLERRVQEL---  498

Query  783  VEKKRCSRERMKR----HKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTE  616
             E  R S ER K      +T G   +M+G   +   DVD++ +    + +W   K     
Sbjct  499  -ESCRGSVERRKHFAVAERTSGNEEIMNGK--RKACDVDEAET----QHNWAVSKDGPIH  551

Query  615  VDVRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKI  445
            V + + + EV++++    R + LL +  ++ +L+LD   V    +    +    SK+
Sbjct  552  VTITMKEKEVSIEMRCPWREHLLLEIIGSMSDLRLDPLSVQSSTVDGMLALTLESKV  608



>gb|ABD65632.1| basic helix-loop-helix (bHLH) family transcription factor [Brassica 
oleracea]
Length=586

 Score = 72.8 bits (177),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 92/163 (56%), Gaps = 23/163 (14%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ +L+ +VPN SK D+AS++ DAI YINELK         ++K  
Sbjct  416  HVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKAK-------LQKAE  468

Query  768  CSRERMKRHKTEGCSSMMDGGDLKS-VED---VDQSYSGTTLRSSWLQRKSKNTEVDVRI  601
              +E +++ + +G S  +  G++KS V+D   +DQ  SG ++            E+DV+I
Sbjct  469  ADKEELQK-QIDGMSKEVGDGNVKSLVKDQKCLDQD-SGVSIE----------VEIDVKI  516

Query  600  IDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDY  472
            I  +  +++   K+ +      +AL EL+L+++H +  ++ ++
Sbjct  517  IGWDAMIRIQCAKKNHPGAKFMEALKELELEVNHASLSVVNEF  559



>ref|XP_010559309.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=635

 Score = 72.8 bits (177),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 83/159 (52%), Gaps = 22/159 (14%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ +L+ LVPN SK D+AS++ DAI YINELK  V +     E  +
Sbjct  471  HVEAERQRREKLNQRFYSLRALVPNVSKMDKASLLGDAISYINELKSKVQK----AEFDK  526

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               ++  R   +G S    G D K +       SG ++           TE+DV+II  +
Sbjct  527  GELQKQLRELRKGVS----GKDQKGL----NQDSGPSVE----------TEIDVKIIGWD  568

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDY  472
            V +++   K+ +      +AL EL L+++H +  ++ D+
Sbjct  569  VMIRIQCSKKNHPGAKFMEALKELDLEVNHASLSVVNDF  607



>ref|XP_007210309.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
 gb|EMJ11508.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
Length=676

 Score = 72.8 bits (177),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 89/177 (50%), Gaps = 20/177 (11%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +   +   +K+ 
Sbjct  501  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKAKLQTTE--SDKED  558

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSK--NTEVDVRIID  595
              ++    ++  GC               D S     L+ S  Q  SK  + ++DV+II 
Sbjct  559  LQKQLESMNQDLGCK--------------DSSSLSDDLKMSKHQASSKLIDLDIDVKIIG  604

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
             +  +++   K+ +    +  +L EL LD+HH +  ++ D    +  + +  GS +Y
Sbjct  605  WDAMIRIQCCKKNHPAARLMASLKELDLDVHHASISVVNDL--MIQQATVKMGSRIY  659



>gb|EPS57820.1| hypothetical protein M569_16997, partial [Genlisea aurea]
Length=562

 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 80/158 (51%), Gaps = 20/158 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +   ++ V++ R
Sbjct  396  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQNSEMDVDELR  455

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K+                   D D     TT  ++     + + +++V+II  +
Sbjct  456  SQLESLKKEHN----------------DSDPPTGYTTASAT----NNVSVDIEVKIIGRD  495

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  A  EL LD+HH +  ++ +
Sbjct  496  AMIQVQCGKRNHPAAQLMTAFRELDLDVHHASVSVVNE  533



>ref|XP_010531704.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=615

 Score = 72.4 bits (176),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 80/158 (51%), Gaps = 15/158 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +   +    +  
Sbjct  445  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQRTESEKTQIE  504

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
            C  E +   K+E      + G+     D   S S  +        K    E++V+II  +
Sbjct  505  CQLENL---KSELAGRNANAGN----RDCGDSSSAVS--------KPIGMEIEVKIIGWD  549

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  550  AMIRIESSKRNHPAARLMSALKDLELEVNHASMSVVND  587



>ref|XP_009131125.1| PREDICTED: transcription factor MYC4-like [Brassica rapa]
Length=230

 Score = 69.3 bits (168),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 89/163 (55%), Gaps = 21/163 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ +L+ +VPN SK D+AS++ DAI YINELK         ++K  
Sbjct  60   HVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKAK-------LQKAE  112

Query  768  CSRERMKRHKTEGCSSMMDGGDLK-SVEDVD--QSYSGTTLRSSWLQRKSKNTEVDVRII  598
              +E +++   +G S  +  G++K SV+D    +  SG ++            E+DV+II
Sbjct  113  ADKEELQKQ-IDGMSKEVGDGNVKSSVKDQKCLEQDSGVSI----------EVEIDVKII  161

Query  597  DDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYY  469
              +  +++   K+ +      +AL EL+L+++H +  ++ ++ 
Sbjct  162  GWDAMIRIQCGKKNHPGAKFMEALKELELEVNHASLSVVNEFM  204



>ref|XP_007219048.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
 gb|EMJ20247.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
Length=496

 Score = 71.6 bits (174),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 83/159 (52%), Gaps = 16/159 (10%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN S+ D+AS++ DA+ YINELK  V EL+  V+++ 
Sbjct  322  HVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKTKVDELESQVQRES  381

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
                  K+ K E   ++       SVE + +  S +              EV+V+I+  +
Sbjct  382  ------KKVKVETGDNLDIQSTTTSVEQIAKPPSSSA--------NGSGLEVEVKIVGTD  427

Query  588  VTVKLVQQKRINC-LLFVSKALDELQLDLHHVAGGLIGD  475
              ++ VQ + +N     +  AL +L+L +HH +   I +
Sbjct  428  AMIR-VQSENVNYPSARLMAALRDLELQIHHASLSCINE  465



>gb|ADH04267.1| MYC1a transcription factor [Nicotiana tabacum]
 gb|ADU60101.1| MYC2b transcription factor [Nicotiana tabacum]
 gb|ADU60102.1| MYC2c transcription factor [Nicotiana tabacum]
Length=681

 Score = 72.0 bits (175),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 90/175 (51%), Gaps = 12/175 (7%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +   +   E  +
Sbjct  502  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQTTETDREDLK  561

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K+ + +   S   G    + +    S++G+         K  + ++DV+II  +
Sbjct  562  SQIEDLKK-ELDSKDSRRPGPPPPNQDHKMSSHTGS---------KIVDVDIDVKIIGWD  611

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              +++   K+ +    +  AL EL LD+HH +  ++ D    +  + +  GS +Y
Sbjct  612  AMIRIQCNKKNHPAARLMVALKELDLDVHHASVSVVNDL--MIQQATVKMGSRLY  664



>gb|AGQ80897.1| MYC1 [Lithospermum erythrorhizon]
Length=636

 Score = 72.0 bits (175),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 83/163 (51%), Gaps = 23/163 (14%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YI ELK  + + +   E  +
Sbjct  460  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLADAISYITELKSKLQKSESAREDLK  519

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNT-----EVDVR  604
               E +K+             DL S     +S  G+   +S   R +KNT     ++DV+
Sbjct  520  SQVEFLKK-------------DLSS--STKESRKGSAPPTS---RGTKNTKIVDIDIDVK  561

Query  603  IIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            II  +  +++   KR +    +  AL E  L++HH +  ++ D
Sbjct  562  IIGWDAMIRIQSSKRNHPAAKLMAALQEHDLEVHHASVSVVND  604



>ref|XP_008670746.1| PREDICTED: transcription factor SCREAM2-like [Zea mays]
 tpg|DAA42031.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=519

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 95/222 (43%), Gaps = 21/222 (9%)
 Frame = -2

Query  1068  EVNGAFYQTVDGCRDFENGVFELTGDMNVLAKNR----DGKG------TKHFATERQRRV  919
             + +G  Y + D CR  E+     +G  +    N     DGKG       K+   ER+RR 
Sbjct  279   DASGLNYDSEDACRGVED-----SGKKDGKGSNANSAGDGKGKRKRLPAKNLMAERRRRK  333

Query  918   HLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHK  739
              LND+   L+ +VP  SK DRAS++ DAI Y+ EL R + EL+  VE             
Sbjct  334   KLNDRLYMLRSVVPKISKMDRASILGDAIEYLKELLRKIEELQNEVESSASPASTASLPP  393

Query  738   TEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDD--EVTVKLVQQ  565
             T      +          V +    + L S      SK   V+VR   +  EV + ++  
Sbjct  394   TPTSFRPLTPTLPALPSRVKEELCPSALPSP----TSKQPRVEVRTTREGREVNIHMLCA  449

Query  564   KRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICE  439
             +R   LL   +A++ L LD+          +   +F +++C+
Sbjct  450   RRPGLLLATMRAIEGLGLDVQQAVASCFNGFSLDIFKAELCK  491



>ref|XP_010275210.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
Length=666

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 83/158 (53%), Gaps = 11/158 (7%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINEL+    +L+     K 
Sbjct  488  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELRT---KLQAAESNKE  544

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
              + ++   K E  +S   G   ++ +D+  S    +        K  + E++V+I+  E
Sbjct  545  GLQSQVDSLKKELAASRYSGSPPQADQDLKISNHQVS--------KLLDMEIEVKILGWE  596

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   K+ +    +  AL EL LD+H+ +  ++ D
Sbjct  597  AMIRIQCNKKNHPAARLMTALKELDLDVHYASVSVVKD  634



>ref|XP_006838603.1| hypothetical protein AMTR_s00002p00225810 [Amborella trichopoda]
 gb|ERN01172.1| hypothetical protein AMTR_s00002p00225810 [Amborella trichopoda]
Length=655

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 83/159 (52%), Gaps = 6/159 (4%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINEL+  +  L+   ++ +
Sbjct  467  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELRGKLQGLESENDELQ  526

Query  768  CSRERMKRHKTEGCSSMMDGGDLKS-VEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDD  592
               E +K+ +     S +  G LKS     D      +  SS    K    E++V+I+  
Sbjct  527  TQVEALKKKE-----SQLFNGSLKSQALSGDSDLKAHSTHSSANSGKYPGLEIEVKILGW  581

Query  591  EVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            E  +++   K+ +       AL +L L++H+ +  ++ D
Sbjct  582  EAMIRIQSNKQNHPAARFMVALKDLDLEVHYASVSVVKD  620



>ref|XP_009780487.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=681

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 90/175 (51%), Gaps = 12/175 (7%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +   +   E  +
Sbjct  502  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQTTETDREDLK  561

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K+ + +   S   G    + +    S++G+         K  + ++DV+II  +
Sbjct  562  SQIEDLKK-ELDSKDSRRPGPPPPNQDHKMSSHTGS---------KIVDVDIDVKIIGWD  611

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              +++   K+ +    +  AL EL LD+HH +  ++ D    +  + +  GS +Y
Sbjct  612  AMIRIQCNKKNHPAARLMVALKELDLDVHHASVSVVNDL--MIQQATVKMGSRLY  664



>emb|CAF74711.1| MYC transcription factor [Solanum tuberosum]
Length=646

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 88/181 (49%), Gaps = 29/181 (16%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V    +  E+ R
Sbjct  474  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELR  533

Query  768  CSRERMKRH-----KTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVR  604
               E +++       +   SS     DLK V D+D                     +DV+
Sbjct  534  SQIESLRKELANKGSSNYSSSPPSNQDLKIV-DMD---------------------IDVK  571

Query  603  IIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
            +I  +  +++   K+ +    +  AL +L LD+HH +  ++ D    +  + +  GS +Y
Sbjct  572  VIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDL--MIQQATVKMGSRLY  629

Query  423  A  421
            A
Sbjct  630  A  630



>ref|XP_009384126.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=676

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 91/199 (46%), Gaps = 23/199 (12%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DA+ YINEL+  +  L+   E+ R
Sbjct  498  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSNLQTLEADKEELR  557

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +++              L      D +   TT        +    E++V+I+  E
Sbjct  558  DRVEALEKK-------------LPVQPPPDHNLRTTT------NGRCHGVEMEVKILGSE  598

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYASAIA  409
              ++L  QKR +    +  AL +L L+LH+ +  ++ D        K+  G  +    + 
Sbjct  599  AMIRLQCQKRNHPAASLMAALKDLDLELHYASVSVVKDLMIQQVTVKMSPGRVMTQEQLC  658

Query  408  NKLIEVVDKHYTAIAPTTS  352
              L   V     A AP +S
Sbjct  659  ASLYSRV----AAEAPISS  673



>ref|XP_006366244.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=650

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 89/183 (49%), Gaps = 33/183 (18%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVG-------ELK  790
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V        EL+
Sbjct  478  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELR  537

Query  789  ILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVD  610
              +E  R  +E   +  +   SS     DLK V D+D                     +D
Sbjct  538  SQIESLR--KELANKGSSNYSSSPPSNQDLKIV-DMD---------------------ID  573

Query  609  VRIIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGST  430
            V++I  +  +++   K+ +    +  AL +L LD+HH +  ++ D    +  + +  GS 
Sbjct  574  VKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDL--MIQQATVKMGSR  631

Query  429  VYA  421
            +YA
Sbjct  632  LYA  634



>ref|XP_009609942.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=679

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 90/175 (51%), Gaps = 12/175 (7%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +   +   E+ +
Sbjct  500  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREELK  559

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K+ +     S   G    + +    S++G+         K  + ++DV+II  +
Sbjct  560  SQIEDLKK-ELASKDSRRPGPPPSNHDHKMSSHTGS---------KIVDVDIDVKIIGWD  609

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              +++   K+ +    +  AL EL LD+HH +  ++ D    +  + +  GS +Y
Sbjct  610  AMIRIQCNKKNHPAARLMVALKELDLDVHHASVSVVNDL--MIQQATVKMGSRLY  662



>gb|ADH04268.1| MYC1b transcription factor [Nicotiana tabacum]
 gb|ADU60100.1| MYC2a transcription factor [Nicotiana tabacum]
Length=679

 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 89/175 (51%), Gaps = 12/175 (7%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +   +   E+ +
Sbjct  500  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREELK  559

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K+       S   G    + +    S++G+         K  + ++DV+II  +
Sbjct  560  SQIEDLKKELVSK-DSRRPGPPPSNHDHKMSSHTGS---------KIVDVDIDVKIIGWD  609

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              +++   K+ +    +  AL EL LD+HH +  ++ D    +  + +  GS +Y
Sbjct  610  AMIRIQCNKKNHPAARLMVALKELDLDVHHASVSVVNDL--MIQQATVKMGSRLY  662



>gb|ACM48567.1| JAMYC [Taxus cuspidata]
Length=660

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 81/153 (53%), Gaps = 1/153 (1%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN +  AL+ +VPN SK D+AS++ DAI YINEL+  V + +   ++ +
Sbjct  467  HVEAERQRREKLNQRVYALRAVVPNVSKMDKASLLGDAIAYINELRSKVVDAETHKKELQ  526

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQR-KSKNTEVDVRIIDD  592
               E +K+       S   G +   ++D   +   + ++   L   K    E++VR++  
Sbjct  527  VQVEALKKELVVVRESGASGPNFGLIKDHYPTADSSDVKGHGLNNSKCHGIELEVRLLGR  586

Query  591  EVTVKLVQQKRINCLLFVSKALDELQLDLHHVA  493
            E  +++   K+ + +  +  AL EL L++HH +
Sbjct  587  EAMIRVQSPKQNHPVARLMGALKELDLEVHHAS  619



>gb|EPS71023.1| hypothetical protein M569_03732, partial [Genlisea aurea]
Length=549

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 105/229 (46%), Gaps = 28/229 (12%)
 Frame = -2

Query  1062  NGAFYQTVDGCRDFENGVFELTGDMNVL--AKNRDGKGTK----------HFATERQRRV  919
             NG   ++ D   D E  V +  G   V+   K    +G K          H   ERQRR 
Sbjct  322   NGGVAESSDAHSDIEASVAKDAGSSKVVDPQKRPKKRGRKPANGREEPLNHVEAERQRRE  381

Query  918   HLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKRCSRERMKRHK  739
              LN ++ AL+ +VP  SK D++S++ DAI YINELK  +   ++ +E+ R   E +K+ K
Sbjct  382   KLNQRFYALRAVVPTVSKMDKSSLLGDAISYINELKSKLQNSELDMEEMRAQLESLKKKK  441

Query  738   TEGCSS---MMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDEVTVKLVQ  568
              +       +    + K     +  Y G              T+++V+II  +  +++  
Sbjct  442   KKKEEEEEGLPPHNETKYSAPSENKYGG-----------GGATDIEVKIIGSDAMIRIQC  490

Query  567   QKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVYA  421
              ++ +    +  A  EL LDLHH +  ++ +  S +  + +  G+T ++
Sbjct  491   SRKNHPAAKLMAAFKELDLDLHHASISVMNE--SMIQRATVKMGATSFS  537



>ref|XP_007039493.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOY23994.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=669

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 77/158 (49%), Gaps = 11/158 (7%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINEL+  +       E+ +
Sbjct  491  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRTKLQNADSEKEELQ  550

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E MK+       S  D        D D   S        L  K    E+DV+II  +
Sbjct  551  KELEAMKKEL-----SSKDSRSAPPAPDQDLKMSNH------LGNKLVELEIDVKIIGWD  599

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   K+ +    +  AL EL LD+HH +  ++ D
Sbjct  600  AMIRIQCNKKNHPAARLMAALKELDLDVHHASVSVVND  637



>ref|XP_008441948.1| PREDICTED: transcription factor MYC4-like [Cucumis melo]
Length=317

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 82/160 (51%), Gaps = 27/160 (17%)
 Frame = -2

Query  975  KNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGE  796
            K R+   + H   ERQRR  LND++ +L+ +VPN S+ D+AS++ DA+ YINEL+  + E
Sbjct  138  KKRENNPSTHVEAERQRREKLNDRFNSLRIVVPNVSRMDKASLLSDAVSYINELEMKISE  197

Query  795  LKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTE  616
            ++  V KK+                  +G D   +E+           +S   R+ +  E
Sbjct  198  MESRVSKKKKK----------------NGVDENEMEE----------EASSRDRRERGIE  231

Query  615  VDVRIIDDEVTVKLVQQKRIN-CLLFVSKALDELQLDLHH  499
            +DV+II  +  V  V+ + ++  +  + +AL +L L + H
Sbjct  232  IDVKIIGGDRAVIRVESRNLSYAVAKLMEALRDLGLKVEH  271



>ref|XP_008799392.1| PREDICTED: transcription factor MYC2-like [Phoenix dactylifera]
Length=665

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 80/158 (51%), Gaps = 12/158 (8%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DA+ YI+EL+  +  L++  E+ +
Sbjct  485  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLADAVSYISELRSKLQSLELDKERLQ  544

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
            C  + +K  +    +      DL    D     +G          +    EV+ +I+  E
Sbjct  545  CQVDALKEERDSASARPRPLLDL----DPKAMMNGCG--------RCHGVEVEAKILGSE  592

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  AL EL L++++ +  ++ D
Sbjct  593  AMIRVQSDKRFHPAARLMMALRELDLEVNYASVSVVKD  630



>ref|XP_009401251.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=690

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 78/158 (49%), Gaps = 16/158 (10%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DA+ YINEL+  +   +   E+ +
Sbjct  512  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYINELRSKLQASEADKEELQ  571

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +K+ +     S           DV             + +     E+DV+++  E
Sbjct  572  SQMEIIKKER----ESAPARPAPPPRYDVK------------MMKGCHGVEIDVKLLGSE  615

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              ++L  QKR +    +  AL +L L++H+ +  ++ D
Sbjct  616  AMIRLQSQKRNHPAARLMAALQDLDLEVHYASVSVVKD  653



>ref|XP_010919958.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=691

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 80/158 (51%), Gaps = 14/158 (9%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINEL+  +  L+   E  +
Sbjct  513  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRSKLQSLESDKEGLQ  572

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +KR +    +  +   D    +D+     G          +    E++V+I+  E
Sbjct  573  TQIEALKRERDSNPARPLQLPD----QDMKMMNGG----------RCHGVEIEVKILGVE  618

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
              +++   KR +    +  AL EL LD+++ +  ++ D
Sbjct  619  AMIRVQCHKRNHPAARLMAALKELDLDVYYASVSVVKD  656



>emb|CDY58502.1| BnaA06g40330D [Brassica napus]
Length=449

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 86/160 (54%), Gaps = 18/160 (11%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ +L+ +VPN SK D+AS++ DAI YINELK         +++  
Sbjct  274  HVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSK-------LQQAE  326

Query  768  CSRERMKRHKTEGCSSMMDG--GDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIID  595
              +E +++ + +G S   +G  G  ++V++   SY  +          S   E+DV+II 
Sbjct  327  SEKEEIQK-QLDGMSKEGNGKSGASRAVKERRSSYQDSA--------SSVEMEIDVKIIG  377

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
             +V +++   K+ +       AL EL L+++H +  ++ D
Sbjct  378  WDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASLSVVND  417



>gb|KHN04880.1| Transcription factor MYC2, partial [Glycine soja]
Length=487

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 90/180 (50%), Gaps = 19/180 (11%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YI ELK  +  L+       
Sbjct  305  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYITELKSKLQTLE-------  357

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSG-----TTLRSSWLQRKSKNTEVDVR  604
              ++ M++ + EG    ++    K+ E+V  +++G             Q+     E+DV+
Sbjct  358  SDKDGMQK-QLEGVKKELE----KTTENVSSNHAGNSSSCNNNNKLSNQKLIDVLEMDVK  412

Query  603  IIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
            I+  +  +++   K+ +    +  AL EL LD+HH    L+ D    +  + +  GS  Y
Sbjct  413  ILGWDAMIRIHCSKKNHPGARLLTALMELDLDVHHANVNLVNDMT--MLQATVKMGSRFY  470



>gb|KDP28433.1| hypothetical protein JCGZ_14204 [Jatropha curcas]
Length=482

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 84/160 (53%), Gaps = 20/160 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN S+ D+AS++ DA+ YINELK  + EL       +
Sbjct  311  HVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVCYINELKAKIDEL-----DSQ  365

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQS-YSGTTLRSSWLQRKSKNTEVDVRIIDD  592
              R++ KR K E   +  +   + SV+    S  SG TL            +++V+I+ D
Sbjct  366  LQRDQSKRVKLEVTDNTDNQSTITSVDQARPSPISGFTL------------DIEVKILGD  413

Query  591  EVTVKLVQQKRINC-LLFVSKALDELQLDLHHVAGGLIGD  475
            +  ++ VQ + +N     +  AL +L+  +HH +   + +
Sbjct  414  DAMIR-VQSENVNYPAAKLLTALRDLEFQVHHASMSTVNE  452



>ref|XP_009101493.1| PREDICTED: transcription factor MYC3 [Brassica rapa]
Length=580

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 86/160 (54%), Gaps = 18/160 (11%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ +L+ +VPN SK D+AS++ DAI YINELK         +++  
Sbjct  405  HVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSK-------LQQAE  457

Query  768  CSRERMKRHKTEGCSSMMDG--GDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIID  595
              +E +++ + +G S   +G  G  ++V++   SY  +          S   E+DV+II 
Sbjct  458  SEKEEIQK-QLDGMSKEGNGKSGASRAVKERRSSYQDSA--------SSVEMEIDVKIIG  508

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
             +V +++   K+ +       AL EL L+++H +  ++ D
Sbjct  509  WDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASLSVVND  548



>ref|XP_004248092.1| PREDICTED: transcription factor MYC3-like [Solanum lycopersicum]
Length=451

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 87/167 (52%), Gaps = 26/167 (16%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VP+ +K D+AS++ DA+ YINELK  V EL+  + +K 
Sbjct  271  HVEAERQRREKLNHRFYALRSVVPHVTKMDKASLLSDAVSYINELKSKVAELETQLTRKS  330

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKN--------TEV  613
                  K+ K E   S            +D + + TT+ +S  Q +  +         EV
Sbjct  331  ------KKLKIECTDSF----------SIDNNSTATTITNSVDQIRHNSFGVHSNLKVEV  374

Query  612  DVRIIDDEVTVKLVQQKRINC-LLFVSKALDELQLDLHHVAGGLIGD  475
            +V+I+  +  V+ VQ + +N     + +AL +L+L +HH +   + D
Sbjct  375  EVKILGPDAMVR-VQSENVNYPSTRLMRALQDLELHVHHASISSVND  420



>emb|CDX78808.1| BnaA01g08750D [Brassica napus]
Length=579

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 90/162 (56%), Gaps = 21/162 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ +L+ +VPN SK D+AS++ DAI YINELK         ++K  
Sbjct  409  HVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKAK-------LQKAE  461

Query  768  CSRERMKRHKTEGCSSMMDGGDLK-SVEDVD--QSYSGTTLRSSWLQRKSKNTEVDVRII  598
              +E +++ + +G S  +  G++K SV+D    +  SG ++            E+DV+II
Sbjct  462  ADKEELQK-QIDGMSKEVGDGNVKSSVKDQKCLEQDSGVSVE----------VEIDVKII  510

Query  597  DDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDY  472
              +  +++   K+ +      +AL EL+L+++H +  ++ ++
Sbjct  511  GWDAMIRIQCGKKDHPGAKFMEALKELELEVNHASLSVVNEF  552



>ref|XP_009375455.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=496

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 83/156 (53%), Gaps = 22/156 (14%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN S+ D+AS++ DA+ YINELK  V EL+  V+++ 
Sbjct  322  HVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINELKSKVDELESQVQRES  381

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDV---DQSYSGTTLRSSWLQRKSKNTEVDVRII  598
                  K+ K E   ++ +     SVE     + S SG+T             E++V+I+
Sbjct  382  ------KKVKVETGDNLDNQSTTTSVEQTRPPNSSASGST-----------GLEMEVKIV  424

Query  597  DDEVTVKLVQQKRINC-LLFVSKALDELQLDLHHVA  493
              +  ++ VQ   +N     +  AL +L+ ++HH +
Sbjct  425  GSDAMIR-VQSANVNYPSARLMAALRDLEFEIHHAS  459



>ref|XP_011081344.1| PREDICTED: transcription factor MYC2-like [Sesamum indicum]
Length=469

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 82/171 (48%), Gaps = 20/171 (12%)
 Frame = -2

Query  981  LAKNRDGKGTKHFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTV  802
            + +N+      H   ERQRR  LN ++ AL+ +VPN S+ D+AS++ DA+ YI ELK  +
Sbjct  287  VGRNQLMTPANHVEAERQRREKLNQRFYALRSIVPNVSRMDKASLLADAVTYIKELKAKI  346

Query  801  GELKILVEKKRCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKN  622
              L     + +C  E +K+    G   M D     S  D  +S SG  +           
Sbjct  347  SGL-----EAKCRVESLKQEPRTGLLEMYDTKSTFSTVDFTRSASGCVI-----------  390

Query  621  TEVDVRIIDDEVTVKLVQQKRIN--CLLFVSKALDELQLDLHHVAGGLIGD  475
             +V+V+I+  E  ++ VQ   +N  C   ++  L +L+  + H +   + D
Sbjct  391  MDVEVKILGSEAMIR-VQSPDVNYPCARLMN-VLGDLEFQISHASVSSVRD  439



>emb|CDY44507.1| BnaC01g10420D [Brassica napus]
Length=586

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 85/162 (52%), Gaps = 21/162 (13%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ +L+ +VPN SK D+AS++ DAI YINELK         ++K  
Sbjct  416  HVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKAK-------LQKAE  468

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVED---VDQSYSGTTLRSSWLQRKSKNTEVDVRII  598
              +E +++        + DG    SV+D   +DQ  SG ++            E+DV+II
Sbjct  469  ADKEELQKQIGGMSKEVGDGNVKSSVKDQKCLDQD-SGVSIE----------VEIDVKII  517

Query  597  DDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDY  472
              +  +++   K  +      +AL EL+L+++H +  ++ ++
Sbjct  518  GWDAMIRIQCGKNNHPGAKFMEALKELELEVNHASLSVVNEF  559



>gb|AGL98101.1| transcription factor MYC2-like protein [Nicotiana attenuata]
Length=666

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 87/175 (50%), Gaps = 13/175 (7%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YIN       ELK+ ++   
Sbjct  488  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIN-------ELKLKLQNTE  540

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
              RE +K    +    +      +     +Q +  ++   S    K  + ++DV+II  +
Sbjct  541  TDREDLKSQIEDLKKELASEDSWRPGPPPNQDHKMSSHTGS----KIVDVDIDVKIIGWD  596

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              V++   K+ +    +  AL EL L++HH +  ++ D    +  + +  GS +Y
Sbjct  597  AMVRIQCNKKNHPAARLMVALKELDLEVHHASVSVVNDL--MIQQATVKMGSRLY  649



>emb|CDX77688.1| BnaC07g19420D [Brassica napus]
Length=452

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 85/160 (53%), Gaps = 18/160 (11%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ +L+ +VPN SK D+AS++ DAI YINELK         +++  
Sbjct  277  HVEAERQRREKLNQRFYSLRAVVPNVSKMDKASLLGDAISYINELKSK-------LQQAE  329

Query  768  CSRERMKRHKTEGCSSMMDG--GDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIID  595
              +E +++ + +G S   +G  G  ++V +   SY  +          S   E+DV+II 
Sbjct  330  SDKEEIQK-QLDGMSKEGNGKSGASRAVRERKSSYQDSA--------SSVEMEIDVKIIG  380

Query  594  DEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
             +V +++   K+ +       AL EL L+++H +  ++ D
Sbjct  381  WDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASLSVVND  420



>emb|CDP13028.1| unnamed protein product [Coffea canephora]
Length=693

 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 82/162 (51%), Gaps = 18/162 (11%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  +  ++   E+ R
Sbjct  514  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLHNMESDKEELR  573

Query  768  CSRERMKRHKT----EGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRI  601
               + +K+  T       +      DLK       S+ G+         KS + ++DV+I
Sbjct  574  NQIDSLKKELTSKEARNFAPPPPDKDLKLA-----SHQGS---------KSLDMDIDVKI  619

Query  600  IDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            I  E  +++   K  +    +  AL +L L+L H +  ++ D
Sbjct  620  IGWEAMIRVQSSKNNHPAARIMGALKDLDLELLHASVSVVND  661



>gb|KCW71784.1| hypothetical protein EUGRSUZ_E00277 [Eucalyptus grandis]
Length=713

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 84/158 (53%), Gaps = 11/158 (7%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YI EL     +L+     K 
Sbjct  538  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIKELN---SKLQTTESDKE  594

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
              +++M+  K E    + +     ++   D+  S ++   +    K    +VDV+II  +
Sbjct  595  NLQKQMESLKKE----LTNKDSRSALPQSDKDLSISSNHGA----KLIELDVDVKIIGWD  646

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            V +++   K+ +    + +AL EL LD+HH +  ++ D
Sbjct  647  VMIRIQSSKKNHPAAKLMQALMELDLDVHHASVSVVND  684



>gb|AGL98100.1| transcription factor MYC2 [Nicotiana attenuata]
Length=656

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 86/175 (49%), Gaps = 20/175 (11%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI +INELK  V       E+ R
Sbjct  485  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFINELKSKVQNSDSDKEELR  544

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
               E +++      S+    G   S +D+                K  + ++DV++I  +
Sbjct  545  NQIESLRKELANKGSNYT--GPPPSNQDL----------------KILDMDIDVKVIGWD  586

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGDYYSFLFNSKICEGSTVY  424
              +++   K+ +    +  AL EL LD+HH +  ++ +    +  + +  GS +Y
Sbjct  587  AMIRIQSNKKNHPAARLMAALMELDLDVHHASVSVVNEL--MIQQATVKMGSRLY  639



>ref|XP_010058170.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
Length=699

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 84/158 (53%), Gaps = 11/158 (7%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YI EL     +L+     K 
Sbjct  524  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYIKELN---SKLQTTESDKE  580

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVRIIDDE  589
              +++M+  K E    + +     ++   D+  S ++   +    K    +VDV+II  +
Sbjct  581  NLQKQMESLKKE----LTNKDSRSALPQSDKDLSISSNHGA----KLIELDVDVKIIGWD  632

Query  588  VTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            V +++   K+ +    + +AL EL LD+HH +  ++ D
Sbjct  633  VMIRIQSSKKNHPAAKLMQALMELDLDVHHASVSVVND  670



>ref|XP_006303928.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
 gb|EOA36826.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
Length=624

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 81/163 (50%), Gaps = 25/163 (15%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGEL---KILVE  778
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DAI YINELK  V +    K++++
Sbjct  453  HVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKAKVVKTESEKVMIK  512

Query  777  KK--RCSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNTEVDVR  604
             +      E   R  + GC      GD+ S                    K    E++V+
Sbjct  513  NQLEEVKMELAGRKASAGC------GDMSSSSCS--------------SIKPVGMEIEVK  552

Query  603  IIDDEVTVKLVQQKRINCLLFVSKALDELQLDLHHVAGGLIGD  475
            II  +  +++   KR +    +  AL +L+L+++H +  ++ D
Sbjct  553  IIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVND  595



>gb|KEH18600.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=464

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 89/165 (54%), Gaps = 30/165 (18%)
 Frame = -2

Query  948  HFATERQRRVHLNDKYEALKKLVPNPSKNDRASVVHDAIGYINELKRTVGELKILVEKKR  769
            H   ERQRR  LN ++ AL+ +VPN SK D+AS++ DA+ YINELK  + +L+  V++K 
Sbjct  292  HVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVDYINELKSKIEDLE-SVQQKE  350

Query  768  CSRERMKRHKTEGCSSMMDGGDLKSVEDVDQSYSGTTLRSSWLQRKSKNT---EVDVRII  598
              + +M                 +++E VD + S TT  +   Q++  N    E+DV+II
Sbjct  351  SKKVKM-----------------ETMEIVDNN-SATTTSTVVDQKRPCNVNAFEIDVKII  392

Query  597  DDEVTVKLVQQKRINC----LLFVSKALDELQLDLHHVAGGLIGD  475
             ++  V+ VQ + +N     L+ V   L +L+  +HH +   + +
Sbjct  393  GNDAMVR-VQSENVNHPGARLMSV---LKDLEFQVHHASISTVNE  433



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6185648665152