BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c87687_g1_i1 len=1556 path=[1:0-1555]

Length=1556
                                                                      Score     E

emb|CDP01876.1|  unnamed protein product                                580   0.0      
ref|XP_010317246.1|  PREDICTED: uncharacterized protein LOC101253155    577   0.0      
ref|XP_006361938.1|  PREDICTED: uncharacterized protein LOC102584895    569   0.0      
ref|XP_009759739.1|  PREDICTED: uncharacterized protein LOC104212220    552   0.0      
ref|XP_009587454.1|  PREDICTED: spartin-like                            540   0.0      
ref|XP_009629962.1|  PREDICTED: uncharacterized protein LOC104120...    539   0.0      
ref|XP_009770410.1|  PREDICTED: uncharacterized protein LOC104221112    537   0.0      
ref|XP_006361956.1|  PREDICTED: uncharacterized protein LOC102590062    531   0.0      
ref|XP_007157899.1|  hypothetical protein PHAVU_002G107200g             509   1e-173   
ref|XP_003516542.1|  PREDICTED: spartin-like                            508   4e-173   
ref|XP_003537642.1|  PREDICTED: spartin-like                            506   2e-172   
ref|XP_002529647.1|  conserved hypothetical protein                     504   1e-171   Ricinus communis
ref|XP_004512148.1|  PREDICTED: uncharacterized protein LOC101506701    504   1e-171   
ref|XP_004232503.1|  PREDICTED: uncharacterized protein LOC101263663    501   3e-170   
gb|AGC51775.1|  drought-inducible protein                               499   2e-169   
ref|XP_006340753.1|  PREDICTED: uncharacterized protein LOC102595817    499   3e-169   
ref|XP_006383080.1|  hypothetical protein POPTR_0005s11370g             497   2e-168   
gb|KDP46778.1|  hypothetical protein JCGZ_06566                         496   4e-168   
ref|XP_011099870.1|  PREDICTED: spartin-like isoform X2                 495   1e-167   
ref|XP_007046657.1|  Senescence/dehydration-associated protein-re...    493   7e-167   
ref|XP_011099868.1|  PREDICTED: uncharacterized protein LOC105178...    494   8e-167   
ref|XP_011043170.1|  PREDICTED: uncharacterized protein LOC105138699    491   4e-166   
gb|AES95158.2|  senescence/dehydration-associated-like protein          489   1e-165   
gb|EYU30804.1|  hypothetical protein MIMGU_mgv1a005840mg                489   2e-165   
ref|XP_003629282.1|  ERD7 protein                                       486   5e-164   
ref|XP_004509373.1|  PREDICTED: uncharacterized protein LOC101497465    483   5e-163   
ref|XP_006425429.1|  hypothetical protein CICLE_v10025594mg             482   7e-163   
ref|XP_010113331.1|  hypothetical protein L484_026662                   480   1e-161   
ref|XP_003612200.1|  ERD7 protein                                       478   1e-160   
ref|XP_006466976.1|  PREDICTED: uncharacterized protein LOC102627...    476   1e-160   
gb|KEH27594.1|  senescence/dehydration-associated-like protein          476   3e-160   
ref|XP_008448535.1|  PREDICTED: uncharacterized protein LOC103490684    473   4e-159   
ref|XP_003519861.2|  PREDICTED: uncharacterized protein LOC100777392    474   9e-159   
ref|XP_010526803.1|  PREDICTED: uncharacterized protein LOC104804269    471   5e-158   
ref|XP_004159722.1|  PREDICTED: uncharacterized protein LOC101227043    469   1e-157   
ref|XP_010548270.1|  PREDICTED: uncharacterized protein LOC104819...    468   4e-157   
ref|XP_002278045.1|  PREDICTED: uncharacterized protein LOC100267615    464   1e-155   Vitis vinifera
ref|XP_004231032.1|  PREDICTED: uncharacterized protein LOC101263355    462   5e-155   
ref|XP_007156174.1|  hypothetical protein PHAVU_003G264500g             461   1e-154   
ref|XP_010426671.1|  PREDICTED: spartin                                 461   2e-154   
ref|XP_011088594.1|  PREDICTED: uncharacterized protein LOC105169782    459   7e-154   
ref|XP_006359688.1|  PREDICTED: uncharacterized protein LOC102595706    459   8e-154   
ref|XP_004146148.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    459   9e-154   
ref|XP_010935097.1|  PREDICTED: uncharacterized protein LOC105055083    459   1e-153   
ref|XP_006486754.1|  PREDICTED: uncharacterized protein LOC102608259    458   1e-153   
ref|XP_006291123.1|  hypothetical protein CARUB_v10017236mg             458   1e-153   
ref|XP_010503811.1|  PREDICTED: uncharacterized protein LOC104780959    458   2e-153   
ref|XP_010266813.1|  PREDICTED: spartin-like                            459   2e-153   
gb|EYU37944.1|  hypothetical protein MIMGU_mgv1a006349mg                457   4e-153   
ref|XP_006422619.1|  hypothetical protein CICLE_v10028214mg             459   5e-153   
ref|XP_009629964.1|  PREDICTED: uncharacterized protein LOC104120...    453   8e-153   
ref|XP_009629963.1|  PREDICTED: uncharacterized protein LOC104120...    454   9e-153   
ref|XP_010920125.1|  PREDICTED: uncharacterized protein LOC105044044    457   1e-152   
ref|XP_009115801.1|  PREDICTED: uncharacterized protein LOC103841043    454   3e-152   
ref|NP_190693.1|  Senescence/dehydration-associated protein-like ...    455   4e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403938.1|  hypothetical protein EUTSA_v10010357mg             455   6e-152   
ref|XP_010515523.1|  PREDICTED: uncharacterized protein LOC104791...    449   6e-150   
ref|XP_010515521.1|  PREDICTED: uncharacterized protein LOC104791...    449   7e-150   
emb|CDY24381.1|  BnaA07g03060D                                          449   8e-150   
ref|XP_007046656.1|  Senescence/dehydration-associated protein-re...    448   9e-150   
ref|XP_009363480.1|  PREDICTED: uncharacterized protein LOC103953470    449   9e-150   
ref|XP_009121073.1|  PREDICTED: uncharacterized protein LOC103845911    447   3e-149   
emb|CDP13169.1|  unnamed protein product                                447   3e-149   
ref|XP_009757300.1|  PREDICTED: uncharacterized protein LOC104210178    447   3e-149   
gb|KHG14503.1|  Spartin                                                 448   1e-148   
ref|XP_006412036.1|  hypothetical protein EUTSA_v10027489mg             445   1e-148   
ref|XP_006409240.1|  hypothetical protein EUTSA_v10022685mg             444   7e-148   
ref|XP_008788442.1|  PREDICTED: uncharacterized protein LOC103706182    444   1e-147   
ref|XP_010547415.1|  PREDICTED: uncharacterized protein LOC104819...    442   2e-147   
ref|XP_010679910.1|  PREDICTED: uncharacterized protein LOC104895177    443   3e-147   
gb|KFK34367.1|  hypothetical protein AALP_AA5G136100                    442   4e-147   
ref|XP_007203685.1|  hypothetical protein PRUPE_ppa004608mg             444   4e-147   
ref|XP_010649007.1|  PREDICTED: uncharacterized protein LOC100241964    441   5e-147   
ref|XP_004289863.1|  PREDICTED: uncharacterized protein LOC101311428    441   6e-147   
ref|XP_009400346.1|  PREDICTED: uncharacterized protein LOC103984555    442   8e-147   
ref|XP_008242060.1|  PREDICTED: uncharacterized protein LOC103340417    443   9e-147   
ref|XP_002876076.1|  hypothetical protein ARALYDRAFT_485477             441   1e-146   
ref|XP_009138401.1|  PREDICTED: uncharacterized protein LOC103862449    440   2e-146   
ref|XP_004287799.1|  PREDICTED: uncharacterized protein LOC101295942    441   2e-146   
ref|XP_009379375.1|  PREDICTED: uncharacterized protein LOC103967792    440   4e-146   
ref|XP_011001970.1|  PREDICTED: uncharacterized protein LOC105109077    439   4e-146   
ref|XP_011001973.1|  PREDICTED: uncharacterized protein LOC105109080    439   7e-146   
ref|NP_179374.1|  senescence/dehydration related protein                438   9e-146   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47047.1|  BnaAnng08350D                                          438   1e-145   
emb|CDX77984.1|  BnaA09g31790D                                          437   1e-145   
ref|XP_009618139.1|  PREDICTED: uncharacterized protein LOC104110370    437   1e-145   
ref|XP_010489421.1|  PREDICTED: uncharacterized protein LOC104767...    437   2e-145   
ref|XP_010028717.1|  PREDICTED: uncharacterized protein LOC104418934    437   3e-145   
ref|XP_002886130.1|  early-responsive to dehydration 7                  437   3e-145   
ref|XP_006297674.1|  hypothetical protein CARUB_v10013699mg             437   3e-145   
ref|XP_008337991.1|  PREDICTED: uncharacterized protein LOC103401062    437   4e-145   
gb|EPS59855.1|  hypothetical protein M569_14950                         435   4e-145   
ref|XP_006856746.1|  hypothetical protein AMTR_s00055p00019700          437   4e-145   
ref|XP_010413396.1|  PREDICTED: uncharacterized protein LOC104699...    437   4e-145   
gb|AAM65608.1|  putative senescence-associated protein 12               436   7e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305512.1|  EARLY-RESPONSIVE TO DEHYDRATION 7 family pro...    435   1e-144   Populus trichocarpa [western balsam poplar]
ref|XP_010413410.1|  PREDICTED: uncharacterized protein LOC104699...    435   2e-144   
ref|XP_010090329.1|  hypothetical protein L484_024994                   434   3e-144   
gb|KFK30231.1|  hypothetical protein AALP_AA7G234600                    434   4e-144   
gb|KFK40168.1|  hypothetical protein AALP_AA3G339500                    431   3e-143   
dbj|BAB63916.1|  ERD7 protein                                           431   8e-143   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72568.1|  BnaC07g45900D                                          436   2e-142   
ref|XP_004158377.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    429   3e-142   
gb|KCW55511.1|  hypothetical protein EUGRSUZ_I01404                     436   3e-142   
gb|KGN61928.1|  hypothetical protein Csa_2G270210                       428   6e-142   
ref|XP_002867044.1|  predicted protein                                  432   7e-142   
emb|CDX73738.1|  BnaC08g22650D                                          426   2e-141   
ref|XP_010467581.1|  PREDICTED: uncharacterized protein LOC104747614    427   2e-141   
gb|KHG14924.1|  Spartin                                                 426   5e-141   
gb|ACH87168.1|  senescence-related protein                              426   6e-141   Camellia sinensis [black tea]
ref|XP_006283732.1|  hypothetical protein CARUB_v10004804mg             426   6e-141   
gb|KCW56616.1|  hypothetical protein EUGRSUZ_I02336                     426   1e-140   
ref|XP_008457682.1|  PREDICTED: uncharacterized protein LOC103497324    422   6e-140   
ref|XP_004147037.1|  PREDICTED: uncharacterized protein LOC101218079    421   2e-139   
ref|NP_567995.1|  senescence/dehydration-associated protein             421   3e-139   Arabidopsis thaliana [mouse-ear cress]
emb|CDY20844.1|  BnaC07g06930D                                          420   8e-139   
ref|XP_010432205.1|  PREDICTED: uncharacterized protein LOC104716523    419   2e-138   
emb|CAA18492.1|  putative protein                                       421   4e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009393901.1|  PREDICTED: uncharacterized protein LOC103979462    419   5e-138   
gb|KDP29638.1|  hypothetical protein JCGZ_18800                         417   1e-137   
ref|XP_010437396.1|  PREDICTED: uncharacterized protein LOC104721176    417   1e-137   
ref|XP_010548271.1|  PREDICTED: uncharacterized protein LOC104819...    415   3e-137   
ref|XP_009124573.1|  PREDICTED: uncharacterized protein LOC103849563    416   9e-137   
ref|XP_010446845.1|  PREDICTED: uncharacterized protein LOC104729587    414   1e-136   
ref|XP_007046658.1|  Senescence/dehydration-associated protein-re...    411   4e-136   
ref|XP_011004616.1|  PREDICTED: uncharacterized protein LOC105111067    411   3e-135   
ref|XP_007046655.1|  Senescence/dehydration-associated protein-re...    412   2e-134   
ref|XP_002313715.2|  hypothetical protein POPTR_0009s13600g             403   2e-132   Populus trichocarpa [western balsam poplar]
ref|XP_008236003.1|  PREDICTED: uncharacterized protein LOC103334814    398   1e-130   
gb|KDO71259.1|  hypothetical protein CISIN_1g0131332mg                  395   2e-130   
emb|CDY29202.1|  BnaA06g25550D                                          398   2e-130   
ref|XP_007201033.1|  hypothetical protein PRUPE_ppa006293mg             397   5e-130   
ref|XP_007131702.1|  hypothetical protein PHAVU_011G034800g             395   4e-129   
ref|XP_009376959.1|  PREDICTED: uncharacterized protein LOC103965610    394   7e-129   
ref|XP_008363294.1|  PREDICTED: uncharacterized protein LOC103426994    388   1e-126   
ref|XP_010547422.1|  PREDICTED: uncharacterized protein LOC104819...    385   4e-126   
ref|XP_010489422.1|  PREDICTED: uncharacterized protein LOC104767...    385   6e-126   
ref|XP_004505787.1|  PREDICTED: uncharacterized protein LOC101495575    385   6e-126   
ref|XP_003537805.1|  PREDICTED: uncharacterized protein LOC100802385    384   1e-124   
emb|CDY07815.1|  BnaC03g48070D                                          382   4e-124   
gb|KEH30493.1|  senescence/dehydration-associated-like protein          371   4e-120   
emb|CBI37885.3|  unnamed protein product                                369   2e-119   
ref|XP_002534253.1|  conserved hypothetical protein                     367   6e-119   Ricinus communis
ref|XP_010690380.1|  PREDICTED: uncharacterized protein LOC104903935    367   1e-118   
ref|XP_010041810.1|  PREDICTED: uncharacterized protein LOC104430777    366   1e-118   
gb|KHN36021.1|  Spartin                                                 361   5e-118   
ref|XP_007041867.1|  Senescence/dehydration-associated protein-re...    364   3e-117   
gb|KHN41888.1|  hypothetical protein glysoja_003628                     353   8e-115   
gb|KCW55512.1|  hypothetical protein EUGRSUZ_I01404                     360   4e-114   
ref|NP_001130339.1|  hypothetical protein                               358   5e-114   Zea mays [maize]
ref|XP_006649716.1|  PREDICTED: uncharacterized protein LOC102699666    354   2e-112   
ref|XP_004966470.1|  PREDICTED: uncharacterized protein LOC101763384    349   1e-111   
ref|XP_003558360.1|  PREDICTED: uncharacterized protein LOC100842789    347   7e-110   
gb|EAY89209.1|  hypothetical protein OsI_10705                          344   1e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_002439032.1|  hypothetical protein SORBIDRAFT_10g030260          341   2e-108   Sorghum bicolor [broomcorn]
ref|XP_009414470.1|  PREDICTED: uncharacterized protein LOC103995553    342   4e-108   
dbj|BAJ95553.1|  predicted protein                                      342   7e-108   
ref|XP_008644255.1|  PREDICTED: physical impedance induced protei...    338   4e-107   
ref|NP_001049520.1|  Os03g0241900                                       340   5e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985044.1|  PREDICTED: uncharacterized protein LOC101780138    336   2e-105   
ref|XP_006656495.1|  PREDICTED: uncharacterized protein LOC102721935    333   3e-105   
gb|ACL53659.1|  unknown                                                 333   4e-105   Zea mays [maize]
gb|KHN04729.1|  hypothetical protein glysoja_046662                     332   6e-105   
gb|EAZ02371.1|  hypothetical protein OsI_24475                          328   2e-103   Oryza sativa Indica Group [Indian rice]
ref|NP_001058592.1|  Os06g0717100                                       325   4e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003560326.1|  PREDICTED: uncharacterized protein LOC100826709    318   2e-99    
gb|KEH30494.1|  senescence/dehydration-associated-like protein          315   6e-99    
ref|XP_002962281.1|  hypothetical protein SELMODRAFT_77517              319   6e-99    
ref|XP_002965196.1|  hypothetical protein SELMODRAFT_64393              314   4e-98    
dbj|BAJ93014.1|  predicted protein                                      306   1e-94    
gb|EAZ38295.1|  hypothetical protein OsJ_22673                          300   3e-92    Oryza sativa Japonica Group [Japonica rice]
gb|KDO68026.1|  hypothetical protein CISIN_1g0104972mg                  295   4e-91    
gb|KHN00463.1|  hypothetical protein glysoja_000131                     287   4e-90    
emb|CBI17351.3|  unnamed protein product                                287   5e-90    
emb|CDY01133.1|  BnaA04g06860D                                          281   8e-87    
ref|XP_006409239.1|  hypothetical protein EUTSA_v10022685mg             282   3e-86    
ref|XP_002982625.1|  hypothetical protein SELMODRAFT_54209              270   3e-81    
ref|XP_002981143.1|  hypothetical protein SELMODRAFT_54208              268   1e-80    
gb|AAC34857.1|  senescence-associated protein 12                        251   2e-76    Hemerocallis hybrid cultivar
ref|XP_001751756.1|  predicted protein                                  255   7e-76    
gb|ACJ85630.1|  unknown                                                 248   1e-75    Medicago truncatula
ref|XP_001779219.1|  predicted protein                                  255   2e-75    
ref|XP_001751445.1|  predicted protein                                  253   6e-75    
ref|XP_001757059.1|  predicted protein                                  251   2e-74    
gb|AFW89036.1|  hypothetical protein ZEAMMB73_959410                    235   1e-68    
gb|AFK37068.1|  unknown                                                 223   6e-66    
gb|ABF94901.1|  Senescence-associated protein, expressed                225   1e-65    Oryza sativa Japonica Group [Japonica rice]
gb|ABR16046.1|  unknown                                                 230   1e-65    Picea sitchensis
gb|ABK24524.1|  unknown                                                 229   4e-65    Picea sitchensis
ref|XP_002992672.1|  hypothetical protein SELMODRAFT_135775             222   5e-63    
ref|XP_003540653.2|  PREDICTED: uncharacterized protein LOC100812553    215   7e-63    
ref|XP_002979961.1|  hypothetical protein SELMODRAFT_111719             220   3e-62    
ref|XP_001754208.1|  predicted protein                                  218   1e-60    
ref|XP_001785373.1|  predicted protein                                  216   2e-60    
gb|EMT30950.1|  hypothetical protein F775_06825                         192   2e-54    
ref|XP_008795898.1|  PREDICTED: uncharacterized protein LOC103711506    196   1e-53    
ref|XP_010924669.1|  PREDICTED: uncharacterized protein LOC105047444    191   1e-51    
gb|KHN16973.1|  hypothetical protein glysoja_035824                     190   5e-51    
ref|XP_003547745.1|  PREDICTED: uncharacterized protein LOC100784641    189   1e-50    
ref|XP_006644642.1|  PREDICTED: uncharacterized protein LOC102719056    188   1e-50    
ref|XP_009629458.1|  PREDICTED: uncharacterized protein LOC104119...    187   2e-50    
ref|XP_009773583.1|  PREDICTED: uncharacterized protein LOC104223...    186   6e-50    
gb|ABB82563.1|  putative senescence-related protein                     177   4e-49    Primula vulgaris
ref|NP_001151530.1|  senescence-associated protein 12                   184   6e-49    Zea mays [maize]
ref|XP_006353491.1|  PREDICTED: uncharacterized protein LOC102604206    182   2e-48    
gb|AFW83773.1|  senescence-associated protein 12                        182   3e-48    
gb|KHN40385.1|  hypothetical protein glysoja_000883                     182   4e-48    
ref|XP_003517642.1|  PREDICTED: uncharacterized protein LOC100800545    181   4e-48    
ref|XP_002280434.1|  PREDICTED: uncharacterized protein LOC100259...    181   1e-47    Vitis vinifera
ref|XP_004251634.1|  PREDICTED: uncharacterized protein LOC101258728    179   2e-47    
ref|XP_011007112.1|  PREDICTED: uncharacterized protein LOC105112911    180   2e-47    
ref|XP_009352697.1|  PREDICTED: uncharacterized protein LOC103944030    180   2e-47    
emb|CDP03258.1|  unnamed protein product                                177   1e-46    
ref|XP_010688335.1|  PREDICTED: uncharacterized protein LOC104902300    177   1e-46    
gb|KDP33790.1|  hypothetical protein JCGZ_07361                         176   3e-46    
ref|XP_008242492.1|  PREDICTED: uncharacterized protein LOC103340819    176   5e-46    
ref|XP_002514213.1|  conserved hypothetical protein                     176   6e-46    Ricinus communis
dbj|BAJ93577.1|  predicted protein                                      171   1e-45    
gb|EEE55313.1|  hypothetical protein OsJ_03303                          175   1e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010267145.1|  PREDICTED: uncharacterized protein LOC104604487    175   1e-45    
ref|NP_001044105.1|  Os01g0723100                                       175   2e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008361305.1|  PREDICTED: uncharacterized protein LOC103424998    174   3e-45    
ref|XP_004503485.1|  PREDICTED: uncharacterized protein LOC101511...    174   3e-45    
ref|XP_007202143.1|  hypothetical protein PRUPE_ppa006997mg             173   5e-45    
ref|XP_007152909.1|  hypothetical protein PHAVU_004G170500g             172   7e-45    
ref|XP_008354416.1|  PREDICTED: uncharacterized protein LOC103418...    171   3e-44    
ref|XP_008362960.1|  PREDICTED: uncharacterized protein LOC103426...    171   3e-44    
gb|KDO68030.1|  hypothetical protein CISIN_1g0104971mg                  164   3e-44    
ref|XP_003630712.1|  hypothetical protein MTR_8g102510                  171   4e-44    
gb|EMT31095.1|  hypothetical protein F775_29680                         164   1e-43    
ref|XP_006475565.1|  PREDICTED: uncharacterized protein LOC102624599    169   2e-43    
ref|XP_006451292.1|  hypothetical protein CICLE_v10008680mg             168   2e-43    
ref|XP_004287472.1|  PREDICTED: uncharacterized protein LOC101295447    168   3e-43    
ref|XP_003524406.2|  PREDICTED: uncharacterized protein LOC100792180    168   3e-43    
ref|XP_004135671.1|  PREDICTED: uncharacterized protein LOC101220646    168   4e-43    
dbj|BAJ98033.1|  predicted protein                                      167   1e-42    
ref|XP_008450779.1|  PREDICTED: uncharacterized protein LOC103492259    165   3e-42    
gb|KEH27196.1|  senescence/dehydration-associated-like protein          164   8e-42    
gb|KHG10562.1|  Spartin                                                 163   1e-41    
ref|XP_007013036.1|  Senescence/dehydration-associated protein-re...    163   2e-41    
gb|EMS55362.1|  hypothetical protein TRIUR3_02144                       158   2e-41    
gb|EPS67503.1|  hypothetical protein M569_07274                         161   4e-41    
ref|XP_007160288.1|  hypothetical protein PHAVU_002G308900g             163   4e-41    
gb|ACZ74699.1|  hypothetical protein                                    160   2e-40    Phaseolus vulgaris [French bean]
emb|CDM84159.1|  unnamed protein product                                159   3e-40    
ref|XP_007151050.1|  hypothetical protein PHAVU_004G014300g             159   4e-40    
emb|CDY49296.1|  BnaC01g22450D                                          159   5e-40    
ref|XP_011078253.1|  PREDICTED: uncharacterized protein LOC105162045    158   1e-39    
ref|XP_009387041.1|  PREDICTED: uncharacterized protein LOC103974036    158   1e-39    
ref|XP_010524496.1|  PREDICTED: uncharacterized protein LOC104802...    158   2e-39    
ref|XP_006414508.1|  hypothetical protein EUTSA_v10025458mg             157   4e-39    
emb|CDY22917.1|  BnaA01g18550D                                          156   7e-39    
ref|XP_002870237.1|  predicted protein                                  155   1e-38    
ref|XP_010434981.1|  PREDICTED: uncharacterized protein LOC104718861    154   2e-38    
ref|XP_009147318.1|  PREDICTED: uncharacterized protein LOC103870887    155   3e-38    
ref|XP_010095341.1|  hypothetical protein L484_010871                   152   1e-37    
ref|XP_004513042.1|  PREDICTED: uncharacterized protein LOC101513453    150   8e-37    
ref|XP_010434326.1|  PREDICTED: uncharacterized protein LOC104718301    150   1e-36    
emb|CDY44324.1|  BnaC05g30690D                                          149   1e-36    
ref|XP_009145471.1|  PREDICTED: uncharacterized protein LOC103869161    149   2e-36    
emb|CDY38625.1|  BnaA05g19620D                                          149   3e-36    
ref|XP_006406253.1|  hypothetical protein EUTSA_v10020930mg             147   1e-35    
gb|EMS62103.1|  hypothetical protein TRIUR3_32479                       148   2e-35    
dbj|BAK01151.1|  predicted protein                                      141   6e-35    
gb|EYU30709.1|  hypothetical protein MIMGU_mgv1a008636mg                143   1e-34    
ref|XP_002885452.1|  hypothetical protein ARALYDRAFT_318900             143   2e-34    
ref|NP_188797.1|  Senescence/dehydration-associated protein-like ...    140   1e-33    Arabidopsis thaliana [mouse-ear cress]
gb|KFK39478.1|  hypothetical protein AALP_AA3G249400                    140   2e-33    
ref|XP_010466408.1|  PREDICTED: uncharacterized protein LOC104746589    140   2e-33    
ref|XP_011003046.1|  PREDICTED: uncharacterized protein LOC105109881    139   3e-33    
ref|XP_010488172.1|  PREDICTED: uncharacterized protein LOC104766056    139   6e-33    
ref|XP_009629459.1|  PREDICTED: uncharacterized protein LOC104119...    136   9e-33    
ref|XP_010524497.1|  PREDICTED: uncharacterized protein LOC104802...    138   1e-32    
ref|XP_006297915.1|  hypothetical protein CARUB_v10013957mg             138   1e-32    
ref|XP_010656266.1|  PREDICTED: uncharacterized protein LOC100259...    136   1e-32    
ref|XP_010047679.1|  PREDICTED: uncharacterized protein LOC104436568    137   2e-32    
ref|XP_009773582.1|  PREDICTED: uncharacterized protein LOC104223...    135   3e-32    
ref|XP_004503486.1|  PREDICTED: uncharacterized protein LOC101511...    135   6e-32    
ref|XP_010510392.1|  PREDICTED: uncharacterized protein LOC104786638    135   7e-32    
ref|XP_008354417.1|  PREDICTED: uncharacterized protein LOC103418...    135   9e-32    
gb|KDP33791.1|  hypothetical protein JCGZ_07362                         134   3e-31    
ref|XP_004969793.1|  PREDICTED: uncharacterized protein LOC101778022    133   6e-31    
gb|KEH21337.1|  senescence/dehydration-associated-like protein          130   2e-30    
ref|XP_003532474.1|  PREDICTED: uncharacterized protein LOC100803010    131   2e-30    
ref|XP_002325027.2|  hypothetical protein POPTR_0018s09450g             127   5e-29    
gb|EEC71405.1|  hypothetical protein OsI_03570                          127   5e-29    
ref|XP_003569707.1|  PREDICTED: uncharacterized protein LOC100830822    127   6e-29    
ref|XP_001773886.1|  predicted protein                                  126   7e-29    
gb|EMS61397.1|  hypothetical protein TRIUR3_18916                       119   2e-28    
ref|NP_193280.5|  Senescence/dehydration-associated protein-like ...    125   2e-28    
ref|XP_007151051.1|  hypothetical protein PHAVU_004G014300g             124   2e-28    
gb|KEH21338.1|  senescence/dehydration-associated-like protein          122   8e-28    
gb|KDO66570.1|  hypothetical protein CISIN_1g017609mg                   122   9e-28    
ref|XP_006451291.1|  hypothetical protein CICLE_v10008680mg             122   9e-28    
gb|KFK22625.1|  hypothetical protein AALP_AAs50448U000300               123   2e-27    
ref|XP_010445394.1|  PREDICTED: uncharacterized protein LOC104728050    122   2e-27    
ref|XP_006283925.1|  hypothetical protein CARUB_v10005045mg             122   2e-27    
gb|KEH27197.1|  senescence/dehydration-associated-like protein          119   1e-26    
ref|XP_007013037.1|  Senescence/dehydration-associated protein-re...    118   2e-26    
ref|XP_002308600.2|  senescence/dehydration-associated family pro...    117   1e-25    
gb|KDO68031.1|  hypothetical protein CISIN_1g0104971mg                  111   2e-25    
gb|EMT31348.1|  Hexokinase-9                                            119   6e-25    
ref|NP_974349.1|  Senescence/dehydration-associated protein-like ...    112   4e-24    
ref|XP_009136054.1|  PREDICTED: uncharacterized protein LOC103860213    112   7e-24    
emb|CAB45990.1|  hypothetical protein                                   111   2e-23    
ref|XP_001780061.1|  predicted protein                                  109   6e-23    
emb|CCD74472.1|  Senescence/dehydration-associated protein-like p...    103   2e-22    
gb|KDO68032.1|  hypothetical protein CISIN_1g0104971mg                90.9    1e-18    
gb|KFK39626.1|  hypothetical protein AALP_AA3G268300                  94.7    7e-18    
gb|KDO66571.1|  hypothetical protein CISIN_1g017609mg                 92.0    2e-17    
gb|EMS60420.1|  hypothetical protein TRIUR3_10673                     92.4    3e-17    
gb|KFK39627.1|  hypothetical protein AALP_AA3G268400                  94.7    5e-17    
ref|XP_006853695.1|  hypothetical protein AMTR_s00056p00140490        87.8    7e-17    
gb|KDO71260.1|  hypothetical protein CISIN_1g0131331mg                85.9    1e-16    
ref|NP_001104872.1|  physical impedance induced protein2              86.7    8e-16    
gb|EMS58042.1|  hypothetical protein TRIUR3_23363                     84.3    2e-15    
ref|XP_006299946.1|  hypothetical protein CARUB_v10016159mg           85.9    3e-15    
emb|CDY48896.1|  BnaA03g36350D                                        84.7    6e-15    
ref|XP_006283926.1|  hypothetical protein CARUB_v10005045mg           82.8    4e-14    
gb|AFK43017.1|  unknown                                               80.5    1e-13    
gb|KFK39628.1|  hypothetical protein AALP_AA3G268400                  82.8    3e-13    
ref|XP_002885451.1|  hypothetical protein ARALYDRAFT_318899           79.0    4e-13    
ref|XP_008657820.1|  PREDICTED: uncharacterized protein LOC103637392  78.2    6e-13    
ref|XP_006853696.1|  hypothetical protein AMTR_s00056p00140820        76.6    3e-12    
ref|XP_001785115.1|  predicted protein                                68.6    2e-09    
dbj|BAB02354.1|  unnamed protein product                              67.8    2e-09    
gb|EMT31094.1|  hypothetical protein F775_29679                       63.5    2e-08    
ref|XP_007144081.1|  hypothetical protein PHAVU_007G1271001g          60.8    2e-07    
ref|XP_010490004.1|  PREDICTED: uncharacterized protein LOC104767717  61.2    2e-07    
ref|XP_001784345.1|  predicted protein                                62.4    5e-07    
tpg|DAA37202.1|  TPA: hypothetical protein ZEAMMB73_793314            60.1    9e-07    
ref|XP_010420660.1|  PREDICTED: uncharacterized protein LOC104706195  57.8    2e-06    
emb|CDY32436.1|  BnaC03g42200D                                        58.2    4e-06    
ref|XP_005845934.1|  hypothetical protein CHLNCDRAFT_136571           58.5    6e-06    
ref|XP_010468956.1|  PREDICTED: uncharacterized protein LOC104749...  55.1    1e-05    
ref|XP_010468954.1|  PREDICTED: uncharacterized protein LOC104749...  54.7    2e-05    
ref|XP_010468955.1|  PREDICTED: uncharacterized protein LOC104749...  54.7    3e-05    
gb|KEH27198.1|  senescence/dehydration-associated-like protein, p...  53.1    1e-04    
ref|NP_188796.2|  Senescence/dehydration-associated protein-like ...  52.8    1e-04    
ref|XP_417098.1|  PREDICTED: spartin isoform X7                       54.3    2e-04    
ref|XP_010901902.1|  PREDICTED: spartin                               53.9    3e-04    
emb|CAG09018.1|  unnamed protein product                              53.5    4e-04    
ref|XP_010468350.1|  PREDICTED: uncharacterized protein LOC104748401  50.8    4e-04    
ref|XP_010727247.1|  PREDICTED: spartin isoform X1                    53.1    5e-04    



>emb|CDP01876.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/444 (70%), Positives = 362/444 (82%), Gaps = 24/444 (5%)
 Frame = -1

Query  1529  MASQ--NRTRSPMYPKVVDPDFENPFHSSSSSANRSP-MYPVVDMKD-VENLFPE-NYET  1365
             MAS+  N TRSPMYP+V+DP++E     SSSS +  P +YP +DMKD VENLFP+ N ET
Sbjct  1     MASEKNNPTRSPMYPQVIDPNYETTLPPSSSSPSSRPNLYPTIDMKDLVENLFPDVNDET  60

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
                    +PSAPPE++EETLL VPGAILHLIDKQYSVELATGDL ++ LRQGD+ VAV A
Sbjct  61    PPANISSAPSAPPESIEETLLTVPGAILHLIDKQYSVELATGDLVILRLRQGDNTVAVLA  120

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
             RVADEIQWPLTKDLA+VKLD S YFFSFR P   ++S++ +                   
Sbjct  121   RVADEIQWPLTKDLAAVKLDPSRYFFSFRAPKEGEESENIESL-----------------  163

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLK  825
               DVLNYGLTIASKGQ++L+K LD IL+  SSFSV +VEE     +GG VA+EVSPADL 
Sbjct  164   --DVLNYGLTIASKGQEDLLKQLDGILEISSSFSVQQVEEKVVAQLGGAVAREVSPADLV  221

Query  824   SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD  645
             SEKKKEVLE RCAAYWTTLAPNVE+YS +AA+L+A+GSG+L+KGILWCGDVTVD LK G+
Sbjct  222   SEKKKEVLEERCAAYWTTLAPNVEEYSGTAAKLIAAGSGQLVKGILWCGDVTVDRLKWGN  281

Query  644   EVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
             EVL+ RMT+GSK EVSP+T++RI+RVKRVT MTEKVA GVLSGVVKVSGFFTSSVANS  
Sbjct  282   EVLKTRMTTGSKAEVSPDTLRRIKRVKRVTKMTEKVALGVLSGVVKVSGFFTSSVANSKA  341

Query  464   GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
             GKKF GLLPGEMVLA+LDGFS+ICDAVEVAGKNVMSTSSTVTTGLVSH+YG+EAAKA SE
Sbjct  342   GKKFFGLLPGEMVLASLDGFSKICDAVEVAGKNVMSTSSTVTTGLVSHRYGEEAAKAASE  401

Query  284   GLEAAGHAMATAWTVFKLRKALNP  213
             GL+AAGHA+ TAW VFK+RKALNP
Sbjct  402   GLDAAGHAVGTAWAVFKIRKALNP  425



>ref|XP_010317246.1| PREDICTED: uncharacterized protein LOC101253155 [Solanum lycopersicum]
Length=453

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/440 (69%), Positives = 348/440 (79%), Gaps = 19/440 (4%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGY  1353
             MAS+N   S MYP+V   D   PF SS+S  N   +YP +DM D VENLFP+N +T    
Sbjct  1     MASKNPNSSSMYPQVAVVDQNVPFPSSTSRQN---LYPTIDMNDLVENLFPQNDQTAPER  57

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
              H+SPSAPPE +EETLL++PG+ILHLIDK YSVELA GDL L  LRQG++ VAV  RV +
Sbjct  58    QHYSPSAPPEILEETLLVIPGSILHLIDKHYSVELAIGDLFLHRLRQGNNIVAVLVRVGN  117

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             EIQWPLTKDLA+VKLD+SHYFFSF+ P                  E   +    D+ ND 
Sbjct  118   EIQWPLTKDLAAVKLDDSHYFFSFQAPK---------------DDESDKESSVSDLANDS  162

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKK  813
             LNYGLTIASKGQ+ L+K+LD IL+N S+F+V KVEE A+V +GGPVAKE+SPADLKSEKK
Sbjct  163   LNYGLTIASKGQEKLLKELDDILENYSNFAVQKVEEKAAVALGGPVAKELSPADLKSEKK  222

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
             KEVLE RCAAYWTTLAPNVE+Y+++AA+L+ASGSG LIKGILWCGDVT D LK G+EVL+
Sbjct  223   KEVLEERCAAYWTTLAPNVEEYNATAAKLVASGSGHLIKGILWCGDVTADRLKWGNEVLK  282

Query  632   NRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
             NR  +GSKTEVSPET+KRI+RVKRVT MTEKVA GVLSG VKVSGFFT S+AN+  GKKF
Sbjct  283   NRFKTGSKTEVSPETLKRIKRVKRVTKMTEKVAVGVLSGAVKVSGFFTRSLANTKAGKKF  342

Query  452   LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
               LLPGEMVLATLDGFSRICDAVEVAGKNVMSTS TVTT  VSH+YG+EAA ATSEGL+A
Sbjct  343   FSLLPGEMVLATLDGFSRICDAVEVAGKNVMSTSGTVTTEFVSHRYGEEAANATSEGLDA  402

Query  272   AGHAMATAWTVFKLRKALNP  213
             AGHA  TAW  FK+RKALNP
Sbjct  403   AGHAFGTAWAAFKIRKALNP  422



>ref|XP_006361938.1| PREDICTED: uncharacterized protein LOC102584895 [Solanum tuberosum]
Length=447

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/440 (69%), Positives = 348/440 (79%), Gaps = 21/440 (5%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGY  1353
             MAS+N   S MYP+VV  D   PF SS+S  N   +YP +DM D VENLFP+N +T    
Sbjct  1     MASKNPNSSSMYPEVV-VDQNAPFPSSTSRQN---LYPTIDMNDIVENLFPQNDQTAPEE  56

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
              H+SPSAPPE +EETLL++PG+ILHLIDK YSVELATGDL L  LRQG++ VAV  RV +
Sbjct  57    QHYSPSAPPEILEETLLVIPGSILHLIDKHYSVELATGDLFLHRLRQGNNIVAVLVRVGN  116

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             EIQWPLTKDLA+VKLD+SHYFFSF+ P                  E   +    D  ND 
Sbjct  117   EIQWPLTKDLAAVKLDDSHYFFSFQAPK---------------DDELDKESSVSDSANDS  161

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKK  813
             LNYGLTIASKGQ+ L+K+LD IL+N S+F+V KVEE A+  +GGPVAKE+SPADLKSEKK
Sbjct  162   LNYGLTIASKGQEKLLKELDGILENYSNFAVQKVEEKAAAALGGPVAKELSPADLKSEKK  221

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
              EVLE RCAAYWTTLAPNVE+Y+++AA+L+ASGSG LIKGILWCGDVT D LK G+EVL+
Sbjct  222   -EVLEERCAAYWTTLAPNVEEYNATAAKLVASGSGHLIKGILWCGDVTTDRLKWGNEVLK  280

Query  632   NRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
             NR  +GSKTEVSPET+KRI+RVKRVT MTEKVA GVLSG VKVSGFFT S+AN+  GKKF
Sbjct  281   NRFKTGSKTEVSPETLKRIKRVKRVTKMTEKVAVGVLSGAVKVSGFFTRSLANTKAGKKF  340

Query  452   LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
               LLPGEMVLATLDGFSRICDAVEVAGKNVMSTS TVTT  VSH+YG+EAA ATSEGL+A
Sbjct  341   FSLLPGEMVLATLDGFSRICDAVEVAGKNVMSTSGTVTTEFVSHRYGEEAANATSEGLDA  400

Query  272   AGHAMATAWTVFKLRKALNP  213
             AGHA  TAW VFK+RKALNP
Sbjct  401   AGHAFGTAWAVFKIRKALNP  420



>ref|XP_009759739.1| PREDICTED: uncharacterized protein LOC104212220 [Nicotiana sylvestris]
Length=501

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/457 (66%), Positives = 371/457 (81%), Gaps = 17/457 (4%)
 Frame = -1

Query  1556  FQSPKIF---SPMASQN--RTRSPMYPKVV--DPDFENPFHSSSSSANRSPMYPVVDMKD  1398
             F  P+ F   S MASQN  + ++P+YP+V+  DP+ +      S+S++R  +YP +D KD
Sbjct  26    FLHPQHFFLSSSMASQNPNQHKAPLYPQVIHNDPNLQ------STSSSRPNLYPTIDEKD  79

Query  1397  V-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVS  1221
             + E L P++Y+T    +  +PSAPPE++EETLL++PG ++HLIDK YSVELATGDLSLV 
Sbjct  80    LTEKLIPDDYQTTP--WPSTPSAPPESLEETLLVIPGVLIHLIDKHYSVELATGDLSLVR  137

Query  1220  LRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFR-FPNVdddsdssdeekskg  1044
             L Q  + VA+ ARVADEIQWPLTKDLA+VKLD+SHYFFSF+     D DS   ++EK K 
Sbjct  138   LLQDKNTVAILARVADEIQWPLTKDLAAVKLDDSHYFFSFQAMKEDDSDSSDDEKEKGKK  197

Query  1043  kkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMG  864
             KK+   KEK K+  N+ LNYGLTIASKGQ+ L+K+LD IL + S+F+V KVEE A++ MG
Sbjct  198   KKDKGKKEKDKEKVNESLNYGLTIASKGQEALLKELDAILKSYSTFAVQKVEEKAALAMG  257

Query  863   GPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILW  684
             G VA+E+SPADLKSEKKKEVLE RCA YWTTLAPNVE+YS SAA+L+A+GSG+LIKGILW
Sbjct  258   GTVARELSPADLKSEKKKEVLEERCAQYWTTLAPNVEEYSGSAAKLVAAGSGQLIKGILW  317

Query  683   CGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKV  504
             CGDV+++ LK G+EVL+ RMTSG+K E+ PET+ RI+RVKRVT MTEKVA GVLSGV++V
Sbjct  318   CGDVSMERLKRGNEVLKQRMTSGTKAEIRPETLMRIKRVKRVTKMTEKVAIGVLSGVLQV  377

Query  503   SGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvS  324
             SGFFTSSVANS VGKKF  +LPGEMVLATLDGF RICDAVEVAGKNVMSTSS VTT LVS
Sbjct  378   SGFFTSSVANSIVGKKFFSMLPGEMVLATLDGFCRICDAVEVAGKNVMSTSSAVTTELVS  437

Query  323   HKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             H+YG+EAAK  +EGL+AAGHA+ TAWTVFK+RKALNP
Sbjct  438   HRYGEEAAKVATEGLDAAGHAVGTAWTVFKIRKALNP  474



>ref|XP_009587454.1| PREDICTED: spartin-like [Nicotiana tomentosiformis]
Length=455

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/436 (68%), Positives = 343/436 (79%), Gaps = 19/436 (4%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGYYHHS  1341
             N +R+PMYP+VV    +    S  SS++R  +YP +DM D VENLFPEN +      H+S
Sbjct  7     NTSRTPMYPQVV---IDQNTPSPPSSSSRQNLYPTIDMNDLVENLFPENDQFTPNEQHYS  63

Query  1340  PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQW  1161
             PSAP E +EETLL +PG+ILHLID  YSVELA+GDLS+  LRQ +S VAV  RV +EIQW
Sbjct  64    PSAPLETLEETLLTIPGSILHLIDTHYSVELASGDLSVHRLRQDNSVVAVLVRVGNEIQW  123

Query  1160  PLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYG  981
             PLTKDLA+VKLD+S YFFSF+ P                  E   +    D+ N+ LNYG
Sbjct  124   PLTKDLAAVKLDDSRYFFSFQAPK---------------DDESDKESSANDLENESLNYG  168

Query  980   LTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVL  801
             LTIASKGQ+ L+K+LD IL+N S+F+V KVEE A+ V+GGPV KE+SPADLKSEKKKEVL
Sbjct  169   LTIASKGQEKLLKELDGILENYSNFAVQKVEEKAAAVLGGPVPKELSPADLKSEKKKEVL  228

Query  800   EGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMT  621
             E RCAAYWTTLAPNVE+Y++SAA+ +ASGSG LIKGILWCGDVT D LK G+EVL+NR  
Sbjct  229   EERCAAYWTTLAPNVEEYNASAAKYVASGSGHLIKGILWCGDVTADRLKWGNEVLKNRFK  288

Query  620   SGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLL  441
             +GSKTEVSPET+KRI+RVKRVT MTEKVA GVLSG VKVSGF T SVAN+  GKKF  LL
Sbjct  289   TGSKTEVSPETLKRIKRVKRVTKMTEKVAVGVLSGAVKVSGFVTRSVANTKAGKKFFSLL  348

Query  440   PGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHA  261
             PGEMVLATLDGFSRICDAVEVAGKNVMSTSSTVTT  VSH+YG+EAAKATSEGL+AAGHA
Sbjct  349   PGEMVLATLDGFSRICDAVEVAGKNVMSTSSTVTTEFVSHRYGEEAAKATSEGLDAAGHA  408

Query  260   MATAWTVFKLRKALNP  213
               TAW VFK+RKALNP
Sbjct  409   FGTAWAVFKIRKALNP  424



>ref|XP_009629962.1| PREDICTED: uncharacterized protein LOC104120020 isoform X1 [Nicotiana 
tomentosiformis]
Length=461

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/445 (65%), Positives = 359/445 (81%), Gaps = 17/445 (4%)
 Frame = -1

Query  1529  MASQN--RTRSPMYPKVV--DPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYET  1365
             M SQN    ++P+YP+++  DP+ +       S+++R  +YP +D KD VE L P++Y+T
Sbjct  1     MTSQNPNLQKAPLYPQIIHNDPNLQ-------STSSRPNLYPTIDEKDLVEKLIPDDYQT  53

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
                    +PSAPPE++EETLL++PG ++HLIDK YSVELATGDLSL+ L Q  + VA+  
Sbjct  54    TPS----APSAPPESLEETLLVIPGVLIHLIDKHYSVELATGDLSLIGLLQDKNTVAILV  109

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFR-FPNVdddsdssdeekskgkkegkhkekqkD  1008
             RVADEIQWPLTKDLA+VKLD+SHYFFSF+       DS   ++EK K +K+   KEK K+
Sbjct  110   RVADEIQWPLTKDLAAVKLDDSHYFFSFQAMKEDGSDSSDDEKEKGKKEKDKGKKEKDKE  169

Query  1007  MGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADL  828
               N+ LNYGLTIASKGQ+ L+K+LD IL + S+FSV KVEE A++ +GG VA+E+SPADL
Sbjct  170   TVNESLNYGLTIASKGQEALLKELDAILKSYSTFSVQKVEEKAALAIGGTVARELSPADL  229

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
             KSEKKKEVLE  C  YWTTLAPNVE+YS SAA+L+A+GSG+LIKGILWCGDV+++ LK G
Sbjct  230   KSEKKKEVLEEHCTQYWTTLAPNVEEYSGSAAKLVAAGSGQLIKGILWCGDVSIERLKRG  289

Query  647   DEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
             +EVL+ RMTSG+K E+ PET++RI+RVKRVT MTEKVA GVLSGV++VSGFFTSSVANS 
Sbjct  290   NEVLKQRMTSGTKAEIRPETLRRIKRVKRVTKMTEKVAIGVLSGVLQVSGFFTSSVANSI  349

Query  467   VGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATS  288
             VGKKF  ++PGEMVLATLDGF RICDAVEVAGKNVMSTSSTVTT LVSH+YG+EAAK  +
Sbjct  350   VGKKFFRMMPGEMVLATLDGFCRICDAVEVAGKNVMSTSSTVTTELVSHRYGEEAAKVAT  409

Query  287   EGLEAAGHAMATAWTVFKLRKALNP  213
             EGL+AAGH + TAWTVFK+RKALNP
Sbjct  410   EGLDAAGHVVGTAWTVFKIRKALNP  434



>ref|XP_009770410.1| PREDICTED: uncharacterized protein LOC104221112 [Nicotiana sylvestris]
Length=458

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/416 (68%), Positives = 329/416 (79%), Gaps = 20/416 (5%)
 Frame = -1

Query  1457  HSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAIL  1281
             ++ SSS++R  +YP +DM D VENLFPEN +      H +PSAP E    TLL +PG++L
Sbjct  32    NTPSSSSSRQNLYPTIDMNDLVENLFPENDQITPNDQHDTPSAPLE----TLLTIPGSML  87

Query  1280  HLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSF  1101
             HLID  YSVEL+ GDLS+  LRQ +S VAV  RV +EIQWPLTKDLA+VKLD+S YFFSF
Sbjct  88    HLIDTHYSVELSAGDLSVHRLRQDNSVVAVLVRVGNEIQWPLTKDLAAVKLDDSRYFFSF  147

Query  1100  RFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILD  921
             + P                  E        D+ N+ LNYGLTIASKGQ+ L+K+LD IL+
Sbjct  148   QAPK---------------DDESDKDSSANDLANESLNYGLTIASKGQEKLLKELDGILE  192

Query  920   NCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSS  741
             N S+F+V KVEETA+ V+GGPVAKE+SPADLKSEKKKEVLE RCAAYWTTLAPNVE+Y++
Sbjct  193   NYSNFAVQKVEETAAAVLGGPVAKELSPADLKSEKKKEVLEERCAAYWTTLAPNVEEYNA  252

Query  740   SAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKR  561
             SAA+ +ASGSG LIKGILWCGDVT D LK G+EVL+NR  +GSKTEVSPET+KRI+RVKR
Sbjct  253   SAAKYVASGSGHLIKGILWCGDVTADRLKWGNEVLKNRFKTGSKTEVSPETLKRIKRVKR  312

Query  560   VTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVE  381
             VT MTEKVA GVLSG VKVSGF T SVAN+  GKKF  LLPGEMVLATLDGFSRICDAVE
Sbjct  313   VTKMTEKVAVGVLSGAVKVSGFVTRSVANTKAGKKFFSLLPGEMVLATLDGFSRICDAVE  372

Query  380   VAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             VAGKNVMSTSSTVTT  VSH+YG+EAAKATSEGL+AAGHA  TAW VFK+R+ALNP
Sbjct  373   VAGKNVMSTSSTVTTEFVSHRYGEEAAKATSEGLDAAGHAFGTAWAVFKIRQALNP  428



>ref|XP_006361956.1| PREDICTED: uncharacterized protein LOC102590062 [Solanum tuberosum]
Length=421

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/431 (65%), Positives = 333/431 (77%), Gaps = 25/431 (6%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGY  1353
             MAS+N   S MYP+++  D   PF SS+S  N   +YP++DM D VENLFP+N +T    
Sbjct  1     MASKNPNSSSMYPQLL-IDQNTPFPSSTSRQN---LYPIIDMNDLVENLFPQNDQTAPEE  56

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
              H+SP APPE +EETLL++PG+ILHLIDK YS+ELATGDL L  LRQG++ VA+   V +
Sbjct  57    QHYSPYAPPEILEETLLVIPGSILHLIDKHYSIELATGDLFLHRLRQGNNIVALLVSVGN  116

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             EIQW LTKDL +VKLD+SHYFFSF+ P  D+    S                      D 
Sbjct  117   EIQWLLTKDLTAVKLDDSHYFFSFQAPKDDESDTESV--------------------GDS  156

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKK  813
             LNYGLTIASKGQ+ L+K+LD IL+N S+F+V KVEE A+V +GGPVAKE+S ADLKSEKK
Sbjct  157   LNYGLTIASKGQEKLLKELDGILENYSNFAVQKVEEKAAVGLGGPVAKELSLADLKSEKK  216

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
             KEVLE RCAAYWTTLAPNVE+Y++ AA+L+ASGSG LIKGILWCGDVT D LK G+EVL+
Sbjct  217   KEVLEERCAAYWTTLAPNVEEYNAKAAKLVASGSGHLIKGILWCGDVTADGLKRGNEVLK  276

Query  632   NRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
             NR  +GSKT+VSPET+KRI+RVKRVT +TEK+A GVLSG VKVSGFFT S+ANS  GKKF
Sbjct  277   NRFKTGSKTKVSPETLKRIKRVKRVTKVTEKMAVGVLSGAVKVSGFFTRSLANSKAGKKF  336

Query  452   LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
               LLPGEMVLATLDGFSRICDAVEVAGKNVMSTS TVTT  VSH+YG+EAAKATSEG+ A
Sbjct  337   FSLLPGEMVLATLDGFSRICDAVEVAGKNVMSTSGTVTTEFVSHRYGEEAAKATSEGIHA  396

Query  272   AGHAMATAWTV  240
              GHA  T W +
Sbjct  397   VGHAFGTVWAI  407



>ref|XP_007157899.1| hypothetical protein PHAVU_002G107200g [Phaseolus vulgaris]
 gb|ESW29893.1| hypothetical protein PHAVU_002G107200g [Phaseolus vulgaris]
Length=456

 Score =   509 bits (1312),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 270/447 (60%), Positives = 336/447 (75%), Gaps = 34/447 (8%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVD--PDFENPF-HSSSSSANRSPMYPVVDMKD-VENLFPENYET  1365
             MASQN + R+ +YP+V D  PD  +P    + SS++++ +YP +D  D V+NLF E+   
Sbjct  1     MASQNPKQRNSLYPQVNDSNPDAPSPLLDVNRSSSSQATLYPSIDYNDLVQNLFSEDASA  60

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
                    SPSAPPEA+EE LL +PGAIL+L+DK YSVELA GD S++ LRQGD+ VAV+A
Sbjct  61    AD-----SPSAPPEAIEEILLRIPGAILNLVDKDYSVELACGDFSVIRLRQGDNAVAVYA  115

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
             RVADEIQWPL KD  +VK+D+SHYFFSFR P   D  +                      
Sbjct  116   RVADEIQWPLAKDETAVKVDDSHYFFSFRVPKGSDPGEEE--------------------  155

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEVSPA  834
               DVL+YGLTIASKGQ+ L+K+LD++L++CS FSV +V E A      + G VAKEVSP 
Sbjct  156   -EDVLSYGLTIASKGQERLLKELDSVLESCSCFSVQRVSEKAKKKGEALDGSVAKEVSPK  214

Query  833   DLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLK  654
             DLKS KKKE++E RCAAYWTTLAPNVEDYS ++AR++A+GSG ++KGILWCG+VTVD LK
Sbjct  215   DLKSGKKKEMMEERCAAYWTTLAPNVEDYSGTSARMIAAGSGHVVKGILWCGEVTVDRLK  274

Query  653   SGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
              G+EV++ R+T GS  EVSP+T+KRI+RVKRVT MTEKVA G LSGVVKVSGFFT SV N
Sbjct  275   WGNEVMKKRITPGSNAEVSPQTLKRIKRVKRVTKMTEKVANGFLSGVVKVSGFFTGSVVN  334

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GKKF   LPGE++LA+LDGFS++CDAVEV GKNV+STSSTVTT LV H+YG++AA+A
Sbjct  335   SKAGKKFFSFLPGEVILASLDGFSKVCDAVEVTGKNVLSTSSTVTTELVDHRYGEKAAEA  394

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             TSEG  AAGHA+ TAW  FK+RKA+NP
Sbjct  395   TSEGFTAAGHALGTAWAAFKIRKAINP  421



>ref|XP_003516542.1| PREDICTED: spartin-like [Glycine max]
Length=448

 Score =   508 bits (1309),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 274/447 (61%), Positives = 332/447 (74%), Gaps = 34/447 (8%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVD--PDFENPFHSSSSSANRSP-MYPVVDMKD-VENLFPENYET  1365
             MASQN   R+ +YP+V+D  PD   P  + + S++  P +YP VD  D V+NLFPE+  T
Sbjct  1     MASQNPNQRNSLYPQVIDSNPDAPPPLLNPNRSSSSQPSLYPSVDYNDLVQNLFPED-AT  59

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
               G    SPSAP EA EE LL +PGAIL+LIDK YSVELA GD S++ LRQGD+ VAV+A
Sbjct  60    AAG----SPSAPLEATEEALLRIPGAILNLIDKDYSVELACGDFSVIRLRQGDNAVAVYA  115

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
             RVADEIQWPL KD  +VK+D+SHYFFSFR P   D  +                      
Sbjct  116   RVADEIQWPLAKDATTVKVDDSHYFFSFRVPKGSDPGEEE--------------------  155

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEVSPA  834
               D+L+YGLTIASKGQ+ L+K+LD +L+NCS FSV  V E        + G VA+EVSP 
Sbjct  156   -EDMLSYGLTIASKGQEGLLKELDVVLENCSCFSVQSVSENVKKKGEALDGSVAREVSPK  214

Query  833   DLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLK  654
             DL+S KKKE++EGRCAAYWTTLAPNVEDYS   A+++A+GSG ++KGILWCGDVTVD LK
Sbjct  215   DLESGKKKEMMEGRCAAYWTTLAPNVEDYSGKTAKMIAAGSGHVVKGILWCGDVTVDRLK  274

Query  653   SGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
              G++V++ R+  GS  EVSP+T+KRI+RVKRVT MTEKVA G LSGVVKVSGFFTSSV N
Sbjct  275   WGNQVMKKRIAPGSHAEVSPQTLKRIKRVKRVTKMTEKVANGFLSGVVKVSGFFTSSVIN  334

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GKKF   LPGE++LA+LDGFS++CDAVEVAGKNVMSTSSTVTT LV H+YG++AA+A
Sbjct  335   SKAGKKFFSFLPGEVLLASLDGFSKVCDAVEVAGKNVMSTSSTVTTELVDHRYGEQAAEA  394

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             TSEG  AAGHA+ TAW  FK+RKALNP
Sbjct  395   TSEGFSAAGHALGTAWAAFKIRKALNP  421



>ref|XP_003537642.1| PREDICTED: spartin-like [Glycine max]
Length=447

 Score =   506 bits (1304),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 272/447 (61%), Positives = 328/447 (73%), Gaps = 35/447 (8%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVD--PDFENPFHSSSSSANRSP-MYPVVDMKD-VENLFPENYET  1365
             MASQN   R+ +YP+V+D  PD  +P   ++ S++  P +YP VD  D VENLF E+   
Sbjct  1     MASQNPNQRNSLYPQVIDSNPDAPSPLLITNHSSSSQPCLYPSVDYNDLVENLFSEDATA  60

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
                    SPSAPPEA EE L  +PGAIL+L+DK YSVELA GD S++ LRQGD+ VAV+A
Sbjct  61    A-----CSPSAPPEATEEVLFRIPGAILNLVDKDYSVELACGDFSVIRLRQGDNAVAVYA  115

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
             RVADEIQWPL KD A+VKLD+SHYFFSFR P   D  +                      
Sbjct  116   RVADEIQWPLAKDAAAVKLDDSHYFFSFRVPKGFDPDEE---------------------  154

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEVSPA  834
               DVL+YGLTIASKGQ+ L+KDLD +L+NCS FSV  V E A      + G VA EVSP 
Sbjct  155   -EDVLSYGLTIASKGQERLVKDLDAVLENCSCFSVQSVSENAKKKGEALDGTVASEVSPK  213

Query  833   DLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLK  654
             D++S KKKE++E RCAAYWTTLAPNVEDYS   A+++A+GSG ++KGILWCGDVTVD LK
Sbjct  214   DMESGKKKEMMEERCAAYWTTLAPNVEDYSGKTAKMIAAGSGHVVKGILWCGDVTVDRLK  273

Query  653   SGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
              G++V++ R+  GS  EVSP+T+KRI+RVKRVT MTEKVA G LSGVVKVSGFFTSSV N
Sbjct  274   WGNQVMKKRIAPGSHAEVSPQTLKRIKRVKRVTKMTEKVANGFLSGVVKVSGFFTSSVIN  333

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GKK    LPGE++LA+LDGFS++CDAVEV GKNVMSTSSTVTT LV H+YG++AA+A
Sbjct  334   SKAGKKIFSFLPGEVLLASLDGFSKVCDAVEVTGKNVMSTSSTVTTELVDHRYGEQAAEA  393

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             TSEG  AAGHA+ TAW  FK+RKALNP
Sbjct  394   TSEGFSAAGHALGTAWAAFKIRKALNP  420



>ref|XP_002529647.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32734.1| conserved hypothetical protein [Ricinus communis]
Length=442

 Score =   504 bits (1298),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 266/443 (60%), Positives = 341/443 (77%), Gaps = 32/443 (7%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQG  1356
             MASQN   +  +YP+++     NP  +  SS++ S +YP +DMKD VENLFP+  +  Q 
Sbjct  1     MASQNPNPKQSLYPEIIQT---NPESNPKSSSSSSNLYPTIDMKDLVENLFPD-LDEQQK  56

Query  1355  YYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVA  1176
              ++  PSAPP+A+EE L+ +PGAIL+LIDK YSVELA+GDLS+  LRQG++ VAV ARV+
Sbjct  57    NHNILPSAPPQALEEELIKIPGAILNLIDKNYSVELASGDLSIARLRQGNNVVAVLARVS  116

Query  1175  DEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGND  996
             DEIQWPLTKD A+VKLD+SHYFFS RFP+ ++                          N+
Sbjct  117   DEIQWPLTKDEAAVKLDDSHYFFSLRFPDDEESR------------------------NE  152

Query  995   VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKV--EETASVVMGGPVAKEVSPADLKS  822
             +LNYGLTIASKGQ+ L+K+ D IL+  S F+V KV  E+ +  +      +E SP DLK 
Sbjct  153   ILNYGLTIASKGQEVLLKEFDNILEAYSCFTVQKVSKEKKSEDLFDELAVRETSPGDLKY  212

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
             E+K+EV+EG+CAAYWTTLAPNVEDY  +AA+++A+GSG LIKGILWCGDVTVD L+ G+E
Sbjct  213   EEKREVMEGKCAAYWTTLAPNVEDYGGTAAKVIAAGSGHLIKGILWCGDVTVDRLQRGNE  272

Query  641   VLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
             V + RM+  SK+E+SP+T+KRIRRVK++T MTEKVA GVLSGV+KVSGFFTSS+ANS VG
Sbjct  273   VFKRRMSPKSKSEISPDTLKRIRRVKKMTKMTEKVANGVLSGVLKVSGFFTSSIANSKVG  332

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
             KKF GLLPGE++LA+LDGF+++CDAVEVAG+NVMSTSSTVTT LV+H+YG++AA+AT+EG
Sbjct  333   KKFFGLLPGEIILASLDGFNKVCDAVEVAGRNVMSTSSTVTTELVNHRYGEQAAEATNEG  392

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
             L AAGHA  TAW  FK+RKALNP
Sbjct  393   LGAAGHAFGTAWAAFKIRKALNP  415



>ref|XP_004512148.1| PREDICTED: uncharacterized protein LOC101506701 [Cicer arietinum]
Length=456

 Score =   504 bits (1299),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 347/447 (78%), Gaps = 26/447 (6%)
 Frame = -1

Query  1529  MASQNRTRS-PMYPKVVDPDFENP---FHSSSSSANRSPMYPVVDMKD-VENLFPENYET  1365
             MA+QN  R+  +YP+V+D + + P    +++ SS  +S +YP +D  D V+NLFP+  + 
Sbjct  1     MATQNPNRTNSLYPQVIDSNPDAPSQLLYTNPSS--QSNLYPSIDFNDLVQNLFPD--DV  56

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
               G   + PSAP E  E+ LL +PGAIL+LIDK+YSVELA+GD ++V LRQG++++AV+A
Sbjct  57    TAGNTLNPPSAPLETTEDILLKIPGAILNLIDKEYSVELASGDFTVVRLRQGENSIAVYA  116

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
             R+ADEIQWPL KD  +VK+D+SHYFFSFR P                    + ++++K+ 
Sbjct  117   RIADEIQWPLAKDETAVKVDDSHYFFSFRAPK--------------DFDSDEEEDRRKNN  162

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGG---PVAKEVSPA  834
              +D+L+YGLTIASKGQ+ L+K+LD IL+NCSSFSV KV E A    G     +A EVSP 
Sbjct  163   DSDLLSYGLTIASKGQERLLKELDKILENCSSFSVQKVSEKAKKKGGALDASMATEVSPK  222

Query  833   DLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLK  654
             DL+S KKKE++EG+CAAYWTTLAPNVE+YS SAA+++A+GSG +IKGILWCGDVT+D L+
Sbjct  223   DLESAKKKEIMEGQCAAYWTTLAPNVEEYSGSAAKMIAAGSGHVIKGILWCGDVTMDRLQ  282

Query  653   SGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
              G++V++ RM SGS  ++SP+T+KRI+RVKRVT MTEKVATG+LSGVVKVSGFFTSSV N
Sbjct  283   WGNQVMKKRMASGSPAQISPQTLKRIKRVKRVTKMTEKVATGLLSGVVKVSGFFTSSVVN  342

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GKKF  LLPGE+VLA+LDGFS++CDAVEVAGKNVMST+STVTT LV H+YG++AA A
Sbjct  343   SKAGKKFFSLLPGEVVLASLDGFSKVCDAVEVAGKNVMSTTSTVTTELVDHRYGEQAAHA  402

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T+EGL AAGHA+ TAW  FK+RKA+NP
Sbjct  403   TNEGLNAAGHALGTAWAAFKIRKAINP  429



>ref|XP_004232503.1| PREDICTED: uncharacterized protein LOC101263663 [Solanum lycopersicum]
Length=460

 Score =   501 bits (1291),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 278/444 (63%), Positives = 345/444 (78%), Gaps = 16/444 (4%)
 Frame = -1

Query  1529  MASQN--RTRSPMYPKVV--DPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYET  1365
             MASQN    ++P+YP+V+  DPD +      ++S++R  +YP ++  D+ ENLFPENY  
Sbjct  1     MASQNPNLKKAPLYPRVIHNDPDLQ------TTSSSRPNLYPTLNETDLAENLFPENYHI  54

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
             +       P +     EE LL++PG ++HLIDK YSVELA GDLSL  L Q  + VA+ A
Sbjct  55    IPSAPSPPPESH----EENLLVIPGVLIHLIDKNYSVELADGDLSLCRLLQDKNTVAILA  110

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
              V D+IQWP+TKDL +VKLD+SHYFFSF+    D+   ++D++K KGKK+ K K+ +   
Sbjct  111   NVGDDIQWPITKDLTAVKLDDSHYFFSFQALKEDESDCTTDDDKEKGKKKKKKKKDKGPT  170

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLK  825
              +D LNYGLTIASKGQ+ L+K+LD IL + S+FSV KV+E A++ MGG VA+E+SP DLK
Sbjct  171   -DDSLNYGLTIASKGQEALLKELDDILKSYSTFSVQKVDENAALAMGGTVARELSPDDLK  229

Query  824   SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD  645
             SEKKKEVLE RCA YWTTLAPNVE+YS +AA+L+A GSG+LIKGILWCGDV+ + L  G+
Sbjct  230   SEKKKEVLEERCAQYWTTLAPNVEEYSGAAAKLVAQGSGQLIKGILWCGDVSAERLMRGN  289

Query  644   EVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
             EVL+ RM +G+K E+SPET+KRI+RVK VT MTEKVA GVLSGV+ VSGFFTSSV NS  
Sbjct  290   EVLKQRMATGTKAEISPETLKRIQRVKTVTKMTEKVALGVLSGVLSVSGFFTSSVVNSVA  349

Query  464   GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
             GKKF  +LPGEMVLATLDGF +ICDAVEVAGKNVMSTSSTVTT LVS KYG+EAAK  SE
Sbjct  350   GKKFFKMLPGEMVLATLDGFCKICDAVEVAGKNVMSTSSTVTTELVSQKYGEEAAKVASE  409

Query  284   GLEAAGHAMATAWTVFKLRKALNP  213
             GL+AAGHA+ TAWTVFK+RKALNP
Sbjct  410   GLDAAGHAVGTAWTVFKIRKALNP  433



>gb|AGC51775.1| drought-inducible protein [Manihot esculenta]
Length=466

 Score =   499 bits (1286),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 282/448 (63%), Positives = 345/448 (77%), Gaps = 18/448 (4%)
 Frame = -1

Query  1529  MASQNRTR-SPMYPKVV--DPDFENPFHSS-SSSANRSPMYPVVDMKD-VENLFPENYET  1365
             MASQN     P+YP+V+  +PD  +  HS  +S ++ S +YP +DM+D VENLFP+  E 
Sbjct  1     MASQNSNPPKPLYPEVILSNPDSPSHLHSKPNSESSSSNLYPTIDMRDLVENLFPDPEE-  59

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
                Y H +PSAPP A EE L+ +PGAIL+LIDK YSVELA GDL++V L QG + VAV A
Sbjct  60    ---YNHCAPSAPPVATEEVLIKIPGAILNLIDKNYSVELACGDLTIVRLCQGGNIVAVLA  116

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
             RVADEIQWPL KD A+VKLD+SHYFFS R PN    SDSS +E+ K  +  K  +     
Sbjct  117   RVADEIQWPLAKDEAAVKLDDSHYFFSLRLPNEHQGSDSSSDEEDKKSRNKKISD-----  171

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSP  837
               D+LNYGLTIASKGQ+ L+K+ D IL   S F+V KV E A      ++     KE SP
Sbjct  172   SGDILNYGLTIASKGQEALLKEFDVILQAYSCFTVQKVSEKAKGKGEALLDELTPKEASP  231

Query  836   ADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL  657
             ADL  E+KKE+LEG+ AAYWTTLAPNVEDYSS++A+++A+GSG LIKGILWCGDVTVD L
Sbjct  232   ADLHYEEKKELLEGQSAAYWTTLAPNVEDYSSTSAKVIAAGSGHLIKGILWCGDVTVDRL  291

Query  656   KSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVA  477
             K G+E+++ RM+  SK+E+SP+TMKRIRRVK++T  TEKVA GVLSGV+KVSG FTS VA
Sbjct  292   KWGNEIMKRRMSPRSKSEISPDTMKRIRRVKKLTKRTEKVANGVLSGVLKVSGIFTSKVA  351

Query  476   NSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAK  297
             NS VGKKF GLLPGE+VLA+LDGFS++CDA EVAGKNVMSTSSTVTT LV+H+YG++AA+
Sbjct  352   NSKVGKKFFGLLPGEIVLASLDGFSKMCDAAEVAGKNVMSTSSTVTTDLVNHRYGEQAAE  411

Query  296   ATSEGLEAAGHAMATAWTVFKLRKALNP  213
             AT+EGL+AAGHAM TA  VFKLRKALNP
Sbjct  412   ATNEGLDAAGHAMGTALAVFKLRKALNP  439



>ref|XP_006340753.1| PREDICTED: uncharacterized protein LOC102595817 [Solanum tuberosum]
Length=462

 Score =   499 bits (1284),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 277/445 (62%), Positives = 342/445 (77%), Gaps = 16/445 (4%)
 Frame = -1

Query  1529  MASQN--RTRSPMYPKVV--DPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYET  1365
             MAS+N    ++P+YP+V+  DPD +      S+S++R  +YP ++  D+ ENL PENY  
Sbjct  1     MASKNPNLQKAPLYPRVIHNDPDLQ------STSSSRPNLYPTLNETDLAENLIPENYHI  54

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
             +       P +     EETL+++ G ++HLIDK YSVELA GDLSL  L Q  + VA+ A
Sbjct  55    IPSAPSPPPESH----EETLVVISGVLIHLIDKNYSVELANGDLSLFRLLQNKNTVAILA  110

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFR-FPNVdddsdssdeekskgkkegkhkekqkD  1008
              V D+IQWP+TKDL +VKLD+SHYFFSF+     + D  + D+++   KK+ K KEK K 
Sbjct  111   NVGDDIQWPITKDLTAVKLDDSHYFFSFQALKEDESDCSTDDDKEKGKKKKKKKKEKDKG  170

Query  1007  MGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADL  828
               +D LNYGLTIASKGQ+ L+K+LD IL + S+FSV KVEE A++ MGG VA+E+SP DL
Sbjct  171   PMDDSLNYGLTIASKGQEALLKELDDILKSYSTFSVQKVEENAALAMGGTVARELSPDDL  230

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
             KSEKKKEVLE RCA YWTTLAPNVE+YS +AA+L+A GSG+LIKGILWCGDV+ + L  G
Sbjct  231   KSEKKKEVLEERCAQYWTTLAPNVEEYSGAAAKLVAQGSGQLIKGILWCGDVSAERLMRG  290

Query  647   DEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
             +EVL+ RM +G+K E+SPET+KRI+RVK VT MTEKVA GVLSGV+ VSGFFTSSV NS 
Sbjct  291   NEVLKQRMATGTKAEISPETLKRIQRVKTVTKMTEKVALGVLSGVLSVSGFFTSSVVNSV  350

Query  467   VGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATS  288
              GKKF  +LPGEMVLATLDGF +ICDAVEVAGKNVMSTSSTVTT LVS KYG+EAAK  S
Sbjct  351   AGKKFFKMLPGEMVLATLDGFCKICDAVEVAGKNVMSTSSTVTTELVSQKYGEEAAKVAS  410

Query  287   EGLEAAGHAMATAWTVFKLRKALNP  213
             EGL+AAGHA+ TAWTVFK+RKALNP
Sbjct  411   EGLDAAGHAVGTAWTVFKIRKALNP  435



>ref|XP_006383080.1| hypothetical protein POPTR_0005s11370g [Populus trichocarpa]
 gb|ERP60877.1| hypothetical protein POPTR_0005s11370g [Populus trichocarpa]
Length=464

 Score =   497 bits (1279),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 274/448 (61%), Positives = 340/448 (76%), Gaps = 20/448 (4%)
 Frame = -1

Query  1529  MASQNRTR-SPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFP------EN  1374
             MASQN  + S +YP+++    +  F SSS S+N   +YP +D +D VENLFP        
Sbjct  1     MASQNPNQNSSLYPQIIQSKPDPLFTSSSPSSN---LYPKIDPEDLVENLFPGHDHSQHE  57

Query  1373  YETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
             Y   Q +    PSAPPE VEE L+ + GAI++LIDK YSVELA+GDL +V L QG++ VA
Sbjct  58    YPRAQSHTQAPPSAPPEVVEEVLIKIAGAIVNLIDKNYSVELASGDLYIVRLSQGNNVVA  117

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             V ARVADEIQWPL KD A+VKLD+SHYFFS RFPN +  SDSSDEE  K +K        
Sbjct  118   VLARVADEIQWPLAKDEAAVKLDDSHYFFSLRFPNENYSSDSSDEEDDKREKRVD-----  172

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPA  834
                G ++LNYGLTIASKGQ+ L+ + D IL + S FSV KV E A  ++GG  AK+ SP 
Sbjct  173   ---GENILNYGLTIASKGQERLLLEFDQILGSYSCFSVQKVSENAKELLGGNAAKDTSPM  229

Query  833   DLK-SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL  657
             D+K   +KKE++EG+CAAYWTTLAPNVEDYS +A +L+A+GSG+LIKGILWCGDVT+D L
Sbjct  230   DMKLGGEKKEIMEGKCAAYWTTLAPNVEDYSGTAGKLIAAGSGQLIKGILWCGDVTMDRL  289

Query  656   KSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVA  477
             K G+EV++ RM    K+E+SP T+KRI+R KR+T MTEKVA G+L GV+KVSGFFTSS+ 
Sbjct  290   KWGNEVMKKRMDPKEKSEISPATLKRIKRAKRMTKMTEKVANGLLCGVLKVSGFFTSSLV  349

Query  476   NSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAK  297
             NS VGKKF GLLPGE+VLA+LDGF+++CDA+EVAG+NVMSTSSTVTT LVSH+YG+EAAK
Sbjct  350   NSKVGKKFFGLLPGEIVLASLDGFNKVCDALEVAGRNVMSTSSTVTTELVSHRYGEEAAK  409

Query  296   ATSEGLEAAGHAMATAWTVFKLRKALNP  213
             AT+EGL A GHA+ TAW  FK+RKA NP
Sbjct  410   ATNEGLGATGHAIGTAWAAFKIRKAFNP  437



>gb|KDP46778.1| hypothetical protein JCGZ_06566 [Jatropha curcas]
Length=466

 Score =   496 bits (1277),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 272/448 (61%), Positives = 347/448 (77%), Gaps = 18/448 (4%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENP---FHSSSSSANRSPMYPVVDMKD-VENLFPENYET  1365
             MASQN   +  +YP+V+  + E+P   F + +S ++ S +YP +DM D VENLFPE  + 
Sbjct  1     MASQNPNPKKSLYPEVIQSNPESPSYVFSNPNSQSSSSNLYPTIDMNDLVENLFPEPVQ-  59

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
                +Y +SPSAPP AVEE L+ +PGAIL+LIDK YSVELA GDL +V LRQGD+ VA+ A
Sbjct  60    ---HYPYSPSAPPVAVEEVLIKIPGAILNLIDKNYSVELACGDLCIVRLRQGDNIVAILA  116

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
             RVADEIQWPL KD A+VKLD+SHYFFS RFP    +SDSS +E+ K  +  K  +     
Sbjct  117   RVADEIQWPLGKDEAAVKLDDSHYFFSLRFPKEHHESDSSSDEEEKKSRNKKVNDS----  172

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEE----TASVVMGGPVAKEVSP  837
              +++LNYGLTIASKGQ+ L+K+ D IL   SSF+V K+ E        ++      E SP
Sbjct  173   -SNLLNYGLTIASKGQEALLKEFDGILQAYSSFTVQKISEKTKANGDALLRELAVTENSP  231

Query  836   ADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL  657
             ADL++E++KE++EG+CAAYWTTLAPNVE+YSS+ AR++A+GSG L+KGIL CGDVT+D L
Sbjct  232   ADLRNEEQKEMMEGKCAAYWTTLAPNVEEYSSTTARVIAAGSGHLVKGILLCGDVTMDRL  291

Query  656   KSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVA  477
             K G+EV++ RM+  SK+E+SP+TM+RIRRVK++T MTEKVA GVLSGVVKVSG FT+ +A
Sbjct  292   KWGNEVMKRRMSPRSKSEISPDTMRRIRRVKKMTKMTEKVANGVLSGVVKVSGIFTTKLA  351

Query  476   NSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAK  297
             NS  GKKF GLLPGE+VLA+LDGF ++CDAVEVAGKNVM+TSSTVTT LV+H+YG++AA+
Sbjct  352   NSKAGKKFFGLLPGEIVLASLDGFGKVCDAVEVAGKNVMATSSTVTTELVNHRYGEQAAE  411

Query  296   ATSEGLEAAGHAMATAWTVFKLRKALNP  213
             AT+EGL AAGHA  TAW  FKLRKALNP
Sbjct  412   ATNEGLGAAGHAFGTAWAAFKLRKALNP  439



>ref|XP_011099870.1| PREDICTED: spartin-like isoform X2 [Sesamum indicum]
Length=466

 Score =   495 bits (1274),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 283/438 (65%), Positives = 343/438 (78%), Gaps = 5/438 (1%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDVENLFPE-NYETVQGYYHHS  1341
             N  R+PMYP+V+DP  E       SS++    YP +DMKD+ENLFPE N     G    S
Sbjct  8     NPKRTPMYPQVIDPIQETALPPHHSSSSSL--YPTIDMKDLENLFPEPNAGIGPGAQPCS  65

Query  1340  PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQW  1161
             PSAPP++VEE L+ + GAILHLIDK YSVELATGDL ++ L QGD+ VA  A V D++QW
Sbjct  66    PSAPPQSVEEALITIQGAILHLIDKHYSVELATGDLRILRLLQGDNTVAALAAVGDDVQW  125

Query  1160  PLTKDLASVKLDNSHYFFSFRFPNVdd--dsdssdeekskgkkegkhkekqkDMGNDVLN  987
             PLTKD+ +VKLD+SHYFFSF+ P   +  ++   D  K K K +GK   K +  G++VL+
Sbjct  126   PLTKDITAVKLDSSHYFFSFQPPRETEDLETSGDDGVKKKKKGKGKGDNKNEQEGDEVLS  185

Query  986   YGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKE  807
             YGLTI SKGQ+ L+K LD IL+  S+FSVHKVEE   V + G  A+E++  +LK EKKKE
Sbjct  186   YGLTIVSKGQEGLLKGLDQILEAYSNFSVHKVEEKEVVAVAGAAAREMTAGELKEEKKKE  245

Query  806   VLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR  627
              +EG+CAAYWTTLAPNVEDYS  AA+L+A+GSG+L+KGILWCGDVT+D LK GDEVL+ R
Sbjct  246   EVEGQCAAYWTTLAPNVEDYSGIAAKLIAAGSGQLVKGILWCGDVTMDRLKWGDEVLKKR  305

Query  626   MTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLG  447
             M  G +TE+ P T+KRI+RVK+VT MTEKVATGVLSGVVKVSGFF  SVANS+VGKKF  
Sbjct  306   MAPGEQTEIDPNTLKRIKRVKQVTKMTEKVATGVLSGVVKVSGFFAGSVANSTVGKKFFS  365

Query  446   LLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAG  267
             LLPGEMVLA+LDGFS+ICDAVEVAGKNVMSTSSTVTTGLVSH+YG+EAAKA SEG++AAG
Sbjct  366   LLPGEMVLASLDGFSKICDAVEVAGKNVMSTSSTVTTGLVSHRYGEEAAKAASEGMDAAG  425

Query  266   HAMATAWTVFKLRKALNP  213
             HA+ TAW VFK+RKA NP
Sbjct  426   HAIGTAWAVFKIRKAFNP  443



>ref|XP_007046657.1| Senescence/dehydration-associated protein-related isoform 3 [Theobroma 
cacao]
 gb|EOX90814.1| Senescence/dehydration-associated protein-related isoform 3 [Theobroma 
cacao]
Length=467

 Score =   493 bits (1269),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 274/450 (61%), Positives = 342/450 (76%), Gaps = 21/450 (5%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPE--NYETV  1362
             MASQN   +S +YP+V     + P +SSS++     +YP +DM+D VENLFP+  NY   
Sbjct  1     MASQNPNQKSSLYPEVTQSKPDIPQYSSSNN-----LYPSLDMRDLVENLFPDPPNYSVN  55

Query  1361  QGYYH----HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
             +   H    H+P+APP+AVEE L+ +PGAIL+LIDK YSVELA GD +++ L QG++ VA
Sbjct  56    RHSDHTDSPHAPTAPPQAVEEVLIKIPGAILNLIDKSYSVELACGDFTVIRLWQGENIVA  115

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             V  RVA+EIQWPL K+  +VKLD+SHYFFS +      D ++ ++       + K K K 
Sbjct  116   VLVRVAEEIQWPLMKNETAVKLDDSHYFFSLQL-----DKEAENDSSDSDDDDKKRKTKT  170

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVA--KEVS  840
                G+ +LNYGLT ASKGQ+ L+++LD IL + S F+V KVE+    V+ G VA  KE+S
Sbjct  171   SGEGSCLLNYGLTFASKGQEYLLRELDVILQSYSCFTVQKVEKKGEEVLDGAVAAAKEMS  230

Query  839   PADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDS  660
             PADLKSE KKEV+E +CAAYWTTLAPNVEDYS  AA+++A+GSG LIKGILWCGDVT+D 
Sbjct  231   PADLKSETKKEVMEEKCAAYWTTLAPNVEDYSGRAAKVIAAGSGHLIKGILWCGDVTMDR  290

Query  659   LKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSS  483
             L  G+EVL+ RM+   K  E+SPET+KRI+RVKRVT MT+K A GVLSGVVKVSGF TSS
Sbjct  291   LNKGNEVLKKRMSPAEKNAEISPETLKRIKRVKRVTKMTQKAANGVLSGVVKVSGFVTSS  350

Query  482   VANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEA  303
             VANS VGKKF  LLPGE+VLA+LDGF+RICDAVEVAGKNVMSTSSTVTT LV+HKYG++A
Sbjct  351   VANSKVGKKFFSLLPGEIVLASLDGFNRICDAVEVAGKNVMSTSSTVTTELVNHKYGEKA  410

Query  302   AKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             A+AT+EGL AAGHA+ TAW  FKLR+ALNP
Sbjct  411   AEATNEGLGAAGHAVGTAWAAFKLRRALNP  440



>ref|XP_011099868.1| PREDICTED: uncharacterized protein LOC105178169 isoform X1 [Sesamum 
indicum]
Length=501

 Score =   494 bits (1272),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 283/438 (65%), Positives = 343/438 (78%), Gaps = 5/438 (1%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDVENLFPE-NYETVQGYYHHS  1341
             N  R+PMYP+V+DP  E       SS++    YP +DMKD+ENLFPE N     G    S
Sbjct  8     NPKRTPMYPQVIDPIQETALPPHHSSSSSL--YPTIDMKDLENLFPEPNAGIGPGAQPCS  65

Query  1340  PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQW  1161
             PSAPP++VEE L+ + GAILHLIDK YSVELATGDL ++ L QGD+ VA  A V D++QW
Sbjct  66    PSAPPQSVEEALITIQGAILHLIDKHYSVELATGDLRILRLLQGDNTVAALAAVGDDVQW  125

Query  1160  PLTKDLASVKLDNSHYFFSFRFPNVdd--dsdssdeekskgkkegkhkekqkDMGNDVLN  987
             PLTKD+ +VKLD+SHYFFSF+ P   +  ++   D  K K K +GK   K +  G++VL+
Sbjct  126   PLTKDITAVKLDSSHYFFSFQPPRETEDLETSGDDGVKKKKKGKGKGDNKNEQEGDEVLS  185

Query  986   YGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKE  807
             YGLTI SKGQ+ L+K LD IL+  S+FSVHKVEE   V + G  A+E++  +LK EKKKE
Sbjct  186   YGLTIVSKGQEGLLKGLDQILEAYSNFSVHKVEEKEVVAVAGAAAREMTAGELKEEKKKE  245

Query  806   VLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR  627
              +EG+CAAYWTTLAPNVEDYS  AA+L+A+GSG+L+KGILWCGDVT+D LK GDEVL+ R
Sbjct  246   EVEGQCAAYWTTLAPNVEDYSGIAAKLIAAGSGQLVKGILWCGDVTMDRLKWGDEVLKKR  305

Query  626   MTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLG  447
             M  G +TE+ P T+KRI+RVK+VT MTEKVATGVLSGVVKVSGFF  SVANS+VGKKF  
Sbjct  306   MAPGEQTEIDPNTLKRIKRVKQVTKMTEKVATGVLSGVVKVSGFFAGSVANSTVGKKFFS  365

Query  446   LLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAG  267
             LLPGEMVLA+LDGFS+ICDAVEVAGKNVMSTSSTVTTGLVSH+YG+EAAKA SEG++AAG
Sbjct  366   LLPGEMVLASLDGFSKICDAVEVAGKNVMSTSSTVTTGLVSHRYGEEAAKAASEGMDAAG  425

Query  266   HAMATAWTVFKLRKALNP  213
             HA+ TAW VFK+RKA NP
Sbjct  426   HAIGTAWAVFKIRKAFNP  443



>ref|XP_011043170.1| PREDICTED: uncharacterized protein LOC105138699 [Populus euphratica]
Length=466

 Score =   491 bits (1264),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 274/450 (61%), Positives = 341/450 (76%), Gaps = 22/450 (5%)
 Frame = -1

Query  1529  MASQNRTR-SPMYPKVVD--PDFENPFHSSSSSANRSPMYPVVDMKD-VENLFP------  1380
             MASQN  + S +YP+++   PD   P  +SSS +  S +YP +D +D VENLFP      
Sbjct  1     MASQNPNQNSSLYPQIIQSKPD---PLFTSSSPSPSSNLYPKIDPEDLVENLFPVHDHSQ  57

Query  1379  ENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSN  1200
               Y   Q +    PSAPPE VEE L+ + GA+++LIDK YSVELA+GDL +V L QG++ 
Sbjct  58    HEYPRAQSHAQAPPSAPPEVVEEVLIKIAGAVVNLIDKNYSVELASGDLHIVRLSQGNNA  117

Query  1199  VAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhke  1020
             VAV ARVADEIQWPL KD A+VKLD+SHYFFS RFPN +  SDSSDEE  K +K      
Sbjct  118   VAVLARVADEIQWPLAKDEAAVKLDDSHYFFSLRFPNENYSSDSSDEEDDKREKRVD---  174

Query  1019  kqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVS  840
                  G ++LNYGLTIASKGQ+ L+ + D IL + S FSV KV E A  ++GG VAK+ S
Sbjct  175   -----GENILNYGLTIASKGQERLLLEFDQILGSYSCFSVQKVSENAKELLGGNVAKDTS  229

Query  839   PADLK-SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVD  663
             P D+K   +KKE++EG+CAAYWTTLAPNVEDYS +A +L+A+GSG+LIKGILWCGDVT+D
Sbjct  230   PMDMKLGGEKKEIMEGKCAAYWTTLAPNVEDYSGTAGKLIAAGSGQLIKGILWCGDVTMD  289

Query  662   SLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSS  483
              LK G+EV++ RM    K+E+SP T+KRI+R KR+T MTEKVA G+L GV+KVSGFFTSS
Sbjct  290   RLKWGNEVMKKRMDPKEKSEISPATLKRIKRAKRMTKMTEKVANGLLCGVLKVSGFFTSS  349

Query  482   VANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEA  303
             + NS VGKKF GLLPGE+VLA+ DGF+++CDA+EVAG+NVMSTSSTVTT LVSH+YG+EA
Sbjct  350   LVNSKVGKKFFGLLPGEIVLASFDGFNKVCDALEVAGRNVMSTSSTVTTELVSHRYGEEA  409

Query  302   AKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             AKAT+EGL A GHA+ TAW  FK+RKA NP
Sbjct  410   AKATNEGLGATGHAIGTAWAAFKIRKAFNP  439



>gb|AES95158.2| senescence/dehydration-associated-like protein [Medicago truncatula]
Length=460

 Score =   489 bits (1260),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 340/447 (76%), Gaps = 26/447 (6%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVD--MKD-VENLFPENYETV  1362
             MA+QN   R+ +YP+V+      P    SS +N   +YP +D    D VENLFP+   T 
Sbjct  1     MATQNPNQRNSLYPQVIS---SIPTAPPSSQSN---LYPSIDHDFDDLVENLFPDTTTTA  54

Query  1361  QGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
                   SPSAPPE  E+ L+ +PGAIL+LID+QYSVELA+GD ++V LRQG++++AV+AR
Sbjct  55    G-VNTTSPSAPPETTEQILIKIPGAILNLIDQQYSVELASGDFTVVRLRQGENSIAVYAR  113

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             +ADEIQWPL KD  +VK+D+SHYFFSF  P                 ++   + K     
Sbjct  114   IADEIQWPLAKDETAVKVDDSHYFFSFSAPK-----------GYDSDEDEADRSKNSKTE  162

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV--VMGGPVAKEVSPADL  828
             +D+L+YGLTIASKGQ++L+K+LD IL+NCS+FSV KV E A    V+ G +AKEVSP DL
Sbjct  163   SDLLSYGLTIASKGQEHLLKELDVILENCSNFSVQKVSEKAKKGEVLDGNLAKEVSPKDL  222

Query  827   KS-EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
             +S +KKKE++EG+CAAYWTTLAPNVE+YS +AAR++ASGSG +IKGILWCGDVT+D L+ 
Sbjct  223   ESSKKKKEMMEGQCAAYWTTLAPNVEEYSGTAARMIASGSGHVIKGILWCGDVTMDRLQW  282

Query  650   GDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
             G++V++ RM +G +  ++SPET+KRIRRVKRVT MT+KVA G+LSGVVKVSGFFTSSV N
Sbjct  283   GNQVMKKRMAAGERDAQISPETLKRIRRVKRVTKMTQKVANGLLSGVVKVSGFFTSSVVN  342

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GKKF  LLPGE+VLA+LDGFS++ DAVE+AGKNVMSTSSTVTT LV H+YG+EAA A
Sbjct  343   SKAGKKFFSLLPGEIVLASLDGFSKVFDAVEIAGKNVMSTSSTVTTELVDHRYGEEAAHA  402

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T+EGL AAGHA+ TAW  FK+RKA+NP
Sbjct  403   TNEGLNAAGHALGTAWAAFKIRKAINP  429



>gb|EYU30804.1| hypothetical protein MIMGU_mgv1a005840mg [Erythranthe guttata]
Length=468

 Score =   489 bits (1260),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 282/450 (63%), Positives = 349/450 (78%), Gaps = 16/450 (4%)
 Frame = -1

Query  1529  MASQ--NRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQ  1359
             MASQ  N  R+PMYP++++ + +        S++ S +YP +DM D+ ENLFP++ +  Q
Sbjct  1     MASQDPNPNRTPMYPQIIESN-QPSAPPLPQSSSSSSLYPKIDMDDLLENLFPDSNDGAQ  59

Query  1358  GYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARV  1179
              Y+   PSAPPE+VEE+LL VPG ILHLIDK YSVELATGDL ++ LRQGD+ VA+ A V
Sbjct  60    PYH---PSAPPESVEESLLTVPGTILHLIDKHYSVELATGDLRILRLRQGDNTVAILAAV  116

Query  1178  ADEIQWPLTKDLASVKLDNSHYFFSFRFP-------NVdddsdssdeekskgkkegkhke  1020
             AD+IQWPLTKDLA+VKLD+SHYFFSF  P       + D+D +S  ++  K K + K K 
Sbjct  117   ADDIQWPLTKDLAAVKLDSSHYFFSFSAPIENEDSDSSDEDRESKKKKNKKKKDKNKTKN  176

Query  1019  kqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVS  840
             K+     +VL+YGLTI SKG +    +LD IL+N S+FSV KV+E     + G  A E+S
Sbjct  177   KKNKEETEVLSYGLTILSKGNEGSPNELDKILENYSNFSVQKVDEKTVGEVAGAEA-EIS  235

Query  839   PADLKS-EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVD  663
               +L++ EKKK  +EG+CAAYWTTLAPNVE+YS +AARL+A+GSG+L+KGILWCGDVT+D
Sbjct  236   VRELETDEKKKAEVEGQCAAYWTTLAPNVEEYSGTAARLIAAGSGQLVKGILWCGDVTMD  295

Query  662   SLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSS  483
              LK G+EV++ RM  G   EV PE +KRI+RVKRVT MTEKVA GVLSGVVKVSG+FT S
Sbjct  296   RLKWGNEVMKKRMAPGVNAEVDPEILKRIKRVKRVTKMTEKVAIGVLSGVVKVSGYFTGS  355

Query  482   VANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEA  303
             VANS VGKKF GLLPGE+ LA+LDGFSRICDAVE+AGKNVMSTSSTVTTGLVSH+YG+EA
Sbjct  356   VANSKVGKKFFGLLPGEIALASLDGFSRICDAVEIAGKNVMSTSSTVTTGLVSHRYGEEA  415

Query  302   AKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             AKATSEGL+AAGHA+ TAWTVFK+RKA NP
Sbjct  416   AKATSEGLDAAGHAVGTAWTVFKIRKAFNP  445



>ref|XP_003629282.1| ERD7 protein [Medicago truncatula]
 gb|AET03758.1| senescence/dehydration-associated-like protein [Medicago truncatula]
Length=477

 Score =   486 bits (1251),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 262/459 (57%), Positives = 346/459 (75%), Gaps = 20/459 (4%)
 Frame = -1

Query  1556  FQSPKIFSPMASQN-RTRSPMYPKVVD--PDFENPFHSSSSSANRSPMYPVVDMKD-VEN  1389
              Q  K  S M SQN   ++ +YP+++D  P+  +PF S+ ++   S +YP +++ D VE+
Sbjct  1     MQEEKEHSSMDSQNPNNKNSLYPQIIDSNPEASSPFISNPNTTTSSSLYPSIEVSDLVED  60

Query  1388  LFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQG  1209
             LF EN          +PSAP  A E+ L+ +PGAILHLID+QYS ELA  DL+++ LRQG
Sbjct  61    LFHENT---------APSAPQIAAEDILIKIPGAILHLIDQQYSFELAISDLTIIRLRQG  111

Query  1208  DSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegk  1029
             ++ VAV+ARV +EIQWPL KD A+VK+D SHYFF FR P   +DSDS   ++ K K +  
Sbjct  112   NNTVAVYARVGNEIQWPLAKDEAAVKVDESHYFFCFRVPKEKNDSDSDSSDEEKEKSKLS  171

Query  1028  hkekqkDM---GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VM  867
              + K +      +D+L+YGLTIASKGQ++L+K+LD +L  CS+FSV +V E A      +
Sbjct  172   FRRKGRRKEEDNSDLLSYGLTIASKGQEDLVKELDEVLKECSNFSVQEVSEKAKKKGEAL  231

Query  866   GGPVAKEVSPADLKSEK-KKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGI  690
              G +A E+SPADL + K KKE++E RCAAYWTTLAPNVEDYS +AA+L+A+GSG+L+KGI
Sbjct  232   DGSLAMEISPADLDNVKEKKELMEERCAAYWTTLAPNVEDYSGTAAKLIAAGSGQLVKGI  291

Query  689   LWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVV  510
             LWCGDVTVD LK G+E+++ +M   ++ E++P+T+KRI+R K+VT MTE VA GVL+GVV
Sbjct  292   LWCGDVTVDRLKWGNEIMKKKMGPPTQAEINPQTLKRIQRAKKVTKMTESVAKGVLTGVV  351

Query  509   KVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttgl  330
             KVSGFFTSSVANS  GKKF   LPGE+VLA+LDGFS++CDAVEVAGKNVMSTS+TVTT +
Sbjct  352   KVSGFFTSSVANSKAGKKFFKFLPGEVVLASLDGFSKLCDAVEVAGKNVMSTSNTVTTEI  411

Query  329   vSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             V H+YG+EAA ATSEGL+AAGHA+ TAW  FK+R+ALNP
Sbjct  412   VHHRYGEEAANATSEGLDAAGHAVGTAWAAFKIRQALNP  450



>ref|XP_004509373.1| PREDICTED: uncharacterized protein LOC101497465 [Cicer arietinum]
Length=467

 Score =   483 bits (1243),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 267/447 (60%), Positives = 344/447 (77%), Gaps = 24/447 (5%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVD--PDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYETV  1362
             MASQN   R+ +YP+++D  P++ NP  +SSS      +YP +D+ + VENLFPEN    
Sbjct  10    MASQNPNRRNSLYPEIIDSNPEYSNPNPTSSS------LYPSIDVSELVENLFPENT---  60

Query  1361  QGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
                   +PSAPP A E+ L+ VPGAILHLID+QYS ELA GDL+++ L QG++ VA++A 
Sbjct  61    ------NPSAPPIAAEDVLIKVPGAILHLIDQQYSFELAIGDLTIIRLMQGENTVAIYAC  114

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             VADEIQWPL KD A+VK+D SHYFF FR P   DDSDSSDEE+       K + K  D G
Sbjct  115   VADEIQWPLAKDEAAVKVDESHYFFCFRAPKEKDDSDSSDEEEGGKHSRRKGRRKGDD-G  173

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEVSPAD  831
             +D+L+YGLTIASKGQ+ L+K+LD +L  CS+FSV +V E A      + G +A E+SPAD
Sbjct  174   SDLLSYGLTIASKGQEGLLKELDEVLKECSNFSVQEVSENAKKKGEALDGSLAMEISPAD  233

Query  830   LKSEK-KKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLK  654
             L + K KKE++E  CAAYWTTLAPNVEDY+ +AA+L+A+GSG+L+KGILWCGDVTV+ LK
Sbjct  234   LNTMKEKKELMEEMCAAYWTTLAPNVEDYNGTAAKLIAAGSGQLVKGILWCGDVTVERLK  293

Query  653   SGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
              G+E ++ RM   ++ E+SP+T++RI+R K+VT MTE VA GVL+GVVKVSGFFTSSVAN
Sbjct  294   WGNEFMKKRMGPPTQAEISPQTLRRIKRAKKVTKMTESVANGVLTGVVKVSGFFTSSVAN  353

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GKK   LLPGE+VLA+LDGFS++CDAVEV+G+NVMSTS+TVTT +V ++YG+EAAKA
Sbjct  354   SKAGKKIFSLLPGEVVLASLDGFSKLCDAVEVSGRNVMSTSNTVTTEIVHYRYGEEAAKA  413

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             TSEGL+AAGHA+ TAW  FK+R+A NP
Sbjct  414   TSEGLDAAGHAVGTAWAAFKIRQAFNP  440



>ref|XP_006425429.1| hypothetical protein CICLE_v10025594mg [Citrus clementina]
 gb|ESR38669.1| hypothetical protein CICLE_v10025594mg [Citrus clementina]
Length=449

 Score =   482 bits (1241),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 267/447 (60%), Positives = 331/447 (74%), Gaps = 37/447 (8%)
 Frame = -1

Query  1532  PMASQNRTRSPMYPKVVDPDFENPFH------SSSSSANRSPMYPVVDMKDV-ENLFPEN  1374
             P+ + N T   +YP+V+D + E P +       SSS +  S +YP +DM+D+ ENLFPE 
Sbjct  6     PIPNPNHTS--LYPQVIDSNPEAPINYKSQSPPSSSQSPPSNLYPSLDMRDLTENLFPET  63

Query  1373  YETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
               T     +  PSAPP+A EETL+ VPGAILHLIDK YSVELA  D  ++ L Q  + VA
Sbjct  64    AAT----GNTKPSAPPQADEETLIKVPGAILHLIDKSYSVELACSDFKIIRLIQDGNVVA  119

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             V A V DEIQWPLTKD+A+VKLD+SHYFFS  FP                       +  
Sbjct  120   VLASVGDEIQWPLTKDIAAVKLDDSHYFFSLSFP----------------------PQPG  157

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPA  834
              +  +D+LNYGLTIASKGQ+ L+++LD IL   S FSV KV E    +  G +AKEV+P 
Sbjct  158   SNSDSDLLNYGLTIASKGQEKLLQELDGILQQYSCFSVQKVSEKVKEI-DGEIAKEVTPL  216

Query  833   DLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLK  654
             ++ + KK+EV+E + AAYWTTLAPNVEDYS +AA+L+A+GSG+LI+GILWCG+VTVD LK
Sbjct  217   EM-TGKKREVMEEKSAAYWTTLAPNVEDYSGTAAKLIAAGSGQLIRGILWCGEVTVDRLK  275

Query  653   SGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
              G++VL+ RM  G  +EVSP+T+KRI+R KRVT MTEKVATGVLSGVVKVSGFFTSSVAN
Sbjct  276   WGNKVLKKRMIPGETSEVSPQTLKRIKRAKRVTKMTEKVATGVLSGVVKVSGFFTSSVAN  335

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             +  GKKF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMSTSSTVTT LVSHKYG++AA+A
Sbjct  336   TKAGKKFFNLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTSSTVTTQLVSHKYGEKAAEA  395

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             TSEGL+AAGHA+ TAW  FK+RKALNP
Sbjct  396   TSEGLDAAGHAIGTAWAAFKIRKALNP  422



>ref|XP_010113331.1| hypothetical protein L484_026662 [Morus notabilis]
 gb|EXC35338.1| hypothetical protein L484_026662 [Morus notabilis]
Length=474

 Score =   480 bits (1235),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 277/451 (61%), Positives = 350/451 (78%), Gaps = 17/451 (4%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVV--DPDFENPFHS---SSSSANRSPMYPVVDMKD-VENLFPENY  1371
             MASQN   R+ +YP+V+  +P+  +  H    +SSS   S +YP +DM + VENLFPE+ 
Sbjct  1     MASQNPGYRNSLYPEVIQSNPEASSLRHHQIPNSSSPATSNLYPSIDMNEFVENLFPES-  59

Query  1370  ETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAV  1191
              TV       PSAPPEA EE ++ +PGAILHLIDK YSV+LA+GD ++V LRQG++ VAV
Sbjct  60    STVSS----PPSAPPEATEEVVVRIPGAILHLIDKHYSVQLASGDFAVVRLRQGENVVAV  115

Query  1190  FARVADEIQWPLTKDLASVKLDNSHYFFSFRFP-NVdddsdssdeekskgkkegkhkekq  1014
              ARV DEIQWPL KD A+VKLD+SHYFF+ R P +   DSDSSDEE    +K  K     
Sbjct  116   LARVGDEIQWPLAKDEAAVKLDDSHYFFALRIPADHRLDSDSSDEESGGKRKGKKSDGDG  175

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEV  843
                 +D+LNYGLTIASKGQ+ L+++LD +L++ SSFSV +V E A     V+ G VA E+
Sbjct  176   GVRDDDLLNYGLTIASKGQEALVRELDAVLEHYSSFSVQRVSEEAKRAGEVVDGTVAMEM  235

Query  842   SPADL-KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTV  666
             SPADL   +KKKE++E R AAYWTTLAPNVE+YS +AA+++A+GSG+LI+GILWCGDVTV
Sbjct  236   SPADLKTKKKKKELIEERSAAYWTTLAPNVEEYSGTAAKMIAAGSGQLIRGILWCGDVTV  295

Query  665   DSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTS  486
             + LK G+EV++ RM+S    E+SP+T++RI+RVKRV+ MTEKVA GVLSGVVKVSGFFTS
Sbjct  296   ERLKWGNEVMKTRMSSRPDKEISPQTLRRIKRVKRVSKMTEKVANGVLSGVVKVSGFFTS  355

Query  485   SVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDE  306
             SV NS VGKKF  LLPGE+VLA+LDGF+++CDAVEV+GKNVMSTSS+VTT LVSH+YG++
Sbjct  356   SVVNSKVGKKFFSLLPGEIVLASLDGFNKVCDAVEVSGKNVMSTSSSVTTELVSHRYGEQ  415

Query  305   AAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             A KAT+EGL AAGHA+ TAW  FK+RKALNP
Sbjct  416   AGKATNEGLSAAGHAIGTAWAAFKIRKALNP  446



>ref|XP_003612200.1| ERD7 protein [Medicago truncatula]
Length=477

 Score =   478 bits (1229),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 268/464 (58%), Positives = 341/464 (73%), Gaps = 43/464 (9%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVD--MKD-VENLFPENYETV  1362
             MA+QN   R+ +YP+V+      P    SS +N   +YP +D    D VENLFP+   T 
Sbjct  1     MATQNPNQRNSLYPQVIS---SIPTAPPSSQSN---LYPSIDHDFDDLVENLFPDTTTTA  54

Query  1361  QGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
                   SPSAPPE  E+ L+ +PGAIL+LID+QYSVELA+GD ++V LRQG++++AV+AR
Sbjct  55    G-VNTTSPSAPPETTEQILIKIPGAILNLIDQQYSVELASGDFTVVRLRQGENSIAVYAR  113

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             +ADEIQWPL KD  +VK+D+SHYFFSF  P   D  +   +     K E           
Sbjct  114   IADEIQWPLAKDETAVKVDDSHYFFSFSAPKGYDSDEDEADRSKNSKTE-----------  162

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV--VMGGPVAKEVSPADL  828
             +D+L+YGLTIASKGQ++L+K+LD IL+NCS+FSV KV E A    V+ G +AKEVSP DL
Sbjct  163   SDLLSYGLTIASKGQEHLLKELDVILENCSNFSVQKVSEKAKKGEVLDGNLAKEVSPKDL  222

Query  827   KS-EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
             +S +KKKE++EG+CAAYWTTLAPNVE+YS +AAR++ASGSG +IKGILWCGDVT+D L+ 
Sbjct  223   ESSKKKKEMMEGQCAAYWTTLAPNVEEYSGTAARMIASGSGHVIKGILWCGDVTMDRLQW  282

Query  650   GDEVLRNRMTSGSK-TEVSPETMKRIRR-----------------VKRVTSMTEKVATGV  525
             G++V++ RM +G +  ++SPET+KRIRR                 VKRVT MT+KVA G+
Sbjct  283   GNQVMKKRMAAGERDAQISPETLKRIRRKGPGKGKDPGNPKFGEGVKRVTKMTQKVANGL  342

Query  524   LSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsst  345
             LSGVVKVSGFFTSSV NS  GKKF  LLPGE+VLA+LDGFS++ DAVE+AGKNVMSTSST
Sbjct  343   LSGVVKVSGFFTSSVVNSKAGKKFFSLLPGEIVLASLDGFSKVFDAVEIAGKNVMSTSST  402

Query  344   vttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             VTT LV H+YG+EAA AT+EGL AAGHA+ TAW  FK+RKA+NP
Sbjct  403   VTTELVDHRYGEEAAHATNEGLNAAGHALGTAWAAFKIRKAINP  446



>ref|XP_006466976.1| PREDICTED: uncharacterized protein LOC102627700 isoform X1 [Citrus 
sinensis]
Length=449

 Score =   476 bits (1226),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 329/447 (74%), Gaps = 37/447 (8%)
 Frame = -1

Query  1532  PMASQNRTRSPMYPKVVDPDFENPFH------SSSSSANRSPMYPVVDMKDV-ENLFPEN  1374
             P+ + N T   +YP+V+D + E P +       SSS +  S +YP +DM+D+ ENLFPE 
Sbjct  6     PIPNPNHTS--LYPQVIDSNPEAPINYKSQSPPSSSQSPPSNLYPSLDMRDLTENLFPET  63

Query  1373  YETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
               T     +  PSAPP+A EETL+ VPGAILHLID+ YSVELA  D  ++ L Q  + VA
Sbjct  64    AAT----GNTEPSAPPQADEETLIKVPGAILHLIDQSYSVELACSDFKIIRLIQDGNVVA  119

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             V A V DE+QWPLTKD+A+VKLD+SHYFFS  FP                       +  
Sbjct  120   VLASVGDEVQWPLTKDIAAVKLDDSHYFFSLSFP----------------------PQPG  157

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPA  834
              +  +D+LNYGLTIASKGQ+ L+++LD IL   S FSV KV E       G +AKEV+P 
Sbjct  158   SNSDSDLLNYGLTIASKGQEKLLQELDGILQQYSCFSVQKVSEKVKE-FDGEIAKEVTPL  216

Query  833   DLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLK  654
             ++ + KK+EV+E + AAYWTTLAPNVEDYS +AA+L+A+GSG+LI+GILWCG+VTVD LK
Sbjct  217   EM-TGKKREVMEEKSAAYWTTLAPNVEDYSGTAAKLIAAGSGQLIRGILWCGEVTVDRLK  275

Query  653   SGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
              G++VL+ RM  G  +EVSP T+KRI+R KRVT MTEKVATGVLSGVVKVSGFFTSSVAN
Sbjct  276   WGNKVLKKRMIPGETSEVSPRTLKRIKRAKRVTKMTEKVATGVLSGVVKVSGFFTSSVAN  335

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             +  GKKF  LLPGE+VLA+LDGF+++CDAVEV+GKNVMSTSSTVTT LVSHKYG++AA+A
Sbjct  336   TKAGKKFFNLLPGEIVLASLDGFNKVCDAVEVSGKNVMSTSSTVTTQLVSHKYGEKAAEA  395

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             TSEGL+AAGHA+ TAW  FK+RKALNP
Sbjct  396   TSEGLDAAGHAIGTAWAAFKIRKALNP  422



>gb|KEH27594.1| senescence/dehydration-associated-like protein [Medicago truncatula]
Length=454

 Score =   476 bits (1224),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 262/447 (59%), Positives = 335/447 (75%), Gaps = 32/447 (7%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVD--MKD-VENLFPENYETV  1362
             MA+QN   R+ +YP+V+      P    SS +N   +YP +D    D VENLFP+   T 
Sbjct  1     MATQNPNQRNSLYPQVIS---SIPTAPPSSQSN---LYPSIDHDFDDLVENLFPDTTTTA  54

Query  1361  QGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
                   SPSAPPE  E+ L+ +PGAIL+LID+QYSVELA+GD ++V LRQG++++AV+AR
Sbjct  55    G-VNTTSPSAPPETTEQILIKIPGAILNLIDQQYSVELASGDFTVVRLRQGENSIAVYAR  113

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             +ADEIQWPL KD  +VK+D+SHYFFSF  P                 ++   + K     
Sbjct  114   IADEIQWPLAKDETAVKVDDSHYFFSFSAPK-----------GYDSDEDEADRSKNSKTE  162

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV--VMGGPVAKEVSPADL  828
             +D+L+YGLTIASKGQ++L+K+LD IL+NCS+FSV KV E A    V+ G +AKEVSP DL
Sbjct  163   SDLLSYGLTIASKGQEHLLKELDVILENCSNFSVQKVSEKAKKGEVLDGNLAKEVSPKDL  222

Query  827   KS-EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
             +S +KKKE++EG+CAAYWTTLAPNVE+YS +AAR++ASGSG +IKGILWCGDVT+D L+ 
Sbjct  223   ESSKKKKEMMEGQCAAYWTTLAPNVEEYSGTAARMIASGSGHVIKGILWCGDVTMDRLQW  282

Query  650   GDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
             G++V++ RM +G +  ++SPET+KRIRRVKRVT MT+KVA G+LSGVVKVSGFFTSSV N
Sbjct  283   GNQVMKKRMAAGERDAQISPETLKRIRRVKRVTKMTQKVANGLLSGVVKVSGFFTSSVVN  342

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GKKF  LLPGE+VLA+LDGF      +E+AGKNVMSTSSTVTT LV H+YG+EAA A
Sbjct  343   SKAGKKFFSLLPGEIVLASLDGF------IEIAGKNVMSTSSTVTTELVDHRYGEEAAHA  396

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T+EGL AAGHA+ TAW  FK+RKA+NP
Sbjct  397   TNEGLNAAGHALGTAWAAFKIRKAINP  423



>ref|XP_008448535.1| PREDICTED: uncharacterized protein LOC103490684 [Cucumis melo]
Length=468

 Score =   473 bits (1218),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 276/454 (61%), Positives = 348/454 (77%), Gaps = 28/454 (6%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVDPDFENPFHSSSSSANRSP-----MYPVVDMKD-VENLFPENYE  1368
             M SQN  R+ +YP+V+     NP   SSS AN +P     +YP +DMKD VENLFP++  
Sbjct  1     MDSQNPYRNSLYPQVI---HSNPDEPSSSFANPNPSSTSNLYPTLDMKDMVENLFPDHV-  56

Query  1367  TVQGYYHHSPSAPPEAV-------EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQG  1209
                GY H   +  P +        EE L+ +PGAIL+LIDK+YSVELA GDL++V +RQG
Sbjct  57    ---GYLHPPSAPAPPSASAPPLAAEEVLIRIPGAILNLIDKEYSVELACGDLTIVHIRQG  113

Query  1208  DSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegk  1029
             +S VAVFARVAD+IQWPL KD+A+VKLD SHYFFSFR P   D    S +E+ K K++ K
Sbjct  114   ESVVAVFARVADDIQWPLAKDIAAVKLDGSHYFFSFRAPKERDSDSDSSDEEDKKKEKKK  173

Query  1028  hkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVV--MGGPV  855
             ++       +D L+YGLTI SKGQ+ L+K+LD IL N SSF++ KV E+A  V  +   +
Sbjct  174   NRS------DDYLSYGLTIVSKGQEGLLKELDGILQNYSSFTLQKVSESAKKVEVLDESL  227

Query  854   AKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGD  675
             AKE+SPADLK+EKKKE +EG+CAAYWTTLAPNVEDY+  AA+L+A+GSG+L+KGILWCGD
Sbjct  228   AKEMSPADLKTEKKKEEIEGKCAAYWTTLAPNVEDYNGLAAKLIAAGSGQLVKGILWCGD  287

Query  674   VTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGF  495
             VTV+ LK G+E ++ R+   S TE+SPET+KRI+RVKRVT M+EKVA GVLSGVVKVSG+
Sbjct  288   VTVERLKQGNEAMQKRLDPCSNTEISPETLKRIKRVKRVTRMSEKVANGVLSGVVKVSGY  347

Query  494   FTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKY  315
             FTSSVANS VGKKF G+LPGE+VLA+LDGF ++ DAVEVAGKNVM+TSSTVTT LV+ +Y
Sbjct  348   FTSSVANSKVGKKFFGMLPGEIVLASLDGFGKVFDAVEVAGKNVMATSSTVTTELVTKRY  407

Query  314   GDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             G++AA AT+EGL+AAGHA+ TAW   K+RKALNP
Sbjct  408   GEQAANATNEGLDAAGHAVGTAWAALKIRKALNP  441



>ref|XP_003519861.2| PREDICTED: uncharacterized protein LOC100777392 [Glycine max]
Length=502

 Score =   474 bits (1219),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 276/453 (61%), Positives = 350/453 (77%), Gaps = 23/453 (5%)
 Frame = -1

Query  1544  KIFSPMASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVD-MKD-VENLFPEN  1374
             K+ S MAS+N   R+ +YP+V++ + E     + SS + S +YP +D + D VENLFP+N
Sbjct  37    KLHSSMASENPNQRNSLYPQVIESEPE-----ACSSNHSSSLYPKIDEVGDLVENLFPDN  91

Query  1373  YETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
                       SPSAPP A EE L+ VPGAILHLIDK  SVELA G+L+++ LRQG S VA
Sbjct  92    T---------SPSAPPVAAEEVLIKVPGAILHLIDKDCSVELACGNLTIICLRQGQSLVA  142

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             V+ARV DEIQWPL KD A+VK+D+SHYFFS R P  + DS SSDEE  K K + K K+K 
Sbjct  143   VYARVGDEIQWPLAKDEAAVKVDDSHYFFSLRVPKEESDSSSSDEEGEKAKHQNKKKKKN  202

Query  1013  kDMGND---VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVA  852
             K   +    VL+YGLTIASKGQ++L+K+LD +L  CS+FSV KV E A      +   + 
Sbjct  203   KKNKDSSASVLSYGLTIASKGQEDLLKELDKVLQECSAFSVQKVSEKAKKEGEALDASLE  262

Query  851   KEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDV  672
               +SPADL++E+KKE++E +CAAYWTTLAPNVEDYS +AA+L+A+GSG+L+KGILWCGDV
Sbjct  263   LTISPADLETEEKKEMMEEKCAAYWTTLAPNVEDYSGTAAKLIAAGSGQLVKGILWCGDV  322

Query  671   TVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFF  492
             TV+ L+ G+EV++ RM  GS+ E+SPET+KRI+RVK+VT MTE VA GVL+GVVKVSGFF
Sbjct  323   TVERLRWGNEVMKRRMAPGSQGEISPETLKRIKRVKKVTKMTESVANGVLTGVVKVSGFF  382

Query  491   TSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYG  312
             TSS+ANS  GKK   LLPGE+VLA+LDGFS++CDAVEVAGK+VMSTS+TVTT LV+H+YG
Sbjct  383   TSSMANSKAGKKIFSLLPGEVVLASLDGFSKVCDAVEVAGKSVMSTSNTVTTELVNHRYG  442

Query  311   DEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             +EAAKATSEGL+AAGHA+ TAW  FK+R+ LNP
Sbjct  443   EEAAKATSEGLDAAGHAVGTAWAAFKIRQVLNP  475



>ref|XP_010526803.1| PREDICTED: uncharacterized protein LOC104804269 [Tarenaya hassleriana]
Length=471

 Score =   471 bits (1211),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 263/445 (59%), Positives = 333/445 (75%), Gaps = 21/445 (5%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENP----FHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGY  1353
              + RS +YP+V   DF NP      S+  S++ S +YP +DM D V NLFP+  E V+  
Sbjct  9     QKQRSSLYPEV---DFSNPEPQMRPSNPISSSSSNLYPSLDMHDLVGNLFPDPLE-VKPI  64

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
              +++ SAPP A+EE +L +PGAILHLID+ YSVELA GDL+++ L QG++ +AV AR+AD
Sbjct  65    RYYAASAPPPAMEEVILRIPGAILHLIDQSYSVELACGDLTVLRLIQGENVIAVLARIAD  124

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             EIQWPL KD ASVK+D+SHYFFS R       +  S  + S  +   K+ + + +  N +
Sbjct  125   EIQWPLAKDEASVKVDDSHYFFSLRL------AKESGSDSSDDEGPSKNSKSKSEEDNGM  178

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADLK  825
             LNYGLTIASKGQ+ L++ LD +L + S F+V +V E A      V+   VAKE SPA+LK
Sbjct  179   LNYGLTIASKGQELLLEQLDRVLSDYSCFTVQQVSEKAKEKGEKVLDATVAKETSPAELK  238

Query  824   SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD  645
              +KK E++E +CAAYWTTLAPNVEDYS   A+L+ASGSG+LIKGILWCGDVT+D LK G+
Sbjct  239   GDKK-EMVEKQCAAYWTTLAPNVEDYSGKTAKLIASGSGQLIKGILWCGDVTMDRLKWGN  297

Query  644   EVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
             E ++ RMT   K  E+SPET+KRI+RVKR+T MTEKVA GVLSGV+KVSGF TSSVAN+ 
Sbjct  298   EFMKRRMTKAEKEKEISPETLKRIKRVKRMTKMTEKVANGVLSGVIKVSGFLTSSVANTK  357

Query  467   VGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATS  288
             VGKKF   LPGE+VLATLDGF++ICDA EVAGKNVM+TSSTVTT LV H YG +AA+AT+
Sbjct  358   VGKKFFSALPGEIVLATLDGFNKICDAAEVAGKNVMATSSTVTTELVDHGYGTKAAEATN  417

Query  287   EGLEAAGHAMATAWTVFKLRKALNP  213
             EGLEAAGHA+ TAW  FK+RKA+NP
Sbjct  418   EGLEAAGHAIGTAWAAFKIRKAINP  442



>ref|XP_004159722.1| PREDICTED: uncharacterized protein LOC101227043 [Cucumis sativus]
 gb|KGN55652.1| hypothetical protein Csa_3G002720 [Cucumis sativus]
Length=468

 Score =   469 bits (1208),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 274/456 (60%), Positives = 346/456 (76%), Gaps = 32/456 (7%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVV--DPD-----FENPFHSSSSSANRSPMYPVVDMKD-VENLFPEN  1374
             M SQN  R+ +YP+V+  +PD     F NP   S+S+     +YP +DMKD VENLFP++
Sbjct  1     MDSQNPYRNSLYPQVIHSNPDAPLSSFANPIPPSTSN-----LYPTLDMKDMVENLFPDD  55

Query  1373  YETVQGYYHHSPSAPPE-------AVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLR  1215
                  G+ H   +  P        AVEE L+ +PGAIL+LIDK+YSVELA GDL++V +R
Sbjct  56    V----GFLHPPSAPAPPSASAPPLAVEEVLIRIPGAILNLIDKEYSVELACGDLTIVHIR  111

Query  1214  QGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkke  1035
             QG+S VAVFARVAD+IQWPL KDLA+VKLD SHYFFSF+ P   D    S +++ K KK+
Sbjct  112   QGESVVAVFARVADDIQWPLAKDLAAVKLDGSHYFFSFQAPKERDSDSDSSDDEDKKKKK  171

Query  1034  gkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVV--MGG  861
              K            L+YGLTI SKGQ+ L+K+LD IL N SSF++ KV E+A  V  +  
Sbjct  172   KKSGSDDY------LSYGLTIVSKGQEGLLKELDGILQNYSSFTLQKVSESAKKVEVLDE  225

Query  860   PVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWC  681
              +AKE+SPADLK+EKKKE +EG+CAAYWTTLAPNVEDY+  AA+L+A+GSG+L+KG+LWC
Sbjct  226   SLAKEMSPADLKTEKKKEEMEGKCAAYWTTLAPNVEDYNGLAAKLIAAGSGQLVKGVLWC  285

Query  680   GDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVS  501
             GDVTV+ LK G+E ++ R+   S TE+SPET+KRIRRVKRVT M+EKVA GVLSGV+KVS
Sbjct  286   GDVTVERLKQGNEAMQKRLDPCSNTEISPETLKRIRRVKRVTKMSEKVANGVLSGVIKVS  345

Query  500   GFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSH  321
             G+FTSSVANS VGKKF G+LPGE+VLA+LDGF ++ DAVEVAGKNVM+TSSTVTT LV+ 
Sbjct  346   GYFTSSVANSKVGKKFFGMLPGEIVLASLDGFGKVFDAVEVAGKNVMATSSTVTTELVTK  405

Query  320   KYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             +YG++AA AT+EGL+AAGHA+ TAW   K+RKALNP
Sbjct  406   RYGEQAANATNEGLDAAGHAVGTAWAALKIRKALNP  441



>ref|XP_010548270.1| PREDICTED: uncharacterized protein LOC104819745 isoform X1 [Tarenaya 
hassleriana]
Length=466

 Score =   468 bits (1204),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 260/443 (59%), Positives = 332/443 (75%), Gaps = 20/443 (5%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENP--FHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGYYH  1347
              + RS +YP+V   DF NP    S+ + ++ S +YP +DM D V+NLFP+  E     +H
Sbjct  9     QKQRSSLYPEV---DFSNPEAPPSNPTPSSSSNLYPSLDMHDLVDNLFPDPPEDDPVRFH  65

Query  1346  HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEI  1167
              S  APP A EE +L +PGAILHLID+ YSV+LA GDL+++SL QG + +AV ARVADEI
Sbjct  66    AS--APPPATEEVILRIPGAILHLIDQSYSVQLACGDLTVLSLVQGGNVIAVLARVADEI  123

Query  1166  QWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLN  987
             QWPLTKD A+VK+D+SHYFFS R       +     + S  +   K+ + +    N +LN
Sbjct  124   QWPLTKDEAAVKVDDSHYFFSLR------PAKECGSDSSDDEAPSKNPKSKPAEENAMLN  177

Query  986   YGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV----VMGGPVAKEVSPADLKSE  819
             YGLTIASKGQ+ L++ LD IL + S F+V +V E A      V+   VAK+ SPA+LK E
Sbjct  178   YGLTIASKGQEPLLEQLDRILSDYSCFTVQQVSEKAKEKGVEVLDATVAKDTSPAELKGE  237

Query  818   KKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEV  639
             +K E++E +CAAYWTTLAPNVEDYS   A+L+A+GSG+LIKGILWCGDVT+D LK G+E 
Sbjct  238   RK-EMMEKQCAAYWTTLAPNVEDYSGKTAKLIAAGSGQLIKGILWCGDVTMDRLKWGNEF  296

Query  638   LRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
             ++ RMT G K  E+SP+T+KRI+RVKR+T MTE+VA GVLSGV+KVSGFFT+SVAN+  G
Sbjct  297   MKRRMTKGEKEKEISPDTLKRIKRVKRMTKMTERVANGVLSGVIKVSGFFTNSVANTKAG  356

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
             KKF  LLPGE+VLATLDGF++ICDAVEVAGKNVM+TSSTVTT LV H+YG +AA AT+EG
Sbjct  357   KKFFSLLPGEIVLATLDGFNKICDAVEVAGKNVMATSSTVTTELVDHRYGAKAAHATNEG  416

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
             L+AAGHA+ TAW  FK+RKA+NP
Sbjct  417   LDAAGHAIGTAWAAFKIRKAINP  439



>ref|XP_002278045.1| PREDICTED: uncharacterized protein LOC100267615 [Vitis vinifera]
Length=450

 Score =   464 bits (1193),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 261/443 (59%), Positives = 331/443 (75%), Gaps = 27/443 (6%)
 Frame = -1

Query  1523  SQNRTRSP--MYPKV--VDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQ  1359
             S N  R+P  +YP+V   +P+  +P  S+ +SA+ S +YP +++K++ ENLFP+  + V 
Sbjct  2     SSNPYRNPNSLYPEVDLSNPEATSPLISNPTSASSSSLYPSLEVKELAENLFPDENDAVL  61

Query  1358  GYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARV  1179
                  +PS+ P   EE L+ V GAI+HLIDKQ+SVELA+G L++V LRQG++ VAV AR+
Sbjct  62    ----QNPSSQP--FEEVLVRVSGAIVHLIDKQHSVELASGVLTIVRLRQGENVVAVLARI  115

Query  1178  ADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGN  999
              DEIQWPL KD A+VKLD SHYFFS R P     S SSD++                   
Sbjct  116   GDEIQWPLAKDEAAVKLDESHYFFSLRVPESGSGSASSDDDGES---------------E  160

Query  998   DVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV-VMGGPVAKEVSPADLKS  822
             ++LNYGLTIASKGQ+ L+K+LD +L+  S FSV KV+ T    V+ G VA+E SP DL S
Sbjct  161   NLLNYGLTIASKGQEGLLKELDAVLEKYSCFSVQKVKGTVGWEVLDGSVARETSPEDLGS  220

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
             +KKKE++E R  AYWTTLAPNVEDYS   AR++A+GSG+LIKGILW G+VTVD L  G+E
Sbjct  221   KKKKELMEERSGAYWTTLAPNVEDYSGCVARMIAAGSGQLIKGILWSGNVTVDGLNWGNE  280

Query  641   VLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
              L+ RM  GSK+E+SPE MKR++RVK++T M+EKVATGVLSGVVKVSGFFTSS+ NS VG
Sbjct  281   FLKKRMGPGSKSEISPEAMKRMKRVKKLTKMSEKVATGVLSGVVKVSGFFTSSIVNSKVG  340

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
             KKF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+S VTTGLVS +YG++AA  T EG
Sbjct  341   KKFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSVVTTGLVSQRYGEQAAHVTHEG  400

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
             L AAGHA+ TAW VFK+RKALNP
Sbjct  401   LGAAGHAIGTAWAVFKIRKALNP  423



>ref|XP_004231032.1| PREDICTED: uncharacterized protein LOC101263355 [Solanum lycopersicum]
Length=443

 Score =   462 bits (1188),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 246/444 (55%), Positives = 325/444 (73%), Gaps = 32/444 (7%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVD--PDFENPFHSSSS-SANRSPMYPVVDMKDV-ENLFPENYETV  1362
             MASQN +   +YP+V+D  P+  +PF +++  + + S MYP +DMKD+ ENLFPE   + 
Sbjct  1     MASQNPSPPKLYPEVIDSNPESSSPFITNTQKNKSSSSMYPTIDMKDLAENLFPETENSQ  60

Query  1361  QGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
                  +  S     +EE ++ +PGAI+HLIDK+ S+ELA+G+  +V L+QGD+ VAV AR
Sbjct  61    PNQNSNFVS-----LEEVIVQIPGAIVHLIDKERSIELASGEFEIVQLKQGDNVVAVLAR  115

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             V D+IQWPL +D A+VKLD SHYFF+ R P+                        +    
Sbjct  116   VGDQIQWPLARDEAAVKLDESHYFFTLRVPS--------------------EANDEDGYA  155

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVA-KEVSPADLK  825
              ++LNYGLTIASKGQ+ L+K+LD +L+  S+F V KV++   V     +A K+VSP ++ 
Sbjct  156   ENLLNYGLTIASKGQERLLKELDLVLEKYSAFRVEKVKKDKGVAEKWWMAPKDVSPEEM-  214

Query  824   SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD  645
              EKKKE +E   AAYWTTLAPNVEDYSSS AR++A+GSG+LIKGILWCGD+TVD LK G+
Sbjct  215   -EKKKEDVERSSAAYWTTLAPNVEDYSSSIARMIAAGSGQLIKGILWCGDITVDRLKWGN  273

Query  644   EVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
             +VL  RM  GS +E+SPE M+R+RRVK++T M+EKVATG+LSGVVKVSGFFTSS+ANS  
Sbjct  274   DVLMKRMGKGSNSEISPEAMRRMRRVKKMTKMSEKVATGILSGVVKVSGFFTSSIANSKA  333

Query  464   GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
             G++F  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+S VTTGLV  ++GD+AA+ T E
Sbjct  334   GQRFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSVVTTGLVQQRHGDQAAQMTRE  393

Query  284   GLEAAGHAMATAWTVFKLRKALNP  213
             G +AAGHA+ TAW VFK+RKALNP
Sbjct  394   GFDAAGHALGTAWAVFKIRKALNP  417



>ref|XP_007156174.1| hypothetical protein PHAVU_003G264500g [Phaseolus vulgaris]
 gb|ESW28168.1| hypothetical protein PHAVU_003G264500g [Phaseolus vulgaris]
Length=456

 Score =   461 bits (1187),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 266/445 (60%), Positives = 339/445 (76%), Gaps = 22/445 (5%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDVENLFPENYETVQGY  1353
             MAS+N   ++ +YP+V+     NP   SS+ +  S +YP +D  +V NL P+N       
Sbjct  1     MASENPNQKNCLYPQVIID--ANPETCSSNPS--SNLYPKID--EVGNLLPDNI------  48

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
                SPSAPP A EE L+ VPGAILHLIDK+ SVELA GDL+++ LRQG + VA +A V D
Sbjct  49    ---SPSAPPLAAEEVLIKVPGAILHLIDKECSVELACGDLTIICLRQGTNIVAFYANVGD  105

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGN--  999
              IQWPL KD A+VK+D+SHYFFS   P+      SSDEE+ +G    +   K+K+  +  
Sbjct  106   -IQWPLAKDEAAVKVDDSHYFFSLHMPDESKSDSSSDEEEKRGIFNLRRNRKKKNKDSVP  164

Query  998   DVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEVSPADL  828
              VL+YGLTIASKGQ+NL+K+LD +   CS+FSV KV E A      +   VA E+SPADL
Sbjct  165   SVLSYGLTIASKGQENLVKELDKVFQECSAFSVQKVSENAKKEGEALDASVATEISPADL  224

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
             ++E+KKE+LE +CA YWTTLAPNVEDYS +AA+L+A+GSG+L+KGILWCGDVTV+ L+ G
Sbjct  225   QTEEKKEMLEEKCAMYWTTLAPNVEDYSGTAAKLIAAGSGQLVKGILWCGDVTVERLRWG  284

Query  647   DEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
             +E+++ RM  GS+ E+SPETMKRI+RVKR+T MTE VA GVL+GVVKVSG+FTSS+ANS 
Sbjct  285   NEIMKTRMAKGSQEEISPETMKRIQRVKRMTQMTESVANGVLTGVVKVSGYFTSSLANSK  344

Query  467   VGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATS  288
              GKKF   LPGE+VLA+LDGFS++CDAVEVAGK+VMSTS+TVTT LV+H+YG+EAAKATS
Sbjct  345   AGKKFFSFLPGEVVLASLDGFSKVCDAVEVAGKSVMSTSNTVTTELVTHRYGEEAAKATS  404

Query  287   EGLEAAGHAMATAWTVFKLRKALNP  213
             EGL+AAGHA+ TAW  FKLR+ALNP
Sbjct  405   EGLDAAGHAVGTAWAAFKLRQALNP  429



>ref|XP_010426671.1| PREDICTED: spartin [Camelina sativa]
Length=450

 Score =   461 bits (1185),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 252/441 (57%), Positives = 318/441 (72%), Gaps = 31/441 (7%)
 Frame = -1

Query  1514  RTRSPMYPKVVDPDFENPFHSSSSSANRSP-MYPVVDMKDV-ENLFPENYETVQGYYHHS  1341
             + R  MYP +     +NPF  ++     SP +YP +  +++  NLFP ++    G  + S
Sbjct  10    KQRPAMYPVIDQSIPDNPFAQTNPPYPSSPHLYPSLSSQNLGPNLFPHHHGDASG--NQS  67

Query  1340  PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQW  1161
             PSAPP+A EE L+ VPGAIL+LIDK YSVELA GD ++V + QGD+ VAV A V DEIQW
Sbjct  68    PSAPPQATEEVLIRVPGAILNLIDKSYSVELACGDFTVVRIIQGDNIVAVLANVGDEIQW  127

Query  1160  PLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYG  981
             PLTK+  + K+D SHYFFS   P                      +    D  +D+LNYG
Sbjct  128   PLTKNEVAAKVDESHYFFSIHPPK---------------------EGSGSDSDDDILNYG  166

Query  980   LTIASKGQDNLIKDLDTILDNCSSFSVH----KVEETASVVMGGPVAKEVSPADLKSEKK  813
             LTIASKGQ+N++  LD +L + S F+      K +ET   V+G  V  + SP +LK E+K
Sbjct  167   LTIASKGQENVLLVLDQVLRDYSCFTEQRMSEKAKETGEEVLGSSVVAQTSPEELKGERK  226

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
              +V+EG+CAAYWTTLAPNVEDYS + A+++ASGSGKLI+GILWCGDVTV+ L+ G+EV++
Sbjct  227   -DVVEGQCAAYWTTLAPNVEDYSHNTAKMIASGSGKLIRGILWCGDVTVERLRKGNEVMK  285

Query  632   NRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKK  456
             NR++   K  +VSPET++RI+RVKRVT MTEKVATGVLSGVVKVSGF T SVANS  GKK
Sbjct  286   NRLSRAEKEKDVSPETLRRIKRVKRVTQMTEKVATGVLSGVVKVSGFITGSVANSKAGKK  345

Query  455   FLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLE  276
               GLLPGE+VLA+LDGFS+ICDAVEVAGKNVMSTSSTVTT LV+H+YG +AA+AT+EGL+
Sbjct  346   LFGLLPGEIVLASLDGFSKICDAVEVAGKNVMSTSSTVTTELVNHRYGTKAAEATNEGLD  405

Query  275   AAGHAMATAWTVFKLRKALNP  213
             AAGHA  TAW  FK+RKALNP
Sbjct  406   AAGHAFGTAWVAFKIRKALNP  426



>ref|XP_011088594.1| PREDICTED: uncharacterized protein LOC105169782 [Sesamum indicum]
Length=444

 Score =   459 bits (1181),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 248/440 (56%), Positives = 324/440 (74%), Gaps = 30/440 (7%)
 Frame = -1

Query  1514  RTRSPMYPKVV--DPDFENPF--HSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQ-GY  1353
             + RS +YP+VV  +P+  +PF  + S + ++ S +YP ++MKD+ ENLFPE  E  Q G 
Sbjct  7     KHRSSLYPEVVQTNPESTSPFISNPSKNPSSSSSLYPSIEMKDLAENLFPETEEEGQTGA  66

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
              H   +A  E+ EE ++ VPGAI+HLIDK+ SVELA GD  +V L+QGD+ VA  ARV D
Sbjct  67    AHRGGNASFESSEEVIIRVPGAIVHLIDKEQSVELANGDFCVVQLKQGDNVVAALARVGD  126

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             EIQWPL KD A+VKLD+SHYFFS R P+                      E  +   + +
Sbjct  127   EIQWPLLKDEAAVKLDDSHYFFSLRVPS----------------------EGGEINSDSI  164

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKK  813
             LNYGLTIA+KGQ+ L+++LD++L+  S+F V K          G VAKEVSP ++  E+K
Sbjct  165   LNYGLTIAAKGQEGLLRELDSVLEKFSAFRVEKAGAVVEQGWWGAVAKEVSPEEM--ERK  222

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
             KE +E   AAYWTTLAPNVEDYS S AR++A+GSG++++GILWCGDVTVD LK G E L+
Sbjct  223   KEEVEKSAAAYWTTLAPNVEDYSGSVARMIAAGSGQVVRGILWCGDVTVDRLKWGHEFLK  282

Query  632   NRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
             NR+   S ++VSP+ ++R++RVKR+T M+E+VATG+LSGVVKVSGFFTSSVANS VG+KF
Sbjct  283   NRVGKASSSDVSPQALRRMKRVKRLTKMSEQVATGILSGVVKVSGFFTSSVANSKVGQKF  342

Query  452   LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
               LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+S VTTGLVS +YG++A + T +GL A
Sbjct  343   FSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSVVTTGLVSQRYGEQAGEVTHDGLGA  402

Query  272   AGHAMATAWTVFKLRKALNP  213
             AGHA+ TAWTVFK+RKALNP
Sbjct  403   AGHAIGTAWTVFKIRKALNP  422



>ref|XP_006359688.1| PREDICTED: uncharacterized protein LOC102595706 [Solanum tuberosum]
Length=443

 Score =   459 bits (1180),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 245/446 (55%), Positives = 326/446 (73%), Gaps = 36/446 (8%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVD--PDFENPFHSSSS-SANRSPMYPVVDMKDV-ENLFPENYETV  1362
             MASQN T   +YP+V+D  P+  +PF +++  + + S MYP +DMK++ ENLFPE     
Sbjct  1     MASQNPTPPKLYPEVIDSNPESTSPFLTNTQKNKSSSSMYPTIDMKELAENLFPETE---  57

Query  1361  QGYYHHSPSAPPE--AVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVF  1188
                 ++ P+      ++EE ++ +PGAI+HLIDK+ S+ELA+G+  +V L+QGD+ VAV 
Sbjct  58    ----NNQPNQNSNFVSLEEVIVQIPGAIVHLIDKERSIELASGEFEIVQLKQGDNVVAVL  113

Query  1187  ARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkD  1008
             ARV D+IQWPL +D A+VKLD SHYFF+ R P+                        +  
Sbjct  114   ARVGDQIQWPLARDEAAVKLDESHYFFTLRVPS--------------------DANDEDG  153

Query  1007  MGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVA-KEVSPAD  831
                ++LNYGLTIASKGQ+ ++K+LD +L+  S+F V KV++   V     +A K+VSP +
Sbjct  154   YAENLLNYGLTIASKGQERVLKELDLVLEKYSAFRVEKVKKDKGVAEKWWMAPKDVSPEE  213

Query  830   LKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
             +  EKKKE +E   AAYWTTLAPNVEDYSSS AR++A+GSG+LIKGILWCGDVTVD LK 
Sbjct  214   M--EKKKEDMERSSAAYWTTLAPNVEDYSSSIARMIAAGSGQLIKGILWCGDVTVDRLKW  271

Query  650   GDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
             G++VL  RM  GS +E+SPE M+R+RRVK++T M+EKVATG+LSGVVKVSGFFTSS+ NS
Sbjct  272   GNDVLMKRMGKGSNSEISPEAMRRMRRVKKMTKMSEKVATGILSGVVKVSGFFTSSIVNS  331

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKAT  291
               G++F  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+S VTTGLV  ++GD+AA+ T
Sbjct  332   KAGQRFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSVVTTGLVQQRHGDQAAQMT  391

Query  290   SEGLEAAGHAMATAWTVFKLRKALNP  213
              EG +AAGHA+ TAW VFK+RKALNP
Sbjct  392   REGFDAAGHALGTAWAVFKIRKALNP  417



>ref|XP_004146148.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101217525 
[Cucumis sativus]
Length=447

 Score =   459 bits (1180),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 266/456 (58%), Positives = 336/456 (74%), Gaps = 53/456 (12%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVV--DPD-----FENPFHSSSSSANRSPMYPVVDMKD-VENLFPEN  1374
             M SQN  R+ +YP+V+  +PD     F NP   S+S+     +YP +DMKD VENLFP++
Sbjct  1     MDSQNPYRNSLYPQVIHSNPDAPLSSFANPIPPSTSN-----LYPTLDMKDMVENLFPDD  55

Query  1373  YETVQGYYHHSPSAPPE-------AVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLR  1215
                  G+ H   +  P        AVEE L+ +PGAIL+LIDK+YSVELA GDL++V +R
Sbjct  56    V----GFLHPPSAPAPPSASAPPLAVEEVLIRIPGAILNLIDKEYSVELACGDLTIVHIR  111

Query  1214  QGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkke  1035
             QG+S VAVFARVAD+IQWPL KDLA+VKLD SHY                          
Sbjct  112   QGESVVAVFARVADDIQWPLAKDLAAVKLDGSHYLXK-----------------------  148

Query  1034  gkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVV--MGG  861
                 +K+K   +D L+YGLTI SKGQ+ L+K+LD IL N SSF++ KV E+A  V  +  
Sbjct  149   ----KKKKSGSDDYLSYGLTIVSKGQEGLLKELDGILQNYSSFTLQKVSESAKKVEVLDE  204

Query  860   PVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWC  681
              +AKE+SPADLK+EKKKE +EG+CAAYWTTLAPNVEDY+  AA+L+A+GSG+L+KG+LWC
Sbjct  205   SLAKEMSPADLKTEKKKEEMEGKCAAYWTTLAPNVEDYNGLAAKLIAAGSGQLVKGVLWC  264

Query  680   GDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVS  501
             GDVTV+ LK G+E ++ R+   S TE+SPET+KRIRRVKRVT M+EKVA GVLSGV+KVS
Sbjct  265   GDVTVERLKQGNEAMQKRLDPCSNTEISPETLKRIRRVKRVTKMSEKVANGVLSGVIKVS  324

Query  500   GFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSH  321
             G+FTSSVANS VGKKF G+LPGE+VLA+LDGF ++ DAVEVAGKNVM+TSSTVTT LV+ 
Sbjct  325   GYFTSSVANSKVGKKFFGMLPGEIVLASLDGFGKVFDAVEVAGKNVMATSSTVTTELVTK  384

Query  320   KYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             +YG++AA AT+EGL+AAGHA+ TAW   K+RKALNP
Sbjct  385   RYGEQAANATNEGLDAAGHAVGTAWAALKIRKALNP  420



>ref|XP_010935097.1| PREDICTED: uncharacterized protein LOC105055083 [Elaeis guineensis]
Length=454

 Score =   459 bits (1180),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 257/453 (57%), Positives = 327/453 (72%), Gaps = 39/453 (9%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVV--DPDFENPFHSSSSSANRSP------MYPVVDMKD-VENLFPE  1377
             MASQ     P YP V+  +P+  +PF S+ +    +P      +YP VDM D V +LFP+
Sbjct  1     MASQQ----PQYPHVLQTNPEALSPFLSNPNPTPSAPPEPSSSLYPTVDMADIVGDLFPD  56

Query  1376  NYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNV  1197
                  +   H    +PP  VEETLL +PGA+LHLIDK +S+ELA+GDL+++ +RQGDS V
Sbjct  57    PDGDPKNPEHPVNLSPP--VEETLLEIPGALLHLIDKHHSIELASGDLAILRVRQGDSIV  114

Query  1196  AVFARVA---DEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkh  1026
             AV ARV    D +QWPLT+D A+VKLD+SHYFFS   P    D                 
Sbjct  115   AVLARVGAGDDAVQWPLTRDEAAVKLDDSHYFFSLHVPEGTADDGEDGSA----------  164

Query  1025  kekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVE-ETASVVMGGPVAK  849
                      D+LNYGLT ASKGQ++L+K+LD +L++CS FSV  V  + AS V+ G VA 
Sbjct  165   ---------DLLNYGLTFASKGQESLLKELDGMLESCSGFSVQNVRGKEASTVLDGSVAM  215

Query  848   EVSPAD-LKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDV  672
             E++PA+ +++  KKE++E R  AYWTTLAPNVEDYS   A+ +A+GSGKL+KGILWCGDV
Sbjct  216   EITPAEIMEAGPKKEMMEERSEAYWTTLAPNVEDYSGCVAKAIAAGSGKLVKGILWCGDV  275

Query  671   TVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFF  492
             T D +K G+E L+ RM +  + EVSPET++RIRRVKRVT M+EKVATG+LSGVVKVSG+F
Sbjct  276   TTDRIKWGNEFLKKRMENTERKEVSPETLRRIRRVKRVTKMSEKVATGILSGVVKVSGYF  335

Query  491   TSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYG  312
             TSSVANS VGKKF GLLPGE+VLA+LDGF +ICDAVEVAGKNV+STSS  TTGLVSH+YG
Sbjct  336   TSSVANSKVGKKFFGLLPGEIVLASLDGFGKICDAVEVAGKNVLSTSSVATTGLVSHRYG  395

Query  311   DEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             ++AA+ T+E L+AAGHA+ TAW VFK+RKAL+P
Sbjct  396   EQAAELTTESLDAAGHAIGTAWAVFKIRKALDP  428



>ref|XP_006486754.1| PREDICTED: uncharacterized protein LOC102608259 [Citrus sinensis]
Length=440

 Score =   458 bits (1178),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 253/443 (57%), Positives = 328/443 (74%), Gaps = 36/443 (8%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVDPDFENP---FHSSSSSANRSPMYPVVDMKDV-ENLFPENYETV  1362
             MAS N +++ +YP+V   D  NP     S+++S++ S +YP VDMKD+ ENLFPE+    
Sbjct  1     MASSNPSKA-LYPEV---DLSNPEAASASTAASSSPSSLYPSVDMKDMAENLFPED----  52

Query  1361  QGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
                 H + +APP   E  L+ +PGAI+HLI+++ SVELA+G+L +VSL QGD+ VAVFAR
Sbjct  53    DAVSHITANAPPS--EHVLVKIPGAIVHLIEREQSVELASGELYIVSLSQGDNVVAVFAR  110

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             V DEIQWPL KD  +VKLD+SHYFF+ R P                        +   + 
Sbjct  111   VGDEIQWPLAKDEPAVKLDDSHYFFTLRVPE-------------------NGSLETDQVH  151

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKS  822
             ++VLNYGLTIA+KGQ +L+K+LD +L+  S FSV KV+   +  M   VAKE+SP +LKS
Sbjct  152   HEVLNYGLTIATKGQKHLLKELDKVLETYSCFSVQKVKNMGNWEM---VAKEMSPEELKS  208

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
              + +E++     AYWT LAPNVEDYS S AR++A+GSG+LIKGILWCGDVTVD LK G+ 
Sbjct  209   AENRELMGKSSGAYWTALAPNVEDYSGSVARMIAAGSGQLIKGILWCGDVTVDGLKWGNG  268

Query  641   VLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
              LR RM SGS++E+SP+T+KRI+RVK++T M+EKVATG+LSGVVKVSGFFT  + NS VG
Sbjct  269   FLRKRMGSGSQSEISPDTIKRIKRVKKLTKMSEKVATGILSGVVKVSGFFTGPIVNSKVG  328

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
             KKF  LLPGE+VLATLDGF+++CDAVEVAG+NVMST+S VTTGLVS +YG++AAKAT+EG
Sbjct  329   KKFFSLLPGEIVLATLDGFNKVCDAVEVAGRNVMSTTSVVTTGLVSDRYGEQAAKATNEG  388

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
             L+AAGHA  TAW VFK+R+A NP
Sbjct  389   LDAAGHAFGTAWAVFKIRQAFNP  411



>ref|XP_006291123.1| hypothetical protein CARUB_v10017236mg [Capsella rubella]
 gb|EOA24021.1| hypothetical protein CARUB_v10017236mg [Capsella rubella]
Length=451

 Score =   458 bits (1179),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 251/440 (57%), Positives = 317/440 (72%), Gaps = 28/440 (6%)
 Frame = -1

Query  1514  RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSP  1338
             + R  MYP+V     +NPF  ++   +   +YP +  +++  NLFP++ +        SP
Sbjct  10    KQRPAMYPQVDQSIPDNPFAPTNPYPSSPYLYPSLSSQNLGPNLFPDHGDASN---DQSP  66

Query  1337  SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWP  1158
             SAPP+A EE L+ VPGAIL+LIDK YSVELA GD ++V + QG + VAV A V +EIQWP
Sbjct  67    SAPPQATEEVLIRVPGAILNLIDKSYSVELACGDFTIVRIIQGQNIVAVLANVGNEIQWP  126

Query  1157  LTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGL  978
             LTK+  + K+D SHYFFS   P                    +      D  +D+LNYGL
Sbjct  127   LTKNEVAAKVDGSHYFFSIHPPK------------------EQGNGSVSDSDDDILNYGL  168

Query  977   TIASKGQDNLIKDLDTILDNCSSFSVHKV----EETASVVMGGPVAKEVSPADLKSEKKK  810
             TIASKGQ+N++  LD +L + S F+  K+    +ET   V+G  V  + SP +LK E+K 
Sbjct  169   TIASKGQENVLLVLDQVLRDYSCFTEQKMSEKAKETGEEVLGSSVVAQTSPEELKGERK-  227

Query  809   EVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRN  630
             +V+EG+CAAYWTTLAPNVEDYS S A+++ASGSGKLI+GILWCGDVTV+ LK G+EV++N
Sbjct  228   DVVEGQCAAYWTTLAPNVEDYSHSTAKMIASGSGKLIRGILWCGDVTVERLKKGNEVMKN  287

Query  629   RMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
             R++   K  +VSPET+KRI+RVKRVT MTEKVATGVLSGVVKVSGF T SVANS  GKK 
Sbjct  288   RLSRAEKEKDVSPETLKRIKRVKRVTQMTEKVATGVLSGVVKVSGFITGSVANSKAGKKL  347

Query  452   LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
              GLLPGE+VLA+LDGFS+ICDAVEVAGKNVMSTSSTVTT LV+H+YG +AA+AT+EGL+A
Sbjct  348   FGLLPGEIVLASLDGFSKICDAVEVAGKNVMSTSSTVTTELVNHRYGTKAAEATNEGLDA  407

Query  272   AGHAMATAWTVFKLRKALNP  213
             AGHA  TAW  FK+RKALNP
Sbjct  408   AGHAFGTAWVAFKIRKALNP  427



>ref|XP_010503811.1| PREDICTED: uncharacterized protein LOC104780959 [Camelina sativa]
Length=452

 Score =   458 bits (1179),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 250/440 (57%), Positives = 316/440 (72%), Gaps = 28/440 (6%)
 Frame = -1

Query  1514  RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSP  1338
             + R  MYP +     +NPF  ++   +   +YP +  +++  NLFP + +      + SP
Sbjct  11    KQRPAMYPVIDQSIPDNPFAQTNPYPSSPHLYPSLSSQNLGPNLFPHHGDASG---NQSP  67

Query  1337  SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWP  1158
             SAPP+A EE L+ VPGAIL+LIDK YSVELA GD ++V + QGD+ VAV A V DEIQWP
Sbjct  68    SAPPQATEEVLIRVPGAILNLIDKSYSVELACGDFTIVRIIQGDNIVAVLANVGDEIQWP  127

Query  1157  LTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGL  978
             LTK+  + K+D SHYFFS   P                    +      D  +D+LNYGL
Sbjct  128   LTKNEVAAKVDESHYFFSIHPPK------------------EEGHGSGSDSDDDILNYGL  169

Query  977   TIASKGQDNLIKDLDTILDNCSSFSVH----KVEETASVVMGGPVAKEVSPADLKSEKKK  810
             TIASKGQ+NL+  LD +L + S F+      K +ET   V+G  V  + SP +LK E+K 
Sbjct  170   TIASKGQENLLLVLDQVLRDYSCFTEQRMSEKAKETGEEVLGSSVVAQTSPEELKGERK-  228

Query  809   EVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRN  630
             +V+EG+CAAYWTTLAPNVEDYS + A+++ASGSGKLI+GILWCGDVTV+ L+ G+EV++N
Sbjct  229   DVVEGQCAAYWTTLAPNVEDYSHNTAKMIASGSGKLIRGILWCGDVTVERLRKGNEVMKN  288

Query  629   RMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
             R++   K  +VSPET++RI+RVKRVT MTEKVATGVLSGVVKVSGF T SVANS  GKK 
Sbjct  289   RLSRAEKEKDVSPETLRRIKRVKRVTQMTEKVATGVLSGVVKVSGFITGSVANSKAGKKL  348

Query  452   LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
              GLLPGE+VLA+LDGFS+ICDAVEVAGKNVMSTSSTVTT LV+H+YG +AA+AT+EGL+A
Sbjct  349   FGLLPGEIVLASLDGFSKICDAVEVAGKNVMSTSSTVTTELVNHRYGTKAAEATNEGLDA  408

Query  272   AGHAMATAWTVFKLRKALNP  213
             AGHA  TAW  FK+RKALNP
Sbjct  409   AGHAFGTAWVAFKIRKALNP  428



>ref|XP_010266813.1| PREDICTED: spartin-like [Nelumbo nucifera]
Length=477

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 271/469 (58%), Positives = 340/469 (72%), Gaps = 45/469 (10%)
 Frame = -1

Query  1529  MASQN--RTRSPMYPKVVD--PDFENPFHSS---SSSANRSPMYPVVDMKD---------  1398
             M SQN     S  YP+V++  P+  +PF S+   SSS++ S MYPV+D  D         
Sbjct  1     MDSQNPGNKNSSFYPQVIESNPETASPFVSNPKSSSSSSSSSMYPVIDSSDRLKDSKPSS  60

Query  1397  -------------VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYS  1257
                          V+NLFP+  +     + H+ SAP ++ EE L+ + GAI+HLID+QYS
Sbjct  61    SSSLYPSIDMNDLVDNLFPDKDDVA---HSHTASAPIQSFEEVLIKISGAIVHLIDRQYS  117

Query  1256  VELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVddd  1077
             VELA GDL++V LRQG+S VAV  RV ++IQWPL KD A V+LD SHYFF+ R P     
Sbjct  118   VELACGDLTIVRLRQGESVVAVLVRVDNDIQWPLAKDEAVVRLDESHYFFTLRLP-----  172

Query  1076  sdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVH  897
                      +G   G  + K  D   +++NYGLT ASKGQ+NL+K+LD IL++ S+FSV 
Sbjct  173   -------ADEGCDSGHGETKAGDGSENLINYGLTFASKGQENLLKELDGILEHYSNFSVQ  225

Query  896   KVE-ETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMA  720
             KV  +  S V+ G VA+ +SP++LKSE+KKE++E R AAYWTTLAPNVEDYS S AR +A
Sbjct  226   KVSGKGKSEVLDGSVAEGISPSELKSEEKKEMMEERSAAYWTTLAPNVEDYSGSVARAIA  285

Query  719   SGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEK  540
              GSG+LI GILWCGDVTVD LK G+E L+ RM  GS  E+SPE MKRI+RVKR++ M+EK
Sbjct  286   VGSGQLIWGILWCGDVTVDRLKWGNEFLKKRMEPGSNAEISPEAMKRIQRVKRLSKMSEK  345

Query  539   VATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvm  360
             VA+GVLSGVVKVSGFFTSS+ANS VGKKF GLLPGE+VLA+LDGFS++CDAVEVAGKNVM
Sbjct  346   VASGVLSGVVKVSGFFTSSIANSKVGKKFFGLLPGEIVLASLDGFSKVCDAVEVAGKNVM  405

Query  359   stsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             STSS VTT LVSH+YG++AA+AT+EGL AAGHA+ TAW VFK+RKALNP
Sbjct  406   STSSVVTTDLVSHRYGEKAAEATNEGLGAAGHAIGTAWAVFKIRKALNP  454



>gb|EYU37944.1| hypothetical protein MIMGU_mgv1a006349mg [Erythranthe guttata]
Length=447

 Score =   457 bits (1176),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 249/445 (56%), Positives = 324/445 (73%), Gaps = 30/445 (7%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVV--DPDFENPF-HSSSSSANRSPMYPVVDMKDV-ENLFPENYET  1365
             M+S+N +TR  MYP+V+  +P+  +PF  + S + + S +YP ++M  + ENLFPE  E 
Sbjct  1     MSSENPKTRKSMYPEVILTNPESSSPFISNPSRNPSSSSLYPTIEMNSLAENLFPETEEE  60

Query  1364  VQGY-YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVF  1188
              Q    +   S+  E+ EE ++ +PGAI+HLIDK+ S+ELA GD S+V L+QGD+ VA  
Sbjct  61    DQTRAMNQGGSSTFESSEEVVITIPGAIVHLIDKKRSIELANGDFSVVQLKQGDNVVAAL  120

Query  1187  ARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkD  1008
             ARV DEIQWPL KD A+VKLD+SHYFFS R P+                      E  + 
Sbjct  121   ARVGDEIQWPLAKDEAAVKLDDSHYFFSLRVPS----------------------EHGEI  158

Query  1007  MGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADL  828
              G+ +LNYGLTIASKGQ+ L++ LD++L+  S+F V K          G VAKEVSPA++
Sbjct  159   NGDSILNYGLTIASKGQEGLLRKLDSVLEKFSAFRVEKAAAAVEQGWWGSVAKEVSPAEM  218

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
             K+  KKE +E   AAYWTT+APNVEDYS S ARL+A+GSG++I+GILWCGD+TVD LK G
Sbjct  219   KN--KKEEVENSAAAYWTTIAPNVEDYSGSVARLIAAGSGQVIRGILWCGDLTVDRLKWG  276

Query  647   DEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
             DE L+ R+  G  +++SPET+ R++RVK++T M+EKVA G+LSGVVKVSGFFTSSVANS 
Sbjct  277   DEFLKKRVGKGYTSDISPETLTRVKRVKQMTKMSEKVAAGILSGVVKVSGFFTSSVANSK  336

Query  467   VGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATS  288
             VG+KF  LLPGE+VLA+LDGF+R+ DAVEVAGKNVMST+S VTTGLVS +YG++A K T 
Sbjct  337   VGQKFFSLLPGEIVLASLDGFNRVFDAVEVAGKNVMSTTSVVTTGLVSQRYGEDAGKVTH  396

Query  287   EGLEAAGHAMATAWTVFKLRKALNP  213
             +GL AAGHA+ TAW VFK+RKALNP
Sbjct  397   DGLGAAGHAIGTAWAVFKIRKALNP  421



>ref|XP_006422619.1| hypothetical protein CICLE_v10028214mg [Citrus clementina]
 gb|ESR35859.1| hypothetical protein CICLE_v10028214mg [Citrus clementina]
Length=520

 Score =   459 bits (1182),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 258/463 (56%), Positives = 335/463 (72%), Gaps = 47/463 (10%)
 Frame = -1

Query  1556  FQSPKI-----------FSPMASQNRTRSPMYPKVVDPDFENP---FHSSSSSANRSPMY  1419
             F SPK+           +S MAS N +++ +YP+V   D  NP     S+++S++ S +Y
Sbjct  61    FVSPKVSSKVTDHHQRQYSIMASSNPSKA-LYPEV---DLSNPEAASASTAASSSPSSLY  116

Query  1418  PVVDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELAT  1242
             P VDMKD+ ENLFPE+        H + +APP   E  L+ +PGAI+HLI+++ SVELA+
Sbjct  117   PSVDMKDMAENLFPED----DAVSHITANAPPS--EHVLVKIPGAIVHLIEREQSVELAS  170

Query  1241  GDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssd  1062
             G+L +VSL QGD+ VAVFARV DEIQWPL KD  +VKLD+SHYFF+ R P          
Sbjct  171   GELYIVSLSQGDNVVAVFARVGDEIQWPLAKDEPAVKLDDSHYFFTLRVPE---------  221

Query  1061  eekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEET  882
                           +   + ++VLNYGLTIA+KGQ +L+K+LD +L+  S FSV KV+  
Sbjct  222   ----------NGSLETDQVHHEVLNYGLTIATKGQKHLLKELDKVLETYSCFSVQKVKNM  271

Query  881   ASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKL  702
              +  M   VAKE+SP +LKS + +E++     AYWT LAPNVEDYS S AR++A+GSG+L
Sbjct  272   GNWEM---VAKEMSPEELKSAENRELMGKSSGAYWTALAPNVEDYSGSVARMIAAGSGQL  328

Query  701   IKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVL  522
             IKGILWCGDVTVD LK G+  LR RM SGS++E+SP+T+KRI+RVK++T M+EKVATG+L
Sbjct  329   IKGILWCGDVTVDGLKWGNGFLRKRMGSGSQSEISPDTIKRIKRVKKLTKMSEKVATGIL  388

Query  521   SGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstv  342
             SGVVKVSGFFT  + NS VGKKF  LLPGE+VLATLDGF+++CDAVEVAG+NVMST+S V
Sbjct  389   SGVVKVSGFFTGPIVNSKVGKKFFSLLPGEIVLATLDGFNKVCDAVEVAGRNVMSTTSVV  448

Query  341   ttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             TTGLVS +YG++AAKAT+EGL+AAGHA  TAW VFK+R+A NP
Sbjct  449   TTGLVSDRYGEQAAKATNEGLDAAGHAFGTAWAVFKIRQAFNP  491



>ref|XP_009629964.1| PREDICTED: uncharacterized protein LOC104120020 isoform X3 [Nicotiana 
tomentosiformis]
Length=370

 Score =   453 bits (1166),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 237/381 (62%), Positives = 301/381 (79%), Gaps = 17/381 (4%)
 Frame = -1

Query  1529  MASQN--RTRSPMYPKVV--DPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYET  1365
             M SQN    ++P+YP+++  DP+ +       S+++R  +YP +D KD VE L P++Y+T
Sbjct  1     MTSQNPNLQKAPLYPQIIHNDPNLQ-------STSSRPNLYPTIDEKDLVEKLIPDDYQT  53

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
                    +PSAPPE++EETLL++PG ++HLIDK YSVELATGDLSL+ L Q  + VA+  
Sbjct  54    TPS----APSAPPESLEETLLVIPGVLIHLIDKHYSVELATGDLSLIGLLQDKNTVAILV  109

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFR-FPNVdddsdssdeekskgkkegkhkekqkD  1008
             RVADEIQWPLTKDLA+VKLD+SHYFFSF+       DS   ++EK K +K+   KEK K+
Sbjct  110   RVADEIQWPLTKDLAAVKLDDSHYFFSFQAMKEDGSDSSDDEKEKGKKEKDKGKKEKDKE  169

Query  1007  MGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADL  828
               N+ LNYGLTIASKGQ+ L+K+LD IL + S+FSV KVEE A++ +GG VA+E+SPADL
Sbjct  170   TVNESLNYGLTIASKGQEALLKELDAILKSYSTFSVQKVEEKAALAIGGTVARELSPADL  229

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
             KSEKKKEVLE  C  YWTTLAPNVE+YS SAA+L+A+GSG+LIKGILWCGDV+++ LK G
Sbjct  230   KSEKKKEVLEEHCTQYWTTLAPNVEEYSGSAAKLVAAGSGQLIKGILWCGDVSIERLKRG  289

Query  647   DEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
             +EVL+ RMTSG+K E+ PET++RI+RVKRVT MTEKVA GVLSGV++VSGFFTSSVANS 
Sbjct  290   NEVLKQRMTSGTKAEIRPETLRRIKRVKRVTKMTEKVAIGVLSGVLQVSGFFTSSVANSI  349

Query  467   VGKKFLGLLPGEMVLATLDGF  405
             VGKKF  ++PGEMVLATLDGF
Sbjct  350   VGKKFFRMMPGEMVLATLDGF  370



>ref|XP_009629963.1| PREDICTED: uncharacterized protein LOC104120020 isoform X2 [Nicotiana 
tomentosiformis]
Length=378

 Score =   454 bits (1167),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 237/381 (62%), Positives = 301/381 (79%), Gaps = 17/381 (4%)
 Frame = -1

Query  1529  MASQN--RTRSPMYPKVV--DPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYET  1365
             M SQN    ++P+YP+++  DP+ +       S+++R  +YP +D KD VE L P++Y+T
Sbjct  1     MTSQNPNLQKAPLYPQIIHNDPNLQ-------STSSRPNLYPTIDEKDLVEKLIPDDYQT  53

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
                    +PSAPPE++EETLL++PG ++HLIDK YSVELATGDLSL+ L Q  + VA+  
Sbjct  54    TPS----APSAPPESLEETLLVIPGVLIHLIDKHYSVELATGDLSLIGLLQDKNTVAILV  109

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFR-FPNVdddsdssdeekskgkkegkhkekqkD  1008
             RVADEIQWPLTKDLA+VKLD+SHYFFSF+       DS   ++EK K +K+   KEK K+
Sbjct  110   RVADEIQWPLTKDLAAVKLDDSHYFFSFQAMKEDGSDSSDDEKEKGKKEKDKGKKEKDKE  169

Query  1007  MGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADL  828
               N+ LNYGLTIASKGQ+ L+K+LD IL + S+FSV KVEE A++ +GG VA+E+SPADL
Sbjct  170   TVNESLNYGLTIASKGQEALLKELDAILKSYSTFSVQKVEEKAALAIGGTVARELSPADL  229

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
             KSEKKKEVLE  C  YWTTLAPNVE+YS SAA+L+A+GSG+LIKGILWCGDV+++ LK G
Sbjct  230   KSEKKKEVLEEHCTQYWTTLAPNVEEYSGSAAKLVAAGSGQLIKGILWCGDVSIERLKRG  289

Query  647   DEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
             +EVL+ RMTSG+K E+ PET++RI+RVKRVT MTEKVA GVLSGV++VSGFFTSSVANS 
Sbjct  290   NEVLKQRMTSGTKAEIRPETLRRIKRVKRVTKMTEKVAIGVLSGVLQVSGFFTSSVANSI  349

Query  467   VGKKFLGLLPGEMVLATLDGF  405
             VGKKF  ++PGEMVLATLDGF
Sbjct  350   VGKKFFRMMPGEMVLATLDGF  370



>ref|XP_010920125.1| PREDICTED: uncharacterized protein LOC105044044 [Elaeis guineensis]
Length=484

 Score =   457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 263/473 (56%), Positives = 330/473 (70%), Gaps = 50/473 (11%)
 Frame = -1

Query  1529  MASQNRTRS------PMYPKVVD--PDFENPFHSSSSSANRSPMY---------------  1419
             MA+Q RT S       +YP+V++  P+ ++PF S  ++ +RSP+Y               
Sbjct  1     MATQERTSSNFRDSKSLYPQVLESNPESDSPFLSHPNNPSRSPLYPSLDDSPPPPRNPNA  60

Query  1418  -------PVVDMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQ  1263
                    P ++MK+ VENLFP+  +        +    P  VEETLL +PGAILHLIDKQ
Sbjct  61    NPSSSLYPSIEMKELVENLFPDADDD-DPKSPAAAPTLPPPVEETLLRIPGAILHLIDKQ  119

Query  1262  YSVELATGDLSLVSLRQGDSNVAVFARVA-DEIQWPLTKDLASVKLDNSHYFFSFRFPNV  1086
              SVEL  GD ++V LRQG++ VAV ARV  D +QWPL +D A+VKLD+ HYFFS   P  
Sbjct  120   RSVELGVGDFTVVRLRQGENTVAVLARVGHDLVQWPLARDEAAVKLDDCHYFFSLHVPK-  178

Query  1085  dddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSF  906
                                  +   D   D+LNYGLT ASKGQ+ L+K+LD IL++ SSF
Sbjct  179   -------------SAAAAADDDGGGDGSEDLLNYGLTFASKGQEGLLKELDRILESYSSF  225

Query  905   SVHKVEETA-SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAAR  729
             SV KVE  A S V+ G VAKEV+PA++    KKE++E R AAYWTTLAPNVEDYS S A+
Sbjct  226   SVQKVEGKAKSEVLDGSVAKEVTPAEVMG-PKKEMMEERSAAYWTTLAPNVEDYSGSVAK  284

Query  728   LMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTS  552
             ++A GSG+LI+GILWCGDVTVD LK G+++L+ RM  GSK TE+S + +KRI+RVK VT 
Sbjct  285   VIAKGSGQLIRGILWCGDVTVDRLKWGEDLLKRRMVPGSKQTEISKDALKRIKRVKGVTK  344

Query  551   MTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAG  372
             M+EKVATG+LSGVVKVSGFFTSSV NS  GKKF  LLPGE+VLA+LDGF +ICDAVEVAG
Sbjct  345   MSEKVATGILSGVVKVSGFFTSSVVNSKAGKKFFSLLPGEIVLASLDGFEKICDAVEVAG  404

Query  371   KNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             KNV+ TSS VTTG+VSH+YGD+AA+ T+EGL+AAGHA+ TAW VFK+RKALNP
Sbjct  405   KNVLQTSSVVTTGVVSHRYGDQAAEVTNEGLDAAGHAIGTAWAVFKIRKALNP  457



>ref|XP_009115801.1| PREDICTED: uncharacterized protein LOC103841043 [Brassica rapa]
Length=439

 Score =   454 bits (1169),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 248/443 (56%), Positives = 312/443 (70%), Gaps = 39/443 (9%)
 Frame = -1

Query  1526  ASQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDVENLFPENYETVQGYYH  1347
             A+  + R  MYP++     +NPF  ++   + SP           NL+P    +   +  
Sbjct  7     AADGKQRPAMYPEIDQSIPDNPFAQTNPYVSSSP-----------NLYPPVVSSSPNHGD  55

Query  1346  HS----PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARV  1179
              S    PSAPP+AVEE L+ VPGAIL+LIDK YSVELA GDL++V + QG+S VAV A V
Sbjct  56    SSNNQPPSAPPQAVEEILIRVPGAILNLIDKSYSVELACGDLTIVRIVQGESIVAVLANV  115

Query  1178  ADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGN  999
             ADEIQWPLTK   + K+D SHYFFS   P                       E   D  +
Sbjct  116   ADEIQWPLTKREVATKVDGSHYFFSIHPPK----------------------ESGSDSDD  153

Query  998   DVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSE  819
             ++LNYGLTIASKGQ+N++  LD +L +   F+  ++ E    V+G  +A   SP +LK E
Sbjct  154   EILNYGLTIASKGQENVLHGLDQVLRDYCCFAEQRMSEKGEEVLGNSMAAATSPEELKGE  213

Query  818   KKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEV  639
             +K +++EG+CAAYWTTLAPN+EDYSS  A+++ASGSG+LI+GILWCGDVTV+ LK G+EV
Sbjct  214   RK-DIVEGQCAAYWTTLAPNIEDYSSKTAKMIASGSGQLIRGILWCGDVTVERLKRGNEV  272

Query  638   LRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
             ++NR++   K  +VSPET++RI+RVKRVT MTEKVATGVLSGVVKVSG  T SVANS  G
Sbjct  273   MKNRLSRAEKEKDVSPETLRRIKRVKRVTQMTEKVATGVLSGVVKVSGLITGSVANSKAG  332

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
             KKF GLLPGE++LA+LDGFS+ICDAVEVAGKNVMSTSSTVTT LV HKYG +AA+AT+EG
Sbjct  333   KKFFGLLPGEIILASLDGFSKICDAVEVAGKNVMSTSSTVTTELVDHKYGTKAAEATNEG  392

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
             L+AAGHA  TAW  FK+RKALNP
Sbjct  393   LDAAGHAFGTAWVAFKIRKALNP  415



>ref|NP_190693.1| Senescence/dehydration-associated protein-like protein [Arabidopsis 
thaliana]
 emb|CAB62647.1| putative protein [Arabidopsis thaliana]
 gb|AAK91390.1| AT3g51250/F24M12_290 [Arabidopsis thaliana]
 gb|AAM52237.1| AT3g51250/F24M12_290 [Arabidopsis thaliana]
 gb|AEE78768.1| Senescence/dehydration-associated protein-like protein [Arabidopsis 
thaliana]
Length=463

 Score =   455 bits (1171),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 248/442 (56%), Positives = 321/442 (73%), Gaps = 17/442 (4%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENPFHSSSSSANRSP-MYPVVDMKDV-ENLFPENYETVQGYYHH  1344
             ++ R  MYP+V     +NPF S++     SP +YP +   ++  NLFP++ +        
Sbjct  9     DKQRPAMYPQVDQSIPDNPFASTNPYVASSPYLYPSLSSHNLGPNLFPDHGDASN---DQ  65

Query  1343  SPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQ  1164
             SPSAPP+A EE L+ VPGAIL+LIDK YSVELA GD ++V + QG + VAV A V +EIQ
Sbjct  66    SPSAPPQATEEVLIRVPGAILNLIDKSYSVELACGDFTIVRIIQGQNIVAVLANVGNEIQ  125

Query  1163  WPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNY  984
             WPLTK+  + K+D SHYFFS   P          +       + + ++ +    +++LNY
Sbjct  126   WPLTKNEVAAKVDGSHYFFSIHPPK------EKGQGSGSDSDDEQGQKSKSKSDDEILNY  179

Query  983   GLTIASKGQDNLIKDLDTILDNCSSFSVH----KVEETASVVMGGPVAKEVSPADLKSEK  816
             GLTIASKGQ+N++  LD +L + S F+      K +ET   V+G  V  + SP +LK E+
Sbjct  180   GLTIASKGQENVLLVLDQVLRDYSCFTEQRMSEKAKETGEEVLGNSVVADTSPEELKGER  239

Query  815   KKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL  636
             K +V+EG+CAAYWTTLAPNVEDY+ S A+++ASGSGKLI+GILWCGDVTV+ LK G+EV+
Sbjct  240   K-DVVEGQCAAYWTTLAPNVEDYTHSTAKMIASGSGKLIRGILWCGDVTVERLKKGNEVM  298

Query  635   RNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGK  459
             +NR++   K  +VSPET++RI+RVKRVT MTEKVATGVLSGVVKVSGF T S+ANS  GK
Sbjct  299   KNRLSRAEKEKDVSPETLRRIKRVKRVTQMTEKVATGVLSGVVKVSGFITGSMANSKAGK  358

Query  458   KFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGL  279
             K  GLLPGE+VLA+LDGFS+ICDAVEVAGKNVMSTSSTVTT LV+H+YG +AA+AT+EGL
Sbjct  359   KLFGLLPGEIVLASLDGFSKICDAVEVAGKNVMSTSSTVTTELVNHRYGTKAAEATNEGL  418

Query  278   EAAGHAMATAWTVFKLRKALNP  213
             +AAGHA  TAW  FK+RKA NP
Sbjct  419   DAAGHAFGTAWVAFKIRKAFNP  440



>ref|XP_006403938.1| hypothetical protein EUTSA_v10010357mg [Eutrema salsugineum]
 gb|ESQ45391.1| hypothetical protein EUTSA_v10010357mg [Eutrema salsugineum]
Length=462

 Score =   455 bits (1170),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 249/441 (56%), Positives = 320/441 (73%), Gaps = 19/441 (4%)
 Frame = -1

Query  1514  RTRSPMYPKVVDPDFENPF-HSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHS  1341
             + RS +YP++     +NPF  ++  +A+   +YP     ++  NLFP++ +      + S
Sbjct  10    KQRSAIYPEIDQSIPDNPFAQTNPYAASSHNLYPSPSSHNLGPNLFPDHGDASN---NQS  66

Query  1340  PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQW  1161
             PSAPP+A EE L+  PGAIL+LIDK YSVELA GD ++V + QG + VAV A VADEIQW
Sbjct  67    PSAPPQATEEVLIRFPGAILNLIDKSYSVELACGDFTVVRIVQGQNIVAVLANVADEIQW  126

Query  1160  PLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYG  981
             PLTK   + K+D SHYFFS   P        SD +  K               +++LNYG
Sbjct  127   PLTKSEVAAKVDGSHYFFSIHSPKEKGHGSGSDSDDEKKSNSKSE--------DEILNYG  178

Query  980   LTIASKGQDNLIKDLDTILDNCSSFSVHKV----EETASVVMGGPVAKEVSPADLKSEKK  813
             LTIASKGQ+N++ +LD +L +   F+  K+    +ET   V+G  +A   SP +LK E+K
Sbjct  179   LTIASKGQENVLSELDRVLRDYCCFTEQKMSEKAKETGGEVLGNSMAAATSPEELKGERK  238

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
              +V+EG+CAAYWTTLAPN+EDYSS  A+L+ASGSG+LI+GILWCGDVTV+ L+ G+EV++
Sbjct  239   -DVVEGQCAAYWTTLAPNIEDYSSKTAKLIASGSGQLIRGILWCGDVTVERLRKGNEVMK  297

Query  632   NRMTSGSKTE-VSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKK  456
             NR++   K + VSPET++RI+RVKRVT MTEKVATGVLSGVVKVSG  T SVANS  GKK
Sbjct  298   NRLSRAEKDKNVSPETLRRIKRVKRVTQMTEKVATGVLSGVVKVSGLITGSVANSKAGKK  357

Query  455   FLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLE  276
             F GLLPGE++LA+LDGFS+ICDAVEVAGKNVMSTSSTVTT LV+HKYG +AA+AT+EGL+
Sbjct  358   FFGLLPGEIILASLDGFSKICDAVEVAGKNVMSTSSTVTTELVNHKYGTKAAEATNEGLD  417

Query  275   AAGHAMATAWTVFKLRKALNP  213
             AAGHA  TAW  FK+RKALNP
Sbjct  418   AAGHAFGTAWVAFKIRKALNP  438



>ref|XP_010515523.1| PREDICTED: uncharacterized protein LOC104791361 isoform X3 [Camelina 
sativa]
Length=457

 Score =   449 bits (1156),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 244/425 (57%), Positives = 311/425 (73%), Gaps = 16/425 (4%)
 Frame = -1

Query  1469  ENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVP  1293
             +NPF  ++   +   +YP +  +++  NLFP + +      + SPSAPP+A EE L+ VP
Sbjct  21    DNPFAQTNPYPSSPHLYPSLSSQNLGPNLFPHHGDASG---NQSPSAPPQATEEVLIRVP  77

Query  1292  GAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHY  1113
             GAIL+LIDK YSVELA GD ++V + QGD+ VAV A V DEIQWPLTK+  + K+D SHY
Sbjct  78    GAILNLIDKSYSVELACGDFTIVRIIQGDNIVAVLANVGDEIQWPLTKNEVAAKVDGSHY  137

Query  1112  FFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLD  933
             FFS   P                  + +      D  +D+LNYGLTIASKGQ+N++  LD
Sbjct  138   FFSIHPPK------EEGHGSGSDSDDEEGHGSGSDSDDDILNYGLTIASKGQENVLLVLD  191

Query  932   TILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLA  765
              +L + S F+  ++ E A      V+G  V  + SP +LK E+K +V+EG+CAAYWTTLA
Sbjct  192   QVLRDYSCFTEQRMSEKAKEKGEEVLGSSVVAQTSPEELKGERK-DVVEGQCAAYWTTLA  250

Query  764   PNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPET  588
             PNVEDYS + A+++ASGSGKLI+GILWCGDVTV+ L+ G+EV++NR++   K  +VSPET
Sbjct  251   PNVEDYSHNTAKMIASGSGKLIRGILWCGDVTVERLRKGNEVMKNRLSRAEKEKDVSPET  310

Query  587   MKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDG  408
             ++RI+RVKRVT MTEKVATGVLSGVVKVSGF T SVANS  GKK  GLLPGE+VLA+LDG
Sbjct  311   LRRIKRVKRVTQMTEKVATGVLSGVVKVSGFITGSVANSKAGKKLFGLLPGEIVLASLDG  370

Query  407   FSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLR  228
             FS+ICDAVEVAGKNVMSTSSTVTT LV+H+YG +AA+AT+EGL+AAGHA  TAW  FK+R
Sbjct  371   FSKICDAVEVAGKNVMSTSSTVTTELVNHRYGTKAAEATNEGLDAAGHAFGTAWVAFKIR  430

Query  227   KALNP  213
             KALNP
Sbjct  431   KALNP  435



>ref|XP_010515521.1| PREDICTED: uncharacterized protein LOC104791361 isoform X1 [Camelina 
sativa]
 ref|XP_010515522.1| PREDICTED: uncharacterized protein LOC104791361 isoform X2 [Camelina 
sativa]
Length=445

 Score =   449 bits (1154),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 244/425 (57%), Positives = 310/425 (73%), Gaps = 28/425 (7%)
 Frame = -1

Query  1469  ENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVP  1293
             +NPF  ++   +   +YP +  +++  NLFP + +      + SPSAPP+A EE L+ VP
Sbjct  21    DNPFAQTNPYPSSPHLYPSLSSQNLGPNLFPHHGDASG---NQSPSAPPQATEEVLIRVP  77

Query  1292  GAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHY  1113
             GAIL+LIDK YSVELA GD ++V + QGD+ VAV A V DEIQWPLTK+  + K+D SHY
Sbjct  78    GAILNLIDKSYSVELACGDFTIVRIIQGDNIVAVLANVGDEIQWPLTKNEVAAKVDGSHY  137

Query  1112  FFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLD  933
             FFS   P                    +      D  +D+LNYGLTIASKGQ+N++  LD
Sbjct  138   FFSIHPPK------------------EEGHGSGSDSDDDILNYGLTIASKGQENVLLVLD  179

Query  932   TILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLA  765
              +L + S F+  ++ E A      V+G  V  + SP +LK E+K +V+EG+CAAYWTTLA
Sbjct  180   QVLRDYSCFTEQRMSEKAKEKGEEVLGSSVVAQTSPEELKGERK-DVVEGQCAAYWTTLA  238

Query  764   PNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPET  588
             PNVEDYS + A+++ASGSGKLI+GILWCGDVTV+ L+ G+EV++NR++   K  +VSPET
Sbjct  239   PNVEDYSHNTAKMIASGSGKLIRGILWCGDVTVERLRKGNEVMKNRLSRAEKEKDVSPET  298

Query  587   MKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDG  408
             ++RI+RVKRVT MTEKVATGVLSGVVKVSGF T SVANS  GKK  GLLPGE+VLA+LDG
Sbjct  299   LRRIKRVKRVTQMTEKVATGVLSGVVKVSGFITGSVANSKAGKKLFGLLPGEIVLASLDG  358

Query  407   FSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLR  228
             FS+ICDAVEVAGKNVMSTSSTVTT LV+H+YG +AA+AT+EGL+AAGHA  TAW  FK+R
Sbjct  359   FSKICDAVEVAGKNVMSTSSTVTTELVNHRYGTKAAEATNEGLDAAGHAFGTAWVAFKIR  418

Query  227   KALNP  213
             KALNP
Sbjct  419   KALNP  423



>emb|CDY24381.1| BnaA07g03060D [Brassica napus]
Length=449

 Score =   449 bits (1154),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 255/442 (58%), Positives = 323/442 (73%), Gaps = 30/442 (7%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHS  1341
             N+  S +YP V   + E P +  SSS+  S +YP +DM D+  NLFPE  E+     H  
Sbjct  8     NKQSSSLYPTVDMSNPEAPLNPISSSST-SNLYPSLDMNDLANNLFPEQPES-----HSI  61

Query  1340  P-SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQ  1164
             P SAPP A EE +L + GAILHLID+ YSVELA GDL+++ + Q  + VAV ARVADEIQ
Sbjct  62    PVSAPPAATEEVILTISGAILHLIDQSYSVELACGDLAIIRIVQDGNVVAVLARVADEIQ  121

Query  1163  WPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNY  984
             WPLTKD  SVK+D SHYFF+ R P+ D  SDSSDE++                  D+LNY
Sbjct  122   WPLTKDENSVKVDESHYFFTLR-PSKDFGSDSSDEDEDNA---------------DMLNY  165

Query  983   GLTIASKGQDNLIKDLDTILDNCSSFSVHKV----EETASVVMGGPVAKEVSPADLKSEK  816
             GLT+ASKGQ++L+++L+ ILD+ S F+V KV    +ET   V+   VA+E SP +L  E+
Sbjct  166   GLTVASKGQEHLLEELERILDHYSCFTVQKVSEEAKETGEEVLDVTVARETSPVELTGER  225

Query  815   KKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL  636
             K E++E +CAAYWTTLAPNVEDYS   A+L+ASGSG LIKGILWCGDVT D L  G++ +
Sbjct  226   K-EIVEKQCAAYWTTLAPNVEDYSGKTAKLIASGSGHLIKGILWCGDVTTDRLNWGNDFM  284

Query  635   RNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGK  459
             + R++   K  +V P+T+KRI+RVK++T MTE VA GVLSGV+KVSGFFTSSVAN+ VGK
Sbjct  285   KRRLSKAEKERDVHPDTLKRIKRVKKMTKMTESVANGVLSGVIKVSGFFTSSVANTKVGK  344

Query  458   KFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGL  279
             KF  LLPGE+VLATLDGF+++CDAVEVAG+NVMSTSSTV T LV H++G +AA+AT+EGL
Sbjct  345   KFFSLLPGEIVLATLDGFNKVCDAVEVAGRNVMSTSSTVATELVDHRHGGKAAEATNEGL  404

Query  278   EAAGHAMATAWTVFKLRKALNP  213
             EA GHA  TAW  FK+RKA+NP
Sbjct  405   EAVGHAFGTAWAAFKIRKAINP  426



>ref|XP_007046656.1| Senescence/dehydration-associated protein-related, putative isoform 
2 [Theobroma cacao]
 gb|EOX90813.1| Senescence/dehydration-associated protein-related, putative isoform 
2 [Theobroma cacao]
Length=438

 Score =   448 bits (1153),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 247/450 (55%), Positives = 313/450 (70%), Gaps = 50/450 (11%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPE--NYETV  1362
             MASQN   +S +YP+V     + P +SSS++     +YP +DM+D VENLFP+  NY   
Sbjct  1     MASQNPNQKSSLYPEVTQSKPDIPQYSSSNN-----LYPSLDMRDLVENLFPDPPNYSVN  55

Query  1361  QGYYH----HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
             +   H    H+P+APP+AVEE L+ +PGAIL+LIDK YSVELA GD +++ L QG++ VA
Sbjct  56    RHSDHTDSPHAPTAPPQAVEEVLIKIPGAILNLIDKSYSVELACGDFTVIRLWQGENIVA  115

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             V  RVA+EIQWPL K+  +VKLD+SHYFFS +      D ++ ++       + K K K 
Sbjct  116   VLVRVAEEIQWPLMKNETAVKLDDSHYFFSLQL-----DKEAENDSSDSDDDDKKRKTKT  170

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVA--KEVS  840
                G+ +LNYGLT ASKGQ+ L+++LD IL + S F+V KVE+    V+ G VA  KE+S
Sbjct  171   SGEGSCLLNYGLTFASKGQEYLLRELDVILQSYSCFTVQKVEKKGEEVLDGAVAAAKEMS  230

Query  839   PADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDS  660
             PADLKSE KKEV+E +CAAYWTTLAPNVEDYS  AA+++A+GSG LIKGILWCGDVT+D 
Sbjct  231   PADLKSETKKEVMEEKCAAYWTTLAPNVEDYSGRAAKVIAAGSGHLIKGILWCGDVTMDR  290

Query  659   LKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSS  483
             L  G+EVL+ RM+   K  E+SPET+KRI+RVKRVT MT+K A GVLSGVVKVSGF TSS
Sbjct  291   LNKGNEVLKKRMSPAEKNAEISPETLKRIKRVKRVTKMTQKAANGVLSGVVKVSGFVTSS  350

Query  482   VANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEA  303
             VANS VGKKF  LLPGE+VLA+LDG                              YG++A
Sbjct  351   VANSKVGKKFFSLLPGEIVLASLDGL-----------------------------YGEKA  381

Query  302   AKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             A+AT+EGL AAGHA+ TAW  FKLR+ALNP
Sbjct  382   AEATNEGLGAAGHAVGTAWAAFKLRRALNP  411



>ref|XP_009363480.1| PREDICTED: uncharacterized protein LOC103953470 [Pyrus x bretschneideri]
Length=462

 Score =   449 bits (1155),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 249/440 (57%), Positives = 316/440 (72%), Gaps = 27/440 (6%)
 Frame = -1

Query  1499  MYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSPS----  1335
             +YP+++  + E P   +SS+ N   +YP +DMKD+ ENLFP N      Y   +PS    
Sbjct  12    LYPEIIHSNPEAPSIPTSSAPN---LYPSLDMKDLYENLFPRNPNPTYQYQPSAPSEASA  68

Query  1334  ---APPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQ  1164
                APP A EE L+ +PGAI++LID  YSVELA+GD +++ L QGD  VA+ ARV DEIQ
Sbjct  69    PPSAPPVATEEVLIKIPGAIVNLIDTHYSVELASGDFTIIRLVQGDDIVAILARVGDEIQ  128

Query  1163  WPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNY  984
             WPL KD  +VKLD+SHYFFS   P                   G   + + +  ++ LNY
Sbjct  129   WPLAKDEGAVKLDDSHYFFSLYAP------------PDSDSGPGSDPKAKTNDPDNFLNY  176

Query  983   GLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEVSPADLKSEKK  813
             GLTIASKGQ+ L+K+LD IL +  SFSV KV + A      +   +A E SP +L SEKK
Sbjct  177   GLTIASKGQEGLVKELDGILKSYCSFSVQKVSDKAKKKGEALDDTLALETSPEELSSEKK  236

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
             KE LE R AAYWTTLAPNVEDY+  AA+L+A+G+G+LIKGILWCGDVTV+ LK G+EV++
Sbjct  237   KE-LEERSAAYWTTLAPNVEDYNGRAAKLIAAGAGQLIKGILWCGDVTVERLKLGNEVMK  295

Query  632   NRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
              RM   S  EVSP+TM+RI+RVK+V+  T+KVA GVLSGV+KVSG+ TSSV NS +GKKF
Sbjct  296   KRMDPRSNKEVSPQTMRRIKRVKKVSKTTQKVAAGVLSGVLKVSGYLTSSVVNSKLGKKF  355

Query  452   LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
                LPGE++LA+LDGF ++CDAVEVAGKNVMSTSSTVTT LVSH+YG++A KA ++GL+A
Sbjct  356   FRHLPGEILLASLDGFCKVCDAVEVAGKNVMSTSSTVTTDLVSHRYGEQAGKAANDGLDA  415

Query  272   AGHAMATAWTVFKLRKALNP  213
             AGHA+ TAWTVFK+RKALNP
Sbjct  416   AGHAVGTAWTVFKIRKALNP  435



>ref|XP_009121073.1| PREDICTED: uncharacterized protein LOC103845911 [Brassica rapa]
Length=449

 Score =   447 bits (1150),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 254/442 (57%), Positives = 323/442 (73%), Gaps = 30/442 (7%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHS  1341
             N+  S +YP V   + E P +  SSS+  S +YP +DM D+  NLFPE  ET        
Sbjct  8     NKQSSSLYPTVDMSNPEAPLNPISSSST-SNLYPSLDMNDLANNLFPEQPET-----RSI  61

Query  1340  P-SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQ  1164
             P SAPP A EE +L + GAILHLID+ YSVELA GDL+++ + Q  + VAV ARVADEIQ
Sbjct  62    PVSAPPAATEEVILTISGAILHLIDQSYSVELACGDLAIIRIVQDGNVVAVLARVADEIQ  121

Query  1163  WPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNY  984
             WPLTKD  SVK+D SHYFF+ R P+ D  SDSSDE++                  D+LNY
Sbjct  122   WPLTKDENSVKVDESHYFFTLR-PSKDFGSDSSDEDEDNA---------------DMLNY  165

Query  983   GLTIASKGQDNLIKDLDTILDNCSSFSVHKV----EETASVVMGGPVAKEVSPADLKSEK  816
             GLT+ASKGQ++L+++L+ ILD+ S F+V KV    +ET   V+   VA+E SP +L  E+
Sbjct  166   GLTVASKGQEHLLEELERILDHYSCFTVQKVSEEAKETGEEVLDVTVARETSPVELTGER  225

Query  815   KKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL  636
             K E++E +CAAYWTTLAPNVEDYS   A+L+ASGSG LIKGILWCGDVT+D L  G++ +
Sbjct  226   K-EIVEKQCAAYWTTLAPNVEDYSGKTAKLIASGSGHLIKGILWCGDVTMDRLNWGNDFM  284

Query  635   RNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGK  459
             + R++   K  +V P+T+KRI+RVK++T MTE VA GVLSGV+KVSGFFTSSVAN+ VGK
Sbjct  285   KRRLSKAEKERDVHPDTLKRIKRVKKMTKMTESVANGVLSGVIKVSGFFTSSVANTKVGK  344

Query  458   KFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGL  279
             KF  LLPGE+VLATLDGF+++CDAVEVAG+NVM+TSSTV T LV H++G +AA+AT+EGL
Sbjct  345   KFFSLLPGEIVLATLDGFNKVCDAVEVAGRNVMATSSTVATELVDHRHGGKAAEATNEGL  404

Query  278   EAAGHAMATAWTVFKLRKALNP  213
             EA GHA  TAW  FK+RKA+NP
Sbjct  405   EAVGHAFGTAWAAFKIRKAINP  426



>emb|CDP13169.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   447 bits (1151),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 243/444 (55%), Positives = 320/444 (72%), Gaps = 35/444 (8%)
 Frame = -1

Query  1499  MYPKVVDPDFENPFHSSSSSANRSP--------MYPVVDMKDV-ENLFPEN-YETVQGYY  1350
             +YP+V++ + E+     S++  R P        +YP +D+KD+ +NLFP++    VQ   
Sbjct  8     LYPEVIESNPESTSQLLSNADQRRPTSSSSSSSIYPSIDLKDLAQNLFPDDDNHDVQVEI  67

Query  1349  HHSP----SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
                P    S   E+ EE ++ +PGAILHLIDK+ SVELA G LS+V LRQGD+ VAV AR
Sbjct  68    QQGPDSQRSIAFESSEEVIVKIPGAILHLIDKEQSVELANGQLSIVMLRQGDNVVAVLAR  127

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             + DEIQWPL KD A+VKLD SHYFF+ R P    D   S+                    
Sbjct  128   IDDEIQWPLAKDEAAVKLDESHYFFTLRVPPESTDGVGSE--------------------  167

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKS  822
             ++VLNYGLTIA KGQ+ L+++LD +L+  S+F V KV E  +      VAK+VSP +++ 
Sbjct  168   DNVLNYGLTIAGKGQEGLLRELDGVLEKYSAFRVEKVAEKGAAEGWWAVAKDVSPEEMER  227

Query  821   EKKK-EVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD  645
             +KKK E++E   AAYWTTLAPNVEDYS S AR++A+GSG L+KGILWCGDVTVD LK G+
Sbjct  228   DKKKGELVEKSSAAYWTTLAPNVEDYSGSVARMIAAGSGHLVKGILWCGDVTVDRLKWGN  287

Query  644   EVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
             E ++ R+ +G++++VS E ++R++RVK++T M+EK+ATG+LSGVVKVSGFFTSS+ANS  
Sbjct  288   EFVKRRLGAGTESKVSSEALRRMKRVKKMTKMSEKLATGILSGVVKVSGFFTSSIANSKA  347

Query  464   GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
             GKKF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMSTS+ VTT LVS KYG++AA+ T E
Sbjct  348   GKKFFSLLPGEIVLASLDGFNKLCDAVEVAGKNVMSTSAIVTTDLVSQKYGEQAAEVTHE  407

Query  284   GLEAAGHAMATAWTVFKLRKALNP  213
             GL AAGHA+ TAW VFK+RKALNP
Sbjct  408   GLGAAGHAIGTAWAVFKIRKALNP  431



>ref|XP_009757300.1| PREDICTED: uncharacterized protein LOC104210178 [Nicotiana sylvestris]
Length=441

 Score =   447 bits (1149),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 245/446 (55%), Positives = 326/446 (73%), Gaps = 38/446 (9%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVD--PDFENPFHSSS--SSANRSPMYPVVDMKDV-ENLFPENYET  1365
             M+SQN     +YP+V+D  P+  +PF S    S+++ S +YP +DMKD+ ENLFPE  ET
Sbjct  1     MSSQNSNPPKLYPQVIDSNPESTSPFLSQKNPSTSSNSSLYPTIDMKDLAENLFPET-ET  59

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
              Q   + +  +    +E+ ++ +PG I+HLIDK+ S+ELA+G+  +V L+QGD+ VAV A
Sbjct  60    NQPDNNSNFVS----LEQVIVKIPGTIIHLIDKERSIELASGEFEIVQLKQGDNVVAVLA  115

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
             RV D+IQWPL KD A+VKLD SHYFF+ R P+  +D                        
Sbjct  116   RVGDQIQWPLAKDEAAVKLDESHYFFTLRTPSEANDE-----------------------  152

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVV--MGGPVAKEVSPAD  831
              +++LNYGLTIASKGQ+ ++K+LD +L+  S+F V KV++    V       AK+VSP +
Sbjct  153   -DNLLNYGLTIASKGQERVLKELDLVLEKYSAFRVEKVKKDNKGVEEKWWMSAKDVSPEE  211

Query  830   LKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
             +  EKKKE +E   AAYWTTLAPNVEDYSSS AR++A+GSG+L+KGILWCGDVTVD L  
Sbjct  212   M--EKKKEDMERSSAAYWTTLAPNVEDYSSSIARMIAAGSGQLVKGILWCGDVTVDRLNW  269

Query  650   GDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
             G++VL  RM  GS +E+SPE M+R++RVK++T M+E+VATG+LSGVVKVSGFFTSS+ANS
Sbjct  270   GNDVLMKRMGKGSNSEISPEAMRRMKRVKKMTKMSEQVATGLLSGVVKVSGFFTSSIANS  329

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKAT  291
               G+KF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+STVTTGLV  ++GD+AA+ T
Sbjct  330   KAGQKFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSTVTTGLVQQRHGDQAAEMT  389

Query  290   SEGLEAAGHAMATAWTVFKLRKALNP  213
              +G  AAGHA+ TAW VFK+RKALNP
Sbjct  390   RDGFGAAGHAIGTAWAVFKIRKALNP  415



>gb|KHG14503.1| Spartin [Gossypium arboreum]
Length=510

 Score =   448 bits (1152),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 262/496 (53%), Positives = 330/496 (67%), Gaps = 70/496 (14%)
 Frame = -1

Query  1529  MASQNRTR-SPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFP--------  1380
             M SQ  TR S +YP+++     NP     SS++ + +YP +D  D V+NLFP        
Sbjct  1     MDSQYPTRRSSLYPELIQ---TNPGIPQYSSSSSNNLYPTIDKHDFVDNLFPDYPQYSVR  57

Query  1379  --------------ENYE-----------------------TVQGYYHHS-------PSA  1332
                           E+++                       +V G+  +S       P+A
Sbjct  58    HRNDHSAPSFAPTAESFQYSVSHHNGYSDPSFAPTAPSFEYSVSGHNGYSDPSPPLAPTA  117

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLT  1152
             PPEAVEE L+ +PGAI+HLIDK YSVELA G+ S++ L Q +  VAV ARVADEIQWP+T
Sbjct  118   PPEAVEEVLIKIPGAIVHLIDKSYSVELACGEFSVIRLWQDNEIVAVLARVADEIQWPIT  177

Query  1151  KDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI  972
             K   SVKLD+SHYFFS +FP   D  +  D +  K   +          G+D+L+YGLTI
Sbjct  178   KQGTSVKLDDSHYFFSLQFPKEADSIEDGDRKVKKSDDD----------GSDLLSYGLTI  227

Query  971   ASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPV--AKEVSPADLKSEKKKEVLE  798
             ASKGQ++L+   D IL   S F+V KV E    V+ G V  AK  SP DL S  KKE +E
Sbjct  228   ASKGQEDLLSQFDVILQCYSFFTVQKVNEKGEEVLDGAVSAAKNTSPEDLNSGSKKEAME  287

Query  797   GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTS  618
             G+CAAYWTTLAPNVE+YS  AA+++A+GSG+LIKGILWCGDVT+D L  G+EVL+ RMT 
Sbjct  288   GKCAAYWTTLAPNVEEYSGKAAKMIAAGSGQLIKGILWCGDVTIDRLNRGNEVLKTRMTP  347

Query  617   GSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLL  441
               K  E+SPET+KRI+RVK+VT++T KVA G+LSG VKVSG+F+SSVANS +GKK   LL
Sbjct  348   AEKDAEISPETLKRIQRVKKVTTVTHKVAKGLLSGAVKVSGYFSSSVANSKLGKKIFKLL  407

Query  440   PGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHA  261
             PGEMV+ATLDGF +ICDAVE AGKNVMSTSSTVTT  V+ KYG++AA+A SEGL+AAGHA
Sbjct  408   PGEMVIATLDGFDKICDAVEAAGKNVMSTSSTVTTEFVNQKYGEKAAEAASEGLDAAGHA  467

Query  260   MATAWTVFKLRKALNP  213
             + TAW  FK+RKALNP
Sbjct  468   VGTAWAAFKIRKALNP  483



>ref|XP_006412036.1| hypothetical protein EUTSA_v10027489mg, partial [Eutrema salsugineum]
 gb|ESQ53489.1| hypothetical protein EUTSA_v10027489mg, partial [Eutrema salsugineum]
Length=438

 Score =   445 bits (1145),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 252/442 (57%), Positives = 314/442 (71%), Gaps = 37/442 (8%)
 Frame = -1

Query  1520  QNRTRSPMYPKVVDPDFEN---PFHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGY  1353
             ++  R  +YP +VD    N   P  SSSSS+  + +YP +D+ D V N+FPE        
Sbjct  2     ESSARPKLYP-IVDTSTTNAPLPSSSSSSSSTTNNLYPSLDVNDLVNNIFPEQSSV----  56

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
                S SAPP A EE +L V GAILHLIDK YSVELA GDL ++ L QG+  VAVFARVAD
Sbjct  57    ---SASAPPVATEEVILTVKGAILHLIDKSYSVELAVGDLEIIRLVQGEITVAVFARVAD  113

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             EIQWPLT+D  +VK+D SHYFFS R                        KE   +  ND+
Sbjct  114   EIQWPLTRDEPAVKVDESHYFFSLR----------------------PVKESGSEENNDM  151

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHK-VEETASVVMGGPVAKEVSPADLKSEK  816
             LNYGLTIASKGQ+ L++ LD IL + SSF+  K  EE  + V+    AKE SP +LK ++
Sbjct  152   LNYGLTIASKGQEQLLEKLDMILSDYSSFTAEKHKEEDVNNVLDLTAAKETSPEELKGKR  211

Query  815   KKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL  636
             KK V E +C AYWTTLAPNVEDYS  AA+L+A+GSG+LIKGILWCGD+T+D L  G++ +
Sbjct  212   KKMV-EKQCTAYWTTLAPNVEDYSGVAAKLIAAGSGQLIKGILWCGDLTMDRLMWGNDFM  270

Query  635   RNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGK  459
             +  ++   K  EV P+T+KR++RVK++T MTEKVA GVLSGV+KVSGFF+SSV NS+ GK
Sbjct  271   KKNLSKAEKEREVGPKTLKRLKRVKKMTKMTEKVANGVLSGVIKVSGFFSSSVVNSTAGK  330

Query  458   KFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGL  279
             K  GLLPGEMVLATLDGF+++CDAVEVAG+NVM TSSTVTT +V HKYG + A+AT+EGL
Sbjct  331   KLFGLLPGEMVLATLDGFNKVCDAVEVAGRNVMKTSSTVTTEIVDHKYGAKTAQATNEGL  390

Query  278   EAAGHAMATAWTVFKLRKALNP  213
              AAGHA+ TAWTVFK+R+ALNP
Sbjct  391   GAAGHAIGTAWTVFKIRQALNP  412



>ref|XP_006409240.1| hypothetical protein EUTSA_v10022685mg [Eutrema salsugineum]
 gb|ESQ50693.1| hypothetical protein EUTSA_v10022685mg [Eutrema salsugineum]
Length=457

 Score =   444 bits (1142),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 249/446 (56%), Positives = 323/446 (72%), Gaps = 27/446 (6%)
 Frame = -1

Query  1523  SQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYH  1347
             +  +  S +YP V   + E P  + SSS++ S +YP +DM D+  +LFPE  ET      
Sbjct  7     TNEKQSSSLYPTVDMSNPEAPPLNPSSSSSTSNLYPSLDMNDLARDLFPEQPET------  60

Query  1346  HSP---SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVA  1176
              +P   SAPP A EE +L +PGAILHLIDK YSVELA GDL+++ + Q  + VAV ARVA
Sbjct  61    -TPVPVSAPPAAAEEVILTIPGAILHLIDKSYSVELACGDLAIIRIVQDGNVVAVLARVA  119

Query  1175  DEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGND  996
             DEIQWPLTKD  SVK+D SHYFF+ R            ++      + +  EK K+  ND
Sbjct  120   DEIQWPLTKDENSVKVDESHYFFTLR----------PTKDFGTKSSDEEEGEKGKEEEND  169

Query  995   VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKV----EETASVVMGGPVAKEVSPADL  828
             +LNYGLTIASKGQ++L+++L+ IL + S F+V +V    +ET   V+   VA+E SP +L
Sbjct  170   MLNYGLTIASKGQEHLLEELEQILADYSCFTVQQVSEEAKETGEKVLDVTVARETSPVEL  229

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
               E+K E++E +CAAYWTTLAPNVEDYSS  A+L+A+GSG LIKGILWCGDVT+D LK G
Sbjct  230   TGERK-EIVEKQCAAYWTTLAPNVEDYSSKTAKLIATGSGHLIKGILWCGDVTMDRLKWG  288

Query  647   DEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
             ++ ++ R++   K  +V P+T+KRI+RVKR+T MTE VA G+LSGV+KVSGFFTSSVAN+
Sbjct  289   NDFMKRRLSKAEKERDVHPDTLKRIQRVKRMTKMTENVANGILSGVIKVSGFFTSSVANT  348

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKAT  291
              VGKKF  LLPGE+VLA+LDGF+++CDA EVAG+NVMSTSS V T LV HK+G +AA+AT
Sbjct  349   KVGKKFFNLLPGEIVLASLDGFNKVCDAFEVAGRNVMSTSSIVATELVDHKHGGKAAEAT  408

Query  290   SEGLEAAGHAMATAWTVFKLRKALNP  213
             +EGLEA GHA  TAW  FK+RKA+NP
Sbjct  409   NEGLEAVGHAFGTAWAAFKIRKAINP  434



>ref|XP_008788442.1| PREDICTED: uncharacterized protein LOC103706182 [Phoenix dactylifera]
Length=484

 Score =   444 bits (1143),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 254/470 (54%), Positives = 325/470 (69%), Gaps = 48/470 (10%)
 Frame = -1

Query  1532  PMASQNRTRSPMYPKVVD--PDFENPFHSSSSSANRSPMY--------------------  1419
             P +S  R    +YP+V++  P+  + F S  ++ +RSP+Y                    
Sbjct  6     PASSNFRDSKSLYPQVLESNPESGSAFLSHPNNPSRSPLYPSLDDSPPPPRNPNANPSSS  65

Query  1418  ----PVVDMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSV  1254
                 P  +MKD V+NLFP + +        +    P  VEETLL +PGAILHLIDKQ SV
Sbjct  66    SSLYPSTEMKDLVDNLFP-DADDEDPKNPAAAPFLPPPVEETLLRIPGAILHLIDKQCSV  124

Query  1253  ELATGDLSLVSLRQGDSNVAVFARVADE-IQWPLTKDLASVKLDNSHYFFSFRFPNVddd  1077
             EL  G+ ++V +RQG++ VAV AR+ D+ +QWPL +D A+VKLD+SHYFFS   P     
Sbjct  125   ELGAGEFTVVRIRQGENTVAVLARIGDDLVQWPLARDEAAVKLDDSHYFFSLHVPKGAAA  184

Query  1076  sdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVH  897
               ++D+                    D+LNYGLT ASKGQ+ L+K+LD IL++ SSFSVH
Sbjct  185   EAAADDG----------------GSEDLLNYGLTFASKGQEGLLKELDRILESYSSFSVH  228

Query  896   KVEETA-SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMA  720
             KVE  A S V+ G VAKEV+P ++   KK ++LE R AAYWTTLAPNVEDY  S A+++A
Sbjct  229   KVEGKAKSEVLDGSVAKEVTPGEVMGPKK-DMLEERSAAYWTTLAPNVEDYGGSVAKVIA  287

Query  719   SGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTE  543
              GSG+LI+GILWCGDVTVD LK G+++L+ RM  GSK  EVS + +KRI+RVKRVT M+ 
Sbjct  288   KGSGQLIRGILWCGDVTVDRLKWGEDLLKRRMEPGSKQIEVSKDALKRIKRVKRVTKMSA  347

Query  542   KVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNv  363
             KVA+GVLSGVVKVSGFFTSSV NS  GKKF  LLPGE+VLA+LDGF +ICDAVE AGKNV
Sbjct  348   KVASGVLSGVVKVSGFFTSSVVNSKAGKKFFSLLPGEIVLASLDGFEKICDAVEAAGKNV  407

Query  362   mstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             + TSS VTTG+VSH+YG++AA+ T+EGL+AAGHA+ TAW VFK+RKALNP
Sbjct  408   LQTSSVVTTGVVSHRYGEQAAEITNEGLDAAGHAIGTAWAVFKIRKALNP  457



>ref|XP_010547415.1| PREDICTED: uncharacterized protein LOC104819174 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010547416.1| PREDICTED: uncharacterized protein LOC104819174 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010547417.1| PREDICTED: uncharacterized protein LOC104819174 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010547418.1| PREDICTED: uncharacterized protein LOC104819174 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010547419.1| PREDICTED: uncharacterized protein LOC104819174 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010547421.1| PREDICTED: uncharacterized protein LOC104819174 isoform X1 [Tarenaya 
hassleriana]
Length=438

 Score =   442 bits (1136),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 246/449 (55%), Positives = 311/449 (69%), Gaps = 47/449 (10%)
 Frame = -1

Query  1532  PMASQNRTRSPMYPKVVDPDFENPFHSS----SSSANRSPMYPVVDMKDVENLFPENYET  1365
             P     + ++P+YP++      NPF+ +    SSSAN              NLFP+    
Sbjct  4     PHEEDRQKKTPLYPEIDQSIPNNPFYPANPNPSSSAN--------------NLFPQYGCP  49

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
             V     HSPSAPPEA EE L+ V GAIL+LIDK YSVELA GDL++V + QG + VAV A
Sbjct  50    VDA---HSPSAPPEATEEILIRVGGAILNLIDKSYSVELACGDLTVVRIVQGQNIVAVLA  106

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
              VADEIQWPLTK   + K+D SHYFFS R P        ++                   
Sbjct  107   CVADEIQWPLTKTEVATKVDRSHYFFSLRPPKEPGSDSENE-------------------  147

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSP  837
              +++LNYGLTI SKGQ+ L+++L+ IL     ++  ++ E A      V+   +    SP
Sbjct  148   -DEILNYGLTIVSKGQEKLMEELERILTEYCCYTEQRMSEKAKEKGEEVLSNAMVVGTSP  206

Query  836   ADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL  657
              +LK EKK E +EG+CAAYWTTLAPNVE+YS   A+L+A+GSG+LI+GILWCGDVT++ +
Sbjct  207   EELKGEKK-EAVEGQCAAYWTTLAPNVEEYSGRTAQLIATGSGQLIRGILWCGDVTMERI  265

Query  656   KSGDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSV  480
             K G++VL+NR++   K  E+SP+T++RI+RVKRVT MTEKVA GVLSGVVKVSGFFTSSV
Sbjct  266   KRGNDVLKNRLSRAEKEKEISPDTLRRIQRVKRVTKMTEKVANGVLSGVVKVSGFFTSSV  325

Query  479   ANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAA  300
             ANS  GKKF GLLPGE+VLA+LDGF +ICDAVEVAGKNVMSTSSTVTT LV H+YG +AA
Sbjct  326   ANSKAGKKFFGLLPGEIVLASLDGFGKICDAVEVAGKNVMSTSSTVTTELVDHRYGSKAA  385

Query  299   KATSEGLEAAGHAMATAWTVFKLRKALNP  213
             +AT+EG+EAAGHA+ TAW  FK+RKALNP
Sbjct  386   EATNEGIEAAGHALGTAWVAFKIRKALNP  414



>ref|XP_010679910.1| PREDICTED: uncharacterized protein LOC104895177 [Beta vulgaris 
subsp. vulgaris]
Length=464

 Score =   443 bits (1139),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 261/462 (56%), Positives = 322/462 (70%), Gaps = 49/462 (11%)
 Frame = -1

Query  1529  MASQ---NRTRSPMYPKV--VDPDFENPFHSSSSSANR----------SPMYPVVDMKD-  1398
             MASQ   NR R  +YP +   +P + +PF+S++ + N           + +YP + M D 
Sbjct  1     MASQELPNR-RPSLYPDIDQSNPSYSSPFYSNNPNPNSNSNSNSQPSSASLYPSIHMPDM  59

Query  1397  VENLFPENYE-----TVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDL  1233
             VENLFP++Y      +  G     P   PE VEETL+ +PGAI+HLIDK YSVELA G+ 
Sbjct  60    VENLFPDDYRNPNPNSTPGTPSAPPELEPEPVEETLITIPGAIVHLIDKNYSVELAIGNF  119

Query  1232  SLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeek  1053
             S+  +RQG + VA+FA V+DE+QWPL K+ A VK+D+SHYFFSF   N            
Sbjct  120   SIRRIRQGPNVVAIFACVSDEVQWPLIKEEAIVKVDDSHYFFSFSDSN------------  167

Query  1052  skgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV  873
                             G DVLNYGL+ ASKGQ+ L+K+LD I     +FSV  V E +  
Sbjct  168   -------------SKEGGDVLNYGLSFASKGQEVLLKELDGIFQTSGNFSVQSVSEKSRG  214

Query  872   VMGG-PVAKEVSPADLKSEKKKEV-LEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLI  699
              + G  VA E+SP +LKS++ K V +E  C AYWTTLAPNVE+YS +AA+ +A+GSG LI
Sbjct  215   ELAGVGVAGEISPEELKSDENKRVAMERSCGAYWTTLAPNVEEYSGTAAKFIATGSGHLI  274

Query  698   KGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLS  519
             KGILWCGDVTVD LK G EVL+ R+    K E+   TMKRI+RVKR+T MT++VATGVLS
Sbjct  275   KGILWCGDVTVDRLKWGHEVLKKRLDPCEKKEIDKNTMKRIKRVKRMTKMTKQVATGVLS  334

Query  518   GVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvt  339
             GVV+VSGFFTSSVANS  GKKF  LLPGEM+LA+LDGF+RICDAVEVAGKNVMST+STVT
Sbjct  335   GVVRVSGFFTSSVANSKAGKKFFSLLPGEMILASLDGFNRICDAVEVAGKNVMSTTSTVT  394

Query  338   tglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             TGLV+HKYGDEA KAT+EGL AAGHA+ TAWTVFK+RKALNP
Sbjct  395   TGLVTHKYGDEAGKATNEGLGAAGHAIGTAWTVFKIRKALNP  436



>gb|KFK34367.1| hypothetical protein AALP_AA5G136100 [Arabis alpina]
Length=460

 Score =   442 bits (1137),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 249/445 (56%), Positives = 319/445 (72%), Gaps = 20/445 (4%)
 Frame = -1

Query  1523  SQNRTRSPMYPKVVDPDFENPFHSSSS--SANRSPMYPVVDMKDV-ENLFPENYETVQGY  1353
             S  + R  MYP +     +NPF  ++    AN   +YP +   ++   LFP + +     
Sbjct  4     SDGKQRPAMYPDIDQSIPDNPFAQTNPYVPAN---LYPSLSSNNLGPKLFPNHGD---AS  57

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
              + SPSAPP+A EE L+ +PGAIL+LIDK YSVELA GD ++V + QG + VAV A VAD
Sbjct  58    TNQSPSAPPQATEEVLIRIPGAILNLIDKSYSVELACGDFTIVRIVQGPNIVAVLANVAD  117

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             EIQWPLTK   + K+D SHYFFS   P        SD +  K  K  + K +     +++
Sbjct  118   EIQWPLTKSEVAAKVDGSHYFFSIHPPKEKGHGSGSDSDDEKQGKNSRPKSE-----DEI  172

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKV----EETASVVMGGPVAKEVSPADLK  825
             LNYGLT ASKGQ+N++  LD +L +   F+  K+    +ET   V+G  +A   SP +LK
Sbjct  173   LNYGLTFASKGQENVLLVLDQVLRDYCCFTEQKMSDKAKETGEEVLGKSMAAATSPDELK  232

Query  824   SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD  645
              E+K +++EG+CAAYWTTLAPN+EDYSS  A+++ASGS +LI+GILWCGDVTV+ LK G+
Sbjct  233   GERK-DIVEGQCAAYWTTLAPNIEDYSSKTAKMIASGSSQLIRGILWCGDVTVERLKRGN  291

Query  644   EVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
             EV++NR++   K  +VSPET++RI+RVKRVT MTEKVATGVLSGVVKVSGF T S+ANS 
Sbjct  292   EVMKNRLSRAEKEKDVSPETLRRIKRVKRVTQMTEKVATGVLSGVVKVSGFITGSMANSK  351

Query  467   VGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATS  288
              GKKF GLLPGE++LA+LDGFS+ICDAVEVAGKNVMSTSSTVTT LV HKYG +AA+AT+
Sbjct  352   AGKKFFGLLPGEIILASLDGFSKICDAVEVAGKNVMSTSSTVTTELVDHKYGAKAAEATN  411

Query  287   EGLEAAGHAMATAWTVFKLRKALNP  213
             EG++AAGHA  TAW  FKLRKALNP
Sbjct  412   EGMDAAGHAFGTAWVAFKLRKALNP  436



>ref|XP_007203685.1| hypothetical protein PRUPE_ppa004608mg [Prunus persica]
 gb|EMJ04884.1| hypothetical protein PRUPE_ppa004608mg [Prunus persica]
Length=500

 Score =   444 bits (1141),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 259/487 (53%), Positives = 327/487 (67%), Gaps = 62/487 (13%)
 Frame = -1

Query  1529  MASQNRT-RSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYE-TVQ  1359
             MA+ N T + P+YP+V+  + E P   + ++++R+ +YP +DMKD V+NLFPEN      
Sbjct  1     MANPNPTPKHPLYPEVMQSNPEAPSIPNPTASSRN-LYPSLDMKDLVDNLFPENSNINPT  59

Query  1358  GYYHH----------SPSAPPE--------------------------------AVEETL  1305
              +Y H           PSAPP                                 A EE L
Sbjct  60    SHYQHWAQPSAPPSFQPSAPPSFQPSAPPSSQPSVPPPSQPSAPPSSQPSAPAVATEEVL  119

Query  1304  LIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLD  1125
             + +PGAI++LIDK YSVELA+GD +++ L QGD  VAV ARV DEIQWPL K+ ASVKLD
Sbjct  120   IKIPGAIVNLIDKHYSVELASGDFTIIRLVQGDDIVAVLARVGDEIQWPLAKEEASVKLD  179

Query  1124  NSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLI  945
             +SHYFFS   P   +    S  + +                ++ LNYGLTIASKGQ  L+
Sbjct  180   DSHYFFSLYAPPDSESESDSKSKTTTNDP------------DNFLNYGLTIASKGQGGLV  227

Query  944   KDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWT  774
             K LD IL +  SFS  KV + A      +   +A E SP +L S+KKKE LE R AAYWT
Sbjct  228   KQLDEILKSYCSFSEQKVSDKAKKKGEALDDTMALETSPTELISDKKKE-LEERSAAYWT  286

Query  773   TLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSP  594
             TLAPNVEDY+  AA+L+A+GSG+LIKGILWCGDVTV+ LK G+EV++ +M   S  EVSP
Sbjct  287   TLAPNVEDYNGRAAKLIAAGSGQLIKGILWCGDVTVERLKWGNEVMKKKMDPLSNKEVSP  346

Query  593   ETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATL  414
             +TM+RI+RVK V+  T+KVA GVLSGV+KVSG+FTSSV NS VGKKF  LLPGE++LA+L
Sbjct  347   QTMRRIKRVKSVSKTTQKVAAGVLSGVLKVSGYFTSSVVNSKVGKKFFRLLPGEILLASL  406

Query  413   DGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFK  234
             DGF ++CDAVEVAGKNVMSTSSTVTT LVSH+YG++A KA ++GL+AAGHA+ TAWTVFK
Sbjct  407   DGFCKVCDAVEVAGKNVMSTSSTVTTELVSHRYGEQAGKAANDGLDAAGHAIGTAWTVFK  466

Query  233   LRKALNP  213
             +RKALNP
Sbjct  467   IRKALNP  473



>ref|XP_010649007.1| PREDICTED: uncharacterized protein LOC100241964 [Vitis vinifera]
 ref|XP_010649008.1| PREDICTED: uncharacterized protein LOC100241964 [Vitis vinifera]
 ref|XP_010649009.1| PREDICTED: uncharacterized protein LOC100241964 [Vitis vinifera]
Length=437

 Score =   441 bits (1135),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 255/443 (58%), Positives = 321/443 (72%), Gaps = 35/443 (8%)
 Frame = -1

Query  1529  MASQN---RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYETV  1362
             MASQN      + +YP+++  D   P   S+ +++ S +YP +DM+D VENLFPEN    
Sbjct  1     MASQNPNPNKPNSLYPEIIQAD--PPPFISNPNSSSSSLYPSIDMRDLVENLFPEN----  54

Query  1361  QGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
                    P+APPE++EE L+++PG ILHLIDKQYSVELA+GDLS++ L QG++ VAV AR
Sbjct  55    -----PHPTAPPESLEEVLVMLPGVILHLIDKQYSVELASGDLSIIRLWQGNNIVAVLAR  109

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             V  EIQWPL KD ASVK+D SHYFFS R                +        + + + G
Sbjct  110   VGQEIQWPLAKDEASVKVDGSHYFFSLR-------------AMKENGSGSDSSDDEGNEG  156

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKS  822
              + LNYGLTI  KGQ+ L++ LD IL++ SSF+     +   V   G    EV  + L  
Sbjct  157   ENRLNYGLTIVPKGQEPLVEMLDGILEHYSSFT-----KVVDVSKEGMEVLEVKLSPL--  209

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
             EK KE+ E R +AYWTTLAPNVEDYS +AARL+A+GSG+L+KGILWCGDVTVD LK G+E
Sbjct  210   EKDKELSEERSSAYWTTLAPNVEDYSGTAARLIAAGSGQLVKGILWCGDVTVDRLKWGNE  269

Query  641   VLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
              L+ RM+  S TE+SP+TMK ++RV+RVT +TEKVATGVLSGVVKVSGFFT SVANS VG
Sbjct  270   FLKKRMSPASNTEISPQTMKNMKRVERVTLVTEKVATGVLSGVVKVSGFFTGSVANSRVG  329

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
             KKF G +PGEMVLA+LDGFS++CDAVEVAG+NVMSTSSTVTTGLVSH+YG++A +AT+ G
Sbjct  330   KKFFGFMPGEMVLASLDGFSKVCDAVEVAGRNVMSTSSTVTTGLVSHRYGEQAGQATNTG  389

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
             L+AAGHA+  AW VFK+RKA NP
Sbjct  390   LDAAGHAVGAAWAVFKIRKAFNP  412



>ref|XP_004289863.1| PREDICTED: uncharacterized protein LOC101311428 [Fragaria vesca 
subsp. vesca]
Length=429

 Score =   441 bits (1133),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 247/436 (57%), Positives = 314/436 (72%), Gaps = 42/436 (10%)
 Frame = -1

Query  1499  MYPKVV--DPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPEN---YETVQGYYHHSP  1338
             +YP+V+  +PD   P  SSSSS     MYP VD+  + E+LFPEN    ET Q       
Sbjct  7     LYPQVIQTNPDAPKPSSSSSSS-----MYPSVDVAHLAEDLFPENDAVSETNQNL-----  56

Query  1337  SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWP  1158
                 ++ EE L+ +PGAI+HLI+K YS+ELA GDL++V+LRQG + VAV ARV DEIQWP
Sbjct  57    ----QSSEEILVKIPGAIVHLIEKSYSIELACGDLTIVALRQGGNVVAVLARVGDEIQWP  112

Query  1157  LTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGL  978
             L KD A+VKLD+SHYFF+ R P      +                        ++LNYGL
Sbjct  113   LAKDEAAVKLDHSHYFFNLRVPADGSSENGEI---------------------ELLNYGL  151

Query  977   TIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV-VMGGPVAKEVSPADLKSEKKKEVL  801
             TIA+KGQD L+K+LD +L+  S FS  K+E      V+ G VA+E +P DL    +K+++
Sbjct  152   TIATKGQDGLMKELDRVLETYSCFSEQKMEGLEHWDVLDGTVARETTPEDLSCTDRKKLM  211

Query  800   EGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMT  621
                 AAYWTTLAPNVEDYS   AR++ASGSG+LI+GILWCGDVTVD LK G+E L+ RM 
Sbjct  212   GDSSAAYWTTLAPNVEDYSGRCARMIASGSGQLIRGILWCGDVTVDRLKWGNEFLKKRMG  271

Query  620   SGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLL  441
               S +E+SPET+KRI+RVKR+T M+EK+A+G+LSGV+KVSGFFTS++ NS VGKKF  LL
Sbjct  272   PCSSSEISPETLKRIQRVKRLTKMSEKMASGILSGVIKVSGFFTSAIVNSKVGKKFFSLL  331

Query  440   PGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHA  261
             PGE+VLA+LDGFS++CDAVEVAG+NVMSTSS VTTGLVS +YG+ AAK T+EGL+AAG+A
Sbjct  332   PGEIVLASLDGFSKVCDAVEVAGRNVMSTSSVVTTGLVSQRYGEPAAKVTNEGLDAAGYA  391

Query  260   MATAWTVFKLRKALNP  213
             + TAW VFK+RKALNP
Sbjct  392   IGTAWAVFKIRKALNP  407



>ref|XP_009400346.1| PREDICTED: uncharacterized protein LOC103984555 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   442 bits (1136),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 260/463 (56%), Positives = 317/463 (68%), Gaps = 53/463 (11%)
 Frame = -1

Query  1505  SPMYPKVVDPDFE------------------NPFHSSSS--------SANRSPMYPVVDM  1404
             +P+YP+VV+ + E                     HS+ S        + N S +YP VDM
Sbjct  10    APLYPQVVESNPEMHSPFLVSSSSSSRPSLYPSIHSAPSPNSPATGAATNSSSLYPSVDM  69

Query  1403  KD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSL  1227
              D VENLF +  E        +PS PP  VEETLL +PGAILHLID+  SVEL  GD SL
Sbjct  70    SDLVENLFLDAGE--DDAEAKNPSLPP-PVEETLLRIPGAILHLIDRHRSVELGAGDFSL  126

Query  1226  VSLRQGDSNVAVFARVADE-IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeeks  1050
             V LRQGD+ VAV ARV D  +QWPL +D A+VKLD+SHYFFS   P    D    D++ +
Sbjct  127   VRLRQGDNTVAVLARVGDGLVQWPLARDEAAVKLDHSHYFFSLHVPRTSHDDGDHDDDGN  186

Query  1049  kgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVE---ETA  879
                               +LNYGLT ASKGQ+ L+ +LD +L   SSFSV KVE   +  
Sbjct  187   N-----------------LLNYGLTFASKGQEGLLGELDRLLQAFSSFSVQKVEVKGKDH  229

Query  878   SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLI  699
               V+ G VA+EV+PA+    KKK ++E   AAYWTTLAPNVEDY SS A+L+A GSG+LI
Sbjct  230   GEVLDGSVAREVTPAEGMGPKKK-MMEEESAAYWTTLAPNVEDYGSSVAKLIAKGSGQLI  288

Query  698   KGILWCGDVTVDSLKSGDEVLRNRMT-SGSKTEVSPETMKRIRRVKRVTSMTEKVATGVL  522
             KGILWCGDVTVD LK G+++L+ R+  S + TE+S + +KR++RVKRVT M+EKVA GVL
Sbjct  289   KGILWCGDVTVDRLKWGEDLLKKRLEPSSNPTEISKDALKRMKRVKRVTKMSEKVANGVL  348

Query  521   SGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstv  342
             SGVVKVSGFFTSSV NS VGKKF GLLPGE+VLA+LDGF +ICDAVEVAGKNV+ TSS V
Sbjct  349   SGVVKVSGFFTSSVVNSKVGKKFFGLLPGELVLASLDGFGKICDAVEVAGKNVLQTSSVV  408

Query  341   ttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             TTG+VSH+YGD+AA+ T EGL+AAGHA  TAW VFK+RKALNP
Sbjct  409   TTGVVSHRYGDQAAEITHEGLDAAGHAFGTAWAVFKIRKALNP  451



>ref|XP_008242060.1| PREDICTED: uncharacterized protein LOC103340417 [Prunus mume]
Length=508

 Score =   443 bits (1139),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 259/495 (52%), Positives = 326/495 (66%), Gaps = 70/495 (14%)
 Frame = -1

Query  1529  MASQNRT-RSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPE--NYETV  1362
             MA+ N T + P+YP+V+  + E P   + +S++R+ +YP +DMKD V+NLFPE  N    
Sbjct  1     MANPNPTPKHPLYPEVMQSNPEAPSIPNPTSSSRN-LYPSLDMKDLVDNLFPENSNINPT  59

Query  1361  QGYYHHS-------------------------------------------------PSAP  1329
               Y + +                                                 PSAP
Sbjct  60    SHYQYWAQPSAPPSSQPSVPLPSQPSVPRPSQPSVPPPSQPSAPPSSQPSDRPSSQPSAP  119

Query  1328  PEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTK  1149
               A EE L+ +PGAI++LIDKQYSVELA+GD +++ L QGD  VAV ARV DEIQWPL K
Sbjct  120   AVATEEVLIKIPGAIVNLIDKQYSVELASGDFTIIRLVQGDDIVAVLARVGDEIQWPLAK  179

Query  1148  DLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIA  969
             + ASVKL++SHYFFS   P                       +   +  ++ LNYGLTIA
Sbjct  180   EEASVKLNDSHYFFSLYAP------------PDSESGSDSKSKTTTNDPDNFLNYGLTIA  227

Query  968   SKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEVSPADLKSEKKKEVLE  798
             SKGQ  L+K LD IL +  SFS  KV + A      +   +A E SPA+L SEKKKE LE
Sbjct  228   SKGQGGLVKQLDEILKSYCSFSEQKVSDKAKKKGEALDDTMALETSPAELSSEKKKE-LE  286

Query  797   GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTS  618
              R AAYWTTLAPNVEDY+  AA+L+A+GSG+LIKGILWCGDVTV+ LK G+EV++ +M  
Sbjct  287   ERSAAYWTTLAPNVEDYNGRAAKLIAAGSGQLIKGILWCGDVTVERLKWGNEVMKKKMDP  346

Query  617   GSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLP  438
              S  EVSP+TM+RI+RVK V+  T+KVA GVLSGV+KVSG+FTSSV NS VGKKF  LLP
Sbjct  347   LSNKEVSPQTMRRIKRVKSVSKTTQKVAAGVLSGVLKVSGYFTSSVVNSKVGKKFFRLLP  406

Query  437   GEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAM  258
             GE++LA+LDGF ++CDAVEVAGKNVMSTSSTVTT LVSH+YG++A KA ++GL+AAGHA+
Sbjct  407   GEILLASLDGFCKVCDAVEVAGKNVMSTSSTVTTELVSHRYGEQAGKAANDGLDAAGHAI  466

Query  257   ATAWTVFKLRKALNP  213
              TAWTVFK+RKALNP
Sbjct  467   GTAWTVFKIRKALNP  481



>ref|XP_002876076.1| hypothetical protein ARALYDRAFT_485477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52335.1| hypothetical protein ARALYDRAFT_485477 [Arabidopsis lyrata subsp. 
lyrata]
Length=464

 Score =   441 bits (1134),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 245/441 (56%), Positives = 317/441 (72%), Gaps = 17/441 (4%)
 Frame = -1

Query  1514  RTRSPMYPKVVDPDFENPFHSSSSSANRSP-MYPVVDMKDV-ENLFPENYETVQGYYHHS  1341
             + R  MYP+V     +NPF  ++   + SP +YP +   ++  NLFP++ +        S
Sbjct  10    KQRPAMYPQVDQSIPDNPFAHTNPYVSSSPYLYPSLSSHNLGPNLFPDHGDASN---DQS  66

Query  1340  PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQW  1161
             PSAPP+A EE L+ VPGAIL+LIDK YSVELA GD ++V + QG + VAV A V +EIQW
Sbjct  67    PSAPPQATEEVLIRVPGAILNLIDKSYSVELACGDFTIVRIIQGGNIVAVLANVGNEIQW  126

Query  1160  PLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYG  981
             PLT +  + K+D SHYFFS   P          +       + + K+ +    +D+LNYG
Sbjct  127   PLTTNEVAAKVDGSHYFFSIHPPK------EKGQGSGSDSDDEQGKKSKSKSDDDILNYG  180

Query  980   LTIASKGQDNLIKDLDTILDNCSSFSVHKV----EETASVVMGGPVAKEVSPADLKSEKK  813
             LTI SKGQ+N++  LD +L +   F+  K+    +ET   V+G  +    SP +LK E+K
Sbjct  181   LTIVSKGQENVLLVLDQVLRDYCCFTEQKMSEKAKETGEEVLGISMVAATSPEELKGERK  240

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
              +V+EG+CAAYWTTLAPNVEDY+ S A+++ASGSGKLI+GILWCGDVTV+ LK G+EV++
Sbjct  241   -DVVEGQCAAYWTTLAPNVEDYTHSTAKMIASGSGKLIRGILWCGDVTVERLKKGNEVMK  299

Query  632   NRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKK  456
             NR++   K  +VSPET+KRI+RVK+VT MTEKVATGVLSGVVKVSGF T S+ANS  GKK
Sbjct  300   NRLSRAEKEKDVSPETLKRIKRVKKVTQMTEKVATGVLSGVVKVSGFITGSMANSKAGKK  359

Query  455   FLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLE  276
               GLLPGE+VLA+LDGFS+ICDAVEVAGKNVMSTSSTVTT LV+H+YG +AA+AT+EGL+
Sbjct  360   LFGLLPGEIVLASLDGFSKICDAVEVAGKNVMSTSSTVTTELVNHRYGTKAAEATNEGLD  419

Query  275   AAGHAMATAWTVFKLRKALNP  213
             AAGHA  TAW  FK+RKA NP
Sbjct  420   AAGHAFGTAWVAFKIRKAFNP  440



>ref|XP_009138401.1| PREDICTED: uncharacterized protein LOC103862449 [Brassica rapa]
Length=437

 Score =   440 bits (1131),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 295/406 (73%), Gaps = 34/406 (8%)
 Frame = -1

Query  1424  MYPVVDMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVEL  1248
             +YP +D+ D V N+FP+   T         SAPP + EE +L +PGAILHLIDK YSVEL
Sbjct  35    LYPSLDVDDLVNNIFPDQTTTA--------SAPPVSTEEVILTIPGAILHLIDKSYSVEL  86

Query  1247  ATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsds  1068
             A G+L ++ L QGD  VAVFARVADEIQWPLTKD  +VK+D SHYFFS R  N       
Sbjct  87    AVGELQILRLVQGDITVAVFARVADEIQWPLTKDAPAVKVDESHYFFSLRPVNESGSDHP  146

Query  1067  sdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVE  888
             +D                    ND+LNYGLTIASKGQ+ L++ LD IL + SSF+  KVE
Sbjct  147   TD-------------------NNDILNYGLTIASKGQEPLLEKLDEILADYSSFTEEKVE  187

Query  887   ETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSG  708
                   M    AKE SP++L + K+K+++E +C AYWTTLAPNVEDYS  AA+++A+GSG
Sbjct  188   ----TAMDLTAAKETSPSEL-TGKRKKMVEKQCTAYWTTLAPNVEDYSGVAAKMIAAGSG  242

Query  707   KLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVAT  531
             +LIKGILWCGDVT+D L  G++ ++ ++T   K  EVSP T++R++RV+++T MTEKVA 
Sbjct  243   QLIKGILWCGDVTMDRLVWGNDFMKRKLTKAEKEREVSPATLRRLKRVRKMTKMTEKVAK  302

Query  530   GVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmsts  351
             GVLSG VKVSGFFTSSV NS+ GKK  GLLPGEMVLATLDGF+++CDAVEVAGKNVM T+
Sbjct  303   GVLSGAVKVSGFFTSSVVNSAAGKKLFGLLPGEMVLATLDGFNKVCDAVEVAGKNVMKTT  362

Query  350   stvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             STVTT +V HKYG + A+AT+ GL AAGHA+ TAWTVFKLR+ LNP
Sbjct  363   STVTTEIVDHKYGAKTAEATNAGLGAAGHALGTAWTVFKLRQVLNP  408



>ref|XP_004287799.1| PREDICTED: uncharacterized protein LOC101295942 [Fragaria vesca 
subsp. vesca]
Length=494

 Score =   441 bits (1135),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 260/469 (55%), Positives = 331/469 (71%), Gaps = 27/469 (6%)
 Frame = -1

Query  1553  QSPKI-FSPMASQNRTRSPMYPKVV--DPDFENPFHSSSSSANRSPMYPVVDMKDVE-NL  1386
             Q P++ F      NR +  +YP VV  +PD +       S+ N   +YP +DM D+  +L
Sbjct  4     QKPRVHFDDSPDPNR-KPKLYPDVVQSNPDSQPNPKPEPSAPN---LYPSLDMDDLYGDL  59

Query  1385  F---PENYET---VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLV  1224
             F   P  YE     Q      PSAPP A EE L+ +PGAI++LIDK YSVELA+GD ++V
Sbjct  60    FLEDPTYYEIPPESQSQIQEPPSAPPLAAEEVLIRIPGAIVNLIDKDYSVELASGDFTIV  119

Query  1223  SLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskg  1044
              L QGD  VA+ ARV D+IQWPL KD A VKLD+SHYFFS   P   +    + E    G
Sbjct  120   KLVQGDDVVAILARVEDKIQWPLLKDEAVVKLDDSHYFFSLFAPENQESPAPATESGEDG  179

Query  1043  kkegkhkekqkDMG---------NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKV  891
             K + K K+K+K+           ++ LNYGLTI SKGQ+ L+++LD +L +CSSFSV KV
Sbjct  180   KTKKKDKKKKKNEKKEKEKAKDVDNFLNYGLTIPSKGQEKLVRELDEVLKSCSSFSVQKV  239

Query  890   EETASV---VMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMA  720
              E A      +   +A   +P +L +EKK+E +E + AAYWTTLAPNVEDY+ SAA+L+A
Sbjct  240   SEKAKKKGEALDSSLALGTAPGELNAEKKRE-MEEQSAAYWTTLAPNVEDYNGSAAKLIA  298

Query  719   SGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEK  540
             +G+G+LI+GILWCGDVTVD L  G+EVL+ RM  GS+ EVSP+TM+RI+R K+V+  T+K
Sbjct  299   AGTGQLIRGILWCGDVTVDRLNRGNEVLKKRMEPGSQKEVSPQTMRRIKRAKKVSKTTQK  358

Query  539   VATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvm  360
             VAT VLSGV+KVSG+FTS+V NS VGKKF   LPGE++LA LDGF ++CDAVEVAGKNVM
Sbjct  359   VATCVLSGVLKVSGYFTSTVVNSKVGKKFFRHLPGEILLAGLDGFCKVCDAVEVAGKNVM  418

Query  359   stsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             STSSTVTT LVSHKYG+EA KA SEGL+AAGHA+ TAWTV+K+RKALNP
Sbjct  419   STSSTVTTELVSHKYGEEAGKAASEGLDAAGHAIGTAWTVYKIRKALNP  467



>ref|XP_009379375.1| PREDICTED: uncharacterized protein LOC103967792 [Pyrus x bretschneideri]
Length=466

 Score =   440 bits (1131),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 253/458 (55%), Positives = 315/458 (69%), Gaps = 38/458 (8%)
 Frame = -1

Query  1529  MASQNRT-RSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQG  1356
             MA+ N   + P+YP+++  + E P   +SS+ N   +YP +DMKD+ ENLFPE       
Sbjct  1     MANPNLVPKQPLYPEIIQSNPEAPSIPTSSAPN---LYPSLDMKDLYENLFPEYLNPTYQ  57

Query  1355  YYHHSPSAPPE-----------AVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQG  1209
             Y   +P                A EE L+ +PG I++LID  YSVEL +GD +++ L  G
Sbjct  58    YPPSAPPEESAPPEAPPSAPPVATEEVLIKIPGTIVNLIDTHYSVELDSGDFTIIRLVHG  117

Query  1208  DSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegk  1029
             D  VAV ARV DEIQWPL K+  +VKLD+SHYFFS   P                  +  
Sbjct  118   DDIVAVLARVGDEIQWPLAKNEGTVKLDDSHYFFSLYAP---------------PDSDSG  162

Query  1028  hkekqkDMGND---VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VM  867
                  K   ND    LNYGLTIASKGQ+ L+K+LD IL + SSFSV KV + A      +
Sbjct  163   SGSDPKSKANDPDSFLNYGLTIASKGQEGLVKELDGILKSYSSFSVQKVSDKAKRKGEAL  222

Query  866   GGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGIL  687
                +A E SP +L SEKKKE LE R A YWTTLAPNVEDY+  AA+L+A+GSG+LIKGIL
Sbjct  223   DDTLALETSPEELSSEKKKE-LEERSAVYWTTLAPNVEDYNGMAAKLIAAGSGQLIKGIL  281

Query  686   WCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVK  507
             WCGDVTV+ LK G+EV++ RM   S  EVSP+TM+RI+RVK+V+  T+KVA GVLSGV+K
Sbjct  282   WCGDVTVERLKLGNEVMKKRMDPRSNKEVSPQTMRRIKRVKKVSKTTQKVAAGVLSGVLK  341

Query  506   VSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglv  327
             VSGFFTSSV NS VGKKF  LLPGE++LA+LDGF ++CDAVEVAGKNVMSTSSTVTT LV
Sbjct  342   VSGFFTSSVVNSKVGKKFFRLLPGEILLASLDGFCKVCDAVEVAGKNVMSTSSTVTTELV  401

Query  326   SHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             SH+YG++A KA ++GL+AAGHA+ TAWTVFK+RKALNP
Sbjct  402   SHRYGEQAGKAANDGLDAAGHAIGTAWTVFKIRKALNP  439



>ref|XP_011001970.1| PREDICTED: uncharacterized protein LOC105109077 [Populus euphratica]
Length=446

 Score =   439 bits (1129),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 243/436 (56%), Positives = 319/436 (73%), Gaps = 29/436 (7%)
 Frame = -1

Query  1508  RSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSP-S  1335
             RS +YP+V+     NP   S++S+  S +YP + MK++ ENLFPE+          SP  
Sbjct  6     RSSLYPQVI---LSNPETISATSSTPSSLYPTIGMKELAENLFPEDDNNND---LGSPLG  59

Query  1334  APPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPL  1155
             +  E+ EE L+ + G+I+HLI++ +SVELA GD  +VSL+QGD+ VAVFARV D+IQWPL
Sbjct  60    SNSESHEEVLIKISGSIVHLIERDHSVELACGDFFIVSLKQGDTIVAVFARVGDDIQWPL  119

Query  1154  TKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLT  975
               D A+VKLD SHYF + R P  + D    ++ +                  ++LNYG+T
Sbjct  120   ANDEAAVKLDGSHYFITLRVPGNEADRGELNKGEV-----------------ELLNYGVT  162

Query  974   IASKGQDNLIKDLDTILDNCSSFSVHKVEETASV--VMGGPVAKEVSPADLKSEKKKEVL  801
              ASKGQ+ L+K+LD IL+  SSFSV +V+E+     V+ G VA+++SP +L  EKKKE+ 
Sbjct  163   FASKGQEGLLKELDKILECYSSFSVQEVKESGGKWEVVDGSVAEKISPDEL--EKKKELT  220

Query  800   EGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMT  621
             E   AAYWT LAPNVEDYSSS ARL+A+GSG+LIKGILWCGDVTVD LK G+E  + R+ 
Sbjct  221   EKSSAAYWTVLAPNVEDYSSSVARLIAAGSGQLIKGILWCGDVTVDRLKWGNEFFKIRID  280

Query  620   SGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLL  441
               S +++SP T++RI+RVK++T M+E VA G+L+GVVKVSGFFTS + NS VGKKF  L+
Sbjct  281   KSSDSDISPGTLRRIKRVKKLTKMSEGVALGILTGVVKVSGFFTSPIVNSRVGKKFFSLM  340

Query  440   PGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHA  261
             PGE+VLA+LDGF+++CDAVEVAGKNVMSTSS VTTGLVSH+YG+EA KAT+EG +AAGHA
Sbjct  341   PGEIVLASLDGFNKVCDAVEVAGKNVMSTSSIVTTGLVSHRYGEEAGKATNEGFDAAGHA  400

Query  260   MATAWTVFKLRKALNP  213
             + TAW VFK+RKALNP
Sbjct  401   IGTAWAVFKIRKALNP  416



>ref|XP_011001973.1| PREDICTED: uncharacterized protein LOC105109080 [Populus euphratica]
Length=446

 Score =   439 bits (1128),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 244/436 (56%), Positives = 318/436 (73%), Gaps = 29/436 (7%)
 Frame = -1

Query  1508  RSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQ-GYYHHSPS  1335
             RS +YP+V+     NP   S++S+  S +YP + MK++ ENLFPE+      G    S S
Sbjct  6     RSSLYPQVI---LSNPEAISATSSTPSSLYPTIGMKELAENLFPEDDNNNDLGSPLGSNS  62

Query  1334  APPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPL  1155
              P E   E L+ + G+I+HLI++ +SVELA GD  +VSL+QGD+ VAVFARV D+IQWPL
Sbjct  63    EPHE---EVLIKISGSIVHLIERDHSVELACGDFFIVSLKQGDTIVAVFARVGDDIQWPL  119

Query  1154  TKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLT  975
               D A+VKLD SHYF + R P  + D    ++ +                  ++LNYG+T
Sbjct  120   ANDEAAVKLDGSHYFITLRVPGNEADRGELNKGEV-----------------ELLNYGVT  162

Query  974   IASKGQDNLIKDLDTILDNCSSFSVHKVEETASV--VMGGPVAKEVSPADLKSEKKKEVL  801
              ASKGQ+ L+K+LD IL+  SSFSV +V+E+     V+ G VA+++SP +L  EKKKE+ 
Sbjct  163   FASKGQEGLLKELDKILECYSSFSVQEVKESGGKWEVVDGSVAEKISPDEL--EKKKELT  220

Query  800   EGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMT  621
             E   AAYWT LAPNVEDYSSS ARL+A+GSG+LIKGILWCGDVTVD LK G+E  + R+ 
Sbjct  221   EKSSAAYWTVLAPNVEDYSSSVARLIAAGSGQLIKGILWCGDVTVDRLKWGNEFFKIRID  280

Query  620   SGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLL  441
               S +++SP T++RI+RVK++T M+E VA G+L+GVVKVSGFFTS + NS VGKKF  L+
Sbjct  281   KSSDSDISPGTLRRIKRVKKLTKMSEGVALGILTGVVKVSGFFTSPIVNSRVGKKFFSLM  340

Query  440   PGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHA  261
             PGE+VLA+LDGF+++CDAVEVAGKNVMSTSS VTTGLVSH+YG+EA KAT+EG +AAGHA
Sbjct  341   PGEIVLASLDGFNKVCDAVEVAGKNVMSTSSIVTTGLVSHRYGEEAGKATNEGFDAAGHA  400

Query  260   MATAWTVFKLRKALNP  213
             + TAW VFK+RKALNP
Sbjct  401   IGTAWAVFKIRKALNP  416



>ref|NP_179374.1| senescence/dehydration related protein [Arabidopsis thaliana]
 gb|AAK17135.1|AF325067_1 putative senescence-related protein [Arabidopsis thaliana]
 gb|AAL16261.1|AF428331_1 probable senescence related protein [Arabidopsis thaliana]
 gb|AAL91208.1| putative senescence-related protein [Arabidopsis thaliana]
 gb|AAN65117.1| putative senescence-related protein [Arabidopsis thaliana]
 gb|AEC06693.1| senescence/dehydration related protein [Arabidopsis thaliana]
Length=452

 Score =   438 bits (1127),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 247/444 (56%), Positives = 320/444 (72%), Gaps = 23/444 (5%)
 Frame = -1

Query  1526  ASQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYY  1350
             +S ++  S +YP V   + E P + SSSS+  + +YP +DM D+  NLFPE  ET     
Sbjct  3     SSGDKQTSSLYPTVDTSNPEAPINPSSSSSTNN-LYPSLDMNDLARNLFPEQPETSS---  58

Query  1349  HHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADE  1170
                 SAPP A EE +L + GAILHLIDK YSVELA GDL ++ + QG++ VAV A V+DE
Sbjct  59    -IPVSAPPAATEEVILKISGAILHLIDKSYSVELACGDLEIIRIVQGENVVAVLASVSDE  117

Query  1169  IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVL  990
             IQWPLTKD  SVK+D SHYFF+ R             ++       +         N++L
Sbjct  118   IQWPLTKDENSVKVDESHYFFTLR-----------PTKEISHDSSDEEDGDGGKNTNEML  166

Query  989   NYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADLKS  822
             NYGLTIASKGQ++L+ +L+ IL++ SSFSV +V E A      V+   VA+E SP +L  
Sbjct  167   NYGLTIASKGQEHLLVELEKILEDYSSFSVQEVSEEAKEAGEKVLDVTVARETSPVELTG  226

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
             E+K E++E +C+AYWTTLAPNVEDYS  AA+L+A+GSG LIKGILWCGDVT+D L  G+ 
Sbjct  227   ERK-EIVERQCSAYWTTLAPNVEDYSGKAAKLIATGSGHLIKGILWCGDVTMDRLIWGNG  285

Query  641   VLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
              ++ R++   K +EV P+T+KRIRRVKR+T MTE VA  +LSGV+KVSGFFTSSVAN+ V
Sbjct  286   FMKRRLSKAEKESEVHPDTLKRIRRVKRMTKMTESVANSILSGVLKVSGFFTSSVANTKV  345

Query  464   GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
             GKKF  LLPGE++LA+LDGF+++CDAVEVAG+NVMSTSSTVTT LV HKYG +AA+AT+E
Sbjct  346   GKKFFSLLPGEVILASLDGFNKVCDAVEVAGRNVMSTSSTVTTELVDHKYGGKAAEATNE  405

Query  284   GLEAAGHAMATAWTVFKLRKALNP  213
             GL+AAG+A+ TAW  FK+RKA+NP
Sbjct  406   GLDAAGYALGTAWVAFKIRKAINP  429



>emb|CDY47047.1| BnaAnng08350D [Brassica napus]
Length=438

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 246/448 (55%), Positives = 312/448 (70%), Gaps = 46/448 (10%)
 Frame = -1

Query  1550  SPKIFSPMASQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPEN  1374
             +PK++  + +   T  P            P  SSSSS++ + +YP +D+ D V N+FP+ 
Sbjct  6     TPKLYPTIDTSTTTAPP------------PISSSSSSSSTNNLYPSLDVDDLVNNIFPDQ  53

Query  1373  YETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
               T         SAPP + EE +L +PGAILHLIDK YSVELA G+L ++ L QGD  VA
Sbjct  54    TTTA--------SAPPVSTEEVILTIPGAILHLIDKSYSVELAVGELQILRLVQGDITVA  105

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             VFARVADEIQWPLTKD  +VK+D SHYFFS R  N       +D                
Sbjct  106   VFARVADEIQWPLTKDAPAVKVDESHYFFSLRPVNESGSDHPTD----------------  149

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPA  834
                 ND+LNYGLTIASKGQ+ L++ LD IL + SSF+  KVE      M    AKE SP+
Sbjct  150   ---NNDILNYGLTIASKGQEPLLEKLDEILADYSSFTEEKVE----TAMDLTAAKETSPS  202

Query  833   DLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLK  654
             +L + K+K+++E +C AYWT LAPNVEDYS  AA+++A+GSG+LIKGILWCGDVT+D L 
Sbjct  203   EL-TGKRKKMVEKQCTAYWTKLAPNVEDYSGVAAKMIAAGSGQLIKGILWCGDVTMDRLV  261

Query  653   SGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVA  477
              G++ ++ ++T   K  EVSP T++R++RV+++T MTEKVA GVLSG VKVSGFFTSSV 
Sbjct  262   WGNDFMKRKLTKAEKEREVSPATLRRLKRVRKMTKMTEKVAKGVLSGAVKVSGFFTSSVV  321

Query  476   NSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAK  297
             NS+ GKK  GLLPGEMVLATLDGF+++CDAVEVAGKNVM T+STVTT +V HKYG + A+
Sbjct  322   NSAAGKKLFGLLPGEMVLATLDGFNKVCDAVEVAGKNVMKTTSTVTTEIVDHKYGAKTAE  381

Query  296   ATSEGLEAAGHAMATAWTVFKLRKALNP  213
             AT+ GL AAGHA+ TAWTVFKLR+ LNP
Sbjct  382   ATNAGLGAAGHALGTAWTVFKLRQVLNP  409



>emb|CDX77984.1| BnaA09g31790D [Brassica napus]
Length=425

 Score =   437 bits (1124),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 243/443 (55%), Positives = 305/443 (69%), Gaps = 53/443 (12%)
 Frame = -1

Query  1526  ASQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDVENLFPENYETVQGYYH  1347
             A+  + R  MYP++     +NPF  ++   + SP           NL+P    +   +  
Sbjct  7     AADGKQRPAMYPEIDQSIPDNPFAQTNPYVSSSP-----------NLYPPVVSSSPNHGD  55

Query  1346  HS----PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARV  1179
              S    PSAPP+AVEE L+ VPGAIL+LIDK YSVELA GDL++V + QG+S VAV A V
Sbjct  56    SSNNQPPSAPPQAVEEILIRVPGAILNLIDKSYSVELACGDLTIVRIVQGESIVAVLANV  115

Query  1178  ADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGN  999
             ADEIQWPLTK   + K+D SHYFFS   P                       E   D  +
Sbjct  116   ADEIQWPLTKREVATKVDGSHYFFSIHPPK----------------------ESGSDSDD  153

Query  998   DVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSE  819
             ++LNYGLTIASKGQ+N++  LD +L +   F+  ++ E                 +LK E
Sbjct  154   EILNYGLTIASKGQENVLHGLDQVLRDYCCFAEQRMSEKGE--------------ELKGE  199

Query  818   KKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEV  639
             +K +++EG+CAAYWTTLAPN+EDYSS  A+++ASGSG+LI+GILWCGDVTV+ LK G+EV
Sbjct  200   RK-DIVEGQCAAYWTTLAPNIEDYSSKTAKMIASGSGQLIRGILWCGDVTVERLKRGNEV  258

Query  638   LRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
             ++NR++   K  +VSPET++RI+RVKRVT MTEKVATGVLSGVVKVSG  T SVANS  G
Sbjct  259   MKNRLSRAEKEKDVSPETLRRIKRVKRVTQMTEKVATGVLSGVVKVSGLITGSVANSKAG  318

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
             KKF GLLPGE++LA+LDGFS+ICDAVEVAGKNVMSTSSTVTT LV HKYG +AA+AT+EG
Sbjct  319   KKFFGLLPGEIILASLDGFSKICDAVEVAGKNVMSTSSTVTTELVDHKYGTKAAEATNEG  378

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
             L+AAGHA  TAW  FK+RKALNP
Sbjct  379   LDAAGHAFGTAWVAFKIRKALNP  401



>ref|XP_009618139.1| PREDICTED: uncharacterized protein LOC104110370 [Nicotiana tomentosiformis]
Length=438

 Score =   437 bits (1125),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 322/446 (72%), Gaps = 41/446 (9%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVD--PDFENPFHSSSS--SANRSPMYPVVDMKDV-ENLFPENYET  1365
             M+ QN     +YP+V+D  P+  +PF S  +  +++ S +YP +DMKD+ ENLFP+    
Sbjct  1     MSFQNSNPPKLYPQVIDSNPESTSPFLSQKNPSTSSSSSLYPTIDMKDLAENLFPDT---  57

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
                    + +A   ++E+ ++ +PG I+HLIDK+ S+ELA+G   +V L+QGD+ VAV A
Sbjct  58    -----ETNKNADFVSLEQVIVKIPGTIVHLIDKERSIELASGGFEIVQLKQGDNVVAVLA  112

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
             RV D+IQWPL KD A++KLD SHYFF+ R P+  +D                        
Sbjct  113   RVGDQIQWPLAKDEAAIKLDESHYFFTLRIPSEANDE-----------------------  149

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVV--MGGPVAKEVSPAD  831
              +++LNYGLTIASKGQ+ ++K+LD +L+  S+F V KV++    V       AK+VSP +
Sbjct  150   -DNLLNYGLTIASKGQERVLKELDLVLEKYSAFRVEKVKKDNKGVEEKWWMAAKDVSPEE  208

Query  830   LKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
             +  EKKKE +E   AAYWTTLAPNVEDYSSS ARL+A+GSG+L+KGILWCGDVTVD LK 
Sbjct  209   M--EKKKEDMERSSAAYWTTLAPNVEDYSSSIARLIAAGSGQLVKGILWCGDVTVDRLKW  266

Query  650   GDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
             G++VL  RM  GS +E+SP  M+R++RVK++T M+E+VATG+LSGVVKVSGFFTSS+ANS
Sbjct  267   GNDVLMKRMGKGSNSEISPGAMRRMKRVKKMTKMSEQVATGLLSGVVKVSGFFTSSIANS  326

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKAT  291
               G+KF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+STVTTGLV  ++GD+AA+ T
Sbjct  327   KAGQKFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSTVTTGLVQQRHGDQAAEMT  386

Query  290   SEGLEAAGHAMATAWTVFKLRKALNP  213
              +G  AAGHA+ TAW VFK+RKALNP
Sbjct  387   RDGFGAAGHAIGTAWAVFKIRKALNP  412



>ref|XP_010489421.1| PREDICTED: uncharacterized protein LOC104767087 isoform X1 [Camelina 
sativa]
Length=451

 Score =   437 bits (1125),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 250/446 (56%), Positives = 319/446 (72%), Gaps = 28/446 (6%)
 Frame = -1

Query  1526  ASQNRTRSPMYPKV--VDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQG  1356
             +S ++  S +YP V   +P+   P + SSSS++ + +YP +DM D+  NLFPE  ET   
Sbjct  3     SSGDKQASSLYPTVDTSNPEAPPPHNPSSSSSSTNNLYPSLDMNDLARNLFPEQPETNN-  61

Query  1355  YYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVA  1176
                 S SAPP A EE +L + GAILHLIDK YSVELA GDLS++ + QGD  VAV A VA
Sbjct  62    --PSSVSAPPAATEEVILKISGAILHLIDKSYSVELACGDLSIIRIVQGDKVVAVLASVA  119

Query  1175  DEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGND  996
              EIQWPLTKD  SVK+D SHYFF+ R                    E       K   ++
Sbjct  120   GEIQWPLTKDENSVKVDESHYFFTLR----------------PTSDEEDGGAGGKKNSDE  163

Query  995   VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADL  828
             +LNYGLTIASKGQ++L+ DL+ IL++ S F+V +V E A      V+   VA+E SP +L
Sbjct  164   MLNYGLTIASKGQEHLLVDLEKILEDYSCFTVQQVSEEAKEAGEKVLDVTVARETSPVEL  223

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
               E+K E++E +C+AYWTTLAPNVEDYS  AA+L+A+GSG LIKGILWCGDVT+D L  G
Sbjct  224   TGERK-EIVERQCSAYWTTLAPNVEDYSGKAAKLIATGSGHLIKGILWCGDVTMDRLIWG  282

Query  647   DEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
             +  ++ R++   K +EV P+T+KRIRRVK++T MTE VA  VLSGV+KVSGFFTSSVAN+
Sbjct  283   NGFMKRRLSKAEKESEVHPDTLKRIRRVKQMTKMTENVANSVLSGVLKVSGFFTSSVANT  342

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKAT  291
              VGKKF  LLPGE++LA+LDGF+++CDAVEVAG+NVMSTSSTVTT LV HKYG +AA+AT
Sbjct  343   KVGKKFFSLLPGEVILASLDGFNKVCDAVEVAGRNVMSTSSTVTTELVDHKYGGKAAEAT  402

Query  290   SEGLEAAGHAMATAWTVFKLRKALNP  213
             +EGL+AAG+A  TAW  FK+RKA+NP
Sbjct  403   NEGLDAAGYAFGTAWAAFKIRKAINP  428



>ref|XP_010028717.1| PREDICTED: uncharacterized protein LOC104418934 [Eucalyptus grandis]
Length=446

 Score =   437 bits (1124),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 243/448 (54%), Positives = 323/448 (72%), Gaps = 41/448 (9%)
 Frame = -1

Query  1535  SPMASQNRTRSPMYPKVV--DPDFENPFHSSSSSANRSP--MYPVVDMKDV-ENLFPENY  1371
             SP  S+N   +P+YP+V+  +P+  +PF+++ ++++ S   +YP VDM D  ENLFPE+ 
Sbjct  3     SPKRSENPA-NPLYPEVILSNPEATSPFYATPATSSSSSPSLYPPVDMTDAAENLFPES-  60

Query  1370  ETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAV  1191
                    +  PS      EETL+ VPGA++HLI  + S+ELA G+L++V LRQGD+ +AV
Sbjct  61    ----DNLYAQPS------EETLVKVPGAMVHLIQTEKSIELACGELTIVGLRQGDNVIAV  110

Query  1190  FARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqk  1011
              ARV DEIQWPL KD  +VKLD++HYFF+ R P                       +  +
Sbjct  111   LARVGDEIQWPLAKDEPAVKLDDTHYFFTLRVP-------------------ADGGDSDR  151

Query  1010  DMGND--VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSP  837
               G D  +LNYGLT A+KGQD L+K+LD +L+  S FSV +V+E  +  M   VA+E+SP
Sbjct  152   GEGGDFEMLNYGLTFAAKGQDGLLKELDRVLEAYSCFSVQEVKEMENWEM---VARELSP  208

Query  836   ADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL  657
              DL+S++KK+++E   AAYWT LAPNVE+YS   ARL+A+GSG+LIKGILWCGDVTV+ L
Sbjct  209   DDLRSKEKKQLVEENSAAYWTALAPNVEEYSGRVARLIAAGSGQLIKGILWCGDVTVERL  268

Query  656   KSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVA  477
             K  DE LR R+   SK+E+S   M+RI+RVK++T M+E VATG+LSGVVKVSGF T S+ 
Sbjct  269   KWADEFLRRRLGPASKSEISAGAMERIKRVKKLTKMSEDVATGILSGVVKVSGFITGSIV  328

Query  476   NSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAK  297
             NS  GKKF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+S VTTGLVS +YG++AA 
Sbjct  329   NSRAGKKFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSVVTTGLVSQRYGEQAAH  388

Query  296   ATSEGLEAAGHAMATAWTVFKLRKALNP  213
             AT+EGL+AAGHA+ TAW VFK+RKA+NP
Sbjct  389   ATNEGLDAAGHAIGTAWAVFKIRKAINP  416



>ref|XP_002886130.1| early-responsive to dehydration 7 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62389.1| early-responsive to dehydration 7 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   437 bits (1124),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 247/444 (56%), Positives = 320/444 (72%), Gaps = 27/444 (6%)
 Frame = -1

Query  1523  SQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYH  1347
             S ++  S +YP V   + E P + SSSS+  + +YP +DM D+  NLFPE  ET      
Sbjct  4     SGDKQTSSLYPTVDTSNPEAPINPSSSSSTNN-LYPSLDMNDLARNLFPEQPET-----S  57

Query  1346  HSP-SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADE  1170
               P +APP A EE +L + GAILHLID  YSVELA GDLS++ + QG++ VAV ARV DE
Sbjct  58    SVPVAAPPAATEEVILKISGAILHLIDTSYSVELACGDLSIIRIVQGENVVAVLARVGDE  117

Query  1169  IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVL  990
             IQWPLTKD  SVK+D SHYFF+ R                +   +   +E      N++L
Sbjct  118   IQWPLTKDENSVKVDESHYFFTLR-------------PTKEIAHDSSDEEDGAKNTNEML  164

Query  989   NYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADLKS  822
             NYGLTIASKGQ++L+ +L+ IL++ S F+V +V E A      V+   VA+E SP +L  
Sbjct  165   NYGLTIASKGQEHLLVELEKILEDYSCFTVQEVSEEAKEAGEKVLDVTVARETSPVELTG  224

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
             E+K E++E +C+AYWTTLAPNVEDYS  AA+L+A+GSG LIKGILWCGDVT+D L  G+ 
Sbjct  225   ERK-EIVERQCSAYWTTLAPNVEDYSGKAAKLIATGSGHLIKGILWCGDVTMDRLIWGNG  283

Query  641   VLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
              ++ R++   K +EV P+T+KRIRRVKR+T MTE VA  +LSGV+KVSGFFTSSVAN+ V
Sbjct  284   FMKRRLSKAEKESEVHPDTLKRIRRVKRMTKMTESVANSILSGVLKVSGFFTSSVANTKV  343

Query  464   GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
             GKKF  LLPGE++LA+LDGF+++CDAVEVAG+NVMSTSSTVTT LV HKYG +AA+AT+E
Sbjct  344   GKKFFSLLPGEVILASLDGFNKVCDAVEVAGRNVMSTSSTVTTELVDHKYGGKAAEATNE  403

Query  284   GLEAAGHAMATAWTVFKLRKALNP  213
             GL+AAG+A+ TAW  FK+RKA+NP
Sbjct  404   GLDAAGYAIGTAWVAFKIRKAINP  427



>ref|XP_006297674.1| hypothetical protein CARUB_v10013699mg [Capsella rubella]
 gb|EOA30572.1| hypothetical protein CARUB_v10013699mg [Capsella rubella]
Length=446

 Score =   437 bits (1123),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 247/441 (56%), Positives = 315/441 (71%), Gaps = 30/441 (7%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHS  1341
             N+  S +YP V   + E P  + SSS+  + +YP +DM D+  NLFPE  ET       S
Sbjct  7     NKQASSLYPTVDTSNPEAP-RNPSSSSTNNNLYPSLDMNDLARNLFPEQPET----NSSS  61

Query  1340  PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQW  1161
              SAPP A EE +L + GAILHLIDK YSVELA GDLS+  + QG++ VAV A V+DEIQW
Sbjct  62    VSAPPAATEEVILKISGAILHLIDKSYSVELACGDLSITRIVQGENVVAVLASVSDEIQW  121

Query  1160  PLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYG  981
             PLTKD  SVK+D SHYFF+ R                      +         N++LNYG
Sbjct  122   PLTKDENSVKVDESHYFFTLR------------------PTSDEEDGDGSKNTNEMLNYG  163

Query  980   LTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADLKSEKK  813
             LTIASKGQ++L+ +L+ IL++ S F+V +V E A      V+   VA+E SP +L  EKK
Sbjct  164   LTIASKGQEHLLVELEKILEDYSCFTVQQVSEEAKEAGEKVLDVTVARETSPVELTGEKK  223

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
              EV+E +C+AYWTTLAPNVEDYS  AA+L+A+GSG LIKGILWCGDVT+D L  G+  ++
Sbjct  224   -EVVERQCSAYWTTLAPNVEDYSGKAAKLIATGSGHLIKGILWCGDVTMDRLIWGNGFMK  282

Query  632   NRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKK  456
              R++   K +EV P+T+KRI+RVKR+T MTE VA  +LSGV+KVSGFFT++VAN+ VGKK
Sbjct  283   RRLSKAEKESEVHPDTLKRIKRVKRMTKMTENVANSMLSGVLKVSGFFTNAVANNKVGKK  342

Query  455   FLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLE  276
             F  LLPGE+VLA+LDGF++ICDAVEVAG+NVMSTSSTVTT LV HKYG +AA+AT+EGL+
Sbjct  343   FFSLLPGEVVLASLDGFNKICDAVEVAGRNVMSTSSTVTTELVDHKYGGKAAEATNEGLD  402

Query  275   AAGHAMATAWTVFKLRKALNP  213
             AAG+A+ TAW  FK+RKA+NP
Sbjct  403   AAGYAIGTAWVAFKIRKAINP  423



>ref|XP_008337991.1| PREDICTED: uncharacterized protein LOC103401062 [Malus domestica]
Length=466

 Score =   437 bits (1125),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 320/455 (70%), Gaps = 32/455 (7%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQG  1356
             MA+ N  ++  +YP+++  + E P   +SS+ N   +YP +DMKD+ ENLFPE+      
Sbjct  1     MANPNPASKQHLYPEIIHSNPEAPSIPTSSAPN---LYPSLDMKDLYENLFPESPNPTYQ  57

Query  1355  YYHHSPSAPPE-----------AVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQG  1209
             Y+  +P                A EE L+ +PGAI++LID  YSVELA+GD +++ L QG
Sbjct  58    YHPSAPPEASAPPEAPPSAPPVATEEVLIKIPGAIVNLIDTHYSVELASGDFTIIRLVQG  117

Query  1208  DSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegk  1029
             D  VA+ ARV DEIQWPL KD  +VKLD+SHYFFS   P                   G 
Sbjct  118   DDIVAILARVGDEIQWPLAKDEGAVKLDDSHYFFSLYAP------------PDSDSGPGS  165

Query  1028  hkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGP  858
               + + +  ++ LNYGLTIASKGQ+ L+K+LD IL +  SFSV KV + A      +   
Sbjct  166   DAKAKTNDPDNFLNYGLTIASKGQEGLVKELDGILKSYCSFSVQKVSDKAKKKGEALDDT  225

Query  857   VAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCG  678
             +A E SP +L SEKKKE LE R AAYWTTLAPNVEDY+  AA+L+A+GSG+LIKGILWCG
Sbjct  226   LALETSPEELSSEKKKE-LEERSAAYWTTLAPNVEDYNGRAAKLIAAGSGQLIKGILWCG  284

Query  677   DVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSG  498
             DVTV+ LK G+EV++ RM   S  EVSP+TM+RI+RVK+V+  T+KVA GVLSGV+KVSG
Sbjct  285   DVTVERLKLGNEVMKKRMDPRSNKEVSPQTMRRIKRVKKVSKTTQKVAAGVLSGVLKVSG  344

Query  497   FFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHK  318
             + TSSV NS +GKKF   LPGE++LA+LDGF ++CDAVEVAGKNVMSTSSTVTT LVSH+
Sbjct  345   YLTSSVVNSKLGKKFFRHLPGEILLASLDGFCKVCDAVEVAGKNVMSTSSTVTTDLVSHR  404

Query  317   YGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             YG++A KA ++GL+AAGHA+ TAWTVFK+RKALNP
Sbjct  405   YGEQAGKAANDGLDAAGHAVGTAWTVFKIRKALNP  439



>gb|EPS59855.1| hypothetical protein M569_14950, partial [Genlisea aurea]
Length=402

 Score =   435 bits (1118),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 241/389 (62%), Positives = 303/389 (78%), Gaps = 13/389 (3%)
 Frame = -1

Query  1340  PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQW  1161
             PSAPPE +EE+++ +P AILHLIDK YSVELATGDL +V + QGD+ VA FA VAD+IQW
Sbjct  3     PSAPPETLEESVVTIPCAILHLIDKHYSVELATGDLRIVRIVQGDNAVAAFASVADDIQW  62

Query  1160  PLTKDLASVKLDNSHYFFSFRFPN----------Vdddsdssdeekskgkkegkhkekqk  1011
             PLTKD A+VKLD SHYFFSFR P            +D   S+ ++  K KK  + +E+ K
Sbjct  63    PLTKDFAAVKLDCSHYFFSFRPPRQSEDSDSSDDDEDGERSNKKKTKKKKKTKQQQEEDK  122

Query  1010  DMGNDVLNYGLTIASKGQD-NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPA  834
                N+VL+YGLTI S GQ+   +K LD IL++  +FSV KVEE   V + G  A++ + +
Sbjct  123   KEDNEVLSYGLTIVSNGQEERTLKLLDAILEDYCNFSVQKVEEKDVVAVAGASARKTTAS  182

Query  833   DLKS-EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL  657
             +LKS EKKKE ++G+CA YWTTLAPNVE+YS +AARL+A+GSG+L+KGILWCGDVTVD L
Sbjct  183   ELKSNEKKKEEVKGQCAVYWTTLAPNVEEYSGTAARLIAAGSGQLVKGILWCGDVTVDRL  242

Query  656   KSGDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSV  480
               G+EVL+ +M  G++  E+ P+ +KRI+RVKRVT MTEKVA G+LSGVVKVSGFFTSSV
Sbjct  243   NWGNEVLKRKMAPGAEDAEIDPKLLKRIKRVKRVTKMTEKVANGILSGVVKVSGFFTSSV  302

Query  479   ANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAA  300
             ANS +GKK   LLPGE+ LA+LDGF ++CDAVEVAGK+VMSTSSTVTTGLVSH+YG+ A 
Sbjct  303   ANSKMGKKLFSLLPGEIALASLDGFGKVCDAVEVAGKSVMSTSSTVTTGLVSHRYGEAAG  362

Query  299   KATSEGLEAAGHAMATAWTVFKLRKALNP  213
             KA  +G++AAGHA+ TAW VFK+RKALNP
Sbjct  363   KAAGDGMDAAGHAVGTAWAVFKIRKALNP  391



>ref|XP_006856746.1| hypothetical protein AMTR_s00055p00019700 [Amborella trichopoda]
 gb|ERN18213.1| hypothetical protein AMTR_s00055p00019700 [Amborella trichopoda]
Length=470

 Score =   437 bits (1125),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 247/462 (53%), Positives = 321/462 (69%), Gaps = 44/462 (10%)
 Frame = -1

Query  1529  MAS-QNRTRSPMYPKVVD--PDFENPFHSSSSSANRSP-----------------MYPVV  1410
             MAS  N+    +YP V++  P+ ++ F +S  S +  P                 MYP  
Sbjct  1     MASPHNQQPKSLYPTVIETNPERDSAFSTSKPSPSLYPVVGSGPPLTAPSSSAKSMYPSF  60

Query  1409  DMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDL  1233
             DMKD VENLFP+  E  +     +P+APPEA EE L+ VPGA+ HLID Q+S+ELA G L
Sbjct  61    DMKDLVENLFPD--EINEKGSSEAPTAPPEACEEVLVCVPGAVAHLIDGQHSIELACGVL  118

Query  1232  SLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeek  1053
             S+V L QG + +AVFAR+AD+IQWPL KD  +VKLD +HYFF+ R P+            
Sbjct  119   SIVRLVQGPNVIAVFARIADDIQWPLAKDETAVKLDENHYFFTLRVPD------------  166

Query  1052  skgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV  873
                      +E   D  +++++YG+T ASKGQ+NL+K LD IL   S FSV KV + +S 
Sbjct  167   -------SDEEVSTDPSDNIVSYGITFASKGQENLLKKLDGILGQYSCFSVQKVSKGSSE  219

Query  872   VMGGPVAKEVSPADL-KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIK  696
             V+   VAK + P+++  SE+KK+++E   AAYWTTLAPNVEDY+   AR +A+GSG+LIK
Sbjct  220   VLDSSVAKGLEPSEVVSSEEKKKLMEATSAAYWTTLAPNVEDYNGLLARTIAAGSGQLIK  279

Query  695   GILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLS  519
             GILWCGDVTVD LK G++ L+ R    +K  EVS + M+R++RVKR++ M+EKVA+GVLS
Sbjct  280   GILWCGDVTVDRLKWGNDFLKKRTEPNAKPAEVSRQAMRRMKRVKRMSKMSEKVASGVLS  339

Query  518   GVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvt  339
             GV+KVSGFFTSSV NS  GKKF  LLPGE+VLA+LDGF ++CDA EVAGKNV+STSS VT
Sbjct  340   GVLKVSGFFTSSVVNSKAGKKFFSLLPGEIVLASLDGFGKVCDAFEVAGKNVLSTSSVVT  399

Query  338   tglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             TGLVSH+YG+EA + T EGL AAGHA+ TAW VFK+R+ALNP
Sbjct  400   TGLVSHRYGEEAGQITHEGLNAAGHALGTAWAVFKVRQALNP  441



>ref|XP_010413396.1| PREDICTED: uncharacterized protein LOC104699748 isoform X1 [Camelina 
sativa]
 ref|XP_010413404.1| PREDICTED: uncharacterized protein LOC104699748 isoform X2 [Camelina 
sativa]
Length=450

 Score =   437 bits (1123),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 250/445 (56%), Positives = 319/445 (72%), Gaps = 27/445 (6%)
 Frame = -1

Query  1526  ASQNRTRSPMYPKVVDPDFENP-FHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGY  1353
             +S ++  S +YP V   + E P  + SSSS++ + +YP +DM D+  NLFPE  ET    
Sbjct  3     SSGDKQASSLYPAVDTSNPEAPPLNPSSSSSSTNNLYPSLDMNDLARNLFPEQPETNN--  60

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
                S SAPP A EE +L + GAILHLIDK YSVELA GDLS++ + QGD  VAV A VA 
Sbjct  61    -PSSVSAPPAATEEVILKISGAILHLIDKSYSVELACGDLSIIRIVQGDKVVAVLASVAG  119

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             EIQWPLTKD  SVK+D SHYFF+ R                    E       K   +++
Sbjct  120   EIQWPLTKDENSVKVDESHYFFTLR----------------PTSDEEDGDVGGKKNSDEM  163

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADLK  825
             LNYGLTIASKGQ++L+ DL+ IL++ S F+V +V E A     +V+   VA+E SP +L 
Sbjct  164   LNYGLTIASKGQEHLLVDLEKILEDYSCFTVQQVSEEAKEAGEMVLDVTVARETSPVELT  223

Query  824   SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD  645
              E+K E++E +C+AYWTTLAPNVEDYS  AA+L+A+GSG LIKGILWCGDVT+D L  G+
Sbjct  224   GERK-EIVERQCSAYWTTLAPNVEDYSGKAAKLIATGSGHLIKGILWCGDVTMDRLIWGN  282

Query  644   EVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
               ++ R++   K +EV P+T+KRIRRVK++T MTE VA  VLSGV+KVSGFFTSSVAN+ 
Sbjct  283   GFMKRRLSKAEKESEVHPDTLKRIRRVKQMTKMTENVANSVLSGVLKVSGFFTSSVANTK  342

Query  467   VGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATS  288
             VGKKF  LLPGE++LA+LDGF+++CDAVEVAG+NVMSTSSTVTT LV HKYG +AA+AT+
Sbjct  343   VGKKFFSLLPGEVILASLDGFNKVCDAVEVAGRNVMSTSSTVTTELVDHKYGGKAAEATN  402

Query  287   EGLEAAGHAMATAWTVFKLRKALNP  213
             EGL+AAG+A  TAW  FK+RKA+NP
Sbjct  403   EGLDAAGYAFGTAWAAFKIRKAINP  427



>gb|AAM65608.1| putative senescence-associated protein 12 [Arabidopsis thaliana]
Length=452

 Score =   436 bits (1122),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 246/444 (55%), Positives = 319/444 (72%), Gaps = 23/444 (5%)
 Frame = -1

Query  1526  ASQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYY  1350
             +S ++  S +YP V   + E P + SSSS+  + +YP +DM D+  NLFPE  ET     
Sbjct  3     SSGDKQTSSLYPTVDTSNPEAPINPSSSSSTNN-LYPSLDMNDLARNLFPEQPETSS---  58

Query  1349  HHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADE  1170
                 SAPP A EE +L + GAILHLIDK YSVELA GDL ++ + QG++ VAV A V+DE
Sbjct  59    -IPVSAPPAATEEVILKISGAILHLIDKSYSVELACGDLEIIRIVQGENVVAVLASVSDE  117

Query  1169  IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVL  990
             IQWPLTKD  SVK+D SHYFF+ R             ++       +         N++L
Sbjct  118   IQWPLTKDENSVKVDESHYFFTLR-----------PTKEISHDSSDEEDGDGGKNTNEML  166

Query  989   NYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADLKS  822
             NYGLTIASKGQ++L+ +L+ IL++ SSFSV +V E A      V+   VA+E SP +L  
Sbjct  167   NYGLTIASKGQEHLLVELEKILEDYSSFSVQEVSEEAKEAGEKVLDVTVARETSPVELTG  226

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
             E+K E++E +C+AYWTTLAPNVEDYS  AA+L+A+GSG LIK ILWCGDVT+D L  G+ 
Sbjct  227   ERK-EIVERQCSAYWTTLAPNVEDYSGKAAKLIATGSGHLIKRILWCGDVTMDRLIWGNG  285

Query  641   VLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
              ++ R++   K +EV P+T+KRIRRVKR+T MTE VA  +LSGV+KVSGFFTSSVAN+ V
Sbjct  286   FMKRRLSKAEKESEVHPDTLKRIRRVKRITKMTESVANSILSGVLKVSGFFTSSVANTKV  345

Query  464   GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
             GKKF  LLPGE++LA+LDGF+++CDAVEVAG+NVMSTSSTVTT LV HKYG +AA+AT+E
Sbjct  346   GKKFFSLLPGEVILASLDGFNKVCDAVEVAGRNVMSTSSTVTTELVDHKYGGKAAEATNE  405

Query  284   GLEAAGHAMATAWTVFKLRKALNP  213
             GL+AAG+A+ TAW  FK+RKA+NP
Sbjct  406   GLDAAGYALGTAWVAFKIRKAINP  429



>ref|XP_002305512.1| EARLY-RESPONSIVE TO DEHYDRATION 7 family protein [Populus trichocarpa]
 gb|EEE86023.1| EARLY-RESPONSIVE TO DEHYDRATION 7 family protein [Populus trichocarpa]
Length=446

 Score =   435 bits (1119),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 242/436 (56%), Positives = 314/436 (72%), Gaps = 29/436 (7%)
 Frame = -1

Query  1508  RSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQ-GYYHHSPS  1335
             R+ +YP+V+     NP   S++S+  S +YP   MKD+ ENLFPE+      G    S S
Sbjct  6     RNSLYPQVI---LSNPEAISATSSTPSSLYPTTGMKDLAENLFPEDDNNNDLGSPLGSNS  62

Query  1334  APPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPL  1155
              P E   E L+ + G+I+HLI++ +SVELA GD  +VSL+QGD+ VAVFARV D+IQWPL
Sbjct  63    EPHE---EVLIKISGSIVHLIERDHSVELACGDFFIVSLKQGDTIVAVFARVGDDIQWPL  119

Query  1154  TKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLT  975
               D A+VKLD SHYFF+   P  +      ++ +                  ++LNYG+T
Sbjct  120   ANDEAAVKLDGSHYFFTLWVPGNESGRGELNKGEV-----------------ELLNYGVT  162

Query  974   IASKGQDNLIKDLDTILDNCSSFSVHKVEETASV--VMGGPVAKEVSPADLKSEKKKEVL  801
              ASKGQ+ L+K+LD IL+  SSFSV +V E+     V+ G VA+++SP +L  EKKKE+ 
Sbjct  163   FASKGQEGLLKELDKILECYSSFSVQEVNESGGKWEVLDGSVAEKISPDEL--EKKKELT  220

Query  800   EGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMT  621
             E   AAYWT LAPNVEDYSSS ARL+A+GSG+LIKGI WCGDVTVD LK G+E  + R+ 
Sbjct  221   EKSSAAYWTVLAPNVEDYSSSIARLIAAGSGQLIKGIFWCGDVTVDRLKWGNEFFKIRID  280

Query  620   SGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLL  441
               S +++SP T++RI+RVK++T M+E VA G+L+GVVKVSGFFTS + NS VGKKF  L+
Sbjct  281   KSSDSDISPGTLRRIKRVKKLTKMSEGVALGILTGVVKVSGFFTSPIVNSKVGKKFFSLM  340

Query  440   PGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHA  261
             PGE+VLA+LDGF+++CDAVEVAGKNVMSTSS VTTGLVSH+YG+EA KAT+EG +AAGHA
Sbjct  341   PGEIVLASLDGFNKVCDAVEVAGKNVMSTSSIVTTGLVSHRYGEEAGKATNEGFDAAGHA  400

Query  260   MATAWTVFKLRKALNP  213
             + TAW VFK+RKALNP
Sbjct  401   IGTAWAVFKIRKALNP  416



>ref|XP_010413410.1| PREDICTED: uncharacterized protein LOC104699748 isoform X3 [Camelina 
sativa]
Length=467

 Score =   435 bits (1119),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 324/447 (72%), Gaps = 14/447 (3%)
 Frame = -1

Query  1526  ASQNRTRSPMYPKVVDPDFENP-FHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGY  1353
             +S ++  S +YP V   + E P  + SSSS++ + +YP +DM D+  NLFPE  ET    
Sbjct  3     SSGDKQASSLYPAVDTSNPEAPPLNPSSSSSSTNNLYPSLDMNDLARNLFPEQPETNN--  60

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
                S SAPP A EE +L + GAILHLIDK YSVELA GDLS++ + QGD  VAV A VA 
Sbjct  61    -PSSVSAPPAATEEVILKISGAILHLIDKSYSVELACGDLSIIRIVQGDKVVAVLASVAG  119

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGN--  999
             EIQWPLTKD  SVK+D SHYFF+ R P  D++   S    +      +         N  
Sbjct  120   EIQWPLTKDENSVKVDESHYFFTLR-PTSDEEDGDSHYFFTLRPTSDEEDGDVGGKKNSD  178

Query  998   DVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPAD  831
             ++LNYGLTIASKGQ++L+ DL+ IL++ S F+V +V E A     +V+   VA+E SP +
Sbjct  179   EMLNYGLTIASKGQEHLLVDLEKILEDYSCFTVQQVSEEAKEAGEMVLDVTVARETSPVE  238

Query  830   LKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
             L  E+K E++E +C+AYWTTLAPNVEDYS  AA+L+A+GSG LIKGILWCGDVT+D L  
Sbjct  239   LTGERK-EIVERQCSAYWTTLAPNVEDYSGKAAKLIATGSGHLIKGILWCGDVTMDRLIW  297

Query  650   GDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
             G+  ++ R++   K +EV P+T+KRIRRVK++T MTE VA  VLSGV+KVSGFFTSSVAN
Sbjct  298   GNGFMKRRLSKAEKESEVHPDTLKRIRRVKQMTKMTENVANSVLSGVLKVSGFFTSSVAN  357

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             + VGKKF  LLPGE++LA+LDGF+++CDAVEVAG+NVMSTSSTVTT LV HKYG +AA+A
Sbjct  358   TKVGKKFFSLLPGEVILASLDGFNKVCDAVEVAGRNVMSTSSTVTTELVDHKYGGKAAEA  417

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T+EGL+AAG+A  TAW  FK+RKA+NP
Sbjct  418   TNEGLDAAGYAFGTAWAAFKIRKAINP  444



>ref|XP_010090329.1| hypothetical protein L484_024994 [Morus notabilis]
 gb|EXB39299.1| hypothetical protein L484_024994 [Morus notabilis]
Length=451

 Score =   434 bits (1117),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 236/433 (55%), Positives = 313/433 (72%), Gaps = 24/433 (6%)
 Frame = -1

Query  1499  MYPKVV--DPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSPSAP  1329
             +YP+V+  +P+  +P  S  ++   S +YP +DM DV +NLFP++          + S  
Sbjct  12    LYPEVILTNPEATSPLLSKPTTTTSSSLYPAIDMTDVADNLFPDD---------DAVSTH  62

Query  1328  PEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTK  1149
             P   EE L+ +PGA+LHLI+   SVELA GD S+V LRQG + VAV AR+ DEIQWPL K
Sbjct  63    PS--EEVLVTIPGAMLHLIENDNSVELACGDFSVVGLRQGANIVAVLARIGDEIQWPLAK  120

Query  1148  DLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIA  969
             D A+VKLD SHYFF+ R P+ D+ +  SD+ +      G+          +VLNYGLTIA
Sbjct  121   DEATVKLDESHYFFTLRVPSTDEFATESDDGEIVSVAAGQF---------EVLNYGLTIA  171

Query  968   SKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKK-EVLEGR  792
             SKGQ+ L+K+LD IL+  S FS  KV      V+ G VA+E +  +++SE +K E L   
Sbjct  172   SKGQEGLLKELDRILETYSCFSTEKVTGGEFRVLDGAVARETTAEEMRSESEKMERLRES  231

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGS  612
              AAYWTTLAPNVE+Y    A+++A+GSG+LI+GILWCGDVTVD LK GDE LR R+ + S
Sbjct  232   SAAYWTTLAPNVEEYGGRVAKMIAAGSGQLIRGILWCGDVTVDRLKWGDEFLRKRLAATS  291

Query  611   KTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGE  432
                V P T++RI+RVK++T M+E VA G+LSGV+KVSGFFTSS+ NS+VGKKF  L+PGE
Sbjct  292   TATVCPRTLRRIKRVKKLTKMSENVALGILSGVIKVSGFFTSSIVNSAVGKKFFSLMPGE  351

Query  431   MVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMAT  252
             +VLA+LDGFS++CDA+EVAG+NV+ST+S VTTGLVS +YG++A +AT+EGL+AAGHA+ T
Sbjct  352   IVLASLDGFSKVCDAIEVAGRNVISTTSVVTTGLVSQRYGEQAGQATNEGLDAAGHAIGT  411

Query  251   AWTVFKLRKALNP  213
             AW VFK+RKALNP
Sbjct  412   AWAVFKIRKALNP  424



>gb|KFK30231.1| hypothetical protein AALP_AA7G234600 [Arabis alpina]
Length=437

 Score =   434 bits (1115),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 245/438 (56%), Positives = 302/438 (69%), Gaps = 33/438 (8%)
 Frame = -1

Query  1520  QNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGYYHH  1344
             +   R  +YP +      +P   SSS      +YP +DM D V N+FPE   T       
Sbjct  2     ETSIRPKLYPTIDTSPIISPLSRSSS------LYPSLDMNDLVNNIFPEQSPTTA----I  51

Query  1343  SPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQ  1164
             S SAPP A EE +L + GAILHLIDK YSVELA GDL ++ L QGD  VAVFA+VADEIQ
Sbjct  52    SASAPPIATEEVILTIHGAILHLIDKSYSVELAVGDLEILRLVQGDITVAVFAKVADEIQ  111

Query  1163  WPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNY  984
             WPLTKD  +VK+D SHYFFS R  N                   +      D   ++LNY
Sbjct  112   WPLTKDEPAVKVDESHYFFSLRPVN-------------------ESGSSGSDPDEEMLNY  152

Query  983   GLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEV  804
             GLTIASKGQ+  ++ LD IL + SSF+  K +      M    AKE SP +LK ++KK V
Sbjct  153   GLTIASKGQEISLEKLDMILTDYSSFTA-KEDGKGENFMELTAAKETSPEELKGKRKKMV  211

Query  803   LEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRM  624
              E +C AYWTTLAPNVEDYS  AA+++A+GSG+LIKGILWCGD+T+D L  G+E ++ ++
Sbjct  212   -EKQCTAYWTTLAPNVEDYSGVAAKMIATGSGQLIKGILWCGDLTMDRLMWGNEFMKKKL  270

Query  623   TSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLG  447
             T   K  EVS  T+KR++RVK++T MTEKVA GVLSGVVKVSGFF+S+V NS  GKK  G
Sbjct  271   TKAEKEREVSVGTLKRLKRVKKMTKMTEKVANGVLSGVVKVSGFFSSTVINSKAGKKLFG  330

Query  446   LLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAG  267
             LLPGEMVLATLDGF+++CDAVEVAG+NVM TSSTVTT +V HKYG + A+AT+EGL AAG
Sbjct  331   LLPGEMVLATLDGFNKVCDAVEVAGRNVMKTSSTVTTEIVDHKYGAKTAQATNEGLSAAG  390

Query  266   HAMATAWTVFKLRKALNP  213
             HA+ TAWTVFK+R+ALNP
Sbjct  391   HAIGTAWTVFKIRQALNP  408



>gb|KFK40168.1| hypothetical protein AALP_AA3G339500 [Arabis alpina]
Length=438

 Score =   431 bits (1109),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 237/441 (54%), Positives = 315/441 (71%), Gaps = 37/441 (8%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHS  1341
             N+  S +YP V   D  NP  +  SS+  S +YP +DM D+  +LFPE  E+        
Sbjct  6     NKQSSSLYPTV---DTSNP-EAPPSSSTTSNLYPSLDMDDLARDLFPEQQESSTSI---P  58

Query  1340  PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQW  1161
              SAPP A EE +L + GAILHLID+  SVELA GDLS++ L Q  + +AV ARV+DEIQW
Sbjct  59    ISAPPSATEEVILTISGAILHLIDQSNSVELACGDLSILRLVQDGNIIAVLARVSDEIQW  118

Query  1160  PLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYG  981
             PLTKD  SVK+D+SHYFF+ R  +                         +D  +++LNYG
Sbjct  119   PLTKDANSVKVDDSHYFFTLRHDS-----------------------GDEDEEDEMLNYG  155

Query  980   LTIASKGQDNLIKDLDTILDNCSSFSVHKVEETAS----VVMGGPVAKEVSPADLKSEKK  813
             LTIASKGQ++LI++L+ IL + S F+V +V E A      V+   V +E SP +L  E+K
Sbjct  156   LTIASKGQEHLIEELEKILSDYSCFTVQQVSEEAKESGDKVLDVTVVRETSPVELVGERK  215

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
              E++E +CAAYWTTLAPNVEDY+  AA+L+ASGSG LIKGILWCGDV+++ LK G++ ++
Sbjct  216   -EIVEKQCAAYWTTLAPNVEDYNGKAAKLIASGSGHLIKGILWCGDVSINRLKWGNDFMK  274

Query  632   NRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKK  456
              R++   K ++V P+T+KRI+RVKR+T MTE VA G+LSGV+KVSGFFTSSVAN+ VG+K
Sbjct  275   RRLSKAEKESDVHPDTLKRIKRVKRMTKMTENVANGILSGVIKVSGFFTSSVANTKVGRK  334

Query  455   FLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLE  276
             F  LLPGE+VLA+LDGF+++CDAVE+AG+NV+STSSTVTT LV H++G +AA+AT+EGLE
Sbjct  335   FFSLLPGEIVLASLDGFNKVCDAVELAGRNVLSTSSTVTTELVDHRHGGKAAEATNEGLE  394

Query  275   AAGHAMATAWTVFKLRKALNP  213
             A G+A  TAW  FK+RKA+NP
Sbjct  395   AVGYAFGTAWAAFKIRKAINP  415



>dbj|BAB63916.1| ERD7 protein [Arabidopsis thaliana]
Length=441

 Score =   431 bits (1107),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 235/410 (57%), Positives = 300/410 (73%), Gaps = 22/410 (5%)
 Frame = -1

Query  1424  MYPVVDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVEL  1248
             +YP +DM D+  NLFPE  ET         SAPP A EE +L + GAILHLIDK YSVEL
Sbjct  21    LYPSLDMNDLARNLFPEQPET----SSIPVSAPPAATEEVILKISGAILHLIDKSYSVEL  76

Query  1247  ATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsds  1068
             A GDL ++ + QG++ VAV A V+DEIQWPLTKD  SVK+D SHYFF+ R          
Sbjct  77    ACGDLEIIRIVQGENVVAVLASVSDEIQWPLTKDENSVKVDESHYFFTLR----------  126

Query  1067  sdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVE  888
                ++       +         N++LNYGLTIASKGQ++L+ +L+ IL++ SSFSV +V 
Sbjct  127   -PTKEISHDSSDEEDGDGGKNTNEMLNYGLTIASKGQEHLLVELEKILEDYSSFSVQEVS  185

Query  887   ETA----SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMA  720
             E A      V+   VA+E SP +L  E+K E++E +C+AYWTTLAPNVEDYS  AA ++A
Sbjct  186   EEAKEAGEKVLDVTVARETSPVELTGERK-EIVERQCSAYWTTLAPNVEDYSGKAANVIA  244

Query  719   SGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTE  543
             +GSG LIKGILWCGDVT+D L  G+  ++ R++   K +EV P+T+KRIRRVKR+T MTE
Sbjct  245   TGSGHLIKGILWCGDVTMDRLIWGNGFMKRRLSKAEKESEVHPDTLKRIRRVKRMTKMTE  304

Query  542   KVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNv  363
              VA  +LSGV+KVSGFFTSSVAN+ VGKKF  LLPGE++LA+LDGF+++CDAVEVAG+NV
Sbjct  305   SVANSILSGVLKVSGFFTSSVANTKVGKKFFSLLPGEVILASLDGFNKVCDAVEVAGRNV  364

Query  362   mstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             MSTSSTVTT LV HKYG +AA+AT+EGL+AAG+A+ TAW  FK+RKA+NP
Sbjct  365   MSTSSTVTTELVDHKYGGKAAEATNEGLDAAGYALGTAWVAFKIRKAINP  414



>emb|CDX72568.1| BnaC07g45900D [Brassica napus]
Length=618

 Score =   436 bits (1120),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 242/431 (56%), Positives = 306/431 (71%), Gaps = 33/431 (8%)
 Frame = -1

Query  1499  MYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGYYHHSPSAPPE  1323
             +YP +       P   SSSS++ + +YP +D+ D V N+FP+   T       + SAPP 
Sbjct  9     LYPTIDTSTTTAPLPISSSSSSTNNLYPSLDVNDLVNNIFPDQTTT-------TASAPPV  61

Query  1322  AVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDL  1143
             + EE +L + GAILHLIDK YSVELA G+L ++ L QGD  VAVFARVADEIQWPLTKD 
Sbjct  62    STEEVILTIHGAILHLIDKSYSVELAVGELQILRLVQGDITVAVFARVADEIQWPLTKDA  121

Query  1142  ASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASK  963
              +VK+D SHYFFS R  N                   +         ND+LNYGLTIASK
Sbjct  122   PAVKVDESHYFFSLRPVN-------------------ESGSDHPADNNDILNYGLTIASK  162

Query  962   GQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAA  783
             GQ+ L++ LD IL + SSF+  KVE      M    AKE SP++L + K+K+++E +C A
Sbjct  163   GQEPLLEKLDEILADYSSFTEEKVE----TAMDLTAAKETSPSEL-TGKRKKMVEKQCTA  217

Query  782   YWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKT-  606
             YWTTLAPNVEDYS  AA+++A+GSG+LIKGILWCGDVT+D L  G++ ++ ++T   K  
Sbjct  218   YWTTLAPNVEDYSGVAAKMIAAGSGQLIKGILWCGDVTMDRLVWGNDFMKRKLTKAEKER  277

Query  605   EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMV  426
             EVSP T++R++RV+++T MTEKVA GVLSG VKVSGFFTSSV NS+ GKK  GLLPGEMV
Sbjct  278   EVSPATLRRLKRVRKMTKMTEKVAKGVLSGAVKVSGFFTSSVVNSAAGKKLFGLLPGEMV  337

Query  425   LATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAW  246
             LATLDGF+++CDAVEVAGKNVM T+STVTT +V HKYG + A+AT+ GL AAGHA+ TAW
Sbjct  338   LATLDGFNKVCDAVEVAGKNVMKTTSTVTTEIVDHKYGAKTAEATNAGLGAAGHALGTAW  397

Query  245   TVFKLRKALNP  213
             TVFKLR+ LNP
Sbjct  398   TVFKLRQVLNP  408



>ref|XP_004158377.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101218079 
[Cucumis sativus]
Length=428

 Score =   429 bits (1102),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 241/423 (57%), Positives = 310/423 (73%), Gaps = 30/423 (7%)
 Frame = -1

Query  1445  SSANRSP---------MYPVVDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIV  1296
             +S+N+ P         +YP +DMKD+ ENLFP+    V G+ H      P++ E+ LL +
Sbjct  2     ASSNQQPTSSSSSSSSLYPSIDMKDLAENLFPDEDPPVSGHKH------PDSSEQVLLQI  55

Query  1295  PGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSH  1116
             PGAILHLI+KQ S+ELA+G+ S+V L QG++ VAV AR+ D++QWPL KD  +VKLD+SH
Sbjct  56    PGAILHLIEKQNSIELASGEFSIVGLIQGNNVVAVLARIGDQVQWPLAKDEPAVKLDDSH  115

Query  1115  YFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDL  936
             YFF+   P+            +   +       + +   ++LNYGLT+ASKGQ++ +K+L
Sbjct  116   YFFTLSVPS------------NGSSENPDSVAGKANQEPEMLNYGLTVASKGQEDRLKEL  163

Query  935   DTILDNCSSFSVHKVEETASV-VMGGPVAKEVSPADLK-SEKKKEVLEGRCAAYWTTLAP  762
             D ILD  S FSV KV E+A   V+ G VAKE+SP D+  SE+K+E+LE R AAYWTTLAP
Sbjct  164   DRILDQYSCFSVQKVGESAKWEVLDGSVAKEISPEDMAVSEEKRELLEERSAAYWTTLAP  223

Query  761   NVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMK  582
             NV+DYS   ARL+A+GSG++IKGILWCGDVTVD L  G+E ++ RM   S  E+S   MK
Sbjct  224   NVDDYSGKVARLIAAGSGRVIKGILWCGDVTVDRLNWGNEFMKKRMGPRSDVEISSAAMK  283

Query  581   RIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFS  402
              I+ VK++T MTEKVATG+LSGVVKVSGFFTSS+ NS VGKKF  LLPGE+VLA+LDGF+
Sbjct  284   SIKSVKKMTKMTEKVATGILSGVVKVSGFFTSSIVNSKVGKKFFSLLPGEIVLASLDGFN  343

Query  401   RICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKA  222
             ++CDAVEVAGKNVMST+S VTTGLVS +YG+EA KAT+EGL AAGHA+ TAW V K+RKA
Sbjct  344   KVCDAVEVAGKNVMSTTSVVTTGLVSERYGEEAGKATNEGLGAAGHAIGTAWAVLKIRKA  403

Query  221   LNP  213
             LNP
Sbjct  404   LNP  406



>gb|KCW55511.1| hypothetical protein EUGRSUZ_I01404 [Eucalyptus grandis]
Length=630

 Score =   436 bits (1120),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 243/448 (54%), Positives = 323/448 (72%), Gaps = 41/448 (9%)
 Frame = -1

Query  1535  SPMASQNRTRSPMYPKVV--DPDFENPFHSSSSSANRSP--MYPVVDMKDV-ENLFPENY  1371
             SP  S+N   +P+YP+V+  +P+  +PF+++ ++++ S   +YP VDM D  ENLFPE+ 
Sbjct  187   SPKRSENPA-NPLYPEVILSNPEATSPFYATPATSSSSSPSLYPPVDMTDAAENLFPES-  244

Query  1370  ETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAV  1191
                    +  PS      EETL+ VPGA++HLI  + S+ELA G+L++V LRQGD+ +AV
Sbjct  245   ----DNLYAQPS------EETLVKVPGAMVHLIQTEKSIELACGELTIVGLRQGDNVIAV  294

Query  1190  FARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqk  1011
              ARV DEIQWPL KD  +VKLD++HYFF+ R P                       +  +
Sbjct  295   LARVGDEIQWPLAKDEPAVKLDDTHYFFTLRVP-------------------ADGGDSDR  335

Query  1010  DMGND--VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSP  837
               G D  +LNYGLT A+KGQD L+K+LD +L+  S FSV +V+E  +  M   VA+E+SP
Sbjct  336   GEGGDFEMLNYGLTFAAKGQDGLLKELDRVLEAYSCFSVQEVKEMENWEM---VARELSP  392

Query  836   ADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL  657
              DL+S++KK+++E   AAYWT LAPNVE+YS   ARL+A+GSG+LIKGILWCGDVTV+ L
Sbjct  393   DDLRSKEKKQLVEENSAAYWTALAPNVEEYSGRVARLIAAGSGQLIKGILWCGDVTVERL  452

Query  656   KSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVA  477
             K  DE LR R+   SK+E+S   M+RI+RVK++T M+E VATG+LSGVVKVSGF T S+ 
Sbjct  453   KWADEFLRRRLGPASKSEISAGAMERIKRVKKLTKMSEDVATGILSGVVKVSGFITGSIV  512

Query  476   NSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAK  297
             NS  GKKF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+S VTTGLVS +YG++AA 
Sbjct  513   NSRAGKKFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSVVTTGLVSQRYGEQAAH  572

Query  296   ATSEGLEAAGHAMATAWTVFKLRKALNP  213
             AT+EGL+AAGHA+ TAW VFK+RKA+NP
Sbjct  573   ATNEGLDAAGHAIGTAWAVFKIRKAINP  600



>gb|KGN61928.1| hypothetical protein Csa_2G270210 [Cucumis sativus]
Length=428

 Score =   428 bits (1100),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 237/407 (58%), Positives = 304/407 (75%), Gaps = 21/407 (5%)
 Frame = -1

Query  1424  MYPVVDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVEL  1248
             +YP +DMKD+ ENLFP+    V G+ H      P++ E+ LL +PGAILHLI++Q S+EL
Sbjct  18    LYPSIDMKDLAENLFPDEDPPVSGHKH------PDSSEQVLLQIPGAILHLIERQNSIEL  71

Query  1247  ATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsds  1068
             A+G+ S+V L QG++ VAV AR+ D++QWPL KD  +VKLD+SHYFF+   P+       
Sbjct  72    ASGEFSIVGLIQGNNVVAVLARIGDQVQWPLAKDEPAVKLDDSHYFFTLSVPS-------  124

Query  1067  sdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVE  888
                  +   +       + +   ++LNYGLT+ASKGQ++ +K+LD ILD  S FSV KV 
Sbjct  125   -----NGSSENPDSVAGKANQEPEMLNYGLTVASKGQEDRLKELDRILDQYSCFSVQKVG  179

Query  887   ETASV-VMGGPVAKEVSPADLK-SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASG  714
             E+A   V+ G VAKE+SP D+  SE+K+E+LE R AAYWTTLAPNV+DYS   ARL+A+G
Sbjct  180   ESAKWEVLDGSVAKEISPEDMAVSEEKRELLEERSAAYWTTLAPNVDDYSGKVARLIAAG  239

Query  713   SGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVA  534
             SG++IKGILWCGDVTVD L  G+E ++ RM   S  E+S   MK I+ VK++T MTEKVA
Sbjct  240   SGRVIKGILWCGDVTVDRLNWGNEFMKKRMGPRSDVEISSAAMKSIKSVKKMTKMTEKVA  299

Query  533   TGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmst  354
             TG+LSGVVKVSGFFTSS+ NS VGKKF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST
Sbjct  300   TGILSGVVKVSGFFTSSIVNSKVGKKFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMST  359

Query  353   sstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             +S VTTGLVS +YG+EA KAT+EGL AAGHA+ TAW V K+RKALNP
Sbjct  360   TSVVTTGLVSERYGEEAGKATNEGLGAAGHAIGTAWAVLKIRKALNP  406



>ref|XP_002867044.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43303.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=540

 Score =   432 bits (1110),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 244/436 (56%), Positives = 310/436 (71%), Gaps = 27/436 (6%)
 Frame = -1

Query  1511  TRSPMYPKVVDPDFENPF-HSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGYYHHSP  1338
             TR  +YP V       P  +SSSSS   + +YP +D+ D V N+FP+   +       S 
Sbjct  6     TRPKLYPTVDTSTTVAPLPNSSSSSCTNNNLYPSIDVNDLVNNIFPDPTAS------DSA  59

Query  1337  SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWP  1158
             SAPP A EE +L + GA+LHLIDK YSVELA GDL ++ L QGD  VAVFARVADEIQWP
Sbjct  60    SAPPMATEEVILTIHGAMLHLIDKSYSVELACGDLEILRLVQGDITVAVFARVADEIQWP  119

Query  1157  LTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGL  978
             LTKD  +VK+D SHYFFS R                  K+ G       +  N++LNYGL
Sbjct  120   LTKDEPAVKVDESHYFFSLR----------------PVKESGSSDHSINEAENEMLNYGL  163

Query  977   TIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLE  798
             TIASKGQ+ L++ LD IL + SSF+  + ++  +V +    AKE SP +LK ++KK V E
Sbjct  164   TIASKGQEPLLEKLDKILADYSSFTAEENQKEENV-LDLTAAKETSPEELKGKRKKMV-E  221

Query  797   GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTS  618
              +C AYWTTLAPNVEDYS  AA+L+A+GSG+LIKGILWCGD+T+D L  G++ ++ +++ 
Sbjct  222   KQCTAYWTTLAPNVEDYSGVAAKLIAAGSGQLIKGILWCGDLTMDRLMWGNDFMKKKLSK  281

Query  617   GSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLL  441
               K  +VSP T+KR++RVK++T MTEKVA GVLSGVVKVSGFF+SSV NS  G+K  GLL
Sbjct  282   AEKERQVSPGTLKRLKRVKKMTKMTEKVANGVLSGVVKVSGFFSSSVINSKAGQKLFGLL  341

Query  440   PGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHA  261
             PGEMVLATLDGF+++CDAVEVAG+NVM TSS V T +V HKYG + A+AT+EGL AAGHA
Sbjct  342   PGEMVLATLDGFNKVCDAVEVAGRNVMKTSSNVATEIVDHKYGAKTAQATNEGLSAAGHA  401

Query  260   MATAWTVFKLRKALNP  213
             + TAWTVFK+R+ALNP
Sbjct  402   IGTAWTVFKIRQALNP  417



>emb|CDX73738.1| BnaC08g22650D [Brassica napus]
Length=401

 Score =   426 bits (1094),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 234/419 (56%), Positives = 292/419 (70%), Gaps = 44/419 (11%)
 Frame = -1

Query  1466  NPFHSSSSSANRSPMYPVVDMKDVENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGA  1287
             NP H ++    R  MYP +D    +N F +       Y   SP+  P      L+ VPGA
Sbjct  2     NPSHGAADGKQRPAMYPEIDQSIPDNPFAQT----NPYVSSSPNLYPP----ILIRVPGA  53

Query  1286  ILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFF  1107
             IL+LIDK YSVELA GDL++V + QG++ VAV A VADEIQWPLTK   + K+D SHYFF
Sbjct  54    ILNLIDKSYSVELACGDLTIVRIVQGENIVAVLANVADEIQWPLTKREVATKVDGSHYFF  113

Query  1106  SFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTI  927
             S   P                       E   +  +++LNYGLTIASKGQ+N++  LD +
Sbjct  114   SIHPPK----------------------ESGSESDDEILNYGLTIASKGQENVLHGLDQV  151

Query  926   LDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDY  747
             L +   F+  ++ E A               +LK E+K +++EG+CAAYWTTLAPN+EDY
Sbjct  152   LRDYCCFAEQRMSEKAK------------GEELKGERK-DIVEGQCAAYWTTLAPNIEDY  198

Query  746   SSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPETMKRIRR  570
             SS  A+++ASGSG+LI+GILWCGDVTV+ LK G+EV++NR++   K  +VSPET++RI+R
Sbjct  199   SSKTAKMIASGSGQLIRGILWCGDVTVERLKRGNEVMKNRLSRAEKEKDVSPETLRRIKR  258

Query  569   VKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICD  390
             VKRVT MTEKVATGVLSGVVKVSGF T SVANS  GKKF GLLPGE++LA+LDGFS+ICD
Sbjct  259   VKRVTQMTEKVATGVLSGVVKVSGFITGSVANSKAGKKFFGLLPGEIILASLDGFSKICD  318

Query  389   AVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             AVEVAGKNVMSTSSTVTT LV HKYG +AA+AT+EGL+AAGHA  TAW  FK+RKALNP
Sbjct  319   AVEVAGKNVMSTSSTVTTELVDHKYGTKAAEATNEGLDAAGHAFGTAWVAFKIRKALNP  377



>ref|XP_010467581.1| PREDICTED: uncharacterized protein LOC104747614 [Camelina sativa]
Length=449

 Score =   427 bits (1098),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 250/445 (56%), Positives = 320/445 (72%), Gaps = 28/445 (6%)
 Frame = -1

Query  1526  ASQNRTRSPMYPKVVDPDFENP-FHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGY  1353
             +S ++  S +YP V   + E P  + SSSS++ + +YP +DM D+  NLFPE  ET    
Sbjct  3     SSGDKQASSLYPTVDTSNPEAPPLNPSSSSSSTNNLYPSLDMNDLARNLFPEQPET----  58

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
                S SAPP A EE +L + GAILHLIDK YSVELA GDLS++ + QGD+ VAV A VAD
Sbjct  59    NPSSVSAPPAATEEVILKISGAILHLIDKSYSVELACGDLSIIRIVQGDNVVAVVASVAD  118

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             EIQWPLTKD  SVK+D SHYFF+ R                    E       K   +++
Sbjct  119   EIQWPLTKDENSVKVDESHYFFTLR----------------PTSDEEDGDVGGKKNSDEM  162

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADLK  825
             LNYGLTIASKGQ++L+ DL+ IL++ S F+V +V E A      V+   VA+E SP +L 
Sbjct  163   LNYGLTIASKGQEHLLVDLEKILEDYSCFTVQQVSEEAKEAGEKVLDVTVARETSPVELT  222

Query  824   SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD  645
              E+K E++E +C+AYWTTLAPNVEDYS  AA+L+A+GSG LIKGILWCGDVT+D L  G+
Sbjct  223   GERK-EIVERQCSAYWTTLAPNVEDYSGKAAKLIATGSGHLIKGILWCGDVTMDRLIWGN  281

Query  644   EVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
               ++ R++   K +EV P+T+KRIRRVK++T MTE VA  +LSGV+KVSGFFTSSVAN+ 
Sbjct  282   GFMKRRLSKAEKESEVHPDTLKRIRRVKQMTKMTENVANSILSGVLKVSGFFTSSVANTK  341

Query  467   VGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATS  288
             VGKKF  LLPGE++LA+LDGF+++CDAVEVAG+NVMSTSSTVTT LV HKYG +AA+AT+
Sbjct  342   VGKKFFSLLPGEVILASLDGFNKVCDAVEVAGRNVMSTSSTVTTELVDHKYGGKAAEATN  401

Query  287   EGLEAAGHAMATAWTVFKLRKALNP  213
             EGL+AAG+A  TAW  FK+RKA+NP
Sbjct  402   EGLDAAGYAFGTAWAAFKIRKAINP  426



>gb|KHG14924.1| Spartin [Gossypium arboreum]
 gb|KHG19353.1| Spartin [Gossypium arboreum]
Length=439

 Score =   426 bits (1095),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 242/434 (56%), Positives = 316/434 (73%), Gaps = 34/434 (8%)
 Frame = -1

Query  1505  SPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSPSAP  1329
             S +YP+V   D  NP  +SSS ++ S +YP +DMKD+ ENLFP++       + H  SA 
Sbjct  10    SSLYPQV---DLSNPDATSSSPSSSSSLYPSLDMKDLAENLFPDD---ATALHTHQDSA-  62

Query  1328  PEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTK  1149
                 E+ LL VPGAI+HLI+++ SVELA GDL +VSL QGD+ VAVFAR+ D+IQWPL K
Sbjct  63    ----EQLLLKVPGAIVHLIERETSVELACGDLCIVSLLQGDNVVAVFARLGDDIQWPLAK  118

Query  1148  DLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIA  969
             D   VKLD SHYFF+ R P+                       K  +   DVLNYGLTIA
Sbjct  119   DEPVVKLDASHYFFTLRVPS----------------NGSFEDGKDSNQTEDVLNYGLTIA  162

Query  968   SKGQDNLIKDLDTILDNCSSFSVHKVE--ETASVVMGGPVAKEVSPADLKSEKKKEVLEG  795
             +KGQ+ L+K+LD IL+  S FSV +V+  E  ++V     A+ V+P +L  ++K++++ G
Sbjct  163   AKGQEGLLKELDRILETYSCFSVQQVKGIENWNLVD----ARNVAPEELNRKEKRDLIVG  218

Query  794   RCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG  615
                AYWTTLAPNVEDY+ S A+ +ASGSG ++KGILWCGDVTVD LK G++ L  R+ SG
Sbjct  219   SAMAYWTTLAPNVEDYNGSIAKAIASGSGYVVKGILWCGDVTVDRLKWGNDFLSKRIKSG  278

Query  614   SKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPG  435
             S +E+SPE ++R++RVK++T M+EKVATG+LSGVVKVSGFFT S+ NS VGKKF  LLPG
Sbjct  279   STSEISPEALRRMKRVKKLTKMSEKVATGILSGVVKVSGFFTGSIVNSKVGKKFFNLLPG  338

Query  434   EMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMA  255
             E+VLA+LDGF+++CDAVEVAG+NVMST+S VTTGLVS +YG++A K T+EGL+AAGHA+ 
Sbjct  339   EIVLASLDGFNKVCDAVEVAGRNVMSTTSVVTTGLVSQRYGEKAGKVTNEGLDAAGHAIG  398

Query  254   TAWTVFKLRKALNP  213
             TAW VFK+RKALNP
Sbjct  399   TAWAVFKIRKALNP  412



>gb|ACH87168.1| senescence-related protein [Camellia sinensis]
Length=448

 Score =   426 bits (1095),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 246/443 (56%), Positives = 326/443 (74%), Gaps = 28/443 (6%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVDPDFENP--FHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQ  1359
             M+SQN  ++ +YP+V   D  NP    SSSSS + S +YP +DMKD+ ENLFP+N     
Sbjct  1     MSSQN-PKNSLYPQV---DQSNPEAISSSSSSPSSSTIYPSIDMKDLAENLFPDN-----  51

Query  1358  GYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARV  1179
                + +  +  E+ EE L+ VPG I+HLIDK+ SVELA G+L++V L QG + VAV AR+
Sbjct  52    DSQNPNSQSQLESSEEILIRVPGTIVHLIDKEQSVELACGELTIVRLLQGGNVVAVLARI  111

Query  1178  ADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGN  999
              D+IQWPL KD A+VKLD SHYFF+ R P+              G    +  ++      
Sbjct  112   DDQIQWPLAKDEAAVKLDESHYFFTLRVPS------------EAGFDNEEDNDEVNMESE  159

Query  998   DVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSE  819
             ++LNYG+TIASKGQ+ L++  D+IL++ S+FSV KV E    V G  VA+E SP +++SE
Sbjct  160   NLLNYGVTIASKGQEGLLEAFDSILEHYSAFSVQKVSEA---VDGSVVARETSPEEMESE  216

Query  818   KKKEVLE-GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
             ++K  +  G  AAYWTTLAPNVEDYS + AR++A GSG+LIKGILWCGDVTVD LK G+E
Sbjct  217   EEKREMMEGSSAAYWTTLAPNVEDYSGNVARMIAVGSGQLIKGILWCGDVTVDRLKWGNE  276

Query  641   VLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
              L+ ++   S+T++SP+ M+R++RVK +T M+E+VATG+LSGVVKVSGFFTSS+ NSSVG
Sbjct  277   FLKKKLGPASQTKISPQAMRRMKRVKLLTKMSEEVATGILSGVVKVSGFFTSSIVNSSVG  336

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
             KKF  LLPGE+VLA+LDGF+++CDAVEVAG+NVMST+S VTTGLVS +YG++AAK T+EG
Sbjct  337   KKFFSLLPGEIVLASLDGFNKVCDAVEVAGRNVMSTTSVVTTGLVSQRYGEQAAKVTNEG  396

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
              +AAGHA+  AW VFK+RKALNP
Sbjct  397   FDAAGHAIGIAWAVFKIRKALNP  419



>ref|XP_006283732.1| hypothetical protein CARUB_v10004804mg [Capsella rubella]
 gb|EOA16630.1| hypothetical protein CARUB_v10004804mg [Capsella rubella]
Length=446

 Score =   426 bits (1095),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 236/408 (58%), Positives = 294/408 (72%), Gaps = 30/408 (7%)
 Frame = -1

Query  1424  MYPVVDMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVEL  1248
             +YP V + D V N+FP+   +       S SAPP A EE LL + GAI+HLIDK YSVEL
Sbjct  36    LYPSVHVNDLVNNIFPDPTAS------DSASAPPLATEEVLLKIHGAIIHLIDKSYSVEL  89

Query  1247  ATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsds  1068
             A GDL +V L QGD  VAV ARV DEIQWPLTKD  +VK+D SHYFFS R          
Sbjct  90    ACGDLEIVRLVQGDITVAVLARVGDEIQWPLTKDEPAVKVDESHYFFSLR----------  139

Query  1067  sdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVH--K  894
                     K+ G       +  +D+LNYGLTIASKGQ+ L++ LD +L +CSSF+    K
Sbjct  140   ------PVKETGSSDHSTDEAEDDMLNYGLTIASKGQEPLLEQLDKVLADCSSFTAEEKK  193

Query  893   VEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASG  714
              EE    V+    AKE SP +LK ++KK V + +C AYWTTLAPNVEDYS  AA+++A+G
Sbjct  194   KEEN---VLDLTAAKETSPEELKGKRKKMV-QKQCTAYWTTLAPNVEDYSGVAAKMIAAG  249

Query  713   SGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKV  537
             SG+LIKGILWCGDVT+D L  G++ ++ +++   K  EVSP T+K ++RV+++T MT+KV
Sbjct  250   SGQLIKGILWCGDVTMDRLMWGNDFMKRKLSKAEKEREVSPSTLKLLKRVRKMTKMTDKV  309

Query  536   ATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvms  357
             A GVLSGVVKVSGFF+SSV NS  GKK  GLLPGEMVLATLDGFS++CDAVEVAG+NVM 
Sbjct  310   ANGVLSGVVKVSGFFSSSVINSKAGKKIFGLLPGEMVLATLDGFSKVCDAVEVAGRNVMK  369

Query  356   tsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             TSSTVTT +V HKYG + A+AT+EGL AAGHA+ TAW+VFK+R+ALNP
Sbjct  370   TSSTVTTEIVDHKYGAKTAQATNEGLSAAGHAIGTAWSVFKIRQALNP  417



>gb|KCW56616.1| hypothetical protein EUGRSUZ_I02336 [Eucalyptus grandis]
Length=450

 Score =   426 bits (1094),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 253/464 (55%), Positives = 310/464 (67%), Gaps = 71/464 (15%)
 Frame = -1

Query  1523  SQNRTRSPMYPKV--VDPDFENPF-----HSSSSSANRSPMYPVVDMKDV-ENLFPENYE  1368
             S   ++  +YP V   +PD  +PF     +     A  S +YP +DMKD+ ENLFP+   
Sbjct  2     SSRASKPSLYPDVPRSNPDSSSPFVSNPNNPPDPPAPSSNLYPSLDMKDLHENLFPDPTY  61

Query  1367  TVQGYYHH------------------SPSAPPEAVEETLLIVPGAILHLIDKQYSVELAT  1242
                   H                   SPSAP ++ EE LL VPGAILHLIDK+YSVEL  
Sbjct  62    GYDPSSHRGGPGLDAAAAAAAEDDLRSPSAPLDSSEEVLLRVPGAILHLIDKEYSVELGC  121

Query  1241  GDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssd  1062
             GD SL++LRQG++ VAV ARVADE QWPLTKD A+VK+D+SHYFFS   P          
Sbjct  122   GDFSLIALRQGENAVAVLARVADEAQWPLTKDGAAVKVDDSHYFFSL--PTTRGKKGGGA  179

Query  1061  eekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEET  882
                                 +D LNYGLT ASKGQ+ ++++LD IL+             
Sbjct  180   S-------------------DDPLNYGLTFASKGQEGVLRELDAILE-------------  207

Query  881   ASVVMGGPVAKEVSPADLKSE-KKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGK  705
                       K  SP DL+S+ KKKE++E +C AYWTTLAPNVEDYS + A+L+A+GSG+
Sbjct  208   ----------KRTSPVDLQSDGKKKEIMEDKCRAYWTTLAPNVEDYSGTTAKLIAAGSGQ  257

Query  704   LIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGV  525
             LIKGILWCGDVTVD L  G+EV++ RMT   K E+  +T+KR++R K++T MTEKVATGV
Sbjct  258   LIKGILWCGDVTVDRLNWGNEVMKKRMTPAEKAEIDKKTLKRLKRAKKMTRMTEKVATGV  317

Query  524   LSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsst  345
             LSGVV+VSGF TSSV NSSVGKKF GLLPGEMVLA+LDGF+++CDAVEVAG+NVM+TSST
Sbjct  318   LSGVVRVSGFVTSSVVNSSVGKKFFGLLPGEMVLASLDGFNKVCDAVEVAGRNVMATSST  377

Query  344   vttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             VTTGLVSH+YG+EA KAT EGL AAGHAM TAW VFK+RKA NP
Sbjct  378   VTTGLVSHRYGEEAGKATHEGLHAAGHAMGTAWAVFKIRKAFNP  421



>ref|XP_008457682.1| PREDICTED: uncharacterized protein LOC103497324 [Cucumis melo]
Length=428

 Score =   422 bits (1086),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 236/402 (59%), Positives = 302/402 (75%), Gaps = 21/402 (5%)
 Frame = -1

Query  1409  DMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDL  1233
             DMKD+ ENLFP+    V G+ H      P++ E+ LL +PGAILHLI++Q S+ELA+G+ 
Sbjct  21    DMKDLAENLFPDEDPPVSGHKH------PDSSEQVLLQIPGAILHLIERQNSIELASGEF  74

Query  1232  SLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeek  1053
             S+V L QG++ VAV AR+ D++QWPL KD  +VKLD+SHYFF+   P+            
Sbjct  75    SIVGLIQGNNVVAVLARIGDQVQWPLAKDEPAVKLDDSHYFFTLSVPS------------  122

Query  1052  skgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV  873
             +   +       + +   ++LNYGLT+ASKGQ++ +K+LD ILD  S FSV K+EE+A  
Sbjct  123   NGLSENPDSVAGKANQEPEMLNYGLTVASKGQEDRLKELDRILDQYSCFSVQKMEESARW  182

Query  872   -VMGGPVAKEVSPADLK-SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLI  699
              V+ G VAKE+SP D+  SE+K+E+LE R AAYWTTLAPNV+DYS   ARL+A+GSG++I
Sbjct  183   EVLDGSVAKEISPEDMAVSEEKRELLEERSAAYWTTLAPNVDDYSGKVARLIAAGSGRVI  242

Query  698   KGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLS  519
             KGILWCGDVTVD L  G+E ++ RM   S  E+S   MK I+ VK++T MTEKVATG+LS
Sbjct  243   KGILWCGDVTVDRLNWGNEFMKKRMGPRSDVEISSAAMKSIKSVKKMTKMTEKVATGILS  302

Query  518   GVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvt  339
             GVVKVSGFFTSS+ NS VGKKF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+S VT
Sbjct  303   GVVKVSGFFTSSIVNSKVGKKFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSVVT  362

Query  338   tglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             TGLVS +YG+EAAKAT+EGL AAGHA+ TAW V K+RKALNP
Sbjct  363   TGLVSERYGEEAAKATNEGLGAAGHAIGTAWAVLKIRKALNP  404



>ref|XP_004147037.1| PREDICTED: uncharacterized protein LOC101218079 [Cucumis sativus]
Length=427

 Score =   421 bits (1083),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 235/403 (58%), Positives = 301/403 (75%), Gaps = 21/403 (5%)
 Frame = -1

Query  1412  VDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGD  1236
             +DMKD+ ENLFP+    V G+ H      P++ E+ LL +PGAILHLI++Q S+ELA+G+
Sbjct  21    IDMKDLAENLFPDEDPPVSGHKH------PDSSEQVLLQIPGAILHLIERQNSIELASGE  74

Query  1235  LSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdee  1056
              S+V L QG++ VAV AR+ D++QWPL KD  +VKLD+SHYFF+   P+           
Sbjct  75    FSIVGLIQGNNVVAVLARIGDQVQWPLAKDEPAVKLDDSHYFFTLSVPS-----------  123

Query  1055  kskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETAS  876
              +   +       + +   ++LNYGLT+ASKGQ++ +K+LD ILD  S FSV KV E+A 
Sbjct  124   -NGSSENPDSVAGKANQEPEMLNYGLTVASKGQEDRLKELDRILDQYSCFSVQKVGESAK  182

Query  875   V-VMGGPVAKEVSPADLK-SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKL  702
               V+ G VAKE+SP D+  SE+K+E+LE R AAYWTTLAPNV+DYS   ARL+A+GSG++
Sbjct  183   WEVLDGSVAKEISPEDMAVSEEKRELLEERSAAYWTTLAPNVDDYSGKVARLIAAGSGRV  242

Query  701   IKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVL  522
             IKGILWCGDVTVD L  G+E ++ RM   S  E+S   MK I+ VK++T MTEKVATG+L
Sbjct  243   IKGILWCGDVTVDRLNWGNEFMKKRMGPRSDVEISSAAMKSIKSVKKMTKMTEKVATGIL  302

Query  521   SGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstv  342
             SGVVKVSGFFTSS+ NS VGKKF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+S V
Sbjct  303   SGVVKVSGFFTSSIVNSKVGKKFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSVV  362

Query  341   ttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             TTGLVS +YG+EA KAT+EGL AAGHA+ TAW V K+RKALNP
Sbjct  363   TTGLVSERYGEEAGKATNEGLGAAGHAIGTAWAVLKIRKALNP  405



>ref|NP_567995.1| senescence/dehydration-associated protein [Arabidopsis thaliana]
 gb|AEE86598.1| senescence/dehydration-associated protein [Arabidopsis thaliana]
Length=448

 Score =   421 bits (1083),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 225/406 (55%), Positives = 295/406 (73%), Gaps = 26/406 (6%)
 Frame = -1

Query  1424  MYPVVDMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVEL  1248
             +YP +++ D V N+FP+   +       S SAPP A EE +L + GA++HLIDK YSVEL
Sbjct  38    LYPSINVNDLVNNIFPDPTAS------DSASAPPLATEEVILTIHGAMVHLIDKSYSVEL  91

Query  1247  ATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsds  1068
             A GDL ++ L QGD  VAVFARV DEIQWPLTKD  +VK+D SHYFFS R          
Sbjct  92    ACGDLEILRLVQGDITVAVFARVGDEIQWPLTKDEPAVKVDESHYFFSLR----------  141

Query  1067  sdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVE  888
                     K+         +  N++LNYGLT+ASKGQ+ +++ LD IL + SSF+  + +
Sbjct  142   ------PVKESESSDHSVNETENEMLNYGLTMASKGQEPMLEKLDKILADYSSFTAEEKQ  195

Query  887   ETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSG  708
             +  +V +    AKE SP +LK ++KK ++E +C AYWTTLAPNVEDYS  AA+L+A+GSG
Sbjct  196   KEENV-LDLTAAKETSPEELKGKRKK-MVEKQCTAYWTTLAPNVEDYSGVAAKLIAAGSG  253

Query  707   KLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVAT  531
             +LIKGILWCGD+T+D L  G++ ++ +++   K  +VSP T+KR++RVK++T MTEKVA 
Sbjct  254   QLIKGILWCGDLTMDRLMWGNDFMKKKLSKAEKERQVSPGTLKRLKRVKKMTKMTEKVAN  313

Query  530   GVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmsts  351
             GVLSGVVKVSGFF+SSV NS  G+K  GLLPGEMVLATLDGF+++CDAVEVAG++VM T+
Sbjct  314   GVLSGVVKVSGFFSSSVINSKAGQKLFGLLPGEMVLATLDGFNKVCDAVEVAGRHVMKTT  373

Query  350   stvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             S VTT +V HKYG + A+AT+EGL AAGHA  TAWTVFK+R+ALNP
Sbjct  374   SDVTTEIVDHKYGAKTAQATNEGLSAAGHAFGTAWTVFKIRQALNP  419



>emb|CDY20844.1| BnaC07g06930D [Brassica napus]
Length=429

 Score =   420 bits (1079),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 246/439 (56%), Positives = 309/439 (70%), Gaps = 44/439 (10%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHS  1341
             N+  S +YP V   + E P +  SSS+  S +YP +DM D+  NLF E  E+        
Sbjct  8     NKQSSSLYPTVDMSNPEAPLNPISSSST-SNLYPSLDMNDLANNLFSEQPES-----RSI  61

Query  1340  P-SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQ  1164
             P SAPP A EE +L + GAILHLID+ YSVELA GDL+++ + Q  + VAV  RVADEIQ
Sbjct  62    PVSAPPAAREEVILTISGAILHLIDQSYSVELACGDLAIIRIVQDGNVVAVLTRVADEIQ  121

Query  1163  WPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNY  984
             WPLTKD  SVK+D SHYFF+ R P+ D  SDSSDE++                  D+LNY
Sbjct  122   WPLTKDENSVKVDESHYFFTLR-PSKDFGSDSSDEDEDNA---------------DMLNY  165

Query  983   GLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEV  804
             GLTIASKGQ++L+++L+ ILD+ S F+V KV E A                   E  +EV
Sbjct  166   GLTIASKGQEHLLEELERILDHYSCFTVQKVSEEAK------------------ETGEEV  207

Query  803   LE-GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR  627
             L+  +CAAYWTTLAPNVEDYS   A+L+ASGSG LIKGILWCGDVT+D L  G++ ++ R
Sbjct  208   LDVTQCAAYWTTLAPNVEDYSGKTAKLIASGSGHLIKGILWCGDVTMDRLNWGNDFMKRR  267

Query  626   MTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFL  450
             ++   K  +V P+T+KRI+RVK++T MTE VA GVLSGV+KVSGFFTSSVAN+ VGKKF 
Sbjct  268   LSKADKERDVHPDTLKRIKRVKKMTKMTESVANGVLSGVIKVSGFFTSSVANTKVGKKFF  327

Query  449   GLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAA  270
              LLPGE+VLATLDGF+++CDAVEVAG+NVMSTSSTV T LV H++G +AA+AT+EGLEA 
Sbjct  328   SLLPGEIVLATLDGFNKVCDAVEVAGRNVMSTSSTVATELVDHRHGGKAAEATNEGLEAV  387

Query  269   GHAMATAWTVFKLRKALNP  213
             GHA  TAW  FK+RKA+NP
Sbjct  388   GHAFGTAWAAFKIRKAINP  406



>ref|XP_010432205.1| PREDICTED: uncharacterized protein LOC104716523 [Camelina sativa]
Length=445

 Score =   419 bits (1078),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (72%), Gaps = 27/406 (7%)
 Frame = -1

Query  1424  MYPVVDMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVEL  1248
             +YP VD+ D V N+FP+   TV      S SAPP A EE LL + GAILHLIDK YSVEL
Sbjct  37    LYPSVDVNDLVNNIFPD--PTVS----DSASAPPLATEEVLLKINGAILHLIDKSYSVEL  90

Query  1247  ATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsds  1068
             A GDL ++ L QGD  VAVFARV DEIQWPLTKD  +VK+D SHYFFS R          
Sbjct  91    ACGDLEILRLVQGDITVAVFARVGDEIQWPLTKDEPAVKVDESHYFFSLR----------  140

Query  1067  sdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVE  888
                     + +       +   N++LNYGLTIASKGQD  ++ LD IL + SSF+  + +
Sbjct  141   -----PVKESKSSDHSTDEAENNEMLNYGLTIASKGQD--LEQLDKILADYSSFTAEEKQ  193

Query  887   ETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSG  708
             +  +  +    AKE SP +LK ++KK +++ +C AYWTTLAPNVEDYS  A++++A+GSG
Sbjct  194   KEENG-LDLTAAKETSPEELKGKRKK-MVQKQCTAYWTTLAPNVEDYSGVASKMIAAGSG  251

Query  707   KLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVAT  531
             +LIKGILWCGDVT+D L  G+E ++ +++   K  EVSP T+K ++RVK++T MTEKVA 
Sbjct  252   QLIKGILWCGDVTMDRLMWGNEFMKKKLSKAEKEREVSPTTLKLLKRVKKMTKMTEKVAN  311

Query  530   GVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmsts  351
             GVLSGVV VSGFF+SSV NS  GKK  GLLPGEMVLATLDGF+++CDAVEVAG+NVM TS
Sbjct  312   GVLSGVVNVSGFFSSSVINSKAGKKLFGLLPGEMVLATLDGFNKVCDAVEVAGRNVMKTS  371

Query  350   stvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             STVTT +V HKYG + A+AT+EGL AAGHA  TAWTVFK+R+AL P
Sbjct  372   STVTTEIVDHKYGAKTAQATNEGLSAAGHAFGTAWTVFKIRQALTP  417



>emb|CAA18492.1| putative protein [Arabidopsis thaliana]
 emb|CAA21484.1| putative protein [Arabidopsis thaliana]
 emb|CAB81507.1| putative protein [Arabidopsis thaliana]
Length=512

 Score =   421 bits (1082),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 225/406 (55%), Positives = 295/406 (73%), Gaps = 26/406 (6%)
 Frame = -1

Query  1424  MYPVVDMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVEL  1248
             +YP +++ D V N+FP+   +       S SAPP A EE +L + GA++HLIDK YSVEL
Sbjct  38    LYPSINVNDLVNNIFPDPTAS------DSASAPPLATEEVILTIHGAMVHLIDKSYSVEL  91

Query  1247  ATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsds  1068
             A GDL ++ L QGD  VAVFARV DEIQWPLTKD  +VK+D SHYFFS R          
Sbjct  92    ACGDLEILRLVQGDITVAVFARVGDEIQWPLTKDEPAVKVDESHYFFSLR----------  141

Query  1067  sdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVE  888
                     K+         +  N++LNYGLT+ASKGQ+ +++ LD IL + SSF+  + +
Sbjct  142   ------PVKESESSDHSVNETENEMLNYGLTMASKGQEPMLEKLDKILADYSSFTAEEKQ  195

Query  887   ETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSG  708
             +  +V +    AKE SP +LK ++KK ++E +C AYWTTLAPNVEDYS  AA+L+A+GSG
Sbjct  196   KEENV-LDLTAAKETSPEELKGKRKK-MVEKQCTAYWTTLAPNVEDYSGVAAKLIAAGSG  253

Query  707   KLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVAT  531
             +LIKGILWCGD+T+D L  G++ ++ +++   K  +VSP T+KR++RVK++T MTEKVA 
Sbjct  254   QLIKGILWCGDLTMDRLMWGNDFMKKKLSKAEKERQVSPGTLKRLKRVKKMTKMTEKVAN  313

Query  530   GVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmsts  351
             GVLSGVVKVSGFF+SSV NS  G+K  GLLPGEMVLATLDGF+++CDAVEVAG++VM T+
Sbjct  314   GVLSGVVKVSGFFSSSVINSKAGQKLFGLLPGEMVLATLDGFNKVCDAVEVAGRHVMKTT  373

Query  350   stvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             S VTT +V HKYG + A+AT+EGL AAGHA  TAWTVFK+R+ALNP
Sbjct  374   SDVTTEIVDHKYGAKTAQATNEGLSAAGHAFGTAWTVFKIRQALNP  419



>ref|XP_009393901.1| PREDICTED: uncharacterized protein LOC103979462 [Musa acuminata 
subsp. malaccensis]
Length=450

 Score =   419 bits (1076),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 237/411 (58%), Positives = 294/411 (72%), Gaps = 32/411 (8%)
 Frame = -1

Query  1424  MYPVVDMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVEL  1248
             +YP VD+ D  E+LFP   E        +PS  P + EET+L +PGA LHLIDKQ SVEL
Sbjct  38    LYPPVDVSDFTEDLFPHIAEDDP----KNPSLQPPS-EETMLRIPGAFLHLIDKQRSVEL  92

Query  1247  ATGDLSLVSLRQGDSNVAVFARVA---DEIQWPLTKDLASVKLDNSHYFFSFRFPNVddd  1077
             A+GDL +  LRQGDS VAV  RV    D +QWPL  D A+VKLD SHYFFS   P    D
Sbjct  93    ASGDLYISGLRQGDSFVAVLVRVGGTDDAVQWPLAHDEAAVKLDESHYFFSLHVPGETGD  152

Query  1076  sdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVH  897
               S                       DVL+YGLT ASKGQ+ L+K+LD IL++ SSFSV 
Sbjct  153   GGSGSP--------------------DVLSYGLTFASKGQEALLKELDAILESYSSFSVQ  192

Query  896   KVE-ETASVVMGGPVAKEVSPAD-LKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLM  723
             KV  +  +  + G VAKEV+P + ++   KKE++E RC AYWTTLAPNVEDYS   A+ +
Sbjct  193   KVSGKEPAEALDGTVAKEVTPTEVMEDSSKKEMMEERCVAYWTTLAPNVEDYSGLVAKAI  252

Query  722   ASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMT  546
             A+GSG+L+KGILWCGDVTV+ LK G+++L+ R+    K TE+SPET  RI+RVKR T M+
Sbjct  253   AAGSGQLVKGILWCGDVTVERLKWGNDMLKTRLGPNEKPTEISPETWARIQRVKRFTKMS  312

Query  545   EKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKN  366
             EKVATGVLSGVV+VSG+FTSSV NS  GKKF G+LPGE+VLA+LDGF +ICDA EVAGKN
Sbjct  313   EKVATGVLSGVVRVSGYFTSSVVNSRAGKKFFGMLPGEVVLASLDGFGKICDAFEVAGKN  372

Query  365   vmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             V+STSS VTTGLVSH+YG++AA A ++GL+AAGHA+ TAW VFK+RK ++P
Sbjct  373   VLSTSSVVTTGLVSHRYGEQAAAAATQGLDAAGHAVGTAWAVFKIRKGIDP  423



>gb|KDP29638.1| hypothetical protein JCGZ_18800 [Jatropha curcas]
Length=444

 Score =   417 bits (1073),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 317/438 (72%), Gaps = 37/438 (8%)
 Frame = -1

Query  1499  MYPKVVDPDFENP---FHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSPSA  1332
             +YPKV   D  NP     +S+S+++ S +YP +D KD+ ENLFPE  E V   Y H  S+
Sbjct  8     LYPKV---DLSNPEAISATSASASSSSSLYPSIDTKDLAENLFPEEDEAV--IYSHPTSS  62

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVA-DEIQWPL  1155
              P   E+TL+ +PGAI+HLI++  SV+LA GDLS++SL+Q D+ +AV  RV  D+IQWPL
Sbjct  63    QP--YEQTLITIPGAIVHLIERDRSVQLACGDLSIISLKQDDTVIAVLVRVGEDDIQWPL  120

Query  1154  TKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV--LNYG  981
              KD A+VKLD SHYFF+ R P                       E+++ +  DV  LNYG
Sbjct  121   AKDEAAVKLDESHYFFTLRVPG---------------------NEEEEGINGDVELLNYG  159

Query  980   LTIASKGQDNLIKDLDTILDNCSSFSVHKVEETAS--VVMGGPVAKEVSPADLKSEKKKE  807
             +TIASKGQ+ L+K+ D IL+  SSF+V +++       V+ G  AK +SP +LKSE+KKE
Sbjct  160   VTIASKGQEALLKEFDKILEIYSSFTVQELKGRGINWEVLDGNTAKGISPEELKSEEKKE  219

Query  806   VLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR  627
             ++E   AAYWT LAPNVEDYS S AR++A+GSG+LIKGILWCGDVTVD LK G+E  +  
Sbjct  220   LMEESSAAYWTVLAPNVEDYSGSVARMIAAGSGQLIKGILWCGDVTVDRLKWGNEFFKKT  279

Query  626   MTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLG  447
             +   S  E+SP T++RI+RVKR+T ++EKVA G+LSGVVKVSG FT ++ NS  GKKF  
Sbjct  280   VEKKSDMEISPATLRRIKRVKRLTKISEKVAVGILSGVVKVSGIFTGTIVNSKAGKKFFS  339

Query  446   LLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAG  267
             LLPGE+VLA+LDGF+++CDAVEVAG+NVMSTSS VTT LVS +YG++AAKAT+EGL+AAG
Sbjct  340   LLPGEIVLASLDGFNKVCDAVEVAGRNVMSTSSVVTTELVSQRYGEQAAKATNEGLDAAG  399

Query  266   HAMATAWTVFKLRKALNP  213
             HA+ TAW VFK+RKALNP
Sbjct  400   HAIGTAWAVFKIRKALNP  417



>ref|XP_010437396.1| PREDICTED: uncharacterized protein LOC104721176 [Camelina sativa]
Length=443

 Score =   417 bits (1072),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 241/433 (56%), Positives = 301/433 (70%), Gaps = 31/433 (7%)
 Frame = -1

Query  1499  MYPKVVDPDFENPFHSSSSSANRSP--MYPVVDMKD-VENLFPENYETVQGYYHHSPSAP  1329
             +YP V     E P  +SSSS++     +YP +++ D V N+ P+   TV      S SAP
Sbjct  10    LYPSVDASTTEAPLPNSSSSSSCPNNNLYPSINVNDLVNNILPD--PTVS----DSASAP  63

Query  1328  PEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTK  1149
             P A EE LL + GAILHLIDK YSVELA GDL ++ L QGD  VAVFARV DEIQWPLTK
Sbjct  64    PLATEEVLLKIHGAILHLIDKSYSVELACGDLEILRLVQGDITVAVFARVGDEIQWPLTK  123

Query  1148  DLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIA  969
             D  +VK+D SHYFFS R                K   +       +   N++LNYGLTIA
Sbjct  124   DEPAVKVDESHYFFSLR--------------PVKESSKSSDHSTDEAENNEMLNYGLTIA  169

Query  968   SKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRC  789
             SKGQD  ++ LD IL + SSF+  + +    +      AKE SP +LK ++KK V + +C
Sbjct  170   SKGQD--LEQLDKILADYSSFTAEEKQNALDLT----AAKETSPEELKGKRKKMV-QKQC  222

Query  788   AAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK  609
              AYWTTLAPNVEDYS  A++++A+GSG+LIKGILWCGDVT+D L  G+E ++ +++   K
Sbjct  223   TAYWTTLAPNVEDYSGIASKMIAAGSGQLIKGILWCGDVTMDRLMWGNEFMKKKLSKADK  282

Query  608   T-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGE  432
               EVSP T+K ++RVK++T MTEKVA GVLSGVV VSGFF+SSV NS  GKK  GLLPGE
Sbjct  283   EREVSPTTLKLLKRVKKMTKMTEKVANGVLSGVVNVSGFFSSSVINSKAGKKLFGLLPGE  342

Query  431   MVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMAT  252
             MVLATLDGF+++CDAVEVAG+NVM TSSTVTT +V HKYG + A+AT+EGL AAGHA  T
Sbjct  343   MVLATLDGFNKVCDAVEVAGRNVMKTSSTVTTEIVDHKYGAKTAQATNEGLSAAGHAFGT  402

Query  251   AWTVFKLRKALNP  213
             AWTVFK+R+AL P
Sbjct  403   AWTVFKIRQALTP  415



>ref|XP_010548271.1| PREDICTED: uncharacterized protein LOC104819745 isoform X2 [Tarenaya 
hassleriana]
Length=404

 Score =   415 bits (1067),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 224/392 (57%), Positives = 288/392 (73%), Gaps = 20/392 (5%)
 Frame = -1

Query  1517  NRTRSPMYPKVVDPDFENP--FHSSSSSANRSPMYPVVDMKD-VENLFPENYETVQGYYH  1347
              + RS +YP+V   DF NP    S+ + ++ S +YP +DM D V+NLFP+  E     +H
Sbjct  9     QKQRSSLYPEV---DFSNPEAPPSNPTPSSSSNLYPSLDMHDLVDNLFPDPPEDDPVRFH  65

Query  1346  HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEI  1167
              S  APP A EE +L +PGAILHLID+ YSV+LA GDL+++SL QG + +AV ARVADEI
Sbjct  66    AS--APPPATEEVILRIPGAILHLIDQSYSVQLACGDLTVLSLVQGGNVIAVLARVADEI  123

Query  1166  QWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLN  987
             QWPLTKD A+VK+D+SHYFFS R       +     + S  +   K+ + +    N +LN
Sbjct  124   QWPLTKDEAAVKVDDSHYFFSLR------PAKECGSDSSDDEAPSKNPKSKPAEENAMLN  177

Query  986   YGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV----VMGGPVAKEVSPADLKSE  819
             YGLTIASKGQ+ L++ LD IL + S F+V +V E A      V+   VAK+ SPA+LK E
Sbjct  178   YGLTIASKGQEPLLEQLDRILSDYSCFTVQQVSEKAKEKGVEVLDATVAKDTSPAELKGE  237

Query  818   KKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEV  639
             +K E++E +CAAYWTTLAPNVEDYS   A+L+A+GSG+LIKGILWCGDVT+D LK G+E 
Sbjct  238   RK-EMMEKQCAAYWTTLAPNVEDYSGKTAKLIAAGSGQLIKGILWCGDVTMDRLKWGNEF  296

Query  638   LRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
             ++ RMT G K  E+SP+T+KRI+RVKR+T MTE+VA GVLSGV+KVSGFFT+SVAN+  G
Sbjct  297   MKRRMTKGEKEKEISPDTLKRIKRVKRMTKMTERVANGVLSGVIKVSGFFTNSVANTKAG  356

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKN  366
             KKF  LLPGE+VLATLDGF++ICDAVEVAGKN
Sbjct  357   KKFFSLLPGEIVLATLDGFNKICDAVEVAGKN  388



>ref|XP_009124573.1| PREDICTED: uncharacterized protein LOC103849563 [Brassica rapa]
Length=454

 Score =   416 bits (1068),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 244/447 (55%), Positives = 320/447 (72%), Gaps = 32/447 (7%)
 Frame = -1

Query  1523  SQNRTRSPMYPKVVDPDFENPFHSSSSSANRSP-MYPVVDMKDV-ENLFPENYETVQGYY  1350
             S ++    +YP V   + E P + SSSS++ +  +YP +DM D+  +LFPE  ET     
Sbjct  7     SSDKQSQSLYPTVDMSNPEAPLNPSSSSSSSTTNLYPSIDMDDLARDLFPEQPET-----  61

Query  1349  HHSP---SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARV  1179
               +P   SAPP A EE +L + GAILHLIDK YSVELA GDL+++ + Q  + V V ARV
Sbjct  62    --TPVPVSAPPAATEEVILKISGAILHLIDKSYSVELACGDLTIIRIVQDGNVVTVLARV  119

Query  1178  ADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGN  999
             ADEIQWPLTKD  SVK+D SHYFF+ R               +K        E  ++  N
Sbjct  120   ADEIQWPLTKDEKSVKVDESHYFFTLR--------------PTKDFGHDPSHEDDEEEEN  165

Query  998   DVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKV----EETASVVMGGPVAKEVSPAD  831
             ++LNYGLT+ASKGQ++L+++L+ IL++ S F+V +V    +ET   V+   VA+E SP +
Sbjct  166   EMLNYGLTVASKGQEHLLEELERILEDYSCFTVQQVSEEAKETGEEVLDVTVARETSPVE  225

Query  830   LKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
             L  E+K E++E +CAAYWTTLAPNVEDYS   A+L+ASGSG LIKGILWCGDVT+D LK 
Sbjct  226   LTGERK-EIVEKQCAAYWTTLAPNVEDYSGKTAKLIASGSGHLIKGILWCGDVTMDRLKW  284

Query  650   GDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
             G++ ++ R++   K  +V P+T+KRI+RVK++T MTE VA G+LSGV+KVSGFFTSSVAN
Sbjct  285   GNDFMKRRLSKAEKERDVHPDTLKRIKRVKKMTKMTENVANGILSGVIKVSGFFTSSVAN  344

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             + VGKKF  LLPGE+VLATLDGF+++CDA EVAG+NVMSTSSTV T LV H++G +AA+A
Sbjct  345   TKVGKKFFSLLPGEIVLATLDGFNKVCDAFEVAGRNVMSTSSTVATELVDHRHGGKAAEA  404

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T+EGLEA GHA  TAW  FK+RKA+NP
Sbjct  405   TNEGLEAVGHAFGTAWAAFKIRKAINP  431



>ref|XP_010446845.1| PREDICTED: uncharacterized protein LOC104729587 [Camelina sativa]
Length=442

 Score =   414 bits (1065),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 291/406 (72%), Gaps = 30/406 (7%)
 Frame = -1

Query  1424  MYPVVDMKD-VENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVEL  1248
             +YP VD+ D V+N+FP+   TV      + SAPP A EE LL + GAI+HLIDK YSVEL
Sbjct  37    LYPSVDVNDLVDNIFPD--PTVS----DAASAPPLATEEVLLKINGAIVHLIDKSYSVEL  90

Query  1247  ATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsds  1068
             A GDL ++ L QGD  VAVFAR+ DEIQWPLTKD  +VK+D SHYFFS R          
Sbjct  91    ACGDLEILRLVQGDITVAVFARIGDEIQWPLTKDEPAVKVDESHYFFSLR----------  140

Query  1067  sdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVE  888
                   K   +       +   N++LNYGLTIASKGQD  ++ LD IL + SSF+    E
Sbjct  141   ----PVKESSKSSDHSTDEAENNEMLNYGLTIASKGQD--LEQLDKILADYSSFTA---E  191

Query  887   ETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSG  708
             E     +GG   +  SP +LK  K+K +++ +C AYWTTLAPNVEDYS  A++++A+GSG
Sbjct  192   EKQKEEIGG--LELTSPEELKG-KRKRMVQKQCTAYWTTLAPNVEDYSGVASKMIAAGSG  248

Query  707   KLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVAT  531
             +LIKGILWCGDVT+D L  G+E ++ +++   K  EVSP T+K ++RVK++T MTEKVA 
Sbjct  249   QLIKGILWCGDVTMDRLMWGNEFMKKKLSKAEKEREVSPTTLKHLKRVKKMTKMTEKVAN  308

Query  530   GVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmsts  351
             GVLSGVV VSGFF+SSV NS  GKK  GLLPGEMVLATLDGF+++CDAVEVAG+NVM TS
Sbjct  309   GVLSGVVNVSGFFSSSVINSKAGKKLFGLLPGEMVLATLDGFNKVCDAVEVAGRNVMKTS  368

Query  350   stvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             STVTT +V HKYG + A+AT+EGL AAGHA+ TAWTVFK+R+AL P
Sbjct  369   STVTTDIVDHKYGAKTAQATNEGLSAAGHAVGTAWTVFKIRQALTP  414



>ref|XP_007046658.1| Senescence/dehydration-associated protein-related, putative isoform 
4 [Theobroma cacao]
 gb|EOX90815.1| Senescence/dehydration-associated protein-related, putative isoform 
4 [Theobroma cacao]
Length=386

 Score =   411 bits (1057),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 224/389 (58%), Positives = 284/389 (73%), Gaps = 21/389 (5%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPE--NYETV  1362
             MASQN   +S +YP+V     + P +SSS++     +YP +DM+D VENLFP+  NY   
Sbjct  1     MASQNPNQKSSLYPEVTQSKPDIPQYSSSNN-----LYPSLDMRDLVENLFPDPPNYSVN  55

Query  1361  QGYYH----HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
             +   H    H+P+APP+AVEE L+ +PGAIL+LIDK YSVELA GD +++ L QG++ VA
Sbjct  56    RHSDHTDSPHAPTAPPQAVEEVLIKIPGAILNLIDKSYSVELACGDFTVIRLWQGENIVA  115

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             V  RVA+EIQWPL K+  +VKLD+SHYFFS +      D ++ ++       + K K K 
Sbjct  116   VLVRVAEEIQWPLMKNETAVKLDDSHYFFSLQL-----DKEAENDSSDSDDDDKKRKTKT  170

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVA--KEVS  840
                G+ +LNYGLT ASKGQ+ L+++LD IL + S F+V KVE+    V+ G VA  KE+S
Sbjct  171   SGEGSCLLNYGLTFASKGQEYLLRELDVILQSYSCFTVQKVEKKGEEVLDGAVAAAKEMS  230

Query  839   PADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDS  660
             PADLKSE KKEV+E +CAAYWTTLAPNVEDYS  AA+++A+GSG LIKGILWCGDVT+D 
Sbjct  231   PADLKSETKKEVMEEKCAAYWTTLAPNVEDYSGRAAKVIAAGSGHLIKGILWCGDVTMDR  290

Query  659   LKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSS  483
             L  G+EVL+ RM+   K  E+SPET+KRI+RVKRVT MT+K A GVLSGVVKVSGF TSS
Sbjct  291   LNKGNEVLKKRMSPAEKNAEISPETLKRIKRVKRVTKMTQKAANGVLSGVVKVSGFVTSS  350

Query  482   VANSSVGKKFLGLLPGEMVLATLDGFSRI  396
             VANS VGKKF  LLPGE+VLA+LDGF  I
Sbjct  351   VANSKVGKKFFSLLPGEIVLASLDGFMLI  379



>ref|XP_011004616.1| PREDICTED: uncharacterized protein LOC105111067, partial [Populus 
euphratica]
Length=441

 Score =   411 bits (1056),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 230/434 (53%), Positives = 307/434 (71%), Gaps = 33/434 (8%)
 Frame = -1

Query  1508  RSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDVENLFPENYETVQGYYHHSPSAP  1329
             R+  YP+V+     NP   ++S++  S +YP +DMKDV +   +  E V     +S    
Sbjct  11    RNSRYPQVI---LSNP--EATSTSTSSSLYPTIDMKDVAD--NKKNEAVSPLGSNS----  59

Query  1328  PEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTK  1149
              EA EE L+ +PG+I+HLI+K  SVELA GD  +VSL+QG++ VAVFARV D+I+WPL +
Sbjct  60    -EAHEEILIKIPGSIVHLIEKDRSVELACGDFFIVSLKQGETTVAVFARVDDDIRWPLAR  118

Query  1148  DLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIA  969
             D A+VKLD SHYFF+ R P  +      ++ +                  ++LNYG+T A
Sbjct  119   DEAAVKLDESHYFFTLRVPENESYGGQLNKGEV-----------------ELLNYGVTFA  161

Query  968   SKGQDNLIKDLDTILDNCSSFSVHKVEETA--SVVMGGPVAKEVSPADLKSEKKKEVLEG  795
             SKGQ  L+K+ D IL+  S FSV +V+++   S V+   VAKE+SP +L  EK KE++E 
Sbjct  162   SKGQKGLLKEFDKILECYSLFSVQEVKKSGGKSEVIDWNVAKEISPDEL--EKNKELMEK  219

Query  794   RCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG  615
               +AYWT LAPNVEDYSS  AR +A+GSG+LI+GILWCGDVTVD LK GD  L+ R+  G
Sbjct  220   SSSAYWTVLAPNVEDYSSCIARTIAAGSGQLIRGILWCGDVTVDRLKWGDGFLKKRIRKG  279

Query  614   SKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPG  435
               +++SP T++RI+RVK++T M+EK A G+LSGVVKVSG  TS + NS  GKKF  LLPG
Sbjct  280   KDSDISPGTLRRIKRVKKLTKMSEKTAVGILSGVVKVSGSVTSPIVNSKAGKKFFSLLPG  339

Query  434   EMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMA  255
             E++LA+LDGF ++CDA+EVAGKNV+STSS VTTG+VSH+YG++AAK T EGL+AAGHA+ 
Sbjct  340   EVILASLDGFIKVCDAIEVAGKNVLSTSSLVTTGVVSHRYGEDAAKVTHEGLDAAGHAIG  399

Query  254   TAWTVFKLRKALNP  213
             TAW VFK+RKALNP
Sbjct  400   TAWVVFKIRKALNP  413



>ref|XP_007046655.1| Senescence/dehydration-associated protein-related, putative isoform 
1 [Theobroma cacao]
 gb|EOX90812.1| Senescence/dehydration-associated protein-related, putative isoform 
1 [Theobroma cacao]
Length=537

 Score =   412 bits (1060),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 227/399 (57%), Positives = 288/399 (72%), Gaps = 23/399 (6%)
 Frame = -1

Query  1529  MASQN-RTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKD-VENLFPE--NYETV  1362
             MASQN   +S +YP+V     + P +SSS++     +YP +DM+D VENLFP+  NY   
Sbjct  1     MASQNPNQKSSLYPEVTQSKPDIPQYSSSNN-----LYPSLDMRDLVENLFPDPPNYSVN  55

Query  1361  QGYYH----HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
             +   H    H+P+APP+AVEE L+ +PGAIL+LIDK YSVELA GD +++ L QG++ VA
Sbjct  56    RHSDHTDSPHAPTAPPQAVEEVLIKIPGAILNLIDKSYSVELACGDFTVIRLWQGENIVA  115

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             V  RVA+EIQWPL K+  +VKLD+SHYFFS +      D ++ ++       + K K K 
Sbjct  116   VLVRVAEEIQWPLMKNETAVKLDDSHYFFSLQL-----DKEAENDSSDSDDDDKKRKTKT  170

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVA--KEVS  840
                G+ +LNYGLT ASKGQ+ L+++LD IL + S F+V KVE+    V+ G VA  KE+S
Sbjct  171   SGEGSCLLNYGLTFASKGQEYLLRELDVILQSYSCFTVQKVEKKGEEVLDGAVAAAKEMS  230

Query  839   PADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDS  660
             PADLKSE KKEV+E +CAAYWTTLAPNVEDYS  AA+++A+GSG LIKGILWCGDVT+D 
Sbjct  231   PADLKSETKKEVMEEKCAAYWTTLAPNVEDYSGRAAKVIAAGSGHLIKGILWCGDVTMDR  290

Query  659   LKSGDEVLRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSS  483
             L  G+EVL+ RM+   K  E+SPET+KRI+RVKRVT MT+K A GVLSGVVKVSGF TSS
Sbjct  291   LNKGNEVLKKRMSPAEKNAEISPETLKRIKRVKRVTKMTQKAANGVLSGVVKVSGFVTSS  350

Query  482   VANSSVGKKFLGLLPGEMVLATLDGFS--RICDAVEVAG  372
             VANS VGKKF  LLPGE+VLA+LDGFS     D +E  G
Sbjct  351   VANSKVGKKFFSLLPGEIVLASLDGFSGTEALDCIESLG  389


 Score = 84.7 bits (208),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -1

Query  401  RICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKA  222
            RICDAVEVAGKNVMSTSSTVTT LV+HKYG++AA+AT+EGL AAGHA+ TAW  FKLR+A
Sbjct  448  RICDAVEVAGKNVMSTSSTVTTELVNHKYGEKAAEATNEGLGAAGHAVGTAWAAFKLRRA  507

Query  221  LNP  213
            LNP
Sbjct  508  LNP  510



>ref|XP_002313715.2| hypothetical protein POPTR_0009s13600g [Populus trichocarpa]
 gb|EEE87670.2| hypothetical protein POPTR_0009s13600g [Populus trichocarpa]
Length=416

 Score =   403 bits (1036),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 223/413 (54%), Positives = 293/413 (71%), Gaps = 28/413 (7%)
 Frame = -1

Query  1445  SSANRSPMYPVVDMKDVENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDK  1266
             S++  S +YP +DMKDV +      E V     +S     EA EE L+ +PG+I+HLI+K
Sbjct  2     STSTSSSLYPNIDMKDVAH--NNKNEAVSPLGSNS-----EAHEEILIKIPGSIVHLIEK  54

Query  1265  QYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNV  1086
               SVELA GD  +VSL+QG++ VAVFARV D+I+WPL +D A+VKLD SHYFF+ R P  
Sbjct  55    DRSVELACGDFFIVSLKQGETTVAVFARVDDDIRWPLARDEAAVKLDESHYFFTLRVPEN  114

Query  1085  dddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSF  906
             + D    ++ +                  ++LNYG++ ASKGQ  L+K  D IL++ S F
Sbjct  115   ESDGGELNKGEV-----------------ELLNYGVSFASKGQKGLLKKFDKILESYSLF  157

Query  905   SVHKVEETA--SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAA  732
             SV +V+++   S V+   VAKE+SP DL  EK KE++E   AAYWT LAPNVEDYSS  A
Sbjct  158   SVQEVKKSGGKSKVIDWNVAKEISPDDL--EKNKELMEKSSAAYWTVLAPNVEDYSSCIA  215

Query  731   RLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTS  552
             R +A+GSG+LI+GILWCGDVTVD LK GD   + R+     +++SP T++RI+R K +T 
Sbjct  216   RTIAAGSGQLIRGILWCGDVTVDRLKWGDGFFKKRIRKSKDSDISPGTLRRIKRAKNLTK  275

Query  551   MTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAG  372
             M+EKVA G+LSGVVKVSG  TS + NS  GKKF  LLPGE++LA+LDGF ++CDA+EVAG
Sbjct  276   MSEKVAVGILSGVVKVSGSVTSPIVNSKAGKKFFSLLPGEVILASLDGFIKVCDAIEVAG  335

Query  371   KNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             KNV+STSS VTTGLVSH+YG++AA+ T EGL+AAGHA+ TAW VFK+R+ALNP
Sbjct  336   KNVLSTSSAVTTGLVSHRYGEDAAEVTHEGLDAAGHAIGTAWVVFKIRRALNP  388



>ref|XP_008236003.1| PREDICTED: uncharacterized protein LOC103334814 [Prunus mume]
Length=416

 Score =   398 bits (1023),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 227/403 (56%), Positives = 289/403 (72%), Gaps = 36/403 (9%)
 Frame = -1

Query  1409  DMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDL  1233
             DMKD+ ENLFPE+ + V      S        EE ++ +PGAI+HLI+K  SVELATG+L
Sbjct  20    DMKDLAENLFPED-DAVSNRNTQSS-------EELMVKIPGAIVHLIEKDSSVELATGEL  71

Query  1232  SLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeek  1053
             ++VSLRQ  + VAV ARV D+IQWPL KD A+VKLD +HYFF+ R P             
Sbjct  72    TIVSLRQNGNIVAVLARVGDQIQWPLAKDEAAVKLDQAHYFFTLRVP------------A  119

Query  1052  skgkkegkhkekqkDMGNDVL-NYGLTIAS-KGQDNLIKDLDTILDNCSSFSVHKVEETA  879
             +   K  +  +   + G  VL NYGLT AS KGQ+ L+K+LD IL   S FS  +VE   
Sbjct  120   NGSPKRDEIDDSTHEKGQFVLLNYGLTFASSKGQEGLLKELDQILGIYSCFSEERVEGLG  179

Query  878   SV-VMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKL  702
             +  V+ G V ++ S             E R AAYWTTLAPNVEDYS   ARL+A+GSG++
Sbjct  180   NWEVLDGSVGRDTSQ------------EERAAAYWTTLAPNVEDYSGKCARLIAAGSGQV  227

Query  701   IKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVL  522
             I+GILWCGDVTVD LK G+E L+ RM   S++E+SPET+KRI+RVK++T M+E VA+G+L
Sbjct  228   IRGILWCGDVTVDRLKWGNEFLKMRMGPTSESEISPETLKRIQRVKKLTKMSEDVASGIL  287

Query  521   SGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstv  342
             SGVVKVSGFFTSS+ NS VG+KF  LLPGE+VLA+LDGF+++CDAVEVAG+NVMST+S V
Sbjct  288   SGVVKVSGFFTSSIVNSKVGQKFFSLLPGEIVLASLDGFNKVCDAVEVAGRNVMSTTSVV  347

Query  341   ttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             TTGLVS +YG+ AA+ T+EGL+AAGHA+ TAW VFK+R+ALNP
Sbjct  348   TTGLVSQRYGEPAARVTNEGLDAAGHAIGTAWAVFKVRRALNP  390



>gb|KDO71259.1| hypothetical protein CISIN_1g0131332mg, partial [Citrus sinensis]
Length=358

 Score =   395 bits (1016),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 214/383 (56%), Positives = 271/383 (71%), Gaps = 37/383 (10%)
 Frame = -1

Query  1532  PMASQNRTRSPMYPKVVDPDFENPFH------SSSSSANRSPMYPVVDMKDV-ENLFPEN  1374
             P+ + N T   +YP+V+D + E P +       SSS +  S +YP +DM+D+ ENLFPE 
Sbjct  6     PIPNPNHTS--LYPQVIDSNPEAPINYKSQSPPSSSQSPPSNLYPSLDMRDLTENLFPET  63

Query  1373  YETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
               T     +  PSAPP+A EETL+ VPGAILHLID+ YSVELA  D  ++ L Q  + VA
Sbjct  64    AAT----GNTEPSAPPQADEETLIKVPGAILHLIDQSYSVELACSDFKIIRLIQDGNVVA  119

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             V A V DE+QWPLTKD+A+VKLD+SHYFFS  FP                       +  
Sbjct  120   VLASVGDEVQWPLTKDIAAVKLDDSHYFFSLSFP----------------------PQPG  157

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPA  834
              +  +D+LNYGLTIASKGQ+ L+++LD IL   S FSV KV E    +  G +AKEV+P 
Sbjct  158   SNSDSDLLNYGLTIASKGQEKLLQELDGILQQYSCFSVQKVSEKVKEI-DGEIAKEVTPL  216

Query  833   DLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLK  654
             ++ + KK+EV+E + AAYWTTLAPNVEDYS +AA+L+A+GSG+LI+GILWCG+VTVD LK
Sbjct  217   EM-TGKKREVMEEKSAAYWTTLAPNVEDYSGTAAKLIAAGSGQLIRGILWCGEVTVDRLK  275

Query  653   SGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
              G++VL+ RM  G  +EVSP+T+KRI+R KRVT MTEKVATGVLSGVVKVSGFFTSSVAN
Sbjct  276   WGNKVLKKRMIPGETSEVSPQTLKRIKRAKRVTKMTEKVATGVLSGVVKVSGFFTSSVAN  335

Query  473   SSVGKKFLGLLPGEMVLATLDGF  405
             +  GKKF  LLPGE+VLA+LDGF
Sbjct  336   TKAGKKFFNLLPGEIVLASLDGF  358



>emb|CDY29202.1| BnaA06g25550D [Brassica napus]
Length=433

 Score =   398 bits (1023),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 308/443 (70%), Gaps = 45/443 (10%)
 Frame = -1

Query  1523  SQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYH  1347
             S ++    +YP V   + E P + SSSS++ + +YP +DM D+  +LFPE  ET      
Sbjct  7     SSDKQSQSLYPTVDMSNPEAPLNPSSSSSSTTNLYPSLDMDDLARDLFPEQPET------  60

Query  1346  HSP---SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVA  1176
              +P   SAPP A EE +L + GAILHLIDK YSVELA GDL+++ + Q  + V V ARVA
Sbjct  61    -TPVPVSAPPAATEEVILKISGAILHLIDKSYSVELACGDLTIIRIVQDGNVVTVLARVA  119

Query  1175  DEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGND  996
             DEIQWPLTKD  SVK+D SHYFF+ R               +K        E  ++  N+
Sbjct  120   DEIQWPLTKDENSVKVDESHYFFTLR--------------TTKDFGHDPSHEDDEEEENE  165

Query  995   VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEK  816
             +LNYGLT+ASKGQ++L+++L+ IL++ S F+V +V E A                   E 
Sbjct  166   MLNYGLTVASKGQEHLLEELERILEDYSCFTVQQVSEEAK------------------ET  207

Query  815   KKEVLE-GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEV  639
              +EVL+  +CAAYWTTLAPNVEDYS   A+L+ASGSG LIKGILWCGDVT+D LK G++ 
Sbjct  208   GEEVLDVTQCAAYWTTLAPNVEDYSGKTAKLIASGSGHLIKGILWCGDVTMDRLKWGNDF  267

Query  638   LRNRMTSGSKT-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
             ++ R++   K  +V P+T+KRI+RVK++T MTE VA G+LSGV+KVSGFFTSSVAN+ VG
Sbjct  268   MKRRLSKAEKERDVHPDTLKRIKRVKKMTKMTENVANGILSGVIKVSGFFTSSVANTKVG  327

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
             KKF  LLPGE+VLATLDGF+++CDA EVAG+NVMSTSSTV T LV H++G +AA+AT+EG
Sbjct  328   KKFFSLLPGEIVLATLDGFNKVCDAFEVAGRNVMSTSSTVATELVDHRHGGKAAEATNEG  387

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
             LEA GHA  TAW  FK+RKA+NP
Sbjct  388   LEAVGHAFGTAWAAFKIRKAINP  410



>ref|XP_007201033.1| hypothetical protein PRUPE_ppa006293mg [Prunus persica]
 gb|EMJ02232.1| hypothetical protein PRUPE_ppa006293mg [Prunus persica]
Length=419

 Score =   397 bits (1020),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 226/403 (56%), Positives = 289/403 (72%), Gaps = 36/403 (9%)
 Frame = -1

Query  1409  DMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDL  1233
             DMKD+ ENLFPE+ ++V      S        EE ++ +PGAI+HLI+K  S+ELATG+L
Sbjct  23    DMKDLAENLFPED-DSVSNRNTQSS-------EELMVKIPGAIVHLIEKDSSIELATGEL  74

Query  1232  SLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeek  1053
             ++VSLRQ  + VAV ARV D+IQWPL +D A+VKLD +HYFF+ R P             
Sbjct  75    TIVSLRQNGNIVAVLARVGDQIQWPLARDEAAVKLDQAHYFFTLRVP------------A  122

Query  1052  skgkkegkhkekqkDMGNDVL-NYGLTIAS-KGQDNLIKDLDTILDNCSSFSVHKVEETA  879
             +   K  +  +   + G  VL NYGLT AS KGQ+ L+ +LD IL   S FS  +VE   
Sbjct  123   NGSPKRDEIDDPTHEKGQFVLLNYGLTFASSKGQEGLLNELDQILGIYSCFSEERVEGLG  182

Query  878   SV-VMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKL  702
             +  V+ G V ++ S             E R AAYWTTLAPNVEDYS   ARL+A+GSG++
Sbjct  183   NWEVLDGSVGRDTSQ------------EERAAAYWTTLAPNVEDYSGKCARLIAAGSGQV  230

Query  701   IKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVL  522
             I+GILWCGDVTVD LK G+E L+ RM   S++E+SPET+KRI+RVK++T M+E VATG+L
Sbjct  231   IRGILWCGDVTVDRLKWGNEFLKMRMGPTSESEISPETLKRIQRVKKLTKMSEDVATGIL  290

Query  521   SGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstv  342
             SGVVKVSGFFTSS+ NS VG+KF  LLPGE+VLA+LDGF+++CDAVEVAG+NVMST+S V
Sbjct  291   SGVVKVSGFFTSSIVNSKVGQKFFSLLPGEIVLASLDGFNKVCDAVEVAGRNVMSTTSVV  350

Query  341   ttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             TTGLVS +YG+ AAK T+EGL+AAGHA+ TAW VFK+RKA+NP
Sbjct  351   TTGLVSQRYGEPAAKVTNEGLDAAGHAIGTAWAVFKVRKAINP  393



>ref|XP_007131702.1| hypothetical protein PHAVU_011G034800g [Phaseolus vulgaris]
 gb|ESW03696.1| hypothetical protein PHAVU_011G034800g [Phaseolus vulgaris]
Length=427

 Score =   395 bits (1014),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 236/437 (54%), Positives = 309/437 (71%), Gaps = 43/437 (10%)
 Frame = -1

Query  1508  RSPMYPKV--VDPDFENPFHSSSSSANRSP--MYPVVDMKDVENLFPENYETVQGYYHHS  1341
             ++  YP+V   +PD ++PF   SSS++ S   +YP ++    ENL  E  +  Q      
Sbjct  4     QNSFYPQVDSTNPDADSPFSHHSSSSSSSSSSIYPSLE---TENLVREEPKATQ------  54

Query  1340  PSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQW  1161
                   A+E  L+ VPGAILHLI+K  SV LA+GDL++ SL +GD  VAV ARV D++QW
Sbjct  55    ------AMENVLVTVPGAILHLIEKDSSVHLASGDLTISSLGEGDKVVAVLARVGDKVQW  108

Query  1160  PLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYG  981
             PL KD+A+VKLD SHYFF+ + P                        KQ + G +VLNYG
Sbjct  109   PLAKDVAAVKLDESHYFFTLQVPQ-----------------------KQAENGFEVLNYG  145

Query  980   LTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV-VMGGPVAKEVSPADLKSEKKKEV  804
             LT+A+KGQ  ++K+LD +L+  S  S  KV+  +   V+ G V+ E SP +LKSE+K+EV
Sbjct  146   LTVAAKGQGRVLKELDEVLEKYSFLSKEKVKGVSGWEVLDGSVSAETSPEELKSEEKREV  205

Query  803   LEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRM  624
             +E R  AYWTTLAPNVEDYS   AR +A+GSG ++ GILW GDVTV+ LK G++ L+ R+
Sbjct  206   VEERSGAYWTTLAPNVEDYSGRFARWIAAGSGHVVWGILWAGDVTVERLKWGNDFLKKRL  265

Query  623   TSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGL  444
               GS +++SP+ M+ + RVK++T M+EKVATGVLSGVVKVSGFFTSSV NS  GKKF  L
Sbjct  266   EPGSHSQISPQAMENMIRVKKLTKMSEKVATGVLSGVVKVSGFFTSSVVNSKPGKKFFSL  325

Query  443   LPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGH  264
             LPGE+VLAT+DGF+++ DAVEVAG+NVMSTSST+TTGLVSHKYG++AA+ T+EGL+AAGH
Sbjct  326   LPGEIVLATMDGFNKVVDAVEVAGRNVMSTSSTLTTGLVSHKYGEQAAQVTNEGLDAAGH  385

Query  263   AMATAWTVFKLRKALNP  213
             A+ TAW VFKLRKALNP
Sbjct  386   AIGTAWAVFKLRKALNP  402



>ref|XP_009376959.1| PREDICTED: uncharacterized protein LOC103965610 [Pyrus x bretschneideri]
 ref|XP_009376961.1| PREDICTED: uncharacterized protein LOC103965613 [Pyrus x bretschneideri]
Length=407

 Score =   394 bits (1011),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 224/412 (54%), Positives = 284/412 (69%), Gaps = 34/412 (8%)
 Frame = -1

Query  1442  SANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLI-VPGAILHLID  1269
             SA++   YP VD+ D+ ENLFPE+          S   P     E LL+ +PGAI+HLI+
Sbjct  2     SASKPTSYPSVDVNDLAENLFPEDDAV-------STEIPVTHSSEDLLVKIPGAIVHLIE  54

Query  1268  KQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPN  1089
             K  S+E+A G+L++V LRQ  + VAV ARV D+IQWPL KD  SVKLD SHYFF+ R P 
Sbjct  55    KDSSIEIARGELTVVGLRQNGNVVAVLARVGDQIQWPLAKDEPSVKLDQSHYFFTLRVPA  114

Query  1088  VdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSS  909
                      ++ +  + E            ++LNYGLT  S GQ++L++D D IL N S 
Sbjct  115   NGSPKRGEIDDSTGKRGEF-----------ELLNYGLTFGSAGQEDLLRDFDQILGNYSC  163

Query  908   FSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAAR  729
             FS  KVE   +         EV  A      K E +  R AAYWTTLAPNVEDYS   AR
Sbjct  164   FSEGKVEGVGNW--------EVLDA------KGEEVGDRAAAYWTTLAPNVEDYSGKCAR  209

Query  728   LMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSM  549
             L+A+GSG++I+GILWCGDVTVD LK G+E L+ RM   S +E+SPE  +RI+RVK++T  
Sbjct  210   LIAAGSGQMIRGILWCGDVTVDRLKWGNEFLKMRMGPTSPSEISPEAFRRIQRVKKLTKR  269

Query  548   TEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGK  369
             +EKVATG+LSGVVKVSGFFTSS+ NS VG+KF  LLPGE++LA+LDGF+++CDAVEVAG+
Sbjct  270   SEKVATGILSGVVKVSGFFTSSIVNSKVGQKFFSLLPGEIILASLDGFNKVCDAVEVAGR  329

Query  368   NvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             NVMST+S VTTGLVSH+YG+ A K T+EGL+AAGHA+  AW VFK+RKALNP
Sbjct  330   NVMSTTSVVTTGLVSHRYGEPAGKVTNEGLDAAGHAIGAAWAVFKVRKALNP  381



>ref|XP_008363294.1| PREDICTED: uncharacterized protein LOC103426994 [Malus domestica]
Length=407

 Score =   388 bits (996),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 222/412 (54%), Positives = 282/412 (68%), Gaps = 34/412 (8%)
 Frame = -1

Query  1442  SANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLI-VPGAILHLID  1269
             SA++   YP VDM D+ ENLFPE+          S   P     E LL+ +PGAI+HLI+
Sbjct  2     SASKPTSYPSVDMNDLAENLFPEDDAV-------STEIPVTHSSEDLLVKIPGAIVHLIE  54

Query  1268  KQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPN  1089
             K  S+ELA G+L++V LRQ  + VAV ARV D+IQWPL KD  SVKLD SHYFF+ R P 
Sbjct  55    KDSSIELARGELTVVGLRQNGNVVAVLARVGDQIQWPLAKDEPSVKLDQSHYFFTIRVPA  114

Query  1088  VdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSS  909
                      ++ +  + E            ++LNYGLT+ S GQ+ L+++ D IL N S 
Sbjct  115   DGWPKRGEIDDSTGKRGEF-----------ELLNYGLTLGSAGQEGLLREFDQILGNYSC  163

Query  908   FSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAAR  729
             FS  KVE   +         EV  A      K E +  R AAYWTTLAPNVEDYS   AR
Sbjct  164   FSEGKVEGVGNW--------EVLDA------KGEEVGDRAAAYWTTLAPNVEDYSGKCAR  209

Query  728   LMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSM  549
             L+ +GSG++I+GILWCGDVTVD LK G+E L+ RM   S +E+SPE  +RI+RVK++T  
Sbjct  210   LIVAGSGQMIRGILWCGDVTVDRLKWGNEFLKMRMGPTSPSEISPEAFRRIQRVKKLTKR  269

Query  548   TEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGK  369
             +E+VATG+LSGVVKVSGFFTSS+ NS VG+KF  LLPGE++LA+LDGF+++CDAVEVAG+
Sbjct  270   SEEVATGILSGVVKVSGFFTSSIVNSKVGQKFFSLLPGEIILASLDGFNKVCDAVEVAGR  329

Query  368   NvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             NVMST+S VTTGLVSH+YG+ A K T+EGL+AAGHA+  AW VFK+ KALNP
Sbjct  330   NVMSTTSVVTTGLVSHRYGEPAGKVTNEGLDAAGHAIGAAWAVFKVSKALNP  381



>ref|XP_010547422.1| PREDICTED: uncharacterized protein LOC104819174 isoform X2 [Tarenaya 
hassleriana]
Length=380

 Score =   385 bits (990),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 208/398 (52%), Positives = 266/398 (67%), Gaps = 47/398 (12%)
 Frame = -1

Query  1532  PMASQNRTRSPMYPKVVDPDFENPFHSS----SSSANRSPMYPVVDMKDVENLFPENYET  1365
             P     + ++P+YP++      NPF+ +    SSSAN              NLFP+    
Sbjct  4     PHEEDRQKKTPLYPEIDQSIPNNPFYPANPNPSSSAN--------------NLFPQYGCP  49

Query  1364  VQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFA  1185
             V     HSPSAPPEA EE L+ V GAIL+LIDK YSVELA GDL++V + QG + VAV A
Sbjct  50    VDA---HSPSAPPEATEEILIRVGGAILNLIDKSYSVELACGDLTVVRIVQGQNIVAVLA  106

Query  1184  RVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDM  1005
              VADEIQWPLTK   + K+D SHYFFS R P        ++                   
Sbjct  107   CVADEIQWPLTKTEVATKVDRSHYFFSLRPPKEPGSDSENE-------------------  147

Query  1004  GNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSP  837
              +++LNYGLTI SKGQ+ L+++L+ IL     ++  ++ E A      V+   +    SP
Sbjct  148   -DEILNYGLTIVSKGQEKLMEELERILTEYCCYTEQRMSEKAKEKGEEVLSNAMVVGTSP  206

Query  836   ADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL  657
              +LK EKK E +EG+CAAYWTTLAPNVE+YS   A+L+A+GSG+LI+GILWCGDVT++ +
Sbjct  207   EELKGEKK-EAVEGQCAAYWTTLAPNVEEYSGRTAQLIATGSGQLIRGILWCGDVTMERI  265

Query  656   KSGDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSV  480
             K G++VL+NR++   K  E+SP+T++RI+RVKRVT MTEKVA GVLSGVVKVSGFFTSSV
Sbjct  266   KRGNDVLKNRLSRAEKEKEISPDTLRRIQRVKRVTKMTEKVANGVLSGVVKVSGFFTSSV  325

Query  479   ANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKN  366
             ANS  GKKF GLLPGE+VLA+LDGF +ICDAVEVAGKN
Sbjct  326   ANSKAGKKFFGLLPGEIVLASLDGFGKICDAVEVAGKN  363



>ref|XP_010489422.1| PREDICTED: uncharacterized protein LOC104767087 isoform X2 [Camelina 
sativa]
Length=392

 Score =   385 bits (990),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 227/411 (55%), Positives = 289/411 (70%), Gaps = 29/411 (7%)
 Frame = -1

Query  1526  ASQNRTRSPMYPKV--VDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQG  1356
             +S ++  S +YP V   +P+   P + SSSS++ + +YP +DM D+  NLFPE  ET   
Sbjct  3     SSGDKQASSLYPTVDTSNPEAPPPHNPSSSSSSTNNLYPSLDMNDLARNLFPEQPET---  59

Query  1355  YYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVA  1176
                 S SAPP A EE +L + GAILHLIDK YSVELA GDLS++ + QGD  VAV A VA
Sbjct  60    -NPSSVSAPPAATEEVILKISGAILHLIDKSYSVELACGDLSIIRIVQGDKVVAVLASVA  118

Query  1175  DEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGND  996
              EIQWPLTKD  SVK+D SHYFF+ R                    E       K   ++
Sbjct  119   GEIQWPLTKDENSVKVDESHYFFTLR----------------PTSDEEDGGAGGKKNSDE  162

Query  995   VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA----SVVMGGPVAKEVSPADL  828
             +LNYGLTIASKGQ++L+ DL+ IL++ S F+V +V E A      V+   VA+E SP +L
Sbjct  163   MLNYGLTIASKGQEHLLVDLEKILEDYSCFTVQQVSEEAKEAGEKVLDVTVARETSPVEL  222

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
               E+K E++E +C+AYWTTLAPNVEDYS  AA+L+A+GSG LIKGILWCGDVT+D L  G
Sbjct  223   TGERK-EIVERQCSAYWTTLAPNVEDYSGKAAKLIATGSGHLIKGILWCGDVTMDRLIWG  281

Query  647   DEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
             +  ++ R++   K +EV P+T+KRIRRVK++T MTE VA  VLSGV+KVSGFFTSSVAN+
Sbjct  282   NGFMKRRLSKAEKESEVHPDTLKRIRRVKQMTKMTENVANSVLSGVLKVSGFFTSSVANT  341

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHK  318
              VGKKF  LLPGE++LA+LDGF+++CDAVEVAG+NVMSTSSTVTT LV HK
Sbjct  342   KVGKKFFSLLPGEVILASLDGFNKVCDAVEVAGRNVMSTSSTVTTELVDHK  392



>ref|XP_004505787.1| PREDICTED: uncharacterized protein LOC101495575 [Cicer arietinum]
Length=394

 Score =   385 bits (990),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 274/370 (74%), Gaps = 38/370 (10%)
 Frame = -1

Query  1316  EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLAS  1137
             ++ L+ VP  ILHLI+K  SV LA+GDL++VSL++ ++ VAV AR++D+IQWPL KD+++
Sbjct  36    QQVLVTVPNVILHLIEKDSSVHLASGDLTIVSLKEDNNVVAVLARISDQIQWPLAKDVST  95

Query  1136  VKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQ  957
             VKLD+SHYFF+ + P                         + + G +VLNYG+T+A+KG+
Sbjct  96    VKLDDSHYFFTLQIPQ-----------------------SKTESGTEVLNYGMTVATKGE  132

Query  956   DN--LIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAA  783
             ++  ++K+LD IL+  S FSV KV             K V   ++  EK+++V E   AA
Sbjct  133   ESVLILKELDKILEKYSFFSVEKV-------------KGVKGWEVLEEKREDVEESSAAA  179

Query  782   YWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTE  603
             YWTTLAPNVEDYS   AR +A+GSG++++GILWCGDVTV+ LK G++ ++ R+  GSK++
Sbjct  180   YWTTLAPNVEDYSGRFARWIAAGSGQVVRGILWCGDVTVERLKWGNDFMKKRLQPGSKSQ  239

Query  602   VSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVL  423
             +SP  ++ I+RVK++T M+EKVA G+L+GVVKVSGFFTSSV NS  GKKF   LPGE++L
Sbjct  240   ISPHALESIKRVKKLTKMSEKVAIGILTGVVKVSGFFTSSVVNSKPGKKFFSFLPGEVLL  299

Query  422   ATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWT  243
             A+LDGF+++CDAVEVAG+NV+STSS VTTGLVSHKYG++AA+ T+EGL+AAGHA  TAWT
Sbjct  300   ASLDGFNKVCDAVEVAGRNVLSTSSVVTTGLVSHKYGEQAAEVTNEGLDAAGHAFGTAWT  359

Query  242   VFKLRKALNP  213
             VFKLRKALNP
Sbjct  360   VFKLRKALNP  369



>ref|XP_003537805.1| PREDICTED: uncharacterized protein LOC100802385 [Glycine max]
Length=431

 Score =   384 bits (985),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 284/389 (73%), Gaps = 25/389 (6%)
 Frame = -1

Query  1370  ETVQGYYHHSP-SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVA  1194
             ET +      P +   EA+E  L+ VPGAILHLI+K  SV LA+GDL++ +L +GD  VA
Sbjct  40    ETTENLIWEEPNTTTEEAMENVLVTVPGAILHLIEKDSSVHLASGDLTISTLGEGDKVVA  99

Query  1193  VFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekq  1014
             V A V D++QWPL KD+++VKLD SHYFF+ + P                       E  
Sbjct  100   VLACVGDQVQWPLAKDVSAVKLDESHYFFTVQVPQ----------------------EHG  137

Query  1013  kDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV-VMGGPVAKEVSP  837
             ++ G +VLNYGLT+A+KGQ+ ++++LD +LD  S  S  K++      V+ G V+ E SP
Sbjct  138   EEKGFEVLNYGLTVAAKGQERVLRELDEVLDKYSFLSKEKLKGVGGWEVLDGSVSTETSP  197

Query  836   ADLK-SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDS  660
              +L+ SE++KEV+E R  AYWTTLAPNVEDYS S AR +A+GSG++++GILW GDVTVD 
Sbjct  198   EELQGSEERKEVVEERSGAYWTTLAPNVEDYSGSFARWIAAGSGQVVRGILWAGDVTVDR  257

Query  659   LKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSV  480
             LK G++ L+ R+  GS ++VSP+ ++ I+RVK++T M+EKVATGVLSGVVKVSGFFTSSV
Sbjct  258   LKWGNDFLKKRLEPGSHSQVSPQALESIKRVKKLTKMSEKVATGVLSGVVKVSGFFTSSV  317

Query  479   ANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAA  300
              NS  GKKF  LLPGE+VLAT+DGF+++ DA EVAG+NVMSTSS VTTGLVSHKYG+EAA
Sbjct  318   VNSKAGKKFFSLLPGEIVLATMDGFNKVLDAAEVAGRNVMSTSSVVTTGLVSHKYGEEAA  377

Query  299   KATSEGLEAAGHAMATAWTVFKLRKALNP  213
               T+EGL+AAGHA+ TAW VFKL KALNP
Sbjct  378   HVTNEGLDAAGHAIGTAWAVFKLGKALNP  406



>emb|CDY07815.1| BnaC03g48070D [Brassica napus]
Length=419

 Score =   382 bits (980),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 224/425 (53%), Positives = 289/425 (68%), Gaps = 42/425 (10%)
 Frame = -1

Query  1457  HSSSSSANRSPMYPVVDMKDVEN-LFPENYETVQGYYHHSPS-------APPEAVEETLL  1302
             H +SS      +YP VDM + E  L P ++ +     +  PS        PP A EE +L
Sbjct  4     HGNSSDKQSQSLYPTVDMSNPEAPLNPSSFSSSSSTTNLYPSLDMDDLAPPPAATEEVIL  63

Query  1301  IVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDN  1122
              + GAILHLIDK YSVELA GDL+++ + Q  + V V ARVADEIQWPLTKD  SVK+D 
Sbjct  64    KISGAILHLIDKSYSVELACGDLTIIRIVQDGNVVTVLARVADEIQWPLTKDENSVKVDE  123

Query  1121  SHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIK  942
             S YFF+ R               +K        E  +   N++LNYGLT+ASKGQ++L++
Sbjct  124   SRYFFTLR--------------PTKDFGHDPSHEDDEGEENEMLNYGLTVASKGQEHLLE  169

Query  941   DLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLE-GRCAAYWTTLA  765
             +L+ IL++ S F+V +V E A                   E  +EVL+  +CAAYWTTLA
Sbjct  170   ELEKILEDYSCFTVQQVSEEAK------------------ETGEEVLDVTQCAAYWTTLA  211

Query  764   PNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKT-EVSPET  588
             PNVEDYS   A+L+ASGSG LIKGILWCGDVT+D LK G++ ++ R++   K  +V P+T
Sbjct  212   PNVEDYSGKTAKLIASGSGHLIKGILWCGDVTMDRLKWGNDFMKRRLSKAEKERDVHPDT  271

Query  587   MKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDG  408
             +KRI+RVK++T MTE VA G+LSGV+KVSGFFTSSVAN+ VG+KF  LLPGE+VLATLDG
Sbjct  272   LKRIKRVKKMTKMTENVANGILSGVIKVSGFFTSSVANTKVGRKFFSLLPGEIVLATLDG  331

Query  407   FSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLR  228
             F+++CDA EVAG+NVMSTSSTV T LV H++G +AA+AT+EGLEA GHA  TAW  FK+R
Sbjct  332   FNKVCDAFEVAGRNVMSTSSTVATELVDHRHGGKAAEATNEGLEAVGHAFGTAWAAFKIR  391

Query  227   KALNP  213
             KA+NP
Sbjct  392   KAINP  396



>gb|KEH30493.1| senescence/dehydration-associated-like protein [Medicago truncatula]
Length=404

 Score =   371 bits (953),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 217/435 (50%), Positives = 283/435 (65%), Gaps = 60/435 (14%)
 Frame = -1

Query  1508  RSPMYPKV--VDPDFENPFHSSSSSANRSPMYPVVDMKDVENLFPENYETVQGYYHHSPS  1335
             ++  YP+V   +PD  +     S S++ S MYP +      NL  E   T Q        
Sbjct  4     KTSFYPQVESTNPDANS---PFSHSSSSSTMYPSIT---TNNLSSEYQNTTQ--------  49

Query  1334  APPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPL  1155
                +A E  L+ VP  ILHLI+K  SV LA+GDL++VSL++ +  VAV AR+ D+IQWPL
Sbjct  50    --TQASEHVLVTVPNVILHLIEKDSSVHLASGDLTIVSLKEEEKVVAVLARIGDQIQWPL  107

Query  1154  TKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLT  975
              KD+++VKLD SHYFF+ + P                              ++VLNYGLT
Sbjct  108   AKDVSTVKLDESHYFFTLKLPQ---------------------------SDDEVLNYGLT  140

Query  974   IASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEG  795
             +A+KG   ++K LD +L+  S  SV KV+     V G  V           EKK++V E 
Sbjct  141   VAAKGSKKVLKKLDEVLEKYSLLSVEKVKG----VKGWEVL----------EKKEDVEEN  186

Query  794   RCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG  615
               AAYWTTLAPNVEDYS    R +A+GSG++I+GILWCGDVTVD LK GD+ ++ R+  G
Sbjct  187   SAAAYWTTLAPNVEDYSGRFGRWIAAGSGQMIRGILWCGDVTVDRLKWGDDFMKKRLQPG  246

Query  614   S-KTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLP  438
             S ++++SP  +  ++ VK++T M+EKVA GVLSG VKVSGF TSSV NS  GKKF   LP
Sbjct  247   SSQSQISPLALNSMKSVKKLTKMSEKVALGVLSGAVKVSGFLTSSVVNSKPGKKFFSFLP  306

Query  437   GEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAM  258
             GE++LA+LDGF+R+CDAVEVAG+NVMSTSS VTTGLVSHKYG++AA+ T+EG +AAGHA+
Sbjct  307   GEVLLASLDGFNRVCDAVEVAGRNVMSTSSVVTTGLVSHKYGEKAAEITNEGFDAAGHAI  366

Query  257   ATAWTVFKLRKALNP  213
              TAW VFKLRKALNP
Sbjct  367   GTAWAVFKLRKALNP  381



>emb|CBI37885.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 224/442 (51%), Positives = 286/442 (65%), Gaps = 94/442 (21%)
 Frame = -1

Query  1523  SQNRTRSP--MYPKV--VDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQ  1359
             S N  R+P  +YP+V   +P+  +P  S+ +SA+ S +YP +++K++ ENLFP+  + V 
Sbjct  2     SSNPYRNPNSLYPEVDLSNPEATSPLISNPTSASSSSLYPSLEVKELAENLFPDENDAVL  61

Query  1358  GYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARV  1179
                  +PS+ P   EE L+ V GAI+HLIDKQ+SVELA+G L++                
Sbjct  62    ----QNPSSQP--FEEVLVRVSGAIVHLIDKQHSVELASGVLTI----------------  99

Query  1178  ADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGN  999
                IQWPL KD A+                                              
Sbjct  100   ---IQWPLAKDEAA----------------------------------------------  110

Query  998   DVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSE  819
             ++LNYGLTIASKGQ+ L+K+LD +L+  S FSV KV+        G V  E         
Sbjct  111   NLLNYGLTIASKGQEGLLKELDAVLEKYSCFSVQKVK--------GTVGWE---------  153

Query  818   KKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEV  639
              KKE++E R  AYWTTLAPNVEDYS   AR++A+GSG+LIKGILW G+VTVD L  G+E 
Sbjct  154   -KKELMEERSGAYWTTLAPNVEDYSGCVARMIAAGSGQLIKGILWSGNVTVDGLNWGNEF  212

Query  638   LRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGK  459
             L+ RM  GSK+E+SPE MKR++RVK++T M+EKVATGVLSGVVKVSGFFTSS+ NS VGK
Sbjct  213   LKKRMGPGSKSEISPEAMKRMKRVKKLTKMSEKVATGVLSGVVKVSGFFTSSIVNSKVGK  272

Query  458   KFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGL  279
             KF  LLPGE+VLA+LDGF+++CDAVEVAGKNVMST+S VTTGLVS +YG++AA  T EGL
Sbjct  273   KFFSLLPGEIVLASLDGFNKVCDAVEVAGKNVMSTTSVVTTGLVSQRYGEQAAHVTHEGL  332

Query  278   EAAGHAMATAWTVFKLRKALNP  213
              AAGHA+ TAW VFK+RKALNP
Sbjct  333   GAAGHAIGTAWAVFKIRKALNP  354



>ref|XP_002534253.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28131.1| conserved hypothetical protein [Ricinus communis]
Length=391

 Score =   367 bits (943),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 222/435 (51%), Positives = 288/435 (66%), Gaps = 79/435 (18%)
 Frame = -1

Query  1505  SPMYPKVVDPDFENP--FHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSPS  1335
             S +YP+V   D  NP    SSSSSA+ S +YP +DMKD+  ++FPE+ +           
Sbjct  5     SSLYPQV---DLSNPEAVSSSSSSASSSSLYPSIDMKDLARDVFPEDRQ-----------  50

Query  1334  APPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPL  1155
                E  EE L+ +PG I+HLI+++ S+ELA GDL++                        
Sbjct  51    ---EPREELLIKIPGVIVHLIERERSIELACGDLTI------------------------  83

Query  1154  TKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLT  975
                        SHYFF+ R P  DD+                          ++LNYG+T
Sbjct  84    -----------SHYFFTLRVPQNDDELSKEV---------------------ELLNYGVT  111

Query  974   IASKGQDNLIKDLDTILDNCSSFSVHKVEETASV-VMGGPVAKEVSPADLKSEKKKEVLE  798
             IASKGQ+ L+K+ D IL+  SSF+V +V ET +  ++ G +AK + P +L  EKKKE++E
Sbjct  112   IASKGQEGLLKEFDKILECYSSFTVQEVRETENWELIDGNIAKGILPEEL--EKKKELME  169

Query  797   GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTS  618
                AAYWT LAPNVEDYSSS AR++A+GSG+LIKGILWCGDVTVD LK G+E L  R+  
Sbjct  170   ESSAAYWTVLAPNVEDYSSSVARMIAAGSGQLIKGILWCGDVTVDRLKWGNEFLMKRVEK  229

Query  617   GSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLP  438
              S TE+SP+ M+R++RVKR+TSM+EKVA G+LSGVVKVSGFFTS++ NS VG KF  LL 
Sbjct  230   KSDTEISPDAMRRVKRVKRLTSMSEKVAIGILSGVVKVSGFFTSAIVNSKVGTKFFSLLA  289

Query  437   GEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAM  258
             GE+VLA+LDGF+++CDAVEVAGKNVMSTSS VTTGLVS +YG++AA+ T+EGL+AAGHA 
Sbjct  290   GEIVLASLDGFNKVCDAVEVAGKNVMSTSSVVTTGLVSQRYGEQAAEVTNEGLDAAGHAF  349

Query  257   ATAWTVFKLRKALNP  213
              TAW VFK+RKALNP
Sbjct  350   GTAWAVFKIRKALNP  364



>ref|XP_010690380.1| PREDICTED: uncharacterized protein LOC104903935 [Beta vulgaris 
subsp. vulgaris]
Length=381

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 200/381 (52%), Positives = 260/381 (68%), Gaps = 33/381 (9%)
 Frame = -1

Query  1346  HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEI  1167
               PS+  +A EE L+ +P  ++HLID Q S+ELA G+L L+ LRQ  ++VAV AR+ D++
Sbjct  10    EQPSSAIDATEELLIKIPATVVHLIDNQQSIELAFGNLELILLRQNATSVAVLARIGDQL  69

Query  1166  QWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLN  987
             QWPLTKD +++KLD+SHYFF+                                   DVLN
Sbjct  70    QWPLTKDESALKLDDSHYFFTI------------------------------SSNGDVLN  99

Query  986   YGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVM--GGPVAKEVSPADLKSEK-  816
             YGLT+ SKGQD+L+K  D+ILD    F   +VE         G  VA+EV P +++ +  
Sbjct  100   YGLTVPSKGQDDLLKKFDSILDKYIEFKEERVEVEVEGEASDGWVVAREVGPDEVERDGV  159

Query  815   KKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL  636
             K+E ++   +AYWTTLAPNVE+YS+  AR++A+GSG L+KGILWCGDVTV+ LK G+E L
Sbjct  160   KREKMKESASAYWTTLAPNVEEYSNCVARMIAAGSGMLVKGILWCGDVTVERLKWGNEFL  219

Query  635   RNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKK  456
             + R+      +VSPE ++RIRRVK +T  +E VAT  L+GVVK S   T SV NS VGK 
Sbjct  220   KRRLGKRENAQVSPECLRRIRRVKSITKRSEDVATATLTGVVKFSETVTGSVVNSRVGKI  279

Query  455   FLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLE  276
             F  + PGE++LA+ DGF +ICDAVEVAGKNVMSTSS VTT LV+ +YG+EAAKAT+EGL+
Sbjct  280   FFNMFPGEIILASFDGFQKICDAVEVAGKNVMSTSSLVTTDLVTERYGEEAAKATNEGLD  339

Query  275   AAGHAMATAWTVFKLRKALNP  213
             AAGHA+ TAWTVFKLRKALNP
Sbjct  340   AAGHAIGTAWTVFKLRKALNP  360



>ref|XP_010041810.1| PREDICTED: uncharacterized protein LOC104430777 [Eucalyptus grandis]
Length=364

 Score =   366 bits (939),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 238/319 (75%), Gaps = 12/319 (4%)
 Frame = -1

Query  1346  HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEI  1167
              SPSAPP++ +E LL VPGAILHLIDK+YSVEL  GD SL++LRQG + VAV ARVADE 
Sbjct  55    RSPSAPPDSSKEVLLRVPGAILHLIDKEYSVELGCGDFSLIALRQGGNAVAVLARVADEA  114

Query  1166  QWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLN  987
             QWPLTKD A+VK+D+SHYFFS R         + ++ KS         +K     +D LN
Sbjct  115   QWPLTKDGAAVKVDDSHYFFSLR---------ALEKAKSGSDSSDDEGKKGGGASDDPLN  165

Query  986   YGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETA--SVVMGGPVAKEVSPADLKSE-K  816
             YGLT ASKGQ+ + ++LD IL+  S+FS+ KV   A  +  +   VAKE SPA+L+S  K
Sbjct  166   YGLTFASKGQEGVFRELDAILEKYSAFSIQKVSRKARKAEALDATVAKETSPAELQSGGK  225

Query  815   KKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL  636
             KKE++E +C AYWTTLAPNVEDYS   A+L+A+GSG+LIKGILWCGDVTVD L  G+EV+
Sbjct  226   KKEIMEDKCRAYWTTLAPNVEDYSGKTAKLIAAGSGQLIKGILWCGDVTVDRLNWGNEVM  285

Query  635   RNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKK  456
             + RMT   K +++ +T+KR+ R K++T MTEKVATGVLSGVV+VSGF TSSVANSSVGKK
Sbjct  286   KKRMTPAEKAQINKKTLKRLERAKKMTRMTEKVATGVLSGVVRVSGFVTSSVANSSVGKK  345

Query  455   FLGLLPGEMVLATLDGFSR  399
             F G   G+MVLA+LDG+S+
Sbjct  346   FFGGKLGQMVLASLDGYSK  364



>gb|KHN36021.1| Spartin [Glycine soja]
Length=288

 Score =   361 bits (927),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 180/261 (69%), Positives = 219/261 (84%), Gaps = 0/261 (0%)
 Frame = -1

Query  995  VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEK  816
            +L+YGLTIASKGQ+ L+K+LD +L+NCS FSV +  +     + G VA+EVSP DL+S K
Sbjct  1    MLSYGLTIASKGQEGLLKELDVVLENCSCFSVQEYAKKKGEALDGTVAREVSPKDLESGK  60

Query  815  KKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL  636
            KKE++EGRCAAYWTTLAPNVEDYS   A+++A+GSG ++KGILWCGDVTVD LK G++V+
Sbjct  61   KKEMMEGRCAAYWTTLAPNVEDYSGKTAKMIAAGSGHVVKGILWCGDVTVDRLKWGNQVM  120

Query  635  RNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKK  456
            + R+  GS  EVSP+T+KRI+RVKRVT MTEKVA G LSGVVKVSGFFTSSV NS  GKK
Sbjct  121  KKRIAPGSHAEVSPQTLKRIKRVKRVTKMTEKVANGFLSGVVKVSGFFTSSVINSKAGKK  180

Query  455  FLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLE  276
            F   LPGE++LA+LDGFS++CDAVEVAGKNVMSTSSTVTT LV H+YG++AA+ATSEG  
Sbjct  181  FFSFLPGEVLLASLDGFSKVCDAVEVAGKNVMSTSSTVTTELVDHRYGEQAAEATSEGFS  240

Query  275  AAGHAMATAWTVFKLRKALNP  213
            AAGHA+ TAW  FK+RKALNP
Sbjct  241  AAGHALGTAWAAFKIRKALNP  261



>ref|XP_007041867.1| Senescence/dehydration-associated protein-related, putative [Theobroma 
cacao]
 gb|EOX97698.1| Senescence/dehydration-associated protein-related, putative [Theobroma 
cacao]
Length=417

 Score =   364 bits (934),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 221/433 (51%), Positives = 289/433 (67%), Gaps = 62/433 (14%)
 Frame = -1

Query  1499  MYPKVVDPDFENP-FHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYHHSPSAPP  1326
             +YP+V   D  NP   S S+S + + +YP +D+KD+ ENLFPE+ +TV   + H  S   
Sbjct  16    LYPQV---DLSNPDATSFSTSPSSTSLYPSIDVKDLAENLFPED-DTV--LHTHQDSQ--  67

Query  1325  EAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKD  1146
                E+ LL +PGAI+HLI+++ SVELA G+  LVSL QGD+ VAVF              
Sbjct  68    ---EQLLLKIPGAIVHLIERETSVELACGEFCLVSLLQGDNVVAVF--------------  110

Query  1145  LASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIAS  966
              A V   N  +     F                                +VLNYGLTIA+
Sbjct  111   -ARVVPSNGSFEDGKDFKE----------------------------SEEVLNYGLTIAA  141

Query  965   KGQDNLIKDLDTILDNCSSFSVHKVEETAS--VVMGGPVAKEVSPADLKSEKKKEVLEGR  792
             KGQ+ L+K+LD +L+  S FSV +V+   +  VV      + V+P +L  E K+E++ G 
Sbjct  142   KGQEGLLKELDRVLETYSCFSVQEVKGIGNWNVVD----TRNVAPEELDREDKRELIVGS  197

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGS  612
               AYWTTLAPNVEDYS S AR +ASGSG ++KGILWCGDVTVD LK  +E L+ RM  GS
Sbjct  198   SMAYWTTLAPNVEDYSGSIARAIASGSGYVVKGILWCGDVTVDRLKWSNEFLKIRMKPGS  257

Query  611   KTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGE  432
              +E+SP  ++R++RVK++T M+EKVATG+LSGVVKVSGFFTSS+ NS VGKKF  LLPGE
Sbjct  258   TSEISPGALRRMKRVKKLTKMSEKVATGILSGVVKVSGFFTSSIINSKVGKKFFNLLPGE  317

Query  431   MVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMAT  252
             +VLA+LDGF+++CDAVEVAG+NVMST+S VTTGLVS +YG++A + T+EGL+AAGHA+ T
Sbjct  318   IVLASLDGFNKVCDAVEVAGRNVMSTTSVVTTGLVSQRYGEKAGQVTNEGLDAAGHAIGT  377

Query  251   AWTVFKLRKALNP  213
             AW VFK+RKALNP
Sbjct  378   AWAVFKIRKALNP  390



>gb|KHN41888.1| hypothetical protein glysoja_003628 [Glycine soja]
Length=291

 Score =   353 bits (906),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 179/264 (68%), Positives = 217/264 (82%), Gaps = 3/264 (1%)
 Frame = -1

Query  995  VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEVSPADLK  825
            +L+YGLTIASKGQ+ L+K+LD +L+NCS FSV  V E A      + G VA+EVSP D++
Sbjct  1    MLSYGLTIASKGQEGLLKELDVVLENCSCFSVQSVSENAKKKGEALDGTVAREVSPKDME  60

Query  824  SEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD  645
            S KKKE++E RCAAYWTTLAPNVEDYS   A+++A+GSG ++KGILWCGDVTVD LK G+
Sbjct  61   SGKKKEMMEERCAAYWTTLAPNVEDYSGKTAKMIAAGSGHVVKGILWCGDVTVDRLKWGN  120

Query  644  EVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
            +V++ R+  GS  EVSP+T+KRI+RVKRVT MTEKVA G LSGVVKVSGFFTSSV NS  
Sbjct  121  QVMKKRIAPGSHAEVSPQTLKRIKRVKRVTKMTEKVANGFLSGVVKVSGFFTSSVINSKA  180

Query  464  GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
            GKK    LPGE++LA+LDGFS++CDAVEV GKNVMSTSSTVTT LV H+YG++AA+ATSE
Sbjct  181  GKKIFSFLPGEVLLASLDGFSKVCDAVEVTGKNVMSTSSTVTTELVDHRYGEQAAEATSE  240

Query  284  GLEAAGHAMATAWTVFKLRKALNP  213
            G  AAGHA+ TAW  FK+RKALNP
Sbjct  241  GFSAAGHALGTAWAAFKIRKALNP  264



>gb|KCW55512.1| hypothetical protein EUGRSUZ_I01404 [Eucalyptus grandis]
Length=538

 Score =   360 bits (924),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 266/386 (69%), Gaps = 41/386 (11%)
 Frame = -1

Query  1535  SPMASQNRTRSPMYPKVV--DPDFENPFHSSSSSANRSP--MYPVVDMKDV-ENLFPENY  1371
             SP  S+N   +P+YP+V+  +P+  +PF+++ ++++ S   +YP VDM D  ENLFPE+ 
Sbjct  187   SPKRSENPA-NPLYPEVILSNPEATSPFYATPATSSSSSPSLYPPVDMTDAAENLFPES-  244

Query  1370  ETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAV  1191
                    +  PS      EETL+ VPGA++HLI  + S+ELA G+L++V LRQGD+ +AV
Sbjct  245   ----DNLYAQPS------EETLVKVPGAMVHLIQTEKSIELACGELTIVGLRQGDNVIAV  294

Query  1190  FARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqk  1011
              ARV DEIQWPL KD  +VKLD++HYFF+ R P                       +  +
Sbjct  295   LARVGDEIQWPLAKDEPAVKLDDTHYFFTLRVP-------------------ADGGDSDR  335

Query  1010  DMGND--VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSP  837
               G D  +LNYGLT A+KGQD L+K+LD +L+  S FSV +V+E  +  M   VA+E+SP
Sbjct  336   GEGGDFEMLNYGLTFAAKGQDGLLKELDRVLEAYSCFSVQEVKEMENWEM---VARELSP  392

Query  836   ADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL  657
              DL+S++KK+++E   AAYWT LAPNVE+YS   ARL+A+GSG+LIKGILWCGDVTV+ L
Sbjct  393   DDLRSKEKKQLVEENSAAYWTALAPNVEEYSGRVARLIAAGSGQLIKGILWCGDVTVERL  452

Query  656   KSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVA  477
             K  DE LR R+   SK+E+S   M+RI+RVK++T M+E VATG+LSGVVKVSGF T S+ 
Sbjct  453   KWADEFLRRRLGPASKSEISAGAMERIKRVKKLTKMSEDVATGILSGVVKVSGFITGSIV  512

Query  476   NSSVGKKFLGLLPGEMVLATLDGFSR  399
             NS  GKKF  LLPGE+VLA+LDGFS+
Sbjct  513   NSRAGKKFFSLLPGEIVLASLDGFSK  538



>ref|NP_001130339.1| hypothetical protein [Zea mays]
 gb|ACF78526.1| unknown [Zea mays]
 gb|ACN29114.1| unknown [Zea mays]
 gb|ACN34631.1| unknown [Zea mays]
 gb|AFW89035.1| hypothetical protein ZEAMMB73_959410 [Zea mays]
Length=487

 Score =   358 bits (919),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 210/479 (44%), Positives = 297/479 (62%), Gaps = 61/479 (13%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKV--VDPDFENPFHSS--------SSSANRSPMYPVVDMKDV-ENLF  1383
              AS N  +S +YP V    PD   PF S+        + +A  + +YP VD  ++ +NLF
Sbjct  3     FASSNAKQS-LYPDVDQSHPDLNTPFFSAPTTSTCAGAGAATGNSLYPTVDPNELAQNLF  61

Query  1382  PENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDS  1203
             PE  E          + PP   EET++ VPGA LHLID   SV+L  G LS+V LRQGD 
Sbjct  62    PETVE-------EDAAPPPPTTEETIIAVPGAQLHLIDPDRSVDLGAGTLSIVRLRQGDH  114

Query  1202  NVAVFARVADE-------------------------IQWPLTKDLASVKLDNSHYFFSFR  1098
             +VAV AR+  E                         +QWPL +D+A+VKLD +HYFFS  
Sbjct  115   SVAVLARLIHEKPHHRRGLFRLFSSGRSDAGAEQEPVQWPLARDVAAVKLDPAHYFFSLH  174

Query  1097  FPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDN  918
              P+ D   D  D + ++   E              L+YGLT+  KGQ+ ++ +LD +L+ 
Sbjct  175   VPHTDHPDDKDDADGAEADAEA------------ALSYGLTVVGKGQEEVLAELDRVLEE  222

Query  917   CSSFSVHKVEETA---SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDY  747
              ++FSV +VE  A   S VM      E++P +   +KK EV+E + AA+WTT+APNV+DY
Sbjct  223   YTTFSVKQVETAAKEKSEVMDARAVAEITPEEAVGDKK-EVVEEKSAAFWTTIAPNVDDY  281

Query  746   SSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPETMKRIRR  570
             SSS ARL+A GSG+L++GI+WCGD+T   L+ G+EV++  +   +K T+V P T++R++R
Sbjct  282   SSSVARLIARGSGQLVRGIIWCGDITAGGLRRGEEVMKKSVGPSTKPTQVKPSTLRRMKR  341

Query  569   VKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICD  390
              +RVT M+ +VA  +LSGV+KV+GF TS+V NS   +KF  L+PGE++LA+LDGF +I D
Sbjct  342   ARRVTKMSNRVANSILSGVLKVTGFVTSTVLNSKPAQKFFKLMPGEVILASLDGFGKIWD  401

Query  389   AVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             AVEV+GKNVM TSS VTT +V+H+YG++A +AT   L A G+ +  AW VFK+RKAL+P
Sbjct  402   AVEVSGKNVMQTSSVVTTSVVTHRYGEQAGEATHNYLHATGNVLGAAWAVFKIRKALDP  460



>ref|XP_006649716.1| PREDICTED: uncharacterized protein LOC102699666 [Oryza brachyantha]
Length=483

 Score =   354 bits (908),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 199/434 (46%), Positives = 283/434 (65%), Gaps = 51/434 (12%)
 Frame = -1

Query  1424  MYPVVDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVEL  1248
             +YP VD + + ENLFP+  +        +P AP    EETL+ VPG++LHL+D   S++L
Sbjct  43    LYPAVDPQQLAENLFPDAADDA------TPPAP--TTEETLVAVPGSLLHLVDPDRSMDL  94

Query  1247  ATGDLSLVSLRQGDSNVAVFARVADE-------------------------IQWPLTKDL  1143
               G LS+V LRQGD +VAV AR+  E                         +QWPLT+D+
Sbjct  95    GAGTLSVVRLRQGDHSVAVLARLIPEKRNQRRGLFSFWSSGKSGDGAAQEPVQWPLTRDV  154

Query  1142  ASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASK  963
             A+VKLD +HYFFS   P+ D D     E +                G   L+YGLT+ASK
Sbjct  155   AAVKLDTAHYFFSLHVPHTDQDDAEDAEAEKDAD------------GEAALSYGLTVASK  202

Query  962   GQDNLIKDLDTILDNCSSFSVHKVEETA---SVVMGGPVAKEVSPADLKSEKKKEVLEGR  792
             GQ+ ++ +LD +L+  ++FSV +VE TA   S VM      E++P +   +KK EV+E +
Sbjct  203   GQEAVLAELDKVLEEYTTFSVKQVEPTAKEKSEVMDTKAVTEITPEEAVGDKK-EVVEEQ  261

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRM-TSG  615
              AA+WTT+APNV+DYSSS ARL+A GSG+L++GI+WCGD+T + L+ G+ V++  +  SG
Sbjct  262   SAAFWTTIAPNVDDYSSSVARLIARGSGQLVRGIIWCGDITAEGLRCGEAVVKKSVGPSG  321

Query  614   SKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPG  435
               ++V P T++R++R +RVT M+ +VA  +LSGV+KVSGF TS+V NS   +KF  L+PG
Sbjct  322   KPSQVKPSTIRRMKRARRVTKMSNRVANSILSGVLKVSGFVTSTVLNSKPAQKFFKLMPG  381

Query  434   EMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMA  255
             E++LA+LDGF ++ DAVEV+GKNVM TSS VTT +V+H+YGD+A + T + L A G+A+ 
Sbjct  382   EVILASLDGFGKVWDAVEVSGKNVMRTSSVVTTSVVTHRYGDQAGQVTQDYLHATGNALG  441

Query  254   TAWTVFKLRKALNP  213
              AW VFK+RKAL+P
Sbjct  442   VAWAVFKIRKALDP  455



>ref|XP_004966470.1| PREDICTED: uncharacterized protein LOC101763384 [Setaria italica]
Length=408

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 214/426 (50%), Positives = 268/426 (63%), Gaps = 61/426 (14%)
 Frame = -1

Query  1460  FHSSSSSANRS---------PMYPVVDMKDVENLFPENYETVQGYYHHSPSAPPEAVEET  1308
             +  SSSSAN +         P+YP + M D   L P     V        + PP + E+ 
Sbjct  7     YSCSSSSANPNNPWPAPSAPPLYPTLTMAD---LAPVEIGPVSSPTAGEDTGPPPS-EDV  62

Query  1307  LLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKL  1128
             LL +PGA LHLID+  S  LA GDLSL+ +R GD+N+A  A + D +QWPL +D+A+VKL
Sbjct  63    LLRIPGAQLHLIDRSRSHPLAAGDLSLLRIRSGDTNLAAIA-LLDPVQWPLARDVAAVKL  121

Query  1127  DNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNL  948
             D  HY FS   P                           D   D L+YGLT++       
Sbjct  122   DPCHYSFSLTVP-----------------------VSADDPNPDPLHYGLTLSHPDAR--  156

Query  947   IKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTL  768
                LD +L   +SFSVH V               V   +L+S  + EV     AAYWT +
Sbjct  157   ---LDGLLATYTSFSVHSV---------------VGTKELESRVRDEV---EAAAYWTAV  195

Query  767   APNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG-SKTEVSPE  591
             APNVE+Y    AR +A+G+  L KGILWCG+VTVD L+ G+EVLR RM  G +  EVSPE
Sbjct  196   APNVEEYGGKVARAIATGAEHLAKGILWCGEVTVDRLRWGNEVLRKRMQPGDANAEVSPE  255

Query  590   TMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLD  411
              ++RI+R K+VT M+EKVATG+LSGVVKV+G+FTSS ANS  GKKF  LLPGE+VLA+LD
Sbjct  256   MLRRIKRAKKVTQMSEKVATGILSGVVKVTGYFTSSFANSKAGKKFFNLLPGEIVLASLD  315

Query  410   GFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKL  231
             GF +ICDAVEV+GKNV+STSSTVTTGLVSHKYGD+AA AT+EGL+AAGHA+ TAW VFK+
Sbjct  316   GFGKICDAVEVSGKNVLSTSSTVTTGLVSHKYGDKAAAATNEGLDAAGHAIGTAWAVFKI  375

Query  230   RKALNP  213
             R+ALNP
Sbjct  376   RQALNP  381



>ref|XP_003558360.1| PREDICTED: uncharacterized protein LOC100842789 [Brachypodium 
distachyon]
Length=484

 Score =   347 bits (891),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 204/473 (43%), Positives = 297/473 (63%), Gaps = 51/473 (11%)
 Frame = -1

Query  1529  MAS-QNRTRSPMYPKVVD--PDFENPFHSS--SSSANRSPMYPVVDMKDV-ENLFPENYE  1368
             MAS  N  +  +YP+V    PD    FHS+  ++ A  + +YP VD +++ E+LFP +  
Sbjct  1     MASASNTNQKSLYPEVAQSHPDHNAAFHSNPPAAGATGASLYPTVDPRELAEDLFPADAA  60

Query  1367  TVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVF  1188
                     +       VEETL+ VPG  LHL+D   S++L  G LS+V LRQGD  VAV 
Sbjct  61    EDAAPAPPT-------VEETLVAVPGTQLHLVDPDRSLDLGAGTLSIVRLRQGDHAVAVL  113

Query  1187  ARVA------------------------DEIQWPLTKDLASVKLDNSHYFFSFRFPNVdd  1080
             AR+                         + +QWPL +D+A+VKLD +HYFFS   P+ D 
Sbjct  114   ARLTPDKSQQRRGLFRFLSGGGRSSEAQEPVQWPLARDVAAVKLDAAHYFFSLHVPHTDH  173

Query  1079  dsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSV  900
               D+ +  +++              G   L+YGLT+A KGQ+ ++++LDT+L   ++FSV
Sbjct  174   PDDAEEAAEAEKDAA---------DGESALSYGLTVAGKGQEKVLEELDTVLKEYTTFSV  224

Query  899   HKVEETA---SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAAR  729
              +V+  A   S VM      E++P +   +KK E++E + AA+WTT+APNV+DYSSS AR
Sbjct  225   KQVDAAANEKSEVMDTRAVTEITPEEAVGDKK-ELMEEQSAAFWTTIAPNVDDYSSSVAR  283

Query  728   LMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMT-SGSKTEVSPETMKRIRRVKRVTS  552
             L+A GSG+L++GI+WCGD+T   LK G+ VL+  +  SG   +V P +++R++R +RVT 
Sbjct  284   LIAKGSGQLVRGIIWCGDITAGGLKCGEAVLKKSVGPSGKPAQVKPSSLRRMKRARRVTK  343

Query  551   MTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAG  372
             M+ +VA  +LSGV+KVSGF TS+V NS   +KF  L+PGE++LA+LDGF ++ DAVEV+G
Sbjct  344   MSNRVANSILSGVLKVSGFVTSTVLNSKPAQKFFKLMPGEVILASLDGFGKVWDAVEVSG  403

Query  371   KNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             KNVM TSS VTT +V+H+YGD+A + T + L A G+A+  AW VFK+RKAL+P
Sbjct  404   KNVMQTSSVVTTSVVTHRYGDQAGEITQDYLHATGNALGVAWAVFKIRKALDP  456



>gb|EAY89209.1| hypothetical protein OsI_10705 [Oryza sativa Indica Group]
Length=482

 Score =   344 bits (882),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 203/470 (43%), Positives = 297/470 (63%), Gaps = 57/470 (12%)
 Frame = -1

Query  1508  RSPMYPKV--VDPDFENPFHSS-SSSANRSP---MYPVVDMKDV-ENLFPENYETVQGYY  1350
             +  +YP+V    PD    F ++ + +A  SP   +YP VD + + ENLFP+  +      
Sbjct  4     KQSLYPEVNQSHPDLNTAFLANPNRAATASPGGSLYPSVDPQQLAENLFPDAADDAAPPP  63

Query  1349  HHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADE  1170
                        EE L+ VPGA LHL+D   S++L  G LS+V LRQGD +VAV AR+  E
Sbjct  64    --------PTTEEALVAVPGAQLHLVDPDRSMDLGAGTLSVVRLRQGDHSVAVLARLVPE  115

Query  1169  ---------------------------IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsd  1071
                                        +QWPLT+D+A+VKLD +HYFFS   P+ D + D
Sbjct  116   KRSQRRGGLFGFLSGGGKAGDGAAQEPVQWPLTRDVAAVKLDTAHYFFSLHVPHTDHEDD  175

Query  1070  ssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKV  891
              ++  +++   +          G   L+YGLT+ASKGQ+ ++  LD +L+  ++FSV +V
Sbjct  176   DAEGAEAEKDAD----------GEAALSYGLTVASKGQEAVLAQLDKVLEEYTTFSVKQV  225

Query  890   EETA---SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMA  720
             E  A   S VM      E++P +   +KK EV+E + AA+WTT+APNV+DYSSS ARL+A
Sbjct  226   EPAAKEKSEVMDTKAVTEITPEEAVGDKK-EVVEEQSAAFWTTIAPNVDDYSSSVARLIA  284

Query  719   SGSGKLIKGILWCGDVTVDSLKSGDEVLRNRM-TSGSKTEVSPETMKRIRRVKRVTSMTE  543
              GSG+L++GI+WCGD+T + L+ G+ V++  +  SG  ++V P T++R++R +RVT M+ 
Sbjct  285   RGSGQLVRGIIWCGDITAEGLRCGEAVVKKSVGPSGKPSQVKPSTIRRMKRARRVTKMSN  344

Query  542   KVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNv  363
             +VA  +LSGV+KVSGF TS+V NS   +KF  L+PGE++LA+LDGF ++ DAVEV+GKNV
Sbjct  345   RVANSILSGVLKVSGFVTSTVLNSKPAQKFFKLMPGEVILASLDGFGKVWDAVEVSGKNV  404

Query  362   mstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             M TSS VTT +V+H+YGD+A + T + L A+G+A+  AW VFK+RKAL+P
Sbjct  405   MRTSSVVTTSVVTHRYGDQAGQVTQDYLHASGNALGVAWAVFKIRKALDP  454



>ref|XP_002439032.1| hypothetical protein SORBIDRAFT_10g030260 [Sorghum bicolor]
 gb|EER90399.1| hypothetical protein SORBIDRAFT_10g030260 [Sorghum bicolor]
Length=419

 Score =   341 bits (875),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 211/428 (49%), Positives = 268/428 (63%), Gaps = 68/428 (16%)
 Frame = -1

Query  1466  NPFHSSSSSANRSPMYPVVDMKDVENLFPENYETVQGYYHHSPSAP---------PEAVE  1314
             NP+ + S+     P+YP + M D   L P       G    SP+AP         P   E
Sbjct  22    NPWPAPSAP----PLYPTLSMAD---LAPVEI----GPVASSPTAPASPSEYDNAPPPSE  70

Query  1313  ETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASV  1134
             + LL VPGA LHLID+  S  LA GDLSL+ +R GD+++A  A + + +QWPL +D+A+V
Sbjct  71    DVLLRVPGAQLHLIDRSRSHPLAAGDLSLLRIRSGDTSLAAIA-LLEPVQWPLARDVAAV  129

Query  1133  KLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQD  954
             KLD  HY FS   P                           D   D L+YGLT+A     
Sbjct  130   KLDPCHYAFSLTVP-----------------------ASADDPSPDPLHYGLTLAHPDAR  166

Query  953   NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWT  774
                  LD IL   +SFSVH V               V   +L+   + EV     AAYWT
Sbjct  167   -----LDGILAAYTSFSVHAV---------------VGTKELEGRVRDEV---EAAAYWT  203

Query  773   TLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG-SKTEVS  597
              +APNVE Y  + AR +A+G+  L KGILWCG+VTV+ L+ G+EVL+ RM  G +  EVS
Sbjct  204   AVAPNVEAYGGAVARTIATGAEHLAKGILWCGEVTVERLRWGNEVLKKRMQPGDANAEVS  263

Query  596   PETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLAT  417
             PE ++RI+R KRV+ ++EKVATG+LSGVVKV+G+FTSS+ANS  GKKF  +LPGE+VLA+
Sbjct  264   PEMLRRIKRAKRVSQISEKVATGILSGVVKVTGYFTSSLANSKAGKKFFNMLPGEIVLAS  323

Query  416   LDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVF  237
             LDGF +ICDAVEVAGKNV+STSSTVTTGLVSHKYGD+AA AT+EGL+AAGHA+ TAW VF
Sbjct  324   LDGFGKICDAVEVAGKNVLSTSSTVTTGLVSHKYGDKAAAATNEGLDAAGHAIGTAWAVF  383

Query  236   KLRKALNP  213
             K+R+ALNP
Sbjct  384   KIRQALNP  391



>ref|XP_009414470.1| PREDICTED: uncharacterized protein LOC103995553 [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   342 bits (877),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 194/383 (51%), Positives = 257/383 (67%), Gaps = 42/383 (11%)
 Frame = -1

Query  1319  VEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADE-IQWPLTKDL  1143
             VEETL+ VPGAI++LID  YS+EL  GD SLV LRQGD+ + V A V D  ++WPL +D 
Sbjct  60    VEETLICVPGAIVYLIDPNYSIELGAGDFSLVRLRQGDNTLTVLAVVGDGLVRWPLLRDE  119

Query  1142  ASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASK  963
               VK D+SHYFFS R P    D D  ++                       NYGLT  SK
Sbjct  120   IVVKFDHSHYFFSLRVPPNFLDDDDGNDLL---------------------NYGLTFTSK  158

Query  962   GQDNLIKDLDTILDNCSSFSVHKV----EETASV--------VMGGPVAKEVSPADLKSE  819
              Q++L+++LD +L   SSFS  ++    E+ A+         V+ G V  EV+PA+    
Sbjct  159   TQESLLRELDCLLQAYSSFSAQEIAVKGEDQAATASSSAMIQVLNGSVELEVTPAE----  214

Query  818   KKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEV  639
                 +++ R AAYWTTLAP+VE+YSS+AA+L+A GSGK+IKGILWCGDVT + +K G++ 
Sbjct  215   ---GMMKERSAAYWTTLAPDVENYSSTAAKLVAKGSGKIIKGILWCGDVTANRIKQGEDK  271

Query  638   LRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
             L+ ++T  SK  E+S   MKR++R KR+T +++KVA GVL+GV+K SG  T+S+  S VG
Sbjct  272   LKGKVTPCSKPAEISKAAMKRMKRAKRITKLSDKVANGVLTGVLKFSGTVTNSIVTSKVG  331

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
              K   LLP E+VLA+LDGF +ICDA EVAGKNV+ TSS VTTG+V H+YGDEAAK T + 
Sbjct  332   SKLFRLLPAEVVLASLDGFGKICDAAEVAGKNVLKTSSEVTTGVVCHRYGDEAAKVTHDS  391

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
             L+AAGHA+ TAW+VFK+R  LNP
Sbjct  392   LQAAGHAVGTAWSVFKIRNVLNP  414



>dbj|BAJ95553.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   342 bits (876),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 203/464 (44%), Positives = 287/464 (62%), Gaps = 47/464 (10%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGY  1353
             MAS ++ +S MYP+V  P      ++++S+     +YP VD  ++ ENLFP +       
Sbjct  1     MASASKQQS-MYPEV--PQSHPDHNTAASTGTGDSLYPTVDPNELAENLFPADEAEDAAP  57

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVA-  1176
                +       VEETL+ VPGA LHL+D   S++L  G LS+V LRQGD  VAV AR+  
Sbjct  58    APPT-------VEETLVDVPGAQLHLVDPDRSLDLGAGTLSVVRLRQGDHCVAVLARLTP  110

Query  1175  ----------------------DEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssd  1062
                                   + +QW L  D+A VKLD  HYFFS   P+ D   D  D
Sbjct  111   DKSNQRRGFFSFLSSGRSSDAQEPVQWLLAGDVAVVKLDAGHYFFSLHVPHSDHPDDKED  170

Query  1061  eekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEET  882
              E                     L+YGLT+A KGQ+ ++++LD +L   ++FSV +V+E 
Sbjct  171   AEAETDADRET-----------ALSYGLTVAGKGQEQVLEELDRVLKEYTTFSVKQVDEG  219

Query  881   ASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKL  702
             A  VM      E++P +   +KK+E+ E + AA+WTT+APNV+DYSSS ARL+A GSG+L
Sbjct  220   AGEVMDTRAVSEITPEEAAGDKKEEI-EEQSAAFWTTIAPNVDDYSSSVARLIAKGSGQL  278

Query  701   IKGILWCGDVTVDSLKSGDEVLRNRM-TSGSKTEVSPETMKRIRRVKRVTSMTEKVATGV  525
             ++GI+WCGD+T   LK G+ VL+     +G  T+V P ++KR++R +RVT M+ +VA  +
Sbjct  279   VRGIIWCGDITASGLKCGEAVLKKGAGANGKPTQVKPSSLKRMKRARRVTKMSNRVANSI  338

Query  524   LSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsst  345
             LSGV+KVSGF TS+V NS   +KF  L+PGE++LA+LDGF ++ DAVEV+GKNVM TSS 
Sbjct  339   LSGVLKVSGFVTSTVVNSKPAQKFFKLMPGEVILASLDGFGKVWDAVEVSGKNVMKTSSV  398

Query  344   vttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             VTT +V+H+YGD+A + T + L A G+A+  AW VFK+RKAL+P
Sbjct  399   VTTSVVTHRYGDQAGEITQDYLHATGNALGVAWAVFKIRKALDP  442



>ref|XP_008644255.1| PREDICTED: physical impedance induced protein2 isoform X1 [Zea 
mays]
 gb|ACG47016.1| senescence-associated protein 12 [Zea mays]
 gb|ACN29122.1| unknown [Zea mays]
 gb|AFW69518.1| Senescence-associated protein 12 [Zea mays]
Length=415

 Score =   338 bits (866),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 204/421 (48%), Positives = 268/421 (64%), Gaps = 59/421 (14%)
 Frame = -1

Query  1466  NPFHSSSSSANRSPMYPVVDMKDVE--NLFPENYETVQGYYHHSPSAPPEAVEETLLIVP  1293
             NP+ + S+     P+YP + M D+    + P +  T    Y+    APP + E+ LL VP
Sbjct  22    NPWPAPSAP----PLYPTLSMADLAPVEIGPASSPTASDDYN----APPPS-EDVLLRVP  72

Query  1292  GAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHY  1113
             GA LHL+D+  S  LA GDLSL+ +R GD+++A  A +   +QWPL +D+A+VKLD  HY
Sbjct  73    GARLHLVDRSRSHPLAAGDLSLLRIRSGDTSLAAIALLG-PVQWPLARDVAAVKLDPCHY  131

Query  1112  FFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLD  933
              FS   P                           D   D L+YGLT++          LD
Sbjct  132   AFSLTVP-----------------------ASADDPSPDPLHYGLTLSRPDVR-----LD  163

Query  932   TILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVE  753
              +L   +SFSVH V               V    L++  + E      AAYWT +APNVE
Sbjct  164   GVLAAYTSFSVHAV---------------VGAGQLEARVRDE---AEAAAYWTAVAPNVE  205

Query  752   DYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG-SKTEVSPETMKRI  576
              Y  + AR +A+G+  L KGILWCG+VTV+ L+ G+EVL+ RM  G +  EVSPE ++RI
Sbjct  206   AYGGAVARTIATGAEHLAKGILWCGEVTVERLRWGNEVLKRRMQPGDANAEVSPEMLRRI  265

Query  575   RRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRI  396
             +R KRV+ ++EKVATG+LSGVVKV+G+FTSS+ANS  GKKF  +LPGE+VLA+LDGF +I
Sbjct  266   KRAKRVSQISEKVATGILSGVVKVTGYFTSSLANSKAGKKFFNMLPGEIVLASLDGFGKI  325

Query  395   CDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALN  216
             CDAVEVAGKNV+STSSTVTTGLVSH+YGD+AA AT+EGL+AAGHA+ TAW VFK+R+ALN
Sbjct  326   CDAVEVAGKNVLSTSSTVTTGLVSHRYGDKAAAATNEGLDAAGHAIGTAWAVFKIRQALN  385

Query  215   P  213
             P
Sbjct  386   P  386



>ref|NP_001049520.1| Os03g0241900 [Oryza sativa Japonica Group]
 gb|ABF94900.1| Senescence-associated protein, expressed [Oryza sativa Japonica 
Group]
 gb|ABF94902.1| Senescence-associated protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11434.1| Os03g0241900 [Oryza sativa Japonica Group]
 gb|EAZ26228.1| hypothetical protein OsJ_10096 [Oryza sativa Japonica Group]
 dbj|BAG93854.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99310.1| unnamed protein product [Oryza sativa Japonica Group]
Length=482

 Score =   340 bits (871),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 202/470 (43%), Positives = 296/470 (63%), Gaps = 57/470 (12%)
 Frame = -1

Query  1508  RSPMYPKV--VDPDFENPFHSS-SSSANRSP---MYPVVDMKDV-ENLFPENYETVQGYY  1350
             +  +YP+V    PD    F ++ + +A  SP   +YP VD + + ENLFP+  +      
Sbjct  4     KQSLYPEVNQSHPDLNTAFLANPNRAATASPGGSLYPSVDPQQLAENLFPDAADDAAPPP  63

Query  1349  HHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADE  1170
                        EE L+ VPGA LHL+D   S++L  G LS+V LRQGD +VAV AR+  E
Sbjct  64    --------PTTEEALVAVPGAQLHLVDPDRSMDLGAGTLSVVRLRQGDHSVAVLARLVPE  115

Query  1169  ---------------------------IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsd  1071
                                        +QWPLT+D+A+VKLD +HYFFS   P+ D + D
Sbjct  116   KRSQRRGGLFGFLSGGGKAGDGAAQEPVQWPLTRDVAAVKLDTAHYFFSLHVPHTDHEDD  175

Query  1070  ssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKV  891
              ++  +++   +          G   L+YGLT+ASKGQ+ ++  LD +L+  ++FSV +V
Sbjct  176   DAEGAEAEKDAD----------GEAALSYGLTVASKGQEAVLAQLDKVLEEYTTFSVKQV  225

Query  890   EETA---SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMA  720
             E  A   S VM      E++P +   +KK EV+E + AA+WTT+APNV+DYSSS ARL+A
Sbjct  226   EPAAKEKSEVMDTKAVTEITPEEAVGDKK-EVVEEQSAAFWTTIAPNVDDYSSSVARLIA  284

Query  719   SGSGKLIKGILWCGDVTVDSLKSGDEVLRNRM-TSGSKTEVSPETMKRIRRVKRVTSMTE  543
              GSG+L++GI+WCGD+T + L+ G+ V++  +  SG  ++V P T++R++R +RVT M+ 
Sbjct  285   RGSGQLVRGIIWCGDITAEGLRCGEAVVKKSVGPSGKPSQVKPSTIRRMKRARRVTKMSN  344

Query  542   KVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNv  363
             +VA  +LSGV+KVSGF TS+V NS   +KF  L+ GE++LA+LDGF ++ DAVEV+GKNV
Sbjct  345   RVANSILSGVLKVSGFVTSTVLNSKPAQKFFKLMLGEVILASLDGFGKVWDAVEVSGKNV  404

Query  362   mstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             M TSS VTT +V+H+YGD+A + T + L A+G+A+  AW VFK+RKAL+P
Sbjct  405   MRTSSVVTTSVVTHRYGDQAGQVTQDYLHASGNALGVAWAVFKIRKALDP  454



>ref|XP_004985044.1| PREDICTED: uncharacterized protein LOC101780138 [Setaria italica]
Length=483

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 210/473 (44%), Positives = 302/473 (64%), Gaps = 56/473 (12%)
 Frame = -1

Query  1526  ASQNRTRSPMYPKV--VDPDFENPFHSS--SSSANRSPMYPVVD-MKDVENLFPENYETV  1362
             AS N  +S +YP+V    PD   PF+S+  +S++  S +YP VD  K  ENLFPE  E  
Sbjct  4     ASSNAKQS-LYPEVNQSHPDLNTPFYSAPTTSTSTGSSLYPTVDPNKLAENLFPETAEEE  62

Query  1361  QGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
                     + PP   EET++ VPGA LHL+D   S++L  G LS+V LRQGD +VAV AR
Sbjct  63    A-------APPPPTTEETIVTVPGAQLHLVDPDRSLDLGAGTLSVVRLRQGDHSVAVLAR  115

Query  1181  VADE--------------------------IQWPLTKDLASVKLDNSHYFFSFRFPNVdd  1080
             +  E                          +QWPLT+D+A+VKLD +HYFFS   P+ D 
Sbjct  116   LTPEKPHHRRGLFRLFSSGRSGGDGAEHEPVQWPLTRDVAAVKLDAAHYFFSLHVPHTDH  175

Query  1079  dsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSV  900
               D  + ++   + E              L+YGLT+A KGQ+ ++++LD  L+  ++FSV
Sbjct  176   PDDKEEGDEGADEAEA------------ALSYGLTVAGKGQEKVLEELDRALEEYTTFSV  223

Query  899   HKVEETASV---VMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAAR  729
              +VE  A     VM      E++P +   +KK EV+E + AA+WTT+APNV+DYSSS AR
Sbjct  224   KQVEAAAKEKLEVMDSRAVAEITPEEAVGDKK-EVVEEKSAAFWTTIAPNVDDYSSSVAR  282

Query  728   LMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTS  552
             L+A GSG+L++GI+WCGD+T + L+ G++V++  +   +K T+V P T++R++R +RVT 
Sbjct  283   LIARGSGQLVRGIIWCGDITAEGLRRGEDVVKKSVGPSAKPTQVKPSTLRRMKRARRVTK  342

Query  551   MTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAG  372
             M+ +VA  +LSGV+KV+GF TS+V NS   +KF  L+PGE++LA+LDGF ++ DAVEV+G
Sbjct  343   MSNRVANSILSGVLKVTGFVTSTVMNSKPAQKFFKLMPGEVILASLDGFGKVWDAVEVSG  402

Query  371   KNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             KNVM TSS VTT +V+H+YG++A +AT   L A G+A+  AW VFK+RKAL+P
Sbjct  403   KNVMQTSSVVTTSVVTHRYGEQAGEATHNYLHATGNALGVAWAVFKIRKALDP  455



>ref|XP_006656495.1| PREDICTED: uncharacterized protein LOC102721935 [Oryza brachyantha]
Length=409

 Score =   333 bits (854),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 203/407 (50%), Positives = 266/407 (65%), Gaps = 52/407 (13%)
 Frame = -1

Query  1424  MYPVVDMKDVE--NLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVE  1251
             +YP + M D+    + P +  +       + + PP   E+ LL +PGA LHLID+  S  
Sbjct  25    LYPTLTMADLAPVEIGPSSPASPATAEDDANAPPPS--EDVLLRIPGAQLHLIDRHRSHP  82

Query  1250  LATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsd  1071
             LA GDLSL+ +R GD+++A  A +   IQWPL +D+A+VKLD  HY FS   P       
Sbjct  83    LAAGDLSLLRIRSGDTSLAAIALL-QPIQWPLARDVAAVKLDPCHYSFSLTVP-------  134

Query  1070  ssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKV  891
                                 D     L+YGLT++     +L   LD IL   +SFSV   
Sbjct  135   ----------------PSADDPNPGPLHYGLTLS---HPDL--RLDGILATYTSFSVQ--  171

Query  890   EETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGS  711
                 SVV G  +A +V         ++EV     AAYWT +APNVE+Y  + AR +++G+
Sbjct  172   ----SVVGGEALASKV---------REEV---EAAAYWTAVAPNVEEYGGAVARAISTGA  215

Query  710   GKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG-SKTEVSPETMKRIRRVKRVTSMTEKVA  534
             G L KGILWCG+VTV+ L+ G+EVL+ RM  G +  EV+PE ++RI+R K+VT M+EKVA
Sbjct  216   GHLAKGILWCGEVTVERLRWGNEVLKKRMQPGDADAEVTPEMLRRIKRAKKVTQMSEKVA  275

Query  533   TGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmst  354
             TG+LSGVVKV+G+FTSS+ANS  GKKF  LLPGE+VLA+LDGF +ICDAVEVAG NV+ST
Sbjct  276   TGILSGVVKVTGYFTSSIANSKAGKKFFSLLPGEIVLASLDGFGKICDAVEVAGTNVLST  335

Query  353   sstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             SSTVTTGLVSHKYG++AA AT+EGL+AAGHA+ TAWTVFK+R+ALNP
Sbjct  336   SSTVTTGLVSHKYGEKAAAATNEGLDAAGHAIGTAWTVFKIRQALNP  382



>gb|ACL53659.1| unknown [Zea mays]
Length=415

 Score =   333 bits (853),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 202/421 (48%), Positives = 266/421 (63%), Gaps = 59/421 (14%)
 Frame = -1

Query  1466  NPFHSSSSSANRSPMYPVVDMKDVE--NLFPENYETVQGYYHHSPSAPPEAVEETLLIVP  1293
             NP+ + S+     P+YP + M D+    + P +  T    Y+    APP + E+ LL VP
Sbjct  22    NPWPAPSAP----PLYPTLSMADLAPVEIGPASSPTASDDYN----APPPS-EDVLLRVP  72

Query  1292  GAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHY  1113
             GA LHL+D+  S  LA GDLSL+ +R GD+++A  A +   +QWPL +D+A+VKLD  HY
Sbjct  73    GARLHLVDRSRSHPLAAGDLSLLRIRSGDTSLAAIALLG-PVQWPLARDVAAVKLDPCHY  131

Query  1112  FFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLD  933
              FS   P                           D   D L+YGLT++          LD
Sbjct  132   AFSLTVP-----------------------ASADDPSPDPLHYGLTLSRPDVR-----LD  163

Query  932   TILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVE  753
              +L   +SFSVH                 V    L++  + E      AAYWT +APNVE
Sbjct  164   GVLAAYTSFSVHA---------------GVGAGQLEARVRDE---AEAAAYWTAVAPNVE  205

Query  752   DYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG-SKTEVSPETMKRI  576
              Y  + AR +A+G+  L KGILWCG+VTV+ L+ G+EV + RM  G +  EVSPE ++RI
Sbjct  206   AYGGAVARTIATGAEHLAKGILWCGEVTVERLRWGNEVPKRRMQPGDANAEVSPEMLRRI  265

Query  575   RRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRI  396
             +R KRV+ ++EKVATG+LSGVVKV+G+FTSS+ANS  GKKF  +LPGE+VLA+LDGF +I
Sbjct  266   KRAKRVSQISEKVATGILSGVVKVTGYFTSSLANSKAGKKFFNMLPGEIVLASLDGFGKI  325

Query  395   CDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALN  216
             CDAVEVAGKNV+STSSTVTTGLVSH+YGD+AA AT+EGL+AAGHA+ TAW VFK+R+ALN
Sbjct  326   CDAVEVAGKNVLSTSSTVTTGLVSHRYGDKAAAATNEGLDAAGHAIGTAWAVFKIRQALN  385

Query  215   P  213
             P
Sbjct  386   P  386



>gb|KHN04729.1| hypothetical protein glysoja_046662 [Glycine soja]
Length=395

 Score =   332 bits (850),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 177/268 (66%), Positives = 225/268 (84%), Gaps = 3/268 (1%)
 Frame = -1

Query  1007  MGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASV---VMGGPVAKEVSP  837
              G  VL++GLTIASKGQ++L+K+LD +L  CS+FSV KV E A     V+   VA  +SP
Sbjct  100   FGASVLSHGLTIASKGQEDLLKELDKVLQECSAFSVQKVSEKAKKEGDVVDASVALAISP  159

Query  836   ADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL  657
              DL+ E+KKE++E +CAAYWTTLAPN+EDYS +A +L+A+ SG+L+KGILWCGDVTV+ L
Sbjct  160   VDLEKEEKKEMMEEKCAAYWTTLAPNMEDYSGTATKLIAASSGQLVKGILWCGDVTVEQL  219

Query  656   KSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVA  477
             + G+EV++ RMT GS+ E+SP+T+K+I+ VK+VT MTE VA GVL+GVVKVSGFFTSSVA
Sbjct  220   RWGNEVMKRRMTLGSQGEISPKTLKQIKMVKKVTKMTESVANGVLTGVVKVSGFFTSSVA  279

Query  476   NSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAK  297
             NS  GKKF  LLPGE+VLA+LDGFS++CDAVEVAGK+VMSTS+TVTT LV+H+YG+EAAK
Sbjct  280   NSKAGKKFFSLLPGEVVLASLDGFSKVCDAVEVAGKSVMSTSNTVTTELVNHRYGEEAAK  339

Query  296   ATSEGLEAAGHAMATAWTVFKLRKALNP  213
             ATSEGL+AAGHA+ TAW  FK+ +ALNP
Sbjct  340   ATSEGLDAAGHAVGTAWAAFKIPQALNP  367



>gb|EAZ02371.1| hypothetical protein OsI_24475 [Oryza sativa Indica Group]
Length=419

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 198/376 (53%), Positives = 250/376 (66%), Gaps = 49/376 (13%)
 Frame = -1

Query  1337  SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWP  1158
             +APP + E+ LL +PGA LHLID+  S  LA GDLSL+ +R GD+++A  A +   IQWP
Sbjct  65    NAPPPS-EDVLLRIPGAQLHLIDRHRSYPLAAGDLSLLRIRSGDTSLAAIA-LLHPIQWP  122

Query  1157  LTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGL  978
             L +D+ASVKLD  HY FS   P                           D     L+YGL
Sbjct  123   LARDVASVKLDPCHYSFSLTVP-----------------------PSADDPNPGPLHYGL  159

Query  977   TIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLE  798
             T++          LD IL   +SFSV       SVV GG +A +V         + EV  
Sbjct  160   TLSHPDPR-----LDGILATYTSFSVQ------SVVGGGALASKV---------RDEV--  197

Query  797   GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTS  618
                AAYWT +APNVE+Y    A  +A+G+G L KGILWC ++TVD L+ G+EVL+ RM  
Sbjct  198   -EAAAYWTAVAPNVEEYGGKVANAIATGAGHLAKGILWCSELTVDRLRWGNEVLKRRMQP  256

Query  617   G-SKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLL  441
             G +  EVSPE ++RI+RVK VT M+EKVATG+LSGVVKV+G+FT+S+ANS  GKKF  LL
Sbjct  257   GDADAEVSPEMLRRIKRVKMVTKMSEKVATGILSGVVKVTGYFTNSIANSKAGKKFFNLL  316

Query  440   PGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHA  261
             PGE+VLA+LDGF +ICDAVEVAG NV+STSSTVTTGLVSHKYG++AA AT+EG++AAGHA
Sbjct  317   PGEIVLASLDGFGKICDAVEVAGTNVLSTSSTVTTGLVSHKYGEKAAAATNEGMDAAGHA  376

Query  260   MATAWTVFKLRKALNP  213
             + TAW VFK+R+ALNP
Sbjct  377   IGTAWAVFKIRQALNP  392



>ref|NP_001058592.1| Os06g0717100 [Oryza sativa Japonica Group]
 gb|AAL79714.1|AC091774_5 putative senescence-associated protein [Oryza sativa Japonica 
Group]
 dbj|BAD53587.1| putative ERD7 protein [Oryza sativa Japonica Group]
 dbj|BAD61717.1| putative ERD7 protein [Oryza sativa Japonica Group]
 dbj|BAF20506.1| Os06g0717100 [Oryza sativa Japonica Group]
Length=419

 Score =   325 bits (833),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 197/376 (52%), Positives = 249/376 (66%), Gaps = 49/376 (13%)
 Frame = -1

Query  1337  SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWP  1158
             +APP + E+ LL +PGA LHLID+  S  LA GDLSL+ +R GD+++A  A +   IQWP
Sbjct  65    NAPPPS-EDVLLRIPGAQLHLIDRHRSYPLAAGDLSLLRIRSGDTSLAAIA-LLHPIQWP  122

Query  1157  LTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGL  978
             L +D+ASVKLD  HY FS   P                           D     L+YGL
Sbjct  123   LARDVASVKLDPCHYSFSLTVP-----------------------PSADDPNPGPLHYGL  159

Query  977   TIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLE  798
             T++          LD IL   +SFSV       SVV G  +A +V         + EV  
Sbjct  160   TLSHPD-----PRLDGILATYTSFSVQ------SVVGGEALASKV---------RDEV--  197

Query  797   GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTS  618
                AAYWT +APNVE+Y    A  +A+G+G L KGILWC ++TVD L+ G+EVL+ RM  
Sbjct  198   -EAAAYWTAVAPNVEEYGGKVANAIATGAGHLAKGILWCSELTVDRLRWGNEVLKRRMQP  256

Query  617   G-SKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLL  441
             G +  EVSPE ++RI+RVK VT M+EKVATG+LSGVVKV+G+FT+S+ANS  GKKF  LL
Sbjct  257   GDADAEVSPEMLRRIKRVKMVTKMSEKVATGILSGVVKVTGYFTNSIANSKAGKKFFNLL  316

Query  440   PGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHA  261
             PGE+VLA+LDGF +ICDAVEVAG NV+STSSTVTTGLVSHKYG++AA AT+EG++AAGHA
Sbjct  317   PGEIVLASLDGFGKICDAVEVAGTNVLSTSSTVTTGLVSHKYGEKAAAATNEGMDAAGHA  376

Query  260   MATAWTVFKLRKALNP  213
             + TAW VFK+R+ALNP
Sbjct  377   IGTAWAVFKIRQALNP  392



>ref|XP_003560326.1| PREDICTED: uncharacterized protein LOC100826709 [Brachypodium 
distachyon]
Length=405

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 193/405 (48%), Positives = 256/405 (63%), Gaps = 58/405 (14%)
 Frame = -1

Query  1424  MYPVVDMKDVENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELA  1245
             +YP + M D   L P    T       +P   P   E+ LL +PGA LHLID++ S  LA
Sbjct  29    LYPTLTMAD---LAPVEIPT-------TPDGAPPPSEDVLLRLPGAQLHLIDRRRSHPLA  78

Query  1244  TGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdss  1065
              GDLSL  +R GD+++A  A +   IQWPL +D+A+VKLD  HY FS   P         
Sbjct  79    AGDLSLRRIRAGDASLAATALLG-PIQWPLARDVAAVKLDPRHYSFSLAVP---------  128

Query  1064  deekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEE  885
                               D   D L+YGLT+++         LD +L   +SFSVH V  
Sbjct  129   --------------ASHDDPSPDPLHYGLTLSAPDPR-----LDAVLGAYTSFSVHSVAG  169

Query  884   TASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGK  705
             + ++  G                + EV     AAYWT +APNVE+Y  + A+ +A G+  
Sbjct  170   SEALAGGA---------------RGEV---EAAAYWTAVAPNVEEYGGAVAKAIARGAEN  211

Query  704   LIKGILWCGDVTVDSLKSGDEVLRNRMTSG-SKTEVSPETMKRIRRVKRVTSMTEKVATG  528
             + KGI+WCG +TVD L+ G+EVLR R+  G +  EVSPE ++RI+RVK+VT M+EKVA+G
Sbjct  212   VAKGIIWCGVMTVDRLRWGNEVLRKRIQPGDTDAEVSPEMLRRIQRVKKVTKMSEKVASG  271

Query  527   VLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstss  348
             +LSGVVKV+G+ TSS+ANS  GKKF  +LPGE++LA+LDGF +I DAVEVAGK+V+STSS
Sbjct  272   ILSGVVKVTGYLTSSLANSKAGKKFFSMLPGEILLASLDGFGKISDAVEVAGKDVLSTSS  331

Query  347   tvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             TVTTGLVSHKYG++AA AT+EG++AAGHA+ TAW VFK+R+ALNP
Sbjct  332   TVTTGLVSHKYGEKAAAATNEGMDAAGHAIGTAWAVFKIRQALNP  376



>gb|KEH30494.1| senescence/dehydration-associated-like protein [Medicago truncatula]
Length=349

 Score =   315 bits (806),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 192/400 (48%), Positives = 252/400 (63%), Gaps = 60/400 (15%)
 Frame = -1

Query  1508  RSPMYPKV--VDPDFENPFHSSSSSANRSPMYPVVDMKDVENLFPENYETVQGYYHHSPS  1335
             ++  YP+V   +PD  +     S S++ S MYP +      NL  E   T Q        
Sbjct  7     KTSFYPQVESTNPDANS---PFSHSSSSSTMYPSIT---TNNLSSEYQNTTQ--------  52

Query  1334  APPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPL  1155
                +A E  L+ VP  ILHLI+K  SV LA+GDL++VSL++ +  VAV AR+ D+IQWPL
Sbjct  53    --TQASEHVLVTVPNVILHLIEKDSSVHLASGDLTIVSLKEEEKVVAVLARIGDQIQWPL  110

Query  1154  TKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLT  975
              KD+++VKLD SHYFF+ + P                              ++VLNYGLT
Sbjct  111   AKDVSTVKLDESHYFFTLKLPQ---------------------------SDDEVLNYGLT  143

Query  974   IASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEG  795
             +A+KG   ++K LD +L+  S  SV KV+     V G  V           EKK++V E 
Sbjct  144   VAAKGSKKVLKKLDEVLEKYSLLSVEKVKG----VKGWEVL----------EKKEDVEEN  189

Query  794   RCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG  615
               AAYWTTLAPNVEDYS    R +A+GSG++I+GILWCGDVTVD LK GD+ ++ R+  G
Sbjct  190   SAAAYWTTLAPNVEDYSGRFGRWIAAGSGQMIRGILWCGDVTVDRLKWGDDFMKKRLQPG  249

Query  614   S-KTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLP  438
             S ++++SP  +  ++ VK++T M+EKVA GVLSG VKVSGF TSSV NS  GKKF   LP
Sbjct  250   SSQSQISPLALNSMKSVKKLTKMSEKVALGVLSGAVKVSGFLTSSVVNSKPGKKFFSFLP  309

Query  437   GEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHK  318
             GE++LA+LDGF+R+CDAVEVAG+NVMSTSS VTTGLVSHK
Sbjct  310   GEVLLASLDGFNRVCDAVEVAGRNVMSTSSVVTTGLVSHK  349



>ref|XP_002962281.1| hypothetical protein SELMODRAFT_77517 [Selaginella moellendorffii]
 gb|EFJ37541.1| hypothetical protein SELMODRAFT_77517 [Selaginella moellendorffii]
Length=491

 Score =   319 bits (818),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 190/414 (46%), Positives = 253/414 (61%), Gaps = 41/414 (10%)
 Frame = -1

Query  1388  LFPENYE--TVQGYYHHSPSAPP--EAVEETLLIVPGAILHLIDKQYSVELATGDLSLVS  1221
             L+P+ Y+  + +G        PP  EA EE L+ +PG + HLID+Q SV LA+G+  LV 
Sbjct  72    LYPDIYQPPSSKGAETSDAKEPPVVEASEEVLVKIPGCLAHLIDEQESVILASGEFVLVK  131

Query  1220  LRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgk  1041
             L Q  ++VA+FARV DE+QWP+  DL + KLD SHY FS R                  +
Sbjct  132   LLQNGTDVALFARVGDELQWPVVNDLPATKLDPSHYVFSLRV-----------------E  174

Query  1040  kegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFS----VHKVEETASV  873
              +   K  +     + LNYG+T    G   L+++LD IL+  S FS    +   EE    
Sbjct  175   ADDDEKPPKDSKATETLNYGVTFQVDGNKELLRELDKILEQYSYFSAPTMLQGSEEDVKK  234

Query  872   VMGGPVAKEVS-------------PADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAA  732
             V GG V +  S             P D  +EKK    +    AYWTT+APNV+DY+SS A
Sbjct  235   VDGGKVPEASSREVVSSDLPGKPVPTDAITEKKPS--DEVSTAYWTTIAPNVDDYNSSLA  292

Query  731   RLMASGSGKLIKGILWCGDVTVDSL-KSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVT  555
             R +A G+G +I+GI WC + TV +L ++G  V R     G  +EVSP TM+ IRR KRVT
Sbjct  293   RAIAGGTGHIIRGIFWCSETTVANLERTGRLVRRVSGACGKPSEVSPRTMRNIRRAKRVT  352

Query  554   SMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVA  375
              M+EKVA GVL+GVV V+GFFT+S+ NS  GKKF  +LPGE+ LA+LDGF +I DAVEVA
Sbjct  353   KMSEKVAKGVLTGVVSVTGFFTTSIVNSRAGKKFFKMLPGEIALASLDGFGKIFDAVEVA  412

Query  374   GKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             G NV++TSS VTTG +SH++GD+A +   EGL  AGH ++TAWT+ KLR A+NP
Sbjct  413   GTNVLNTSSVVTTGAISHRFGDKAGEFAHEGLATAGHLVSTAWTISKLRNAINP  466



>ref|XP_002965196.1| hypothetical protein SELMODRAFT_64393, partial [Selaginella moellendorffii]
 gb|EFJ34034.1| hypothetical protein SELMODRAFT_64393, partial [Selaginella moellendorffii]
Length=387

 Score =   314 bits (804),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 185/388 (48%), Positives = 240/388 (62%), Gaps = 37/388 (10%)
 Frame = -1

Query  1322  AVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDL  1143
             A EE L+ +PG + HLID+Q SV LA+G+  LV L Q  ++VA+FARV DE+QWP+  DL
Sbjct  1     ASEEVLVKIPGCLAHLIDEQESVILASGEFVLVKLLQNGTDVALFARVGDELQWPVVNDL  60

Query  1142  ASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASK  963
              + KLD SHY FS R                    +   K  +     + LNYG+T    
Sbjct  61    PATKLDPSHYVFSLRV-----------------DADDDEKPPKDSKATETLNYGVTFQVD  103

Query  962   GQDNLIKDLDTILDNCSSFS----VHKVEETASVVMGGPVAKEVS-------------PA  834
             G   L+ +LD IL+  S FS    +   EE    V GG V +  S             P 
Sbjct  104   GNKELLGELDKILEQYSYFSAPTMLQGSEEDVKKVDGGKVPEASSREVVSSDLPGKPVPT  163

Query  833   DLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL-  657
             D  +EKK    E    AYWTT+APNV+DY+SS AR +ASG+G +I+GI WC + TV +L 
Sbjct  164   DAITEKKPS--EEVSTAYWTTIAPNVDDYNSSLARAIASGTGHIIRGIFWCSETTVTNLE  221

Query  656   KSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVA  477
             ++G  V R     G  +EVSP TM+ IRR KRVT M+EKVA GVL+GVV V+GFFT+S+ 
Sbjct  222   RTGRLVRRVSGACGKPSEVSPRTMRNIRRAKRVTKMSEKVAKGVLTGVVSVTGFFTTSIV  281

Query  476   NSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAK  297
             NS  GKKF  +LPGE+ LA+LDGF +I DAVEVAG NV++TSS VTTG +SH++GD+A +
Sbjct  282   NSRAGKKFFKMLPGEIALASLDGFGKIFDAVEVAGTNVLNTSSVVTTGAISHRFGDKAGE  341

Query  296   ATSEGLEAAGHAMATAWTVFKLRKALNP  213
                EGL  AGH ++TAWT+ KLR A+NP
Sbjct  342   FAHEGLATAGHLVSTAWTISKLRNAINP  369



>dbj|BAJ93014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   306 bits (784),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 186/379 (49%), Positives = 244/379 (64%), Gaps = 54/379 (14%)
 Frame = -1

Query  1340  PSAP--PEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEI  1167
             PS+P  P   E+ LL +P A LHLID++ S+ LA G LSL+ +R G +++A  AR+   I
Sbjct  82    PSSPGAPAPSEDVLLRLPRAQLHLIDRRRSLPLAAGGLSLLRIRAGGTSLAAIARLG-PI  140

Query  1166  QWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLN  987
             QWPL +D+A+VKLD  HY FS   P                              +  L+
Sbjct  141   QWPLARDVAAVKLDPCHYSFSLTVPASP---------------------------DTPLH  173

Query  986   YGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKE  807
             YGLT++          LD +L   + FS H      SVV G  +A  V         + E
Sbjct  174   YGLTLSDPDSR-----LDGVLATYTRFSAH------SVVGGEGLADRV---------RGE  213

Query  806   VLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR  627
             V EG  AAYWT +APNVE+Y    A+ +A G+  L KG+LWCG++TV+ L+ G+EVLR R
Sbjct  214   V-EG--AAYWTAVAPNVEEYGGPVAKAIAVGADNLAKGVLWCGEMTVERLRWGNEVLRKR  270

Query  626   MTSG-SKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFL  450
             +  G ++ EVSPE +KRI+ VK+VT M+EKVA G+LSGVVKV+G+FT S+ANS  GKKF 
Sbjct  271   IQPGDAEAEVSPEMLKRIKMVKKVTKMSEKVAAGILSGVVKVTGYFTGSLANSQAGKKFF  330

Query  449   GLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAA  270
              LLPGE+VLA+LDGF RICD +E  GK+V+STSSTVT GLVSHKYG++AA AT+EGL+AA
Sbjct  331   NLLPGEIVLASLDGFGRICDTIEEVGKDVLSTSSTVTVGLVSHKYGEKAAAATNEGLDAA  390

Query  269   GHAMATAWTVFKLRKALNP  213
             GHA+ TAW VFK+ +A+NP
Sbjct  391   GHALGTAWAVFKIGQAINP  409



>gb|EAZ38295.1| hypothetical protein OsJ_22673 [Oryza sativa Japonica Group]
Length=419

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 234/362 (65%), Gaps = 48/362 (13%)
 Frame = -1

Query  1295  PGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSH  1116
             PG          S  LA GDLSL+ +R GD+++A  A +   IQWPL +D+ASVKLD  H
Sbjct  78    PGGRSSTSSTHRSYPLAAGDLSLLRIRSGDTSLAAIALL-HPIQWPLARDVASVKLDPCH  136

Query  1115  YFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDL  936
             Y FS   P   DD +                          L+YGLT++          L
Sbjct  137   YSFSLTVPPSADDPNPGP-----------------------LHYGLTLSHPDPR-----L  168

Query  935   DTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNV  756
             D IL   +SFSV       SVV G  +A +V         + EV     AAYWT +APNV
Sbjct  169   DGILATYTSFSVQ------SVVGGEALASKV---------RDEV---EAAAYWTAVAPNV  210

Query  755   EDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG-SKTEVSPETMKR  579
             E+Y    A  +A+G+G L KGILWC ++TVD L+ G+EVL+ RM  G +  EVSPE ++R
Sbjct  211   EEYGGKVANAIATGAGHLAKGILWCSELTVDRLRWGNEVLKRRMQPGDADAEVSPEMLRR  270

Query  578   IRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSR  399
             I+RVK VT M+EKVATG+LSGVVKV+G+FT+S+ANS  GKKF  LLPGE+VLA+LDGF +
Sbjct  271   IKRVKMVTKMSEKVATGILSGVVKVTGYFTNSIANSKAGKKFFNLLPGEIVLASLDGFGK  330

Query  398   ICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKAL  219
             ICDAVEVAG NV+STSSTVTTGLVSHKYG++AA AT+EG++AAGHA+ TAW VFK+R+AL
Sbjct  331   ICDAVEVAGTNVLSTSSTVTTGLVSHKYGEKAAAATNEGMDAAGHAIGTAWAVFKIRQAL  390

Query  218   NP  213
             NP
Sbjct  391   NP  392



>gb|KDO68026.1| hypothetical protein CISIN_1g0104972mg, partial [Citrus sinensis]
 gb|KDO68027.1| hypothetical protein CISIN_1g0104972mg, partial [Citrus sinensis]
 gb|KDO68028.1| hypothetical protein CISIN_1g0104972mg, partial [Citrus sinensis]
 gb|KDO68029.1| hypothetical protein CISIN_1g0104972mg, partial [Citrus sinensis]
Length=360

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 228/343 (66%), Gaps = 47/343 (14%)
 Frame = -1

Query  1556  FQSPKI-----------FSPMASQNRTRSPMYPKVVDPDFENP---FHSSSSSANRSPMY  1419
             F SPK+           +S MAS N +++ +YP+V   D  NP     S+++S++ S +Y
Sbjct  50    FVSPKVSSKVTDHHQRQYSIMASSNPSKA-LYPEV---DLSNPEAASASTAASSSPSSLY  105

Query  1418  PVVDMKDV-ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELAT  1242
             P VDMKD+ ENLFPE+        H + +APP   E  L+ +PGAI+HLI+++ SVELA+
Sbjct  106   PSVDMKDMAENLFPED----DAVSHITANAPPS--EHVLVKIPGAIVHLIEREQSVELAS  159

Query  1241  GDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssd  1062
             G+L +VSL QGD+ VAVFARV DEIQWPL KD  +VKLD+SHYFF+ R P          
Sbjct  160   GELYIVSLSQGDNVVAVFARVGDEIQWPLAKDEPAVKLDDSHYFFTLRVPE---------  210

Query  1061  eekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEET  882
                           +   + ++VLNYGLTIA+KGQ +L+K+LD +L+  S FSV KV+  
Sbjct  211   ----------NGSLETDQVHHEVLNYGLTIATKGQKHLLKELDKVLETYSCFSVQKVKNM  260

Query  881   ASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKL  702
              +  M   VAKE+SP +LKS + +E++     AYWT LAPNVEDYS S AR++A+GSG+L
Sbjct  261   GNWEM---VAKEMSPEELKSAENRELMGKSSGAYWTALAPNVEDYSGSVARMIAAGSGQL  317

Query  701   IKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIR  573
             IKGILWCGDVTVD LK G+  LR RM SGS++E+SP+T+KRI+
Sbjct  318   IKGILWCGDVTVDGLKWGNGFLRKRMGSGSQSEISPDTIKRIK  360



>gb|KHN00463.1| hypothetical protein glysoja_000131 [Glycine soja]
Length=225

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -1

Query  806  VLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR  627
            ++E +CAAYWTTLAPNVEDYS +AA+L+A+GSG+L+KGILWCGDVTV+ L+ G+EV++ R
Sbjct  1    MMEEKCAAYWTTLAPNVEDYSGTAAKLIAAGSGQLVKGILWCGDVTVERLRWGNEVMKRR  60

Query  626  MTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLG  447
            M  GS+ E+SPET+KRI+RVK+VT MTE VA GVL+GVVKVSGFFTSS+ANS  GKK   
Sbjct  61   MAPGSQGEISPETLKRIKRVKKVTKMTESVANGVLTGVVKVSGFFTSSMANSKAGKKIFS  120

Query  446  LLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAG  267
            LLPGE+VLA+LDGFS++CDAVEVAGK+VMSTS+TVTT LV+H+YG+EAAKATSEGL+AAG
Sbjct  121  LLPGEVVLASLDGFSKVCDAVEVAGKSVMSTSNTVTTELVNHRYGEEAAKATSEGLDAAG  180

Query  266  HAMATAWTVFKLRKALNP  213
            HA+ TAW  FK+R+ LNP
Sbjct  181  HAVGTAWAAFKIRQVLNP  198



>emb|CBI17351.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -1

Query  812  KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
            KE+ E R +AYWTTLAPNVEDYS +AARL+A+GSG+L+KGILWCGDVTVD LK G+E L+
Sbjct  13   KELSEERSSAYWTTLAPNVEDYSGTAARLIAAGSGQLVKGILWCGDVTVDRLKWGNEFLK  72

Query  632  NRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
             RM+  S TE+SP+TMK ++RV+RVT +TEKVATGVLSGVVKVSGFFT SVANS VGKKF
Sbjct  73   KRMSPASNTEISPQTMKNMKRVERVTLVTEKVATGVLSGVVKVSGFFTGSVANSRVGKKF  132

Query  452  LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
             G +PGEMVLA+LDGFS++CDAVEVAG+NVMSTSSTVTTGLVSH+YG++A +AT+ GL+A
Sbjct  133  FGFMPGEMVLASLDGFSKVCDAVEVAGRNVMSTSSTVTTGLVSHRYGEQAGQATNTGLDA  192

Query  272  AGHAMATAWTVFKLRKALNP  213
            AGHA+  AW VFK+RKA NP
Sbjct  193  AGHAVGAAWAVFKIRKAFNP  212



>emb|CDY01133.1| BnaA04g06860D [Brassica napus]
Length=299

 Score =   281 bits (719),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 182/259 (70%), Gaps = 24/259 (9%)
 Frame = -1

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             EIQWPLTK   + K+D SHYFFS   P                              +++
Sbjct  29    EIQWPLTKREVATKVDGSHYFFSIHPPKESGSDSD----------------------DEI  66

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKK  813
             LNYGLTIASKGQ+N++  LD +L +   F+  ++ E    V+G  +A   SP +LK E+K
Sbjct  67    LNYGLTIASKGQENVLHGLDQVLRDYCCFAEQRMSEKGEEVLGNSMAAATSPEELKGERK  126

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
              +++EG+CAAYWTTLAPN+EDYSS   +++ASGSG+LI+GILWCGDVTV+ LK G+EV++
Sbjct  127   -DIVEGQCAAYWTTLAPNIEDYSSKTVKMIASGSGQLIRGILWCGDVTVERLKRGNEVMK  185

Query  632   NRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKK  456
             N ++   K  +VSPET++RI+RVKRVT MTEKVATGVLSGVVKVSGF T SVANS  GKK
Sbjct  186   NMLSRAEKEKDVSPETLRRIKRVKRVTQMTEKVATGVLSGVVKVSGFITGSVANSKAGKK  245

Query  455   FLGLLPGEMVLATLDGFSR  399
             F GLLPGE++LA+LDGFS+
Sbjct  246   FSGLLPGEIILASLDGFSK  264



>ref|XP_006409239.1| hypothetical protein EUTSA_v10022685mg [Eutrema salsugineum]
 gb|ESQ50692.1| hypothetical protein EUTSA_v10022685mg [Eutrema salsugineum]
Length=356

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 221/327 (68%), Gaps = 27/327 (8%)
 Frame = -1

Query  1523  SQNRTRSPMYPKVVDPDFENPFHSSSSSANRSPMYPVVDMKDV-ENLFPENYETVQGYYH  1347
             +  +  S +YP V   + E P  + SSS++ S +YP +DM D+  +LFPE  ET      
Sbjct  7     TNEKQSSSLYPTVDMSNPEAPPLNPSSSSSTSNLYPSLDMNDLARDLFPEQPET------  60

Query  1346  HSP---SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVA  1176
              +P   SAPP A EE +L +PGAILHLIDK YSVELA GDL+++ + Q  + VAV ARVA
Sbjct  61    -TPVPVSAPPAAAEEVILTIPGAILHLIDKSYSVELACGDLAIIRIVQDGNVVAVLARVA  119

Query  1175  DEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGND  996
             DEIQWPLTKD  SVK+D SHYFF+ R            ++      + +  EK K+  ND
Sbjct  120   DEIQWPLTKDENSVKVDESHYFFTLR----------PTKDFGTKSSDEEEGEKGKEEEND  169

Query  995   VLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKV----EETASVVMGGPVAKEVSPADL  828
             +LNYGLTIASKGQ++L+++L+ IL + S F+V +V    +ET   V+   VA+E SP +L
Sbjct  170   MLNYGLTIASKGQEHLLEELEQILADYSCFTVQQVSEEAKETGEKVLDVTVARETSPVEL  229

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
               E+K E++E +CAAYWTTLAPNVEDYSS  A+L+A+GSG LIKGILWCGDVT+D LK G
Sbjct  230   TGERK-EIVEKQCAAYWTTLAPNVEDYSSKTAKLIATGSGHLIKGILWCGDVTMDRLKWG  288

Query  647   DEVLRNRMTSGSKT-EVSPETMKRIRR  570
             ++ ++ R++   K  +V P+T+KRI+R
Sbjct  289   NDFMKRRLSKAEKERDVHPDTLKRIQR  315



>ref|XP_002982625.1| hypothetical protein SELMODRAFT_54209, partial [Selaginella moellendorffii]
 gb|EFJ16378.1| hypothetical protein SELMODRAFT_54209, partial [Selaginella moellendorffii]
Length=383

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 153/384 (40%), Positives = 233/384 (61%), Gaps = 22/384 (6%)
 Frame = -1

Query  1322  AVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDL  1143
             A EE L+ +  +++HLIDK+ SV LA+G  SLV L Q  + VAVFARV  ++QWP+ KD 
Sbjct  1     AGEERLVKISHSLVHLIDKEQSVLLASGTFSLVRLTQNGNEVAVFARVGKKLQWPVLKDE  60

Query  1142  ASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASK  963
                KLD  HYFFS R           D+   +     + +   K +  + L+YG+T   K
Sbjct  61    VVTKLDAGHYFFSLRV--------DPDDHTDRDDSHSERENPSKKVSVENLSYGVTFKVK  112

Query  962   GQDNLIKDLDTILDNCSSFS-----------VHKVEETASVVMGGPVAKEV--SPADLKS  822
             G +  +  LD +L   + FS           + +  ET  ++    +  +V   P  L  
Sbjct  113   GNEEKLSKLDELLKKYTFFSNPKMMQGDEGEIREKLETEGMIKPDEIQGQVLVPPPSLAQ  172

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
             +  K   E +   YWT +APNVEDY+SS AR +A+G+G +I+ + WC + T   L+ G E
Sbjct  173   DMNKRPSETKSRLYWTAIAPNVEDYNSSIARGVATGTGHVIRSLFWCSNSTAAQLEKGGE  232

Query  641   VLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
              ++    +  K  ++SP TM+ I+RV+RVT M+E+VA G+L+G+V  +G+FTS+   S V
Sbjct  233   YVKKHTKAAKKPVQLSPTTMRNIKRVRRVTQMSERVARGILTGIVTATGYFTSAAVTSKV  292

Query  464   GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
             GKK   ++PGE+ LA+LD FS++ DAVE+A +N++ST + +TTG+V+HK+G++A + T E
Sbjct  293   GKKVFKMMPGEVALASLDAFSKVFDAVEMATQNILSTGTLITTGVVAHKFGEQAGEFTHE  352

Query  284   GLEAAGHAMATAWTVFKLRKALNP  213
             GL + GH ++TAW V K+RKA+NP
Sbjct  353   GLSSIGHVLSTAWVVSKIRKAINP  376



>ref|XP_002981143.1| hypothetical protein SELMODRAFT_54208, partial [Selaginella moellendorffii]
 gb|EFJ17844.1| hypothetical protein SELMODRAFT_54208, partial [Selaginella moellendorffii]
Length=373

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/374 (40%), Positives = 229/374 (61%), Gaps = 12/374 (3%)
 Frame = -1

Query  1322  AVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDL  1143
             A EE L+ +  +++HLIDK+ SV L +G  SLV L Q    VAVFARV  ++QWP+ KD 
Sbjct  1     AGEEGLVKISHSLVHLIDKEQSVLLGSGTFSLVRLTQNGKEVAVFARVGKKLQWPILKDE  60

Query  1142  ASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASK  963
                KLD  HYFFS R    D         + +   + +          + L+YG+T   K
Sbjct  61    VVTKLDAGHYFFSLRVDPDDHTDRDDSHSERENPSKKESV--------ENLSYGVTFKVK  112

Query  962   GQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKE--VSPADLKSEK-KKEVLEGR  792
             G +  +  LD +L   + FS  K+ +     +   +  E  + P +++ +   K   E +
Sbjct  113   GNEEKLSKLDELLKTYTFFSKPKMMQGDEGEIREKLEAEGMIKPDEIQGQDMNKRPSETK  172

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGS  612
                YWT +APNVEDY+SS AR +A+G+G +I+ + WC + T   L+ G E +R    +  
Sbjct  173   SRLYWTAIAPNVEDYNSSIARGVATGTGHVIRSLFWCSNSTAAQLEKGGEYVRKHTKAAK  232

Query  611   K-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPG  435
             K  ++SP TM+ I+RV+RVT M+E+VA G+L+G+V  +G+FTS+   S VGKK   ++PG
Sbjct  233   KPVQLSPTTMRNIKRVRRVTQMSERVARGILTGIVTATGYFTSAAVTSKVGKKVFKMMPG  292

Query  434   EMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMA  255
             E+ LA+LD FS++ DAVE+A +N++ST + +TTG+V+HK+G++A + T EGL + GH ++
Sbjct  293   EVALASLDAFSKVFDAVEMATQNILSTGTLITTGVVAHKFGEQAGEFTHEGLSSIGHVLS  352

Query  254   TAWTVFKLRKALNP  213
             TAW V K+RKA+NP
Sbjct  353   TAWVVSKIRKAINP  366



>gb|AAC34857.1| senescence-associated protein 12 [Hemerocallis hybrid cultivar]
Length=222

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 165/193 (85%), Gaps = 1/193 (1%)
 Frame = -1

Query  788  AAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK  609
            AAYWTTLAPNVEDYS S AR++A GSG++I+GILWCGDVTV+ LK G+++L+ +M   ++
Sbjct  3    AAYWTTLAPNVEDYSGSVARVIAMGSGRVIQGILWCGDVTVERLKWGEQLLKRKMDPNAQ  62

Query  608  T-EVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGE  432
            +  VS E ++R++RVK+VT M++KV TG+LSGVV+VSG+FTSSV NS  GK F G+LPGE
Sbjct  63   SSRVSKEALQRMKRVKKVTKMSDKVVTGILSGVVRVSGYFTSSVVNSKAGKSFFGMLPGE  122

Query  431  MVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMAT  252
            ++LA+LDGF++ICDA EVAGKN+M TSS VTTG+VSH+YG++AA+ T EG  AAGHA+ T
Sbjct  123  VLLASLDGFAKICDAAEVAGKNIMETSSEVTTGVVSHRYGEQAAELTHEGFGAAGHAIGT  182

Query  251  AWTVFKLRKALNP  213
            AW+VFK+RKALNP
Sbjct  183  AWSVFKIRKALNP  195



>ref|XP_001751756.1| predicted protein [Physcomitrella patens]
 gb|EDQ83191.1| predicted protein [Physcomitrella patens]
Length=365

 Score =   255 bits (651),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 147/379 (39%), Positives = 225/379 (59%), Gaps = 25/379 (7%)
 Frame = -1

Query  1325  EAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKD  1146
             E  EE L+ V GA++HL+D + S  LA G  S+V + Q  + +  F +V D ++WPLTKD
Sbjct  1     ETSEEVLVRVRGAVVHLVDDEESPLLAEGSFSVVLIEQEGNGIVAFVKVGDNLRWPLTKD  60

Query  1145  LASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIAS  966
               +VKLD++HYFF+   P                  +   KE     G + L+YG+T + 
Sbjct  61    ALAVKLDSTHYFFTIHVPR---------------PVDEMDKETADGAGGEALSYGVTFSV  105

Query  965   KGQDNLIKDLDTILDNCSSFS----VHKVEETASVVMG----GPVAKEVSPADLKSEKKK  810
              GQ+  +  LD++L+  S+FS    VH   + ++  +       V  +  P D    ++ 
Sbjct  106   TGQERELLHLDSLLEKYSNFSNPQLVHDDRQKSNFDLSEWGVSYVGADYIP-DQSRLERV  164

Query  809   EVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRN  630
             +V EG  A +W T+APNV DY+S  A+ MA G+G +IKGI W  DVTV  L++G   ++ 
Sbjct  165   QVTEGNQAEFWKTMAPNVNDYNSRLAKGMAKGTGNVIKGIFWVRDVTVARLENGSIYMKG  224

Query  629   RMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
             ++   SK +++SP T++ ++RV+ ++  TE+VA  VL GVVK  GFF+ S+  S  GKKF
Sbjct  225   KVKPCSKPSKISPRTLRNLKRVENMSKATEEVAKNVLDGVVKTVGFFSQSLLKSKPGKKF  284

Query  452   LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
               LLPGE+ LA++D F+++ DA+E AG ++M +++  T  +VSH+YG+ A +     +  
Sbjct  285   FSLLPGEVALASMDAFAKVFDAMEKAGSDMMQSTAVFTQDVVSHRYGEGAGQVAENTMST  344

Query  272   AGHAMATAWTVFKLRKALN  216
             AGH M TAWTV K+RKALN
Sbjct  345   AGHVMGTAWTVSKVRKALN  363



>gb|ACJ85630.1| unknown [Medicago truncatula]
Length=191

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  806  VLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR  627
            ++EG+CAAYWTTLAPNVE+YS +AAR++ASGSG +IKGILWCGDVT+D L+ G++V++ R
Sbjct  1    MMEGQCAAYWTTLAPNVEEYSGTAARMIASGSGHVIKGILWCGDVTMDRLQWGNQVMKKR  60

Query  626  MTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFL  450
            M +G +  ++SPET+KR+RRVKRVT MT+KVA G+LSGVVKVSGFFTSSV NS  GKKF 
Sbjct  61   MAAGERDAQISPETLKRVRRVKRVTKMTQKVANGLLSGVVKVSGFFTSSVVNSKAGKKFF  120

Query  449  GLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGL  279
             LLPGE+VLA+LDGFS++ DAVE+AGKNVMSTSSTVTT LV H+YG+EAA AT+EGL
Sbjct  121  SLLPGEIVLASLDGFSKVFDAVEIAGKNVMSTSSTVTTELVDHRYGEEAAHATNEGL  177



>ref|XP_001779219.1| predicted protein [Physcomitrella patens]
 gb|EDQ55982.1| predicted protein [Physcomitrella patens]
Length=408

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 148/387 (38%), Positives = 226/387 (58%), Gaps = 34/387 (9%)
 Frame = -1

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLT  1152
             P +  EE L+ VP AI+HL+D Q S  LAT   S+V + Q  + + V  RV +++ WPL 
Sbjct  14    PLDPREECLVTVPDAIVHLVDDQQSPHLATAHFSVVRITQKGNGIVVLVRVGEDLHWPLM  73

Query  1151  KDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI  972
             KD+ +VKLD +HYFF+   P+                   + + K +  G + LNYG+T 
Sbjct  74    KDMPTVKLDPTHYFFTLPVPS--------------SIDAPEDESKSEKNGFETLNYGVTF  119

Query  971   AS-KGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPAD----LKSEKKKE  807
                   +  + +LD++L   +SFS      + ++V G    +E +  +    L  ++K E
Sbjct  120   PDPSNHEQALHELDSLLATYTSFS------SPTLVQGDQRKEEFAQTNKHLSLNKKEKTE  173

Query  806   --------VLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
                     V E   +A+WTT+APNV+DY SSAAR +A+GSG +I+GI W  D TV  L+S
Sbjct  174   TDVATRVTVTEENQSAFWTTMAPNVDDYGSSAARAIATGSGHVIRGIFWVRDSTVAQLES  233

Query  650   GDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
             G   L+++M    K + +SP T++ ++RV+ ++  TE VA  VL G+VK +GFF+ S+  
Sbjct  234   GTLYLQSKMNPLDKPSNISPRTLRNLKRVRDMSRATENVARSVLLGIVKTAGFFSGSLIK  293

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GKK   L+PGE+ L +LD F ++ DAVE A  +V+ ++S +T  +++H+YG+ A + 
Sbjct  294   SRAGKKVFKLMPGEVALVSLDAFGKLFDAVEKATSDVLESTSLMTQNVIAHRYGESAGQV  353

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T +    AGH +ATAWTV KLR ALNP
Sbjct  354   TQDTFATAGHVVATAWTVAKLRNALNP  380



>ref|XP_001751445.1| predicted protein [Physcomitrella patens]
 gb|EDQ83762.1| predicted protein [Physcomitrella patens]
Length=366

 Score =   253 bits (645),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 145/387 (37%), Positives = 219/387 (57%), Gaps = 37/387 (10%)
 Frame = -1

Query  1325  EAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKD  1146
             EA EE L+ + GA++HL+D Q S  L  GD S+V + Q  + +  F RV D+++WPLTKD
Sbjct  1     EASEEVLVRIRGAVVHLVDDQKSPLLGDGDFSIVLIEQAGNGLVTFVRVGDKLRWPLTKD  60

Query  1145  LASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIAS  966
               +VKLD+SHY+F+ RFP                K +    E  +    +VL+YG+T   
Sbjct  61    EPAVKLDSSHYYFTIRFPR---------------KVDEMDTETARSASPEVLSYGVTFPL  105

Query  965   KGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPA---------DLKSEKK  813
              GQ+  +++LD IL+  S F   K+      V G     E   A         D  +  +
Sbjct  106   DGQEEQLRELDDILETYSRFLSPKL------VQGNKERDEFDGAFGYGHSQIPDALNTSR  159

Query  812   KEVLEGR------CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
              EVL  +       + YW  +APNV+DY+S  A+  A G+G LIKGI W  D TV  L++
Sbjct  160   SEVLYNKQEKQDSSSDYWRIMAPNVDDYNSDLAKAFAMGTGSLIKGIFWLRDSTVAGLEN  219

Query  650   GDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
             G   +R  + S S  + ++P+ +  ++RVK ++  TE VA  +L G V+ + FF+S++  
Sbjct  220   GSSYMREHVRSTSNPSTINPQILVNLKRVKNMSMATETVANSILEGFVRAASFFSSALIR  279

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S +GKKF  LLPGE+ L ++D F+++ DA+E AG +V + +   T  +V+H+YG++A + 
Sbjct  280   SDIGKKFFQLLPGEVALVSMDAFAKLFDALEAAGYDVAAQTKMFTQDVVAHRYGEQAGEV  339

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T + L  AGH  ATAWTV K+R A NP
Sbjct  340   TGDTLSTAGHLFATAWTVTKVRSAWNP  366



>ref|XP_001757059.1| predicted protein [Physcomitrella patens]
 gb|EDQ78290.1| predicted protein [Physcomitrella patens]
Length=371

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 149/383 (39%), Positives = 221/383 (58%), Gaps = 45/383 (12%)
 Frame = -1

Query  1316  EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLAS  1137
             EE L   P AI++L+D+Q S  LAT   S+V + Q  ++  V  RV +++ WPL KD+ +
Sbjct  12    EECLFSTPVAIVYLVDEQQSPHLATDYFSIVRITQKGNDSVVIVRVGEDLHWPLMKDVPT  71

Query  1136  VKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIAS-KG  960
             VKLD +HYFF+  FP+  D++                           LNYG+T    K 
Sbjct  72    VKLDPTHYFFTLSFPSSLDEAIGI-----------------------TLNYGVTFPDRKD  108

Query  959   QDNLIKDLDTILDNCSSFS----VHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGR  792
              +   K LD +L   SSFS    VH  ++    +      +++S      EK KE++   
Sbjct  109   HEKEFKQLDELLILYSSFSSPTLVHGDQQKEKFIQN---TQQLSV----QEKDKEIVAPS  161

Query  791   C---------AAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEV  639
                       AA+WTT+APNV+DY SSAAR +A+G+G++I+GI W  D TV  L+SG   
Sbjct  162   ANQVEKYENQAAFWTTMAPNVDDYGSSAARAIATGTGQIIRGIFWVRDSTVKQLESGTIY  221

Query  638   LRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVG  462
             ++ ++ +  K + +SP+ +K ++RV++++  TE VA GVL G+VK +GF T S   S  G
Sbjct  222   MKTKLNTNDKPSTISPKALKNMKRVRKLSRATENVAKGVLGGIVKAAGFLTGSAIQSKAG  281

Query  461   KKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEG  282
              K   L+PGE+ LA+LD F ++ DAVE A K+V+ +SS +T  +V+HKYG+ A +   + 
Sbjct  282   SKIFKLMPGEVALASLDAFGKLFDAVEKATKDVLHSSSEMTQTVVAHKYGEPAGQVAQDT  341

Query  281   LEAAGHAMATAWTVFKLRKALNP  213
             L  AGH + TAWT+ KLRKALNP
Sbjct  342   LATAGHVIGTAWTISKLRKALNP  364



>gb|AFW89036.1| hypothetical protein ZEAMMB73_959410 [Zea mays]
Length=341

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 142/360 (39%), Positives = 205/360 (57%), Gaps = 61/360 (17%)
 Frame = -1

Query  1529  MASQNRTRSPMYPKV--VDPDFENPFHSS--------SSSANRSPMYPVVDMKDV-ENLF  1383
              AS N  +S +YP V    PD   PF S+        + +A  + +YP VD  ++ +NLF
Sbjct  3     FASSNAKQS-LYPDVDQSHPDLNTPFFSAPTTSTCAGAGAATGNSLYPTVDPNELAQNLF  61

Query  1382  PENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDS  1203
             PE  E          + PP   EET++ VPGA LHLID   SV+L  G LS+V LRQGD 
Sbjct  62    PETVE-------EDAAPPPPTTEETIIAVPGAQLHLIDPDRSVDLGAGTLSIVRLRQGDH  114

Query  1202  NVAVFARVADE-------------------------IQWPLTKDLASVKLDNSHYFFSFR  1098
             +VAV AR+  E                         +QWPL +D+A+VKLD +HYFFS  
Sbjct  115   SVAVLARLIHEKPHHRRGLFRLFSSGRSDAGAEQEPVQWPLARDVAAVKLDPAHYFFSLH  174

Query  1097  FPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDN  918
              P+ D   D  D + ++   E              L+YGLT+  KGQ+ ++ +LD +L+ 
Sbjct  175   VPHTDHPDDKDDADGAEADAEA------------ALSYGLTVVGKGQEEVLAELDRVLEE  222

Query  917   CSSFSVHKVEETA---SVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDY  747
              ++FSV +VE  A   S VM      E++P +   +KK EV+E + AA+WTT+APNV+DY
Sbjct  223   YTTFSVKQVETAAKEKSEVMDARAVAEITPEEAVGDKK-EVVEEKSAAFWTTIAPNVDDY  281

Query  746   SSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPETMKRIRR  570
             SSS ARL+A GSG+L++GI+WCGD+T   L+ G+EV++  +   +K T+V P T++R++R
Sbjct  282   SSSVARLIARGSGQLVRGIIWCGDITAGGLRRGEEVMKKSVGPSTKPTQVKPSTLRRMKR  341



>gb|AFK37068.1| unknown [Lotus japonicus]
Length=190

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = -1

Query  704  LIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK-TEVSPETMKRIRRVKRVTSMTEKVATG  528
            +++GILWCGDVTVD LK G++ L+ R+  G K +++SP+ M+R++RVK +T M+EKVA G
Sbjct  1    MVRGILWCGDVTVDRLKWGNDFLKKRLQPGEKNSQISPQAMERMKRVKNLTKMSEKVALG  60

Query  527  VLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstss  348
            +LSGVVKVSGFFTSSV NS  GKKF  LLPGE+VLA++DGF+++CDAVEVAG+NVMSTSS
Sbjct  61   ILSGVVKVSGFFTSSVVNSKPGKKFFSLLPGEIVLASMDGFNKVCDAVEVAGRNVMSTSS  120

Query  347  tvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             VTTGLVSHKYG+EAA+ T+EGL+AAGHA+ TAWTVFKLRKALNP
Sbjct  121  VVTTGLVSHKYGEEAAQVTNEGLDAAGHAIGTAWTVFKLRKALNP  165



>gb|ABF94901.1| Senescence-associated protein, expressed [Oryza sativa Japonica 
Group]
Length=276

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 166/213 (78%), Gaps = 2/213 (1%)
 Frame = -1

Query  848  EVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVT  669
            E++P +   +KK EV+E + AA+WTT+APNV+DYSSS ARL+A GSG+L++GI+WCGD+T
Sbjct  37   EITPEEAVGDKK-EVVEEQSAAFWTTIAPNVDDYSSSVARLIARGSGQLVRGIIWCGDIT  95

Query  668  VDSLKSGDEVLRNRM-TSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFF  492
             + L+ G+ V++  +  SG  ++V P T++R++R +RVT M+ +VA  +LSGV+KVSGF 
Sbjct  96   AEGLRCGEAVVKKSVGPSGKPSQVKPSTIRRMKRARRVTKMSNRVANSILSGVLKVSGFV  155

Query  491  TSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYG  312
            TS+V NS   +KF  L+ GE++LA+LDGF ++ DAVEV+GKNVM TSS VTT +V+H+YG
Sbjct  156  TSTVLNSKPAQKFFKLMLGEVILASLDGFGKVWDAVEVSGKNVMRTSSVVTTSVVTHRYG  215

Query  311  DEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
            D+A + T + L A+G+A+  AW VFK+RKAL+P
Sbjct  216  DQAGQVTQDYLHASGNALGVAWAVFKIRKALDP  248



>gb|ABR16046.1| unknown [Picea sitchensis]
Length=432

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 145/442 (33%), Positives = 241/442 (55%), Gaps = 69/442 (16%)
 Frame = -1

Query  1466  NPFH-SSSSSANRSPMYPV--VDMKDVENLFPENYETVQGYYHHSPSAPPEAVEETLLIV  1296
             NPF  S   S N+S   P   VD KD +N   ++ E              ++ EET++ +
Sbjct  7     NPFSFSKRKSRNKSTEDPPPPVDEKDEQNSEDDDQE-----------CGGDSTEETVVSI  55

Query  1295  PG-AILHLIDK----QYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVK  1131
             PG +++HL++       SV+L  G+ S+V L QG++ +A+F +V ++++WPLTKD  ++K
Sbjct  56    PGGSVVHLVEAGEEVSDSVQLGRGEFSIVRLVQGNTGIALFVKVGEDMRWPLTKDEPTLK  115

Query  1130  LDNSHYFFSFR-FPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQD  954
             LD+ HY FS R  P+ +   +  +                     ++LNYG+T A    +
Sbjct  116   LDSCHYLFSIRPLPDEETSDNDKESP-------------------EILNYGVTFA---DE  153

Query  953   NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWT  774
               +  LD+ L   +  S+             P +   +    +S K     +    AYWT
Sbjct  154   EGLDSLDSFLQQHACLSLP------------PESTGYASKSTRSAKNDSSEKENPEAYWT  201

Query  773   TLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRM----------  624
              LAP VEDY+S  A+ +A GSG++IKG+  C +  V  ++ G E +R R+          
Sbjct  202   DLAPRVEDYNSVVAKAIAKGSGQIIKGLFLCTNAYVSQVQKGGEFVRGRLRKAKSKTAAA  261

Query  623   -----TSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGK  459
                   + +  ++SP T + IRRVK+++ MTEK++  VL+G+V V+G  T+ V  S  G+
Sbjct  262   ADHQKKTSTYAKISPRTKRNIRRVKKLSKMTEKLSENVLAGIVTVTGAATAPVLGSKAGQ  321

Query  458   KFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGL  279
             KF  +LPG+++LA+LD F+++ +A EVAGK+ +S +S VT  +++H++G++A + T +  
Sbjct  322   KFFRMLPGDVLLASLDAFNKVLEAAEVAGKDAISATSEVTVEIIAHRFGEDAGEMTHDTF  381

Query  278   EAAGHAMATAWTVFKLRKALNP  213
               AGH + TAW V K+RK++NP
Sbjct  382   AVAGHTIGTAWNVIKIRKSINP  403



>gb|ABK24524.1| unknown [Picea sitchensis]
Length=443

 Score =   229 bits (584),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 137/390 (35%), Positives = 221/390 (57%), Gaps = 54/390 (14%)
 Frame = -1

Query  1322  AVEETLLIVPG-AILHLIDKQYSV----ELATGDLSLVSLRQGDSNVAVFARVADEIQWP  1158
             ++EETL+ +PG A+++L+D    V    +L +G+ S+V + QG++ + +F  V ++++WP
Sbjct  60    SIEETLVRIPGGAVVNLVDAGEEVSDSAQLGSGEFSIVRIVQGNTGIVLFVNVGEDVRWP  119

Query  1157  LTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGL  978
             LTKD  ++KLD+ HY FS R P                      +E      +D+LNYG+
Sbjct  120   LTKDEPTLKLDSRHYLFSIRLP--------------------PDEEAADKDSSDILNYGV  159

Query  977   TIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLE  798
             T A    +  +  LD+ L   +  S+   E T      G  +K        S  +    E
Sbjct  160   TFA---DEEGLDSLDSFLQQHACLSL-PAEST------GGASKSTRATKWGSCDR----E  205

Query  797   GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMT-  621
                AAYWT LAP VE+Y+S  A+ +A+GSG++IKG+  C +     L+ G E +R R+T 
Sbjct  206   NPEAAYWTALAPRVENYNSVVAKAIAAGSGQIIKGLFLCTNAYDSQLQKGGESVRGRVTK  265

Query  620   --------------SGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSS  483
                           + S  ++SP T + IRR K+++ MTEK++  +L+GVV VSG  T+ 
Sbjct  266   AESKTGAAADHQKKTSSHAKISPSTKRNIRRAKKLSRMTEKLSENLLAGVVTVSGGVTAP  325

Query  482   VANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEA  303
             V  S  G+KF  +LPG+++LA+LD F+++ DA E+ G++ +S +S  T  +V++++G+EA
Sbjct  326   VVGSKAGQKFFRMLPGDVLLASLDAFNKVLDAAEIVGRDALSAASEATVEIVANRFGEEA  385

Query  302   AKATSEGLEAAGHAMATAWTVFKLRKALNP  213
              + T +    AGHA+ TAW V K+RKA+NP
Sbjct  386   GEVTHDTFAVAGHAIGTAWNVTKVRKAINP  415



>ref|XP_002992672.1| hypothetical protein SELMODRAFT_135775 [Selaginella moellendorffii]
 gb|EFJ06257.1| hypothetical protein SELMODRAFT_135775 [Selaginella moellendorffii]
Length=401

 Score =   222 bits (566),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 150/377 (40%), Positives = 225/377 (60%), Gaps = 23/377 (6%)
 Frame = -1

Query  1313  ETLLIVPGAILHLIDKQY----SVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKD  1146
             E L+ +P A ++L+D       SV LA+GDLS++ + Q  S VA   ++ DE+QWPL KD
Sbjct  11    EVLVTLPNAKVYLMDHDQAGSESVLLASGDLSVIRIVQNGSVVAAIVKLGDELQWPLAKD  70

Query  1145  LASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIAS  966
                +KL  SHY FS R P   ++ +  D+  S+GK+E   K        +VLNYG+T+  
Sbjct  71    APVLKLSESHYIFSLRLPVTVEEDEDEDQPSSEGKEEVSFKSSA-----EVLNYGVTLPG  125

Query  965   KGQDNLIKDLDTILDNCSSF----SVHKVEETASVVMGGPVAKE-VSPADLKSEKKKEVL  801
                  L+K+LD  L++ SS     ++ K ++   V M      + ++   L ++KK   L
Sbjct  126   DASQELLKELDLALESYSSLVPVPALLKDQDEEVVEMVQDDGNQGIAGVKLTTKKKNYYL  185

Query  800   EGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL-KSGDEVLRNRM  624
             E         LAPN +DY S+ A+ +ASGSG +++GILW  ++    + +SG  + ++  
Sbjct  186   E--------QLAPNADDYQSAIAKAIASGSGHIVRGILWVSELIATQIERSGLLMQQHIK  237

Query  623   TSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGL  444
                  +++SP+TMK IR  K+++ MTE +A+G+LSGVV  +   TSSV  +  G   +GL
Sbjct  238   PKKKPSKISPKTMKNIRTAKQISRMTETLASGLLSGVVTATESITSSVLKTKPGAALIGL  297

Query  443   LPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGH  264
             L GE  +ATLD F ++ DA+E+AGKNVMS ++ VT  +VSH+YGDEAA  T EGL  AGH
Sbjct  298   LRGEAAIATLDAFVKVFDALELAGKNVMSRTTLVTCQVVSHRYGDEAAALTKEGLSTAGH  357

Query  263   AMATAWTVFKLRKALNP  213
              + TAW + K+R A+NP
Sbjct  358   VVTTAWKISKIRTAMNP  374



>ref|XP_003540653.2| PREDICTED: uncharacterized protein LOC100812553, partial [Glycine 
max]
Length=187

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  704  LIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGV  525
            L++GILW GDVTV+ LK G++ L+ R+ SGS ++VSP+ ++ ++RVK++T M+EKVATGV
Sbjct  1    LVRGILWVGDVTVERLKWGNDFLKKRLESGSHSQVSPQALESMKRVKKLTMMSEKVATGV  60

Query  524  LSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsst  345
            LSGVVKVSGFFTSSV NS  GKKF  LLPGE+VLAT+DGF+++ DA EVAG+NVMSTSS 
Sbjct  61   LSGVVKVSGFFTSSVVNSKAGKKFFSLLPGEIVLATMDGFNKVLDAAEVAGRNVMSTSSV  120

Query  344  vttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
            VTTGLVS KYG+EAA+ T+EGL+AAGHA+ TAW VFKLRKALNP
Sbjct  121  VTTGLVSDKYGEEAAQVTNEGLDAAGHAIGTAWAVFKLRKALNP  164



>ref|XP_002979961.1| hypothetical protein SELMODRAFT_111719 [Selaginella moellendorffii]
 gb|EFJ18831.1| hypothetical protein SELMODRAFT_111719 [Selaginella moellendorffii]
Length=404

 Score =   220 bits (561),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 149/377 (40%), Positives = 224/377 (59%), Gaps = 23/377 (6%)
 Frame = -1

Query  1313  ETLLIVPGAILHLIDKQY----SVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKD  1146
             E L+ +P A ++L+D       SV LA+GDLS++ + Q    VA   ++ DE+QWPL KD
Sbjct  14    EVLVTLPNAKVYLMDHDQAGSESVLLASGDLSVIRIVQNGKVVAAIVKLGDELQWPLAKD  73

Query  1145  LASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIAS  966
                +KL  SHY FS R P   ++ +  D+  S+GK+E   K        +VLNYG+T+  
Sbjct  74    APVLKLSESHYIFSLRLPVTVEEDEDEDQPSSEGKEEVSFKSSA-----EVLNYGVTLPG  128

Query  965   KGQDNLIKDLDTILDNCSSF----SVHKVEETASVVMGGPVAKE-VSPADLKSEKKKEVL  801
                  L+K+LD  L++ SS     ++ K ++   V M      + ++   L ++KK   L
Sbjct  129   DASQELLKELDLALESYSSLVPVPALLKDQDEELVEMVQDDGNQGIAGVKLTTKKKNYYL  188

Query  800   EGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSL-KSGDEVLRNRM  624
             E         LAPN +DY S+ A+ +ASGSG +++GILW  ++    + +SG  + ++  
Sbjct  189   E--------QLAPNADDYQSAIAKAIASGSGHIVRGILWVSELIATQIERSGLLMQQHIK  240

Query  623   TSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGL  444
                  +++SP+TMK IR  K+++ MTE +A+G+LSGVV  +   TSSV  +  G   +GL
Sbjct  241   PKKKPSKISPKTMKNIRTAKQISRMTETLASGLLSGVVTATESITSSVLKTKPGAALIGL  300

Query  443   LPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGH  264
             L GE  +ATLD F ++ DA+E+AGKNVMS ++ VT  +VSH+YGDEAA  T EGL  AGH
Sbjct  301   LRGEAAIATLDAFVKVFDALELAGKNVMSRTTLVTCQVVSHRYGDEAAALTKEGLSTAGH  360

Query  263   AMATAWTVFKLRKALNP  213
              + TAW + K+R A+NP
Sbjct  361   VVTTAWKISKIRTAMNP  377



>ref|XP_001754208.1| predicted protein [Physcomitrella patens]
 gb|EDQ81109.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 143/446 (32%), Positives = 227/446 (51%), Gaps = 49/446 (11%)
 Frame = -1

Query  1499  MYPKVVDPDFE---NPFHSSSSSANRSPMYPVVDMKDVENLFPENYETVQGYYHHSPSAP  1329
             +YPK+     +   NP    +  + RS  YP +  +  +   P     +      S +A 
Sbjct  17    LYPKIPSEGPQPSRNPTVDVAGDSARSHPYPQIHSQVQQ---PTGNPYILPMSDCSANAQ  73

Query  1328  PEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTK  1149
                 EE L+ + GAI+HL+D Q SV L  G+ ++  ++Q D  +    RV D +QWPL  
Sbjct  74    NSGFEELLVTISGAIVHLVDDQESVFLDHGNFTVSRIKQHDQGIVAVVRVGDGLQWPLMS  133

Query  1148  DLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIA  969
             D   VKLD  HY FS    +                     K+  +  G + ++YG+T +
Sbjct  134   DEQVVKLDFIHYVFSLPVID---------------------KDTAEAQGGENMHYGVTFS  172

Query  968   SKGQDNLIKDLDTILDNCSSFS----VH--KVEETASVVMGGPVAKE-------VSPADL  828
               GQ+  ++ LD +L+  S F     VH  ++++ A   +    A +       V P  +
Sbjct  173   IPGQEAALRTLDEVLECYSLFYLPTLVHGDQIKQAADAGLAPNAASQLDTMGAAVVPESI  232

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
               E +K         +WT +APNV+DY +  A+ +ASGSG LI+GI W  D TV+ L+SG
Sbjct  233   TEENQK--------VFWTEMAPNVDDYRNRVAKSVASGSGHLIRGIFWVRDSTVERLQSG  284

Query  647   D-EVLRNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
                 ++N   +   T + P T++ ++RVK +T  T+  A  VLSG++ V+G   +++  S
Sbjct  285   AINKIKNSKPADKPTNIRPSTLRNLQRVKSLTKATDNFAKSVLSGIISVAGTVPNAIVKS  344

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKAT  291
              VG+ F    PGE+ LA++  F ++CDAVE A K V+ + +   + +V+H+ G  A KAT
Sbjct  345   RVGRAFFRTGPGEVALASMISFWKVCDAVEQATKEVLKSGTNAASKVVTHRRGHSAGKAT  404

Query  290   SEGLEAAGHAMATAWTVFKLRKALNP  213
              E L +AGH +  AW+  K+ KALNP
Sbjct  405   EEVLGSAGHLVGAAWSAVKIPKALNP  430



>ref|XP_001785373.1| predicted protein [Physcomitrella patens]
 gb|EDQ49813.1| predicted protein [Physcomitrella patens]
Length=430

 Score =   216 bits (551),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 145/429 (34%), Positives = 231/429 (54%), Gaps = 50/429 (12%)
 Frame = -1

Query  1469  ENPFHSSSSSANRSPMYPVVDMKDVENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPG  1290
             ++PF S++SS+    +YP +  +      P            S ++P  A EE L+ +PG
Sbjct  21    QSPFPSNASSS----LYPKIQSEG----RPPAAAAAADMASGSANSPVGAFEELLVTIPG  72

Query  1289  AILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYF  1110
             A++HL+D Q SV LA+GD S+V + Q +  + V  R  D +QWPL  D   VKLD+ HY 
Sbjct  73    ALVHLVDDQESVLLASGDFSIVRINQQNQRIVVLVRAGDSLQWPLVSDEQVVKLDSIHYV  132

Query  1109  FSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDT  930
             FS                           E      ++ ++YG+T A++GQ+  ++ LD 
Sbjct  133   FSLPM-------------------APTLDEAVDGTASEKVHYGVTFAAQGQEEDLRLLDD  173

Query  929   ILDNCSSFSVHKVEETASVVMGGPVAKEV-----SPADLKSEKKKEVLEGRCAAYWTTLA  765
             +L++ S FS      + S+V G    + V     S  DL +E+ + +       +WT +A
Sbjct  174   LLESYSFFS------SPSLVHGDNQKETVERHLASKDDLITEENQRI-------FWTAMA  220

Query  764   PNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD-EVLRNRMTSGSKTEVSPET  588
             PNV+DY +S A+ +ASG+G++I+GI W  D TV +L+SG   V RN   +   +++ P T
Sbjct  221   PNVDDYGNSLAKAIASGTGQIIRGIFWVRDSTVKTLESGSINVTRNSKPTDHPSDIRPST  280

Query  587   MKRIR----RVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLA  420
             ++ ++    RV  ++  T+  A  VLSGV+   G   +++  SSVG+  L   PGE+ LA
Sbjct  281   LRNLQSLTCRVNYLSKATDDFAKSVLSGVISTVGIIPNAIIRSSVGRAILKTAPGEVALA  340

Query  419   TLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTV  240
             ++  F ++ DAVE A ++V+ T +     +V+HKYG+ A  AT + L  AGH + TAW+V
Sbjct  341   SMISFWKLFDAVEQASRDVLKTGTAAAATVVTHKYGEPAGTATGQTLGTAGHMVGTAWSV  400

Query  239   FKLRKALNP  213
              K+ KA NP
Sbjct  401   AKIPKAFNP  409



>gb|EMT30950.1| hypothetical protein F775_06825 [Aegilops tauschii]
Length=185

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = -1

Query  674  VTVDSLKSGDEVLRNRMTSG-SKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSG  498
            +TVD L+ G EVLR R+  G ++ EVSPE ++RI+R K+VT M+EKVATG+LSGVVKV+ 
Sbjct  1    MTVDRLRWGQEVLRKRIQPGDTEAEVSPEMLRRIKRAKKVTKMSEKVATGILSGVVKVTS  60

Query  497  FFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHK  318
            + TSS+ NS  GKKF  LLPGE+VLA+LDGF +I DAVEVAGK+V+STSSTVTTGLVSHK
Sbjct  61   YVTSSLVNSKAGKKFFSLLPGEVVLASLDGFGKISDAVEVAGKDVLSTSSTVTTGLVSHK  120

Query  317  YGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
            YG++AA AT+EGL+AAGHA+ TAW VFKLR+ALNP
Sbjct  121  YGEKAAAATNEGLDAAGHAIGTAWAVFKLRQALNP  155



>ref|XP_008795898.1| PREDICTED: uncharacterized protein LOC103711506 [Phoenix dactylifera]
Length=361

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 125/384 (33%), Positives = 196/384 (51%), Gaps = 71/384 (18%)
 Frame = -1

Query  1316  EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLAS  1137
             EE LL +PGA +HL++ +   ELA GD +++ + + D+ +A   R+  +++WPLTKD   
Sbjct  19    EEVLLHIPGASVHLLENREVFELARGDFAILRIIEQDAVLATIIRIGPDLRWPLTKDEPV  78

Query  1136  VKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQ  957
             +KLD  HY F+   P+                                LNYG++ A+   
Sbjct  79    IKLDQVHYLFTL--PD---------------------------KDGGFLNYGVSFAA--A  107

Query  956   DNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYW  777
             D+L+  LD  L   + FS       AS +M  P + EV                    YW
Sbjct  108   DSLLASLDMFLKGNTCFST---PTDASSMMKRPPSYEV--------------------YW  144

Query  776   TTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVS  597
                AP VEDY+   A+ +A G+G+++KGI  C +     ++ G ++++ +   G KT VS
Sbjct  145   KDYAPRVEDYNGVLAKAIAGGTGEIVKGIFKCSNAYAGQIQKGADLIQPKAVGG-KTGVS  203

Query  596   P----------------ETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
                              E  K +RRV++++ MTEK++  +L GV  ++G   + +  S  
Sbjct  204   DGKDRTDKSIEVKKNRGEINKSLRRVRKLSEMTEKMSRSLLDGVFLITGSVAAPLVQSKA  263

Query  464   GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
             GK F  +LPGE++LA+LD  +++ DAVEVA +  ++ +S V  G VS K+G+ A  AT +
Sbjct  264   GKSFFSMLPGEVLLASLDAVNKVLDAVEVAERKTIAATSNVVAGAVSKKFGESAGVATED  323

Query  284   GLEAAGHAMATAWTVFKLRKALNP  213
                 AGHA+ TAW +FK+RKAL P
Sbjct  324   AFATAGHAVGTAWNIFKIRKALKP  347



>ref|XP_010924669.1| PREDICTED: uncharacterized protein LOC105047444 [Elaeis guineensis]
Length=361

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 196/392 (50%), Gaps = 69/392 (18%)
 Frame = -1

Query  1343  SPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQ  1164
             SP       EE LL +PGA +HL++ +   ELA GD +++ + + D+ +A   R+  +++
Sbjct  10    SPMRQNSCKEEVLLHIPGASVHLLEDREVFELARGDFTILRIIEQDAVLATIIRIGSDLR  69

Query  1163  WPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNY  984
             WPLTKD   +KLD  HY F+   P+                                LNY
Sbjct  70    WPLTKDEPVIKLDQVHYLFTL--PD---------------------------KDGGFLNY  100

Query  983   GLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEV  804
             G++ A+   D  +  LD  L   + FS       AS  M  P + +V             
Sbjct  101   GVSFAA--PDGRLASLDMFLKENTCFST---PADASSTMKPPPSYDV-------------  142

Query  803   LEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRM  624
                    YW   AP VEDY+   A+ +A G+G+++KGI  C +     ++ G ++++ + 
Sbjct  143   -------YWKDCAPRVEDYNGVLAKAIAGGTGEIVKGIFKCSNAYNSQIQKGADLMQPKA  195

Query  623   TSGS--------KTEVSPETMKR-------IRRVKRVTSMTEKVATGVLSGVVKVSGFFT  489
               G         +T+ S E  K        +RRV++++ MTEK++  +L GVV V+G   
Sbjct  196   VGGQNSVSDGRDRTDRSSEAKKNRGEINRSLRRVRKLSEMTEKMSRSLLDGVVLVTGSVG  255

Query  488   SSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGD  309
             + +  S  GK F  +LPGE++LA+LD  +++ DAVE+A +  ++ +S V  G V  ++G+
Sbjct  256   APLVRSKAGKCFFSMLPGEVLLASLDAVNKVLDAVEIAERRTIAATSHVVAGAVYKRFGE  315

Query  308   EAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
              A +AT +    AGHA+ TAW +FK+RKAL P
Sbjct  316   GAGEATEDAFATAGHAIGTAWNIFKMRKALKP  347



>gb|KHN16973.1| hypothetical protein glysoja_035824 [Glycine soja]
Length=399

 Score =   190 bits (483),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 124/407 (30%), Positives = 199/407 (49%), Gaps = 76/407 (19%)
 Frame = -1

Query  1382  PENYETVQGYYHHSPSA----PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLR  1215
             P   E    ++HH+  A    P    EE +L +PG  +HL+D+  ++ELA G  +++ + 
Sbjct  31    PPPLENTMHHHHHADVAEFQKPKTLKEEVVLQIPGCKVHLMDQGEALELAQGHFTIMKIM  90

Query  1214  QGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkke  1035
             + +  +A   +V + +QWPLTKD   VK+D  HY FS    +                  
Sbjct  91    EQNVALATIIKVGNSVQWPLTKDEPVVKVDALHYLFSLPVKD------------------  132

Query  1034  gkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPV  855
                       G + L+YG+T   +   N+ + LD+ L + S FS                
Sbjct  133   ----------GGEPLSYGVTFPEQCYGNM-EMLDSFLKDHSCFS----------------  165

Query  854   AKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGD  675
                     L+  KK ++        W   AP VEDY+   AR +A G+G+++KGI  C +
Sbjct  166   -------GLERNKKSDL-------KWEEFAPRVEDYNHFLARAIAGGTGQIVKGIFLCSN  211

Query  674   VTVDSLKSGDEVLRNRMTSGSKTEVSPETMKR-------------IRRVKRVTSMTEKVA  534
                + ++ G E + N     +   +  E+M               ++RV+++T+MTEK+ 
Sbjct  212   AYTNQVQKGGETILNTAAEKNNGGMVTESMNHRSDATKNNATNDNLKRVRKLTNMTEKLT  271

Query  533   TGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmst  354
               +L GV  +SG   + V  S  G+ FL +LPGE++LA+LD  +R+ +A E A K   S 
Sbjct  272   KSLLDGVGIMSGSVMTPVLKSQPGQAFLNMLPGEVLLASLDAVNRVFEAAEAAEKQTFSA  331

Query  353   sstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             +S   T +VS+++G+EA +AT      AGHA+ TAW V K+RKA+NP
Sbjct  332   TSQAATRMVSNRFGEEAGEATEHVFATAGHAVNTAWNVSKIRKAINP  378



>ref|XP_003547745.1| PREDICTED: uncharacterized protein LOC100784641 [Glycine max]
Length=399

 Score =   189 bits (480),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 123/407 (30%), Positives = 199/407 (49%), Gaps = 76/407 (19%)
 Frame = -1

Query  1382  PENYETVQGYYHHSPSA----PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLR  1215
             P   E    ++HH+  A    P    EE +L +PG  +HL+D+  ++ELA G  +++ + 
Sbjct  31    PPPLENTMHHHHHADVAEFQKPKTLKEEVVLQIPGCKVHLMDQGEALELAQGHFTIMKIM  90

Query  1214  QGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkke  1035
             + +  +A   +V + +QWPLTKD   VK+D  HY FS    +                  
Sbjct  91    EQNVALATIIKVGNSVQWPLTKDEPVVKVDALHYLFSLPVKD------------------  132

Query  1034  gkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPV  855
                       G + L+YG+T   +   N+ + LD+ L + S FS                
Sbjct  133   ----------GGEPLSYGVTFPEQCYGNM-EMLDSFLKDHSCFS----------------  165

Query  854   AKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGD  675
                     L+  KK ++        W   AP VEDY+   AR +A G+G+++KGI  C +
Sbjct  166   -------GLERNKKSDL-------KWEEFAPRVEDYNHFLARAIAGGTGQIVKGIFLCSN  211

Query  674   VTVDSLKSGDEVLRNRMTSGSKTEVSPETMKR-------------IRRVKRVTSMTEKVA  534
                + ++ G E + N     +   +  E+M               ++RV+++T+MTE++ 
Sbjct  212   AYTNQVQKGGETILNTAAEKNNGGMVTESMNHRSDATKNNATNDNLKRVRKLTNMTERLT  271

Query  533   TGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmst  354
               +L GV  +SG   + V  S  G+ FL +LPGE++LA+LD  +R+ +A E A K   S 
Sbjct  272   KSLLDGVGIMSGSVMTPVLKSQPGQAFLNMLPGEVLLASLDAVNRVFEAAEAAEKQTFSA  331

Query  353   sstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             +S   T +VS+++G+EA +AT      AGHA+ TAW V K+RKA+NP
Sbjct  332   TSQAATRMVSNRFGEEAGEATEHVFATAGHAVNTAWNVSKIRKAINP  378



>ref|XP_006644642.1| PREDICTED: uncharacterized protein LOC102719056 [Oryza brachyantha]
Length=379

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 127/395 (32%), Positives = 199/395 (50%), Gaps = 59/395 (15%)
 Frame = -1

Query  1343  SPSAPPEAV-EETLLIVPGAILHLID-KQYSVELATGDLSLVSLRQGDSNVAVFARVADE  1170
             S S PP  + EETLL VPGA +HL+D  +  VELA GDL++V + +    VA  ARV  +
Sbjct  9     STSRPPRGIREETLLRVPGASVHLLDGAEGPVELARGDLAVVRIAKDGVAVATVARVGRD  68

Query  1169  IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVL  990
             + WPLT+D   V+LD  HY F+   P+ D                          G   L
Sbjct  69    LGWPLTRDEPVVRLDRLHYLFTL--PDRD--------------------------GGAFL  100

Query  989   NYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPV-AKEVSPADLKSEKK  813
             NYG++ A+   D L+  LD  L   + FS            G P  ++  +     +   
Sbjct  101   NYGVSFAAP-NDALLASLDAFLRANACFSTPSA--------GAPAPSRSYTATATATNTP  151

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
                 +G    YW   AP +E Y++  A+ +A+G+G+L++GI  C D     ++ G +++R
Sbjct  152   PATTDG----YWNDYAPRMEGYNNVLAKAIAAGTGQLVRGIFMCSDAYASQVQRGADLVR  207

Query  632   NRMTSGSKTEVSPETM---------------KRIRRVKRVTSMTEKVATGVLSGVVKVSG  498
              +        V                    K ++RV++++ MTEK++  +L  V+ V+G
Sbjct  208   LQAAGSVSKRVGGAGGGPGRTGQADAKRGVNKSLKRVRKLSEMTEKMSQSLLDTVIAVTG  267

Query  497   FFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHK  318
                + +  S  GK FL  +PGE++LA+LD  +++ DAVE A +  ++ +S V  G VS +
Sbjct  268   SMAAPLLRSKQGKAFLATVPGEVILASLDAINKVMDAVEAAERRSLAATSNVVAGAVSRR  327

Query  317   YGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             YG+ A +AT +    AGHA+ TAW +FK+RKA+ P
Sbjct  328   YGESAGEATEDAFATAGHAVGTAWNLFKIRKAVTP  362



>ref|XP_009629458.1| PREDICTED: uncharacterized protein LOC104119611 isoform X1 [Nicotiana 
tomentosiformis]
Length=367

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/382 (31%), Positives = 190/382 (50%), Gaps = 77/382 (20%)
 Frame = -1

Query  1313  ETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASV  1134
             E LL +PG  +HL+D+  ++EL+ G  ++ S+ + D  VA   +V DE+QWPLTKD   V
Sbjct  32    EVLLSIPGCKVHLMDEGETLELSNGFFTIFSISEEDVCVATIVKVGDELQWPLTKDEPVV  91

Query  1133  KLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQD  954
             KLD  HY F+    +                                L+YG+T    G  
Sbjct  92    KLDALHYLFTLPVKDCHP-----------------------------LSYGVTFTENGSG  122

Query  953   NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWT  774
             NL   LD  L   + F+                      + + S ++K++        W 
Sbjct  123   NL-GFLDAFLKENTLFT----------------------SSISSNRRKDI-------EWK  152

Query  773   TLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL--------------  636
               AP +EDY++  A+ +A G+G+++KGI  C +   + ++ G E +              
Sbjct  153   EFAPRIEDYNNVLAKAIAGGTGQIVKGIFKCSNAYTNQVQKGGENILIPAVENSGSTATK  212

Query  635   -RNRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGK  459
              +  +T+ +K     E++KR+R + +   MTEK++  +L+GV   +G     +  S  GK
Sbjct  213   RKGNVTAATKKNAVNESLKRVRNLSK---MTEKMSKSMLNGVGIATGSVMGPMVRSQAGK  269

Query  458   KFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGL  279
             KFL ++PGE++LA+LD  ++I DA E A K  +S +S   T +V++++G+ A +AT + L
Sbjct  270   KFLAMVPGEVLLASLDAINKILDAAEAAEKQTLSATSGAVTRIVTNRFGENAGEATEDAL  329

Query  278   EAAGHAMATAWTVFKLRKALNP  213
               AGH   TAW VFK+RKALNP
Sbjct  330   ATAGHCAGTAWNVFKIRKALNP  351



>ref|XP_009773583.1| PREDICTED: uncharacterized protein LOC104223781 isoform X2 [Nicotiana 
sylvestris]
Length=364

 Score =   186 bits (473),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 119/379 (31%), Positives = 188/379 (50%), Gaps = 74/379 (20%)
 Frame = -1

Query  1313  ETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASV  1134
             E LL +PG  +HL+D+  ++EL+ G  ++ S+ + D  VA   +V DE+QWPLTKD   V
Sbjct  32    EVLLSIPGCKVHLMDEGETLELSNGFFTIFSISEEDVCVATIVKVGDELQWPLTKDEPVV  91

Query  1133  KLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQD  954
             KLD  HY F+                                     L+YG+T +  G  
Sbjct  92    KLDALHYLFTLPVKE-----------------------------GHPLSYGVTFSENGSG  122

Query  953   NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWT  774
             NL   LDT L   S F+                      + + S K+ ++        W 
Sbjct  123   NL-GFLDTFLKENSLFT----------------------SSISSNKRNDI-------EWK  152

Query  773   TLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL------------RN  630
               AP +EDY++  A+ +A G+G+++KGI  C +   + ++ G E +              
Sbjct  153   DFAPRIEDYNNVLAKAIAGGTGQIVKGIFKCSNAYTNQVQKGGENILIPAVENSGSTATK  212

Query  629   RMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFL  450
             R  + +K     E++KR+R++ +   MT K++  +L+GV   +G     +  S  GKKFL
Sbjct  213   RKGNATKNNAVNESLKRVRKLSK---MTGKMSKSMLNGVGIATGSVMGPMVRSQAGKKFL  269

Query  449   GLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAA  270
              ++PGE++LA+LD  ++I DA E A K  +S +S   T +V++++G+ A +AT + L  A
Sbjct  270   AMVPGEVLLASLDAINKILDAAEAAEKQTLSATSGAVTRMVTNRFGENAGEATEDALATA  329

Query  269   GHAMATAWTVFKLRKALNP  213
             GH   TAW VFK+RKALNP
Sbjct  330   GHCAGTAWNVFKIRKALNP  348



>gb|ABB82563.1| putative senescence-related protein, partial [Primula vulgaris]
Length=160

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = -1

Query  785  AYWTTLAP----NVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTS  618
            A W ++ P    +VE+YSS  AR +A+GSG + KGILWCGDV V+ LK G E +R R+  
Sbjct  10   AEWGSIGPSVGQDVEEYSSGVARAIAAGSGHVAKGILWCGDVGVEKLKWGHEFMRRRLKE  69

Query  617  GSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLP  438
            GS +E+SPE +KR+ RVK++T M E VATG+LSGVVKVSGFFT  + NS+VGKKF  LLP
Sbjct  70   GS-SEISPEGLKRMERVKKLTKMCEDVATGILSGVVKVSGFFTGCIVNSTVGKKFFSLLP  128

Query  437  GEMVLATLDGFSRICDAVEVAGKN  366
            GE+VLA+LDGF+++ DAVEVAG+N
Sbjct  129  GEIVLASLDGFNKVFDAVEVAGRN  152



>ref|NP_001151530.1| senescence-associated protein 12 [Zea mays]
 gb|ACG43185.1| senescence-associated protein 12 [Zea mays]
Length=378

 Score =   184 bits (467),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 129/396 (33%), Positives = 198/396 (50%), Gaps = 64/396 (16%)
 Frame = -1

Query  1337  SAPPEAV-EETLLIVPGAILHLI--DKQYSVELATGDLSLVSLRQGDSNVAVFARVADEI  1167
             SA P  + EETLL VPGA +HL+       VELA GDL++V L + D  +A   RV  ++
Sbjct  9     SARPRGIHEETLLRVPGASVHLLAGSSDGPVELARGDLAVVRLTKDDVALATAVRVGRDL  68

Query  1166  QWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLN  987
              WPL +D   V+LD  HY F+                               D     LN
Sbjct  69    GWPLARDEPVVRLDPLHYLFTL----------------------------PADKDGTFLN  100

Query  986   YGLTI-ASKGQD-NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKK  813
             YG++  A  G D + +  LD +L + + FS              P +  V P    S  +
Sbjct  101   YGVSFNAGAGADASALASLDGLLRSNACFST-------------PSSGAVVPPSKGSRTR  147

Query  812   KEVLEGRCAA----YWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGD  645
              +   G  AA    YW   AP VE Y+   A+ +A+G+G+L+KGI  C +     ++ G 
Sbjct  148   PQ--PGPVAASGDGYWNEFAPRVEGYNGVLAKAIAAGTGQLVKGIFMCSEAYASQVQRGA  205

Query  644   EVLRNRMTS-----------GSKTEVSPETM-KRIRRVKRVTSMTEKVATGVLSGVVKVS  501
             ++ R +              G+     P  + K ++RV++++ MTEK++  +L+ V+ V+
Sbjct  206   DLFRAQAAGSARSRFGDAAGGADRNTKPGAVNKSLKRVRKLSEMTEKMSQSLLNTVISVT  265

Query  500   GFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSH  321
             G   + +  S  G+ FL  +PGE++LA+LD  +++ DAVE A K  ++ +S V  G VS 
Sbjct  266   GSMAAPLIRSKQGRAFLATVPGEVILASLDAINKVMDAVEAAEKKSLAATSNVVAGAVSR  325

Query  320   KYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             +YG+ A +AT E    AGHA+ TAW +FK+RKA+ P
Sbjct  326   RYGENAGEATQEAFATAGHAVGTAWNLFKIRKAVTP  361



>ref|XP_006353491.1| PREDICTED: uncharacterized protein LOC102604206 [Solanum tuberosum]
Length=366

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 119/377 (32%), Positives = 188/377 (50%), Gaps = 68/377 (18%)
 Frame = -1

Query  1313  ETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASV  1134
             E LL +P   +HL+D+  ++EL+ G  ++ S+ + D  VA   +V DE+QWPLTKD   V
Sbjct  32    EVLLNIPSCKVHLMDEGETLELSNGFFTIFSIFEEDVCVATIIKVGDELQWPLTKDEPVV  91

Query  1133  KLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQD  954
             KLD+ HY F+    N                                L+YG+T   KG  
Sbjct  92    KLDSLHYLFTLPIKN-----------------------------GHPLSYGVTFLEKGSG  122

Query  953   NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWT  774
             NL   LD  L   + F+                         KS  +K  ++      W 
Sbjct  123   NL-GVLDEFLKKNAMFTCSS----------------------KSLIRKSDID------WK  153

Query  773   TLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE-----VLRNRMTSGSK  609
               AP +EDY+   A+ +A G+G+++KGI  C +   + ++ G E      + N  ++ +K
Sbjct  154   EFAPRIEDYNHVLAKAIAEGTGQIVKGIFKCSNAYTNQVQKGGENILIPTIENSGSTINK  213

Query  608   TEVSPETMKR-----IRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGL  444
              + +  T K      ++RV++++ MTEK++  +L+GV   SG     +  S  GK+FL +
Sbjct  214   KKGNNTTNKSALNESLKRVRKLSKMTEKMSKSMLNGVGIASGSVMGPMVRSQAGKQFLTM  273

Query  443   LPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGH  264
             +PGE++LA+LD  ++I DA E A K  ++ +S   T +V+ +YG+ A +AT + L   GH
Sbjct  274   VPGEVLLASLDALNKILDAAEAAEKQTLTATSGAVTRMVTQRYGENAGEATGDALATVGH  333

Query  263   AMATAWTVFKLRKALNP  213
                TAW VFK+RKALNP
Sbjct  334   CAGTAWNVFKIRKALNP  350



>gb|AFW83773.1| senescence-associated protein 12 [Zea mays]
Length=380

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 130/392 (33%), Positives = 200/392 (51%), Gaps = 54/392 (14%)
 Frame = -1

Query  1337  SAPPEAV-EETLLIVPGAILHLI--DKQYSVELATGDLSLVSLRQGDSNVAVFARVADEI  1167
             SA P  + EETLL VPGA +HL+       VELA GDL++V L + D  VA   RV  ++
Sbjct  9     SARPRGIHEETLLRVPGASVHLLAGSSDGPVELARGDLAVVRLTKDDVAVATAVRVGRDL  68

Query  1166  QWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLN  987
              WPL +D   V+LD  HY F+                               D     LN
Sbjct  69    GWPLARDEPVVRLDPLHYLFTL---------------------------PAADKDGTFLN  101

Query  986   YGLTI-ASKGQD-NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKK  813
             YG++  A  G D + +  LD +L + + FS      + +VV   P +K  S A  + +  
Sbjct  102   YGVSFNAGAGADASALASLDGLLRSNACFSA---PSSGAVV---PPSKGSSRA--RPQPG  153

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
               V  G    YW   AP VE Y+   A+ +A+G+G+L+KGI  C +     ++ G ++ R
Sbjct  154   PVVASGD--GYWNEFAPRVEGYNGVLAKAIAAGTGQLVKGIFMCSEAYASQVQRGADLFR  211

Query  632   NRMTS-----------GSKTEVSPETM-KRIRRVKRVTSMTEKVATGVLSGVVKVSGFFT  489
              +              G+     P  + K ++RV++++ MTEK++  +L  V+ V+G   
Sbjct  212   PQAAGSARSRFGDAAGGANRNTKPGAVNKSLKRVRKLSEMTEKMSQSLLDTVISVTGSMA  271

Query  488   SSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGD  309
             + +  S  G+ FL  +PGE++LA+LD  +++ DAVE A K  ++ +S V  G VS +YG+
Sbjct  272   APLIRSKQGRAFLATVPGEVILASLDAINKVMDAVENAEKKSLAATSNVVAGAVSRRYGE  331

Query  308   EAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
              A +AT +    AGHA+ TAW +FK+RKA+ P
Sbjct  332   NAGEATQDAFATAGHAVGTAWNLFKIRKAVTP  363



>gb|KHN40385.1| hypothetical protein glysoja_000883 [Glycine soja]
Length=376

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 118/386 (31%), Positives = 190/386 (49%), Gaps = 72/386 (19%)
 Frame = -1

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLT  1152
             P    +E +L +PG  +HL+D+  ++ELA G  +++ +   +  +A   +V + +QWPLT
Sbjct  29    PKTLKQEVVLQIPGCKVHLMDEGEAIELAQGHFTIMKIMDQNVPLATSIKVGNSVQWPLT  88

Query  1151  KDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI  972
             KD   VK+D  HY FS    +                            G + L+YG+T 
Sbjct  89    KDEPVVKVDALHYLFSLPVKD----------------------------GGEPLSYGVTF  120

Query  971   ASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGR  792
               +   N+   LD+ L + S FS                        L+  KK ++    
Sbjct  121   PEQCYGNM-GMLDSFLKDQSCFS-----------------------GLERNKKSDL----  152

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGS  612
                 W   AP VEDY+   AR +A G+G+++KGI  C +   + ++ G E + N     +
Sbjct  153   ---NWEEFAPRVEDYNHFLARAIAGGTGQIVKGIFMCSNAYTNQVQKGGETILNTAAEKN  209

Query  611   KTEVSPETMKR-------------IRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
                V  E+M +             ++RV+++T+MTEK+   +L GV  +SG   + V  S
Sbjct  210   NGSVVTESMNQRSDATKNNATNENLKRVRKLTNMTEKLTKSLLDGVGIMSGSMMTPVLKS  269

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKAT  291
               G+ FL +LPGE++LA+LD  +R+ +A E A K   S +S   T +VS+++G+EA +AT
Sbjct  270   QPGQAFLKMLPGEVLLASLDAVNRVFEAAEAAEKQTFSATSQAATRMVSNRFGEEAGEAT  329

Query  290   SEGLEAAGHAMATAWTVFKLRKALNP  213
                   AGH++ TAW V K+RKA+NP
Sbjct  330   EHVFATAGHSVNTAWNVSKIRKAINP  355



>ref|XP_003517642.1| PREDICTED: uncharacterized protein LOC100800545 [Glycine max]
Length=377

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 118/386 (31%), Positives = 190/386 (49%), Gaps = 72/386 (19%)
 Frame = -1

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLT  1152
             P    +E +L +PG  +HL+D+  ++ELA G  +++ +   +  +A   +V + +QWPLT
Sbjct  30    PKTLKQEVVLQIPGCKVHLMDEGEAIELAQGHFTIMKIMDKNVPLATTIKVGNSVQWPLT  89

Query  1151  KDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI  972
             KD   VK+D  HY FS    +                            G + L+YG+T 
Sbjct  90    KDEPVVKVDALHYLFSLPVKD----------------------------GGEPLSYGVTF  121

Query  971   ASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGR  792
               +   N+   LD+ L + S FS                        L+  KK ++    
Sbjct  122   PEQCYGNM-GMLDSFLKDQSCFS-----------------------GLERNKKSDL----  153

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGS  612
                 W   AP VEDY+   AR +A G+G+++KGI  C +   + ++ G E + N     +
Sbjct  154   ---NWEKFAPRVEDYNHFLARAIAGGTGQIVKGIFMCSNAYTNQVQKGGETILNTAAEKN  210

Query  611   KTEVSPETM-------------KRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
                V  E+M             + ++RV+++T+MTEK+   +L GV  +SG   + V  S
Sbjct  211   NGSVVTESMNHRSDATKNNATNENLKRVRKLTNMTEKLTKSLLDGVGIMSGSMMAPVLKS  270

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKAT  291
               G+ FL +LPGE++LA+LD  +R+ +A E A K   S +S   T +VS+++G+EA +AT
Sbjct  271   QPGQAFLKMLPGEVLLASLDAVNRVFEAAEAAEKQTFSATSQAATRMVSNRFGEEAGEAT  330

Query  290   SEGLEAAGHAMATAWTVFKLRKALNP  213
                   AGH++ TAW V K+RKA+NP
Sbjct  331   EHVFATAGHSVNTAWNVSKIRKAINP  356



>ref|XP_002280434.1| PREDICTED: uncharacterized protein LOC100259546 isoform X1 [Vitis 
vinifera]
 emb|CBI28002.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 125/409 (31%), Positives = 189/409 (46%), Gaps = 86/409 (21%)
 Frame = -1

Query  1394  ENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLR  1215
             E  FP N   ++         P    +E LL +P   +HL+++  +VELA G+ +L  LR
Sbjct  22    EAAFPANQGNLE---------PKSLKQELLLQIPACTVHLMEEGEAVELANGEFTL--LR  70

Query  1214  QGDSNV--AVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgk  1041
               D NV  A   +V D++QWPLTKD   VKLD+ HY FS    +                
Sbjct  71    ISDENVFLATIIKVGDDLQWPLTKDEPVVKLDSLHYLFSLPMKD----------------  114

Query  1040  kegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGG  861
                           D L+YG+T + +   NL   LD+ L   S FS              
Sbjct  115   -------------GDPLSYGVTFSEQHGGNL-GLLDSFLKEHSCFS--------------  146

Query  860   PVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWC  681
                       L S + K V        W   AP +EDY+   A+ +  G+G+++KGI  C
Sbjct  147   ---------GLSSARNKGV-------DWKEYAPRIEDYNGVLAKAIGGGTGQIVKGIFKC  190

Query  680   GDVTVDSLKSGDEVL-------------RNRMTSGSKTEVSPETMKRIRRVKRVTSMTEK  540
              +   + ++ G E++             R     G  T       K ++RV++++ MTEK
Sbjct  191   SNAYTNQVQKGGEMILTKAAEEKNGATARENKNKGVGTTKKSGAHKSLKRVRKLSKMTEK  250

Query  539   VATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvm  360
             ++  +L GV   +G   + +  S  GK FL ++PGE++LA+LD  + + DA EVA K   
Sbjct  251   ISKAMLDGVGLATGSVMAPLVKSQTGKAFLAMVPGEVLLASLDAVNTVLDAAEVAEKQAF  310

Query  359   stsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             S +S   T +VS +YG+ A +AT +     GH   T W +FK+RKA+NP
Sbjct  311   SATSGAATRMVSKRYGESAGEATEDAFATVGHCAGTVWNIFKIRKAINP  359



>ref|XP_004251634.1| PREDICTED: uncharacterized protein LOC101258728 [Solanum lycopersicum]
Length=366

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 184/377 (49%), Gaps = 68/377 (18%)
 Frame = -1

Query  1313  ETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASV  1134
             E +L +P   +HL+D+  ++EL+ G  ++ S+ +    VA   +V DE+QWPLTKD   V
Sbjct  32    EVILNIPSCKVHLMDEGETLELSNGFFTIFSIFEEGVCVATIIKVGDELQWPLTKDEPIV  91

Query  1133  KLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQD  954
             KLD+ HY F+    N                                L+YG+T   KG  
Sbjct  92    KLDSLHYLFTLPIKN-----------------------------GHTLSYGVTFLEKGSG  122

Query  953   NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWT  774
             NL   LD  L   + F+                         KS  +K  ++      W 
Sbjct  123   NL-GVLDEFLKKNAMFTCSS----------------------KSLIRKSDID------WK  153

Query  773   TLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMT---------  621
               AP +EDY++  A+ +A G+G+++KGI  C +   + ++ G E +  R           
Sbjct  154   EFAPRIEDYNNVLAKAIAEGTGQIVKGIFKCSNAYTNQVQKGGENILIRAIENSDSTIIK  213

Query  620   -SGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGL  444
               G+ T       + ++RV++++ MTEK++  +L+GV   SG     +  S  G+KFL +
Sbjct  214   KKGNNTTNKSALNESLKRVRKLSKMTEKMSKSMLNGVGIASGSVMGPMVRSQAGQKFLTM  273

Query  443   LPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGH  264
             +PGE++LA+LD  ++I DA E A K  +S +S   T +V+ +YG+ A +AT + L   GH
Sbjct  274   VPGEVLLASLDALNKILDAAEAAEKQTLSATSGAVTRMVTQRYGENAGEATGDALATVGH  333

Query  263   AMATAWTVFKLRKALNP  213
                TAW VFK+RKALNP
Sbjct  334   CAGTAWNVFKIRKALNP  350



>ref|XP_011007112.1| PREDICTED: uncharacterized protein LOC105112911 [Populus euphratica]
Length=387

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 122/393 (31%), Positives = 192/393 (49%), Gaps = 71/393 (18%)
 Frame = -1

Query  1349  HHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADE  1170
               +P  P    +E LL +P   +HL++   ++ELA GD SLV +   + ++A   ++ D+
Sbjct  28    QQNPPGPKNVKQELLLQIPACTVHLMEAGEALELAKGDFSLVRILDENISLATIVKIGDD  87

Query  1169  IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVL  990
             +QWPLTKD   VKLD  HY FS    +                              D L
Sbjct  88    LQWPLTKDEPVVKLDVLHYLFSLPMKD-----------------------------GDPL  118

Query  989   NYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKK  810
             +YG+    +   +L   LD+ L   S FS                  E S A  +S +  
Sbjct  119   SYGVAFLDEYGSSL-GLLDSFLCELSCFS----------------GAEASSA--RSTRNV  159

Query  809   EVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRN  630
             +         W   APNVE Y++  A+ +A G+G+++KGI  C +   + +  G E++ +
Sbjct  160   D---------WKEFAPNVEYYNNFLAKAIAGGTGQIVKGIFKCSNAYTNQVHKGGEMILS  210

Query  629   RM----TSGSKTEVSP----------ETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFF  492
             R          TEVS           +  K IRRV++++ MTEK++  +L GV   +G  
Sbjct  211   RAAEEKNGAMATEVSSNRSAGSTKKSKVNKSIRRVRKLSRMTEKLSKTMLDGVGIATGSV  270

Query  491   TSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYG  312
              + +  S  GK FL ++PGE++LA+LD  ++I DA EVA +  +S +S  TT ++S ++G
Sbjct  271   ITPLVKSQAGKAFLSMVPGEVLLASLDAVNKIIDAAEVAERQALSATSKATTRMISDRFG  330

Query  311   DEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             D A +A  +    AGH +  AW +FK+RKA+NP
Sbjct  331   DSAGEAAEDAFATAGHCVRAAWNIFKIRKAINP  363



>ref|XP_009352697.1| PREDICTED: uncharacterized protein LOC103944030 [Pyrus x bretschneideri]
Length=405

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 120/387 (31%), Positives = 188/387 (49%), Gaps = 72/387 (19%)
 Frame = -1

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLT  1152
             P    ++ L  +PG  +HL+D+  ++ELA GD  L ++ + + ++A   +V +EIQWPLT
Sbjct  36    PKNLQQQVLFRIPGCKVHLMDEGETLELANGDFVLENILENNVSLATIIKVGEEIQWPLT  95

Query  1151  KDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI  972
              D   VKLD  HY FS    +                              D L+YG+T 
Sbjct  96    NDEPVVKLDALHYLFSLPMKD-----------------------------GDPLSYGVTF  126

Query  971   ASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGR  792
              ++ + NL   LD+ L   S FS                      A  K+   K V    
Sbjct  127   PAQYESNL-GFLDSYLKEHSCFST---------------------ALTKNNNNKGV----  160

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG-  615
                 W   AP +EDY++  A+ +A G+G++++GI  C +   + ++ G E    R   G 
Sbjct  161   ---DWKEYAPRIEDYNNVLAKAIAGGTGQIVRGIFMCSNAYTNQVQKGGETTLARPVEGK  217

Query  614   --------SKTEVSPETMK-----RIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
                     + +E S  T K      ++RVK ++ MT +++  +L GV  V+G     V N
Sbjct  218   SYVKKQGSNSSESSAATKKSGINENLKRVKNLSKMTSELSKSMLDGVGIVTGSVMGPVVN  277

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GK F  ++PGE++LA+LDG ++I DA EVA K  +S +S   T +VS+++G+ A + 
Sbjct  278   SQAGKAFFAMVPGEVLLASLDGINKILDAAEVAEKQALSATSGAATRIVSNRFGESAGET  337

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T +     GH   TAW +FK+RKA+NP
Sbjct  338   TEDVFATTGHIANTAWNIFKIRKAINP  364



>emb|CDP03258.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 119/380 (31%), Positives = 183/380 (48%), Gaps = 71/380 (19%)
 Frame = -1

Query  1316  EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLAS  1137
              E LL +PG   HL+D   +VELA+GD  LV +   + ++A   ++ DE+QWPLTKD   
Sbjct  36    HEVLLSIPGCKAHLMDAGEAVELASGDFELVRISDDNVSLATVIKIGDELQWPLTKDEPV  95

Query  1136  VKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQ  957
             VKLD  HY FS    +                              D L+YG+T +    
Sbjct  96    VKLDALHYLFSLPMKD-----------------------------GDPLSYGITFSGLNS  126

Query  956   DNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYW  777
              NL      +LD   SF       TAS                 S K K V        W
Sbjct  127   GNL-----GLLD---SFLSEHALLTASA---------------SSTKNKNV-------NW  156

Query  776   TTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL------------R  633
                AP +++Y+   A+ +A G+G+++KGI  C +   + +  G E +             
Sbjct  157   KEFAPRIDNYNHVLAKAIAGGTGQIVKGIFKCSNAYANQVHKGGETILVAEGNSSVTATS  216

Query  632   NRMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
             ++ ++ S ++      K ++RV++++ MTEK++  +L GV   +G   + V  S  GK F
Sbjct  217   SKRSNNSDSQKKNAVNKSLKRVRKLSKMTEKMSKAMLDGVGIATGSVMAPVVRSQAGKAF  276

Query  452   LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
               +LPGE++LA+LD  ++I DA E A K  +S +S   T +V+ ++G+ A +AT + L  
Sbjct  277   FTMLPGEVLLASLDAVNKIIDAAEAAEKQALSATSGAVTRMVTKRFGESAGEATEDVLAT  336

Query  272   AGHAMATAWTVFKLRKALNP  213
             AGH    AW VFK+RKA+NP
Sbjct  337   AGHCAGFAWNVFKIRKAINP  356



>ref|XP_010688335.1| PREDICTED: uncharacterized protein LOC104902300 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 114/380 (30%), Positives = 187/380 (49%), Gaps = 70/380 (18%)
 Frame = -1

Query  1316  EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLAS  1137
              E +L +PG++++L+++  ++ELA GD S+  L   + ++A   +V D +QWPLTKD   
Sbjct  35    HELILRIPGSVVNLMEEGETIELARGDFSVYVLSDQNISLATIIKVGDNLQWPLTKDEPV  94

Query  1136  VKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQ  957
             +KLD  HY F+                                 G D LNYG+T + +  
Sbjct  95    IKLDALHYLFTLPMK-----------------------------GGDPLNYGVTFSERCD  125

Query  956   DNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYW  777
               L+  LD+ L   S FS                          S K      GR    W
Sbjct  126   KKLLSSLDSYLKQHSCFSC-------------------------SSK----FNGRNDLDW  156

Query  776   TTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL-----RNRMTSGS  612
                AP VE Y+   AR +A G+G+++KGI  C +   + +++G E++      N   + +
Sbjct  157   KEFAPKVEAYNGVVARAIAEGTGQIVKGIFMCSNAYTNQMQNGGELILSQENNNVKITPA  216

Query  611   KTEVSPETMKR-------IRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKF  453
             KT+ +  T+ R       I+RV++++  T+K++  +L GV   SG     + NS  G+ F
Sbjct  217   KTKSNKSTVSRNNSMNQSIKRVRKLSDTTQKMSKTMLDGVGIASGSVMGPLVNSKQGRAF  276

Query  452   LGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEA  273
               ++PGE++LA+ D   +I +A E A +  +  +S   T +VS+++G+ A +AT + L  
Sbjct  277   FSMMPGEVLLASFDALDKIMNAAEAAEQQALYATSGAATRMVSNRFGENAGEATEDALAT  336

Query  272   AGHAMATAWTVFKLRKALNP  213
             AGH   TAW +FK+RKA+NP
Sbjct  337   AGHCAGTAWNIFKIRKAINP  356



>gb|KDP33790.1| hypothetical protein JCGZ_07361 [Jatropha curcas]
Length=360

 Score =   176 bits (446),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 120/376 (32%), Positives = 182/376 (48%), Gaps = 67/376 (18%)
 Frame = -1

Query  1316  EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLAS  1137
              E LL +PG I++L+DK   ++LA GD  LV +      +A   +V +++QWPLTKD   
Sbjct  27    REVLLQIPGCIVYLMDKGGVLDLAKGDFELVQILDKGVCIANIIKVGNDLQWPLTKDEPV  86

Query  1136  VKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQ  957
             VKLD+ HY FS    +                             +D L+YG+T + +  
Sbjct  87    VKLDSVHYLFSLPMKD-----------------------------SDPLSYGVTFSGQFS  117

Query  956   DNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYW  777
              +L   LD  L   S FS                          S K + ++E      W
Sbjct  118   SSL-PSLDAFLMENSCFS-----------------------STTSTKSRNIIE------W  147

Query  776   TTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRN------RMTSG  615
                +  +EDY +  A  +  G+G+++KGI    +     + +G E++ N      R  S 
Sbjct  148   NQFSSRIEDYKNVLANAIVEGTGQIVKGIFIMSNTYSSQVHNGGEIISNPAIPVSRTNSK  207

Query  614   SKTEVSPETM--KRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLL  441
                E + E+   + I+RV+ ++ MTEK++  VL  V   +G   S +  S  GK FL   
Sbjct  208   KYAEATNESSINESIKRVRSLSQMTEKLSKAVLDQVGVATGSVMSPLVTSQAGKAFLATA  267

Query  440   PGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHA  261
             PGE++LA+LD  ++I DA E+AGK  +S +S  TT +V+ KYG+ A +AT E L  AGH 
Sbjct  268   PGEILLASLDAVNKILDAAEIAGKQALSATSAATTRMVTDKYGEGAGEATKEVLATAGHC  327

Query  260   MATAWTVFKLRKALNP  213
               TAW + K+RKA+NP
Sbjct  328   ANTAWNILKIRKAINP  343



>ref|XP_008242492.1| PREDICTED: uncharacterized protein LOC103340819 [Prunus mume]
 ref|XP_008242493.1| PREDICTED: uncharacterized protein LOC103340819 [Prunus mume]
Length=386

 Score =   176 bits (446),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 183/378 (48%), Gaps = 76/378 (20%)
 Frame = -1

Query  1298  VPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNS  1119
             +PG  +HL+D+  S+ELA G+  L ++   + ++A   +V DE+QWPLTKD   VKLD  
Sbjct  49    IPGCRVHLMDEGESIELANGEFILENILDENISLATIIKVGDELQWPLTKDEPVVKLDAL  108

Query  1118  HYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKD  939
             HY FS                                 G D L+YG+T   + + NL   
Sbjct  109   HYLFSLPM-----------------------------HGGDPLSYGVTFPEQYESNL-GF  138

Query  938   LDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPN  759
             LD+ L   S FS                        L +  K           W   AP 
Sbjct  139   LDSFLKEHSCFS-----------------------GLSTSTKTNK-----GVDWKEYAPR  170

Query  758   VEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR----------------  627
             ++DY++  A+ +A G+G+++KGI  C +   + L+ G EV   R                
Sbjct  171   MDDYNNVLAKAIAGGTGQIVKGIFMCSNGYTNQLQKGGEVTLARPVEEKSYVKEQGSNSG  230

Query  626   MTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLG  447
               SG+K +   E  K ++RV++++ MT K++  +L GV   +G     V NS  GK F  
Sbjct  231   KNSGAKKK--SEINKSLKRVRKLSKMTSKLSKSMLDGVGIATGSVMRPVVNSQAGKAFFA  288

Query  446   LLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAG  267
             ++PG+++LA+LD  ++I DA EVA K  +S +S   T +VS+++G+ A +AT +    AG
Sbjct  289   MVPGQVLLASLDAVNKILDAAEVAEKQALSATSGAATRMVSNRFGESAGEATEDVFATAG  348

Query  266   HAMATAWTVFKLRKALNP  213
             H   TAW +FK+RKA+NP
Sbjct  349   HCANTAWNIFKIRKAINP  366



>ref|XP_002514213.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48167.1| conserved hypothetical protein [Ricinus communis]
Length=384

 Score =   176 bits (445),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 195/387 (50%), Gaps = 69/387 (18%)
 Frame = -1

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLT  1152
             P    +E LL +P   +HL++   +VELATG+ +L  +     ++A   +V D +QWPLT
Sbjct  30    PKNLKQELLLQIPECTVHLMEGGEAVELATGEFNLFRILDESISLATIVKVGD-LQWPLT  88

Query  1151  KDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI  972
             KD   VKLD+ HY FS                                   D L+YG+T 
Sbjct  89    KDEPVVKLDSLHYLFSLPM-----------------------------FDGDPLSYGVTF  119

Query  971   ASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGR  792
                    L   LD+ L   S FS     E+AS+                +  +K  L+  
Sbjct  120   LEHHISKL-SLLDSFLSEHSCFS-----ESASLSTA-------------ARSRKNNLD--  158

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMT---  621
                 W   AP+VEDY++  A+ +A G+G+++KGI  C +   + +  G E++  R     
Sbjct  159   ----WKEFAPSVEDYNNVLAKAIAGGTGQIVKGIFKCSNAYTNQVHKGGEMILTRAAEEK  214

Query  620   SGSK-TEVSPETM----------KRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
             +G+K  E+S  T           K ++RV++++ MTEK++  +L GV   +G   + +  
Sbjct  215   NGAKANEISSNTSTGATQRSKVNKSLKRVRKLSKMTEKLSKTMLDGVGIATGSVMAPLVK  274

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GK FL ++PGE++LA+LD  ++I DA E A K  +S +S  TT +VS+++G+ A +A
Sbjct  275   SQAGKAFLSMVPGEVLLASLDAVNKILDAAEAAEKQTLSATSKATTRMVSNRFGESAGQA  334

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T +    AGH  +TAW +FK+RKA+NP
Sbjct  335   TEDVFATAGHCASTAWNIFKIRKAINP  361



>dbj|BAJ93577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=253

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 117/304 (38%), Positives = 159/304 (52%), Gaps = 58/304 (19%)
 Frame = -1

Query  1475  DFENPFHSSSSSANRSPMYPVVDMKDVENL-FPENYETVQGYYHHSPSAPPEAVEETLLI  1299
             +  NP + SS +    P+YP + M D+  +  P +  T        P AP  + E+ LL 
Sbjct  6     NHPNPTNPSSPAPTAPPLYPSLSMADLAPVEIPRSLST--------PDAPAPS-EDVLLR  56

Query  1298  VPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNS  1119
             VPGA LHLID+Q S  LA GDLSL  +R GD+++A  A +   +QWPL +D+A+VKLD  
Sbjct  57    VPGAQLHLIDRQRSHPLAAGDLSLHRIRAGDTSLAAIAALG-PVQWPLARDVAAVKLDPR  115

Query  1118  HYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKD  939
             HY FSF  P                           D   D L+YGLT++          
Sbjct  116   HYSFSFAVP-----------------------ASPDDPAPDPLHYGLTLSVPD-----PR  147

Query  938   LDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPN  759
             LD +L   + FS H V  +  +  G  V  EV                  AAYWT +APN
Sbjct  148   LDALLGAYTRFSAHSVAGSEGLADG--VRGEVE----------------AAAYWTAVAPN  189

Query  758   VEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG-SKTEVSPETMK  582
             VE+Y S+ AR +ASG+  + KGILWCG +TVD L+ G+EVLR R+  G ++ EVSPE ++
Sbjct  190   VEEYGSAVARAIASGAENVAKGILWCGVMTVDRLRWGNEVLRKRIQPGDTEAEVSPEMLR  249

Query  581   RIRR  570
             RI+R
Sbjct  250   RIKR  253



>gb|EEE55313.1| hypothetical protein OsJ_03303 [Oryza sativa Japonica Group]
Length=383

 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 122/394 (31%), Positives = 197/394 (50%), Gaps = 54/394 (14%)
 Frame = -1

Query  1334  APPEAVEETLLIVPGAILHLID-KQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWP  1158
             AP    EETLL VPGA +HL+D  +  VELA GDL++V + +    VA  ARV   + WP
Sbjct  7     APRGIREETLLRVPGASVHLLDGAEGPVELARGDLAVVRIAKDGVAVATVARVGRGLGWP  66

Query  1157  LTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGL  978
             +T+D   V+LD  HY F+   P+                                LNYG+
Sbjct  67    ITRDEPVVRLDRLHYLFTL--PDSTGGGGGGGGGAL------------------FLNYGV  106

Query  977   TIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLE  798
             + A+   D L+  LD  L   + FS       +            +     +       +
Sbjct  107   SFAAP-DDALLASLDAFLKANACFSTPSSPAPSR--------SSATTTTRPAPTTTATAD  157

Query  797   GRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTS  618
             G    YW   AP ++ Y++  A+ +A+G+G+L++GI  C +     ++ G +++R + T 
Sbjct  158   G----YWNDFAPRMDSYNNVLAKAIAAGTGQLVRGIFMCSEAYATQVQRGADLIRPQAT-  212

Query  617   GSKTEV--------------SPETM-----KRIRRVKRVTSMTEKVATGVLSGVVKVSGF  495
             GS T+                P+       K ++RV++++ MTEK++  +L  V+ V+G 
Sbjct  213   GSVTKRSGGAGGGGASRTTGQPDAKRGGVNKSLKRVRKLSEMTEKMSQSLLDTVIAVTGS  272

Query  494   FTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKY  315
               + +  S  GK FL  +PGE++LA+LD  +++ DAVE A +  ++ +S V +G VS +Y
Sbjct  273   MAAPLLRSKQGKAFLATVPGEVILASLDAINKVMDAVEAAERRSLAATSNVVSGAVSRRY  332

Query  314   GDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             G+ A +AT +    AGHA+ TAW +FK+RKA+ P
Sbjct  333   GESAGEATEDAFATAGHAVGTAWNLFKIRKAVTP  366



>ref|XP_010267145.1| PREDICTED: uncharacterized protein LOC104604487 [Nelumbo nucifera]
Length=379

 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/430 (30%), Positives = 203/430 (47%), Gaps = 91/430 (21%)
 Frame = -1

Query  1451  SSSSANRSPMYPVVDMKDVENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLI  1272
             S+ S  RSP      M   E +F    E V+            A EE LL +PG  +HL+
Sbjct  6     SARSRKRSP----TKMTSPETVFASKQENVEN---------KRAKEEMLLEIPGCTVHLM  52

Query  1271  DKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFP  1092
             +   ++ELA G   LV L +   ++A   +V DE+QWPLTKD   VKLD  HY FS    
Sbjct  53    EGGEALELAKGVFRLVRLTEDGISLATIVKVGDELQWPLTKDEPVVKLDALHYLFSLPMK  112

Query  1091  NVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCS  912
             +                             +D L+YG++   + + +L   LD+ L   S
Sbjct  113   D-----------------------------DDPLSYGVSFLEQFKGDL-GLLDSFLKEHS  142

Query  911   SFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAA  732
              F+     +T +V                               W   AP +EDY+   A
Sbjct  143   CFTGSSSTQTGAV------------------------------DWKDFAPRIEDYNGVLA  172

Query  731   RLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPE-------------  591
             + +A G+G+++KGI  C +     +++G E++ +R+    K +VS               
Sbjct  173   KAIAEGTGEIVKGIFKCSNAYTKKVQNGGEMIVSRVGE-EKNKVSTTTTGSKSSKSSAGT  231

Query  590   ----TMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVL  423
                   K ++RV++++ MTEK++  +L GV  V+G     +A S  GK FL ++PGE++L
Sbjct  232   KKSGVQKGLKRVRKLSKMTEKMSKSLLDGVGVVTGSVVVPLARSQAGKTFLAMVPGEVLL  291

Query  422   ATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWT  243
             A+LD  +++ DAVEVA K  +S +S   T +VS ++G+ A + T +    AGH   TAW 
Sbjct  292   ASLDAVNKVLDAVEVAEKQALSATSRAATRMVSQRFGENAGEITEDVFATAGHCAGTAWN  351

Query  242   VFKLRKALNP  213
             +FK+RKA+NP
Sbjct  352   IFKIRKAINP  361



>ref|NP_001044105.1| Os01g0723100 [Oryza sativa Japonica Group]
 dbj|BAD87410.1| senescence/dehydration-associated protein-related (ERD7)-like 
[Oryza sativa Japonica Group]
 dbj|BAD87055.1| senescence/dehydration-associated protein-related (ERD7)-like 
[Oryza sativa Japonica Group]
 dbj|BAF06019.1| Os01g0723100 [Oryza sativa Japonica Group]
 dbj|BAG86887.1| unnamed protein product [Oryza sativa Japonica Group]
Length=389

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 123/402 (31%), Positives = 199/402 (50%), Gaps = 54/402 (13%)
 Frame = -1

Query  1358  GYYHHSPSAPPEAVEETLLIVPGAILHLID-KQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
             G    +  AP    EETLL VPGA +HL+D  +  VELA GDL++V + +    VA  AR
Sbjct  5     GGMSSTSRAPRGIREETLLRVPGASVHLLDGAEGPVELARGDLAVVRIAKDGVAVATVAR  64

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             V   + WP+T+D   V+LD  HY F+   P+                             
Sbjct  65    VGRGLGWPITRDEPVVRLDRLHYLFTL--PDSTGGGGGGGGGAL----------------  106

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKS  822
                LNYG++ A+   D L+  LD  L   + FS       +            +     +
Sbjct  107   --FLNYGVSFAAP-DDALLASLDAFLKANACFSTPSSPAPSR--------SSATTTTRPA  155

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
                    +G    YW   AP ++ Y++  A+ +A+G+G+L++GI  C +     ++ G +
Sbjct  156   PTTTATADG----YWNDFAPRMDSYNNVLAKAIAAGTGQLVRGIFMCSEAYATQVQRGAD  211

Query  641   VLRNRMTSGSKTEV--------------SPETM-----KRIRRVKRVTSMTEKVATGVLS  519
             ++R + T GS T+                P+       K ++RV++++ MTEK++  +L 
Sbjct  212   LIRPQAT-GSVTKRSGGAGGGGASRTTGQPDAKRGGVNKSLKRVRKLSEMTEKMSQSLLD  270

Query  518   GVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvt  339
              V+ V+G   + +  S  GK FL  +PGE++LA+LD  +++ DAVE A +  ++ +S V 
Sbjct  271   TVIAVTGSMAAPLLRSKQGKAFLATVPGEVILASLDAINKVMDAVEAAERRSLAATSNVV  330

Query  338   tglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             +G VS +YG+ A +AT +    AGHA+ TAW +FK+RKA+ P
Sbjct  331   SGAVSRRYGESAGEATEDAFATAGHAVGTAWNLFKIRKAVTP  372



>ref|XP_008361305.1| PREDICTED: uncharacterized protein LOC103424998 [Malus domestica]
Length=383

 Score =   174 bits (441),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 115/382 (30%), Positives = 181/382 (47%), Gaps = 73/382 (19%)
 Frame = -1

Query  1316  EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLAS  1137
             ++ L  +PG  +HL+D+  ++ELA GD  L ++ + + ++A   +V +EIQWPLT D   
Sbjct  41    QQVLFRIPGCKVHLMDEGETLELANGDFVLENILENNVSLATIIKVGEEIQWPLTNDEPV  100

Query  1136  VKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQ  957
             VKLD  HY FS    +                              D L+YG+T   + +
Sbjct  101   VKLDALHYLFSLPMKD-----------------------------GDPLSYGVTFPDQYE  131

Query  956   DNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYW  777
              NL   LD+ L   S FS    +     V                              W
Sbjct  132   SNL-GFLDSYLKEHSCFSTTSTKNNNKGV-----------------------------DW  161

Query  776   TTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSG------  615
                AP +EDY+   A+ +A G+G++++GI  C +   + ++ G E    R   G      
Sbjct  162   KEYAPRIEDYNXVLAKAIAGGTGQIVRGIFMCSNAYTNQVQKGGETTLARPVEGKSYVKE  221

Query  614   ---SKTEVSPETMK-----RIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGK  459
                + +E S    K      ++RVK ++ MT +++  +L GV  V+G     V NS  GK
Sbjct  222   QGSNSSEXSAAKKKXGINVNLKRVKNLSKMTSELSKSMLDGVGIVTGSVMGPVVNSQAGK  281

Query  458   KFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGL  279
              F  ++PGE++LA+LDG ++I DA EVA K  +S +S   T +VS+++G+ A + T +  
Sbjct  282   AFFAMVPGEVLLASLDGINKILDAAEVAEKQALSATSGAATRMVSNRFGESAGETTEDVF  341

Query  278   EAAGHAMATAWTVFKLRKALNP  213
                GH   TAW +FK+RKA+NP
Sbjct  342   ATTGHIANTAWNIFKIRKAINP  363



>ref|XP_004503485.1| PREDICTED: uncharacterized protein LOC101511898 isoform X1 [Cicer 
arietinum]
Length=369

 Score =   174 bits (440),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 120/403 (30%), Positives = 193/403 (48%), Gaps = 79/403 (20%)
 Frame = -1

Query  1379  ENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSN  1200
             E   TV+ Y     + P    +E L+ +P   +HL+D+  + ELA G   ++     D +
Sbjct  15    ETGSTVEEY-----AGPKNLKQEVLIKIPECKVHLMDEGEAFELAQGHFMVIKTFDEDVS  69

Query  1199  VAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhke  1020
             +A   +V D++ WPLTKD   VKLD  HY FS    +                       
Sbjct  70    LATIIKVGDDLHWPLTKDEPVVKLDALHYLFSLPVKD-----------------------  106

Query  1019  kqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVS  840
                    + L+YGL+ A     +L+  LD+ L   S FS                     
Sbjct  107   ------GEPLSYGLSFAEDSYGSLVL-LDSFLKEHSCFS---------------------  138

Query  839   PADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDS  660
                LK   K ++        W   AP V+DY+   ++++A G+G+++KGI  C +   + 
Sbjct  139   --GLKLSNKNDL-------DWKEFAPRVDDYNHFLSKVIAGGTGQIVKGIFICSNAYTNK  189

Query  659   LKSGDEVLRNRMTSGSKTEVSPETMKR--------------IRRVKRVTSMTEKVATGVL  522
             ++ G E++ N       + V+ E+M                ++RV++++ MTEK++  +L
Sbjct  190   VQKGGEMILNSHADEKNSFVAKESMSNKSVGASKKNKINKNLKRVRKLSKMTEKLSKSLL  249

Query  521   SGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstv  342
             +GV  VSG     +  S  GK FL +LPGE++LA+LD  +++ DA E A K  +S +S  
Sbjct  250   NGVGIVSGSVMVPLVKSQPGKAFLKMLPGEVLLASLDAINKVLDAAEAAEKQTLSATSKA  309

Query  341   ttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
              + +VS+++G+ A +AT      AGHA  TAW VFK+RKA+NP
Sbjct  310   ASRMVSNRFGENAGEATEHVFATAGHAANTAWNVFKIRKAINP  352



>ref|XP_007202143.1| hypothetical protein PRUPE_ppa006997mg [Prunus persica]
 gb|EMJ03342.1| hypothetical protein PRUPE_ppa006997mg [Prunus persica]
Length=386

 Score =   173 bits (439),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 118/378 (31%), Positives = 182/378 (48%), Gaps = 76/378 (20%)
 Frame = -1

Query  1298  VPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNS  1119
             +PG  +HL+D+  S+ELA G+  L ++   + ++A   +V DE+QWPLTKD   VKLD  
Sbjct  49    IPGCRVHLMDEGESIELANGEFILENILDENISLATIIKVGDELQWPLTKDEPVVKLDAL  108

Query  1118  HYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKD  939
             HY FS                                 G D L+YG+T   + + NL   
Sbjct  109   HYLFSLPM-----------------------------HGGDPLSYGVTFPEQYESNL-GF  138

Query  938   LDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPN  759
             LD+ L   S FS                        L +  K           W   AP 
Sbjct  139   LDSFLREHSCFS-----------------------GLSTSTKTNK-----GVDWKEYAPR  170

Query  758   VEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR----------------  627
             ++DY++  A+ +A G+G+++KGI  C +   + L+ G EV   R                
Sbjct  171   MDDYNNVLAKAIAGGTGQIVKGIFMCSNGYTNQLQKGGEVTLARPVEEKSYVKEQGSNSS  230

Query  626   MTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLG  447
               SG+K +   E  K ++RV++++ MT K++  +L GV   +G     V  S  GK F  
Sbjct  231   KNSGAKKK--SEINKSLKRVRKLSKMTSKLSKSMLDGVGIATGSVMRPVVKSQAGKAFFA  288

Query  446   LLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAG  267
             ++PG+++LA+LD  ++I DA EVA K  +S +S   T +VS+++G+ A +AT +    AG
Sbjct  289   MVPGQVLLASLDAVNKILDAAEVAEKQALSATSGAATRMVSNRFGESAGEATEDVFATAG  348

Query  266   HAMATAWTVFKLRKALNP  213
             H   TAW +FK+RKA+NP
Sbjct  349   HCANTAWNIFKIRKAINP  366



>ref|XP_007152909.1| hypothetical protein PHAVU_004G170500g [Phaseolus vulgaris]
 gb|ESW24903.1| hypothetical protein PHAVU_004G170500g [Phaseolus vulgaris]
Length=374

 Score =   172 bits (437),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 116/396 (29%), Positives = 194/396 (49%), Gaps = 76/396 (19%)
 Frame = -1

Query  1349  HHSP----SAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
             HH+       P     E +L +PG  +HL+D+  ++EL+ G+ +++ + + +  +A   +
Sbjct  17    HHASFQDLQKPKIPTHELVLQIPGCKVHLVDEGEALELSQGNFTIMRVMEQNVALATVIK  76

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             V   +QWPLTKD   VK+D  HY FS    +                            G
Sbjct  77    VGSSVQWPLTKDEPVVKVDGLHYLFSLPVKD----------------------------G  108

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKS  822
              + L+YG+T   +   N+   +D+ L     FS                        L+ 
Sbjct  109   GEPLSYGVTFPKECYGNM-GMVDSFLKEHCCFS-----------------------GLER  144

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
              KK ++        W   AP VEDY+   AR +A G+G+++KGI  C +   + ++   E
Sbjct  145   SKKSDL-------DWEDFAPRVEDYNHFLARAIAGGTGQIVKGIFMCSNAYTNQVQKEGE  197

Query  641   VLRN-----------RMTSGSKTEVSPET--MKRIRRVKRVTSMTEKVATGVLSGVVKVS  501
              + N           R ++ S+ + +  +   + ++RV+++T+MTEK+   +L GV  +S
Sbjct  198   AILNSAAEKNNGNLVRQSTNSRNDATKNSGMNENLKRVRKLTNMTEKLTKSLLDGVGIMS  257

Query  500   GFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSH  321
             G   + V  S  G+ FL +LPGE++LA+LD  +R+ +A E A K   S +S   T +VS+
Sbjct  258   GSVMTPVLKSQPGQAFLKMLPGEVLLASLDAVNRVFEAAEAAEKQTFSATSKAATRMVSN  317

Query  320   KYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             ++G+EA +AT     +AGHA+ TAW V K+RKA+NP
Sbjct  318   RFGEEAGEATEHVFASAGHAVNTAWNVSKIRKAINP  353



>ref|XP_008354416.1| PREDICTED: uncharacterized protein LOC103418043 isoform X1 [Malus 
domestica]
Length=387

 Score =   171 bits (434),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/387 (29%), Positives = 181/387 (47%), Gaps = 73/387 (19%)
 Frame = -1

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLT  1152
             P    ++  L +PG  ++L+D+  ++ELA+GD  L ++ + +  +A   +V +E+QWPLT
Sbjct  32    PKNIQQQVFLQIPGCRVNLMDEGETLELASGDFVLENILENNVTLATIIKVGEELQWPLT  91

Query  1151  KDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI  972
              D   VKLD  HY FS    +                              D L+YG+T 
Sbjct  92    NDEPVVKLDAXHYLFSLPMKD-----------------------------GDPLSYGVTF  122

Query  971   ASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGR  792
               + +  L   LD+ L     FS                         K+ K K V    
Sbjct  123   PDQCESQL-AFLDSFLMEHXCFSA---------------------TSTKNNKNKGV----  156

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGS  612
                 W   AP +EDY++  A+ +A G+G++++GI  C +   + ++ G E    R   G 
Sbjct  157   ---DWKEYAPRIEDYNNVLAKAIAGGTGQIVRGIFMCSNAYTNQVQKGGEATLARXVEG-  212

Query  611   KTEVSPETM--------------KRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
             K+ V  +                K ++RVK ++  T K++  +L GV   +G     V N
Sbjct  213   KSYVKEQGSSSSKSAAKKKSGINKNLKRVKNLSKXTSKLSKAMLDGVGIATGSVMGPVVN  272

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GK F  L+PG+++LA+LD  ++I DA EVA K  +S +      +VS+++G+ A +A
Sbjct  273   SKAGKXFFALVPGQVLLASLDAINKILDAAEVAEKQALSATKGAAGRIVSNRFGESAGEA  332

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T + +  AGH    AW VFK+RKA+NP
Sbjct  333   TEDVIATAGHCACIAWNVFKIRKAINP  359



>ref|XP_008362960.1| PREDICTED: uncharacterized protein LOC103426655 isoform X1 [Malus 
domestica]
Length=387

 Score =   171 bits (434),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/387 (29%), Positives = 181/387 (47%), Gaps = 73/387 (19%)
 Frame = -1

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLT  1152
             P    ++  L +PG  ++L+D+  ++ELA+GD  L ++ + +  +A   +V +E+QWPLT
Sbjct  32    PKNIQQQVFLQIPGCRVNLMDEGETLELASGDFVLENILENNVTLATIIKVGEELQWPLT  91

Query  1151  KDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI  972
              D   VKLD  HY FS    +                              D L+YG+T 
Sbjct  92    NDEPVVKLDAXHYLFSLPMKD-----------------------------GDPLSYGVTF  122

Query  971   ASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGR  792
               + +  L   LD+ L     FS                         K+ K K V    
Sbjct  123   PDQCESQL-AFLDSFLMEHXCFSA---------------------TSTKNNKNKGV----  156

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGS  612
                 W   AP +EDY++  A+ +A G+G++++GI  C +   + ++ G E    R   G 
Sbjct  157   ---DWKEYAPRIEDYNNVLAKAIAGGTGQIVRGIFMCSNAYTNQVQKGGEATLARXVEG-  212

Query  611   KTEVSPETM--------------KRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVAN  474
             K+ V  +                K ++RVK ++  T K++  +L GV   +G     V N
Sbjct  213   KSYVKEQGSSSSKSAAKKKSGINKNLKRVKNLSKXTSKLSKAMLDGVGIATGSVMGPVVN  272

Query  473   SSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKA  294
             S  GK F  L+PG+++LA+LD  ++I DA EVA K  +S +      +VS+++G+ A +A
Sbjct  273   SKAGKXFFALVPGQVLLASLDAINKILDAAEVAEKQALSATKGAAGRIVSNRFGESAGEA  332

Query  293   TSEGLEAAGHAMATAWTVFKLRKALNP  213
             T + +  AGH    AW VFK+RKA+NP
Sbjct  333   TEDVIATAGHCACIAWNVFKIRKAINP  359



>gb|KDO68030.1| hypothetical protein CISIN_1g0104971mg, partial [Citrus sinensis]
Length=148

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -1

Query  569  VKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICD  390
            VK++T M+EKVATG+LSGVVKVSGFFT  + NS VGKKF  LLPGE+VLATLDGF+++CD
Sbjct  1    VKKLTKMSEKVATGILSGVVKVSGFFTGPIVNSKVGKKFFSLLPGEIVLATLDGFNKVCD  60

Query  389  AVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
            AVEVAG+NVMST+S VTTGLVS +YG++AAKAT+EGL+AAGHA  TAW VFK+R+A NP
Sbjct  61   AVEVAGRNVMSTTSVVTTGLVSDRYGEQAAKATNEGLDAAGHAFGTAWAVFKIRQAFNP  119



>ref|XP_003630712.1| hypothetical protein MTR_8g102510 [Medicago truncatula]
 gb|AET05188.1| senescence/dehydration-associated-like protein [Medicago truncatula]
Length=375

 Score =   171 bits (432),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 124/412 (30%), Positives = 197/412 (48%), Gaps = 80/412 (19%)
 Frame = -1

Query  1406  MKDVENLFPENYETVQGYYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSL  1227
             M+ +E   P +  T++ Y  H         +E L+ +P   +HL+D+  + ELA G   +
Sbjct  11    MQPMETSIPRS-STIEDYAGHK-----NLRQEVLIQIPRCKVHLMDEGEAFELAQGHFMV  64

Query  1226  VSLRQGDSNVAVFARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeeksk  1047
             +   + + ++A   +V +++QWPLTKD   VKLD  HY FS    +              
Sbjct  65    IKTLEENVSLATVIKVEEDLQWPLTKDEPVVKLDALHYLFSLPVKD--------------  110

Query  1046  gkkegkhkekqkDMGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVM  867
                             + L+YGLT +     +L   LD+ L   S FS            
Sbjct  111   ---------------GEPLSYGLTFSEDSYGSL-SLLDSFLKEHSCFS------------  142

Query  866   GGPVAKEVSPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGIL  687
                         LK   K ++        W   AP VEDY+   ++L+A G+G+++KGI 
Sbjct  143   -----------GLKLSNKNDL-------DWKEFAPRVEDYNHFLSKLIAGGTGQIVKGIF  184

Query  686   WCGDVTVDSLKSGDEVLRNRMTSGSKTEVSPET--------------MKRIRRVKRVTSM  549
              C +   + ++ G E++ N         V+ E+               K ++RV++++ M
Sbjct  185   ICSNAYTNKVQKGGEMILNSHADKKNGVVAWESKSNKNVGASKKNKINKNLKRVRKLSKM  244

Query  548   TEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGK  369
             TEK++  +LSGV  VSG     +  S  GK FL +LPGE++LA+LD  +++ DA E A K
Sbjct  245   TEKLSKSLLSGVGIVSGTVIGPLVKSQPGKAFLRMLPGEVLLASLDAVNKVLDAAEAAEK  304

Query  368   NvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
               +S +S   + +VS+++GD A +AT      AGHA  TAW VFK+RKA+NP
Sbjct  305   QTLSATSKAASRMVSNRFGDNAGEATEHVFATAGHAANTAWNVFKIRKAINP  356



>gb|EMT31095.1| hypothetical protein F775_29680 [Aegilops tauschii]
Length=216

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 125/200 (63%), Gaps = 13/200 (7%)
 Frame = -1

Query  1169  IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVL  990
             +QWPL  D+A VKLD  HYFFS   P+ D   D  D+                      L
Sbjct  16    VQWPLASDVAVVKLDAGHYFFSLHVPHSDHPDDKEDDVAETDADREA-----------AL  64

Query  989   NYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKK  810
             +YGLT+A KGQ+ ++++LD +L   ++FSV +V++ A  VM      E++P +   +KK+
Sbjct  65    SYGLTVAGKGQEQVLEELDRVLKEYTTFSVKQVDDEAGEVMDTRAVSEITPEEAAGDKKE  124

Query  809   EVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRN  630
             E+ E + AA+WTT+APNV+DYSSS ARL+A GSG+L++GI+WCGD+T   LK G+ VL+ 
Sbjct  125   EI-EEQSAAFWTTIAPNVDDYSSSVARLIAKGSGQLVRGIIWCGDITASGLKCGEAVLKK  183

Query  629   RM-TSGSKTEVSPETMKRIR  573
                 +G  T+V P ++KR++
Sbjct  184   GAGANGKHTQVKPSSLKRMK  203



>ref|XP_006475565.1| PREDICTED: uncharacterized protein LOC102624599 [Citrus sinensis]
 gb|KDO66569.1| hypothetical protein CISIN_1g017609mg [Citrus sinensis]
Length=368

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/398 (30%), Positives = 192/398 (48%), Gaps = 84/398 (21%)
 Frame = -1

Query  1343  SPSAPPEAV--EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADE  1170
             SPS P      +E LL +PG  +HL+D+  ++ELA G+ +LV +   + ++A   +V D+
Sbjct  20    SPSNPESRTLKQEVLLRIPGCTVHLMDEGEAIELAKGEFTLVRIFDENVSLATIIKVGDD  79

Query  1169  IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVL  990
             +QWPLTKD   VKLD  HY FS    +                             ++ L
Sbjct  80    LQWPLTKDEPVVKLDVLHYLFSLPMKD-----------------------------DEPL  110

Query  989   NYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKK  810
             +YG+T  S+   + +  LD+ L   S FS            G   +   +  D       
Sbjct  111   SYGVTF-SEAYGSSLGLLDSFLREHSCFS------------GAATSTRKNDID-------  150

Query  809   EVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL--  636
                       W   AP +++Y++  A+ +A G+G++IKGI  C +   + +  G E++  
Sbjct  151   ----------WKEFAPKIDNYNNVLAKAIAGGTGQIIKGIFKCSNAYTNQVHKGGEMILT  200

Query  635   ----------------RNRMT-SGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVK  507
                              NR   SG K++V+    K ++RV++++ MT K++  +L  V  
Sbjct  201   QAAEEKKCVTARESNNNNRSDGSGKKSQVN----KSLKRVRKLSKMTNKLSKSMLDVVGV  256

Query  506   VSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglv  327
              +G   + +  S  GK F  + PGE++LA+LD  +++ DA E A K  +S +S   T  V
Sbjct  257   ATGSVMAPLVKSQAGKTFFSMAPGEVLLASLDAVNKVLDAAEAAEKQALSATSKAATRAV  316

Query  326   SHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             S ++G+ A +AT + L  AGH  +TAW V K+RKALNP
Sbjct  317   SERFGESAGEATGDVLATAGHCASTAWNVLKIRKALNP  354



>ref|XP_006451292.1| hypothetical protein CICLE_v10008680mg [Citrus clementina]
 gb|ESR64532.1| hypothetical protein CICLE_v10008680mg [Citrus clementina]
Length=373

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/398 (30%), Positives = 192/398 (48%), Gaps = 84/398 (21%)
 Frame = -1

Query  1343  SPSAPPEAV--EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADE  1170
             SPS P      +E LL +PG  +HL+D+  ++ELA G+ +LV +   + ++A   +V D+
Sbjct  20    SPSNPESRTLKQEVLLRIPGCTVHLMDEGEAIELAKGEFTLVRIFDENVSLATIIKVGDD  79

Query  1169  IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVL  990
             +QWPLTKD   VKLD  HY FS    +                             ++ L
Sbjct  80    LQWPLTKDEPVVKLDVLHYLFSLPIKD-----------------------------DEPL  110

Query  989   NYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKK  810
             +YG+T  S+   + +  LD+ L   S FS            G   +   +  D       
Sbjct  111   SYGVTF-SEAYGSSLGLLDSFLREHSCFS------------GAATSTRKNDID-------  150

Query  809   EVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL--  636
                       W   AP +++Y++  A+ +A G+G++IKGI  C +   + +  G E++  
Sbjct  151   ----------WKEFAPKIDNYNNVLAKAIAGGTGQIIKGIFKCSNAYTNQVHKGGEMILT  200

Query  635   ----------------RNRMT-SGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVK  507
                              NR   SG K++V+    K ++RV++++ MT K++  +L  V  
Sbjct  201   QAAEEKKCVTARESNNNNRSDGSGKKSQVN----KSLKRVRKLSKMTNKLSKSMLDVVGV  256

Query  506   VSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglv  327
              +G   + +  S  GK F  + PGE++LA+LD  +++ DA E A K  +S +S   T  V
Sbjct  257   ATGSVMAPLVKSQAGKTFFSMAPGEVLLASLDAVNKVLDAAEAAEKQALSATSRAATRAV  316

Query  326   SHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             S ++G+ A +AT + L  AGH  +TAW V K+RKALNP
Sbjct  317   SERFGESAGEATGDVLATAGHCASTAWNVLKIRKALNP  354



>ref|XP_004287472.1| PREDICTED: uncharacterized protein LOC101295447 [Fragaria vesca 
subsp. vesca]
Length=382

 Score =   168 bits (426),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/392 (29%), Positives = 190/392 (48%), Gaps = 70/392 (18%)
 Frame = -1

Query  1352  YHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVAD  1173
             Y   PS   +  ++ LL +PG  +H++++  ++ELA G+  L ++   + ++A   +V +
Sbjct  32    YQEPPSKNIQ--QQILLQIPGCRVHIMEEGEALELAVGEFILENIFDENISLATIIKVGE  89

Query  1172  EIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDV  993
             E+QWPLTKD   VK+D+ +Y FS    +                              D 
Sbjct  90    ELQWPLTKDEPVVKIDDLNYLFSIPMRD-----------------------------GDP  120

Query  992   LNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKK  813
             L+YG+T   +   +L   LD+ L   S F++                K +   D      
Sbjct  121   LSYGVTFPEQYASHL-GFLDSFLKEYSCFTI---------TSNSSATKNIKGVD------  164

Query  812   KEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR  633
                        W   AP +EDY++  A+ +A G+G++++GI  C +   + L  G E   
Sbjct  165   -----------WKEYAPRIEDYNNVLAKAIAGGTGQIVRGIFMCSNAYANQLHKGGETTL  213

Query  632   NR----------MTSGSKTEVSPET--MKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFT  489
              R           + G  +  + ++   K ++R +R++ MT K++  +L GV  V+G   
Sbjct  214   ARPVEEKRYAKQESHGKHSNATNKSGMNKSLKRARRLSKMTSKLSKSMLDGVGLVTGSVM  273

Query  488   SSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGD  309
             + V  S  GK FL ++PG+++LA+LD  ++I DA EVA +  +S +S  TT +VS++YG+
Sbjct  274   TPVVKSQAGKAFLNMVPGQVLLASLDAINKILDAAEVAEQQALSATSAATTRMVSNRYGE  333

Query  308   EAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
              A +AT       GH   TAW +FK+RKA+NP
Sbjct  334   SAGEATEHAFATVGHCANTAWNIFKIRKAINP  365



>ref|XP_003524406.2| PREDICTED: uncharacterized protein LOC100792180 [Glycine max]
 gb|KHN41672.1| hypothetical protein glysoja_036416 [Glycine soja]
Length=374

 Score =   168 bits (425),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 188/385 (49%), Gaps = 80/385 (21%)
 Frame = -1

Query  1316  EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLAS  1137
             +E L+ +P   +HL+D   ++ELA G   ++   + + ++A   +V D++QWPLTKD   
Sbjct  33    QEVLIQIPACKVHLMDGGEALELAQGHFMIIKTFEENVSLATIIKVGDDLQWPLTKDEPV  92

Query  1136  VKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI--ASK  963
             VKLD+ HY FS    +                              + L+YG+T   AS 
Sbjct  93    VKLDSLHYLFSLLVKD-----------------------------GEPLSYGVTFSEASL  123

Query  962   GQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAA  783
             G  +L   LD  L + S FS                        L   KK  +       
Sbjct  124   GSLSL---LDMFLKDQSCFS-----------------------GLNLSKKNNL-------  150

Query  782   YWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTE  603
              W   AP V+DY+   A+ +A G+G+++KGI  C +   + ++ G E + N  ++G KT 
Sbjct  151   DWREFAPKVDDYNHFLAKAIAGGTGQIVKGIFICSNAYTNKVQKGGETILNS-SAGEKTG  209

Query  602   V-SPETMKR--------------IRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
             V + E+M                ++RV++++ MTEK++  +L+GV  VSG   + V  S 
Sbjct  210   VVARESMSNKTASASKKNKINKNLKRVRKLSKMTEKLSKSLLNGVGIVSGSVMAPVVKSQ  269

Query  467   VGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATS  288
              GK FL +LPGE++LA+LD  +++ DA E A K  +S +S   +  VS+++G+ A + T 
Sbjct  270   PGKAFLRMLPGEVLLASLDAVNKVLDAAEAAEKQTLSATSKAASRAVSNRFGESAGEGTE  329

Query  287   EGLEAAGHAMATAWTVFKLRKALNP  213
                  AGHA  TAW VFK+RKA  P
Sbjct  330   HVFATAGHAANTAWNVFKIRKAFTP  354



>ref|XP_004135671.1| PREDICTED: uncharacterized protein LOC101220646 [Cucumis sativus]
 ref|XP_004157282.1| PREDICTED: uncharacterized protein LOC101226428 [Cucumis sativus]
 gb|KGN66173.1| hypothetical protein Csa_1G574900 [Cucumis sativus]
Length=376

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 190/384 (49%), Gaps = 66/384 (17%)
 Frame = -1

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLT  1152
             P +  +E LL + G  +HL+D   ++ELA G+  L  + + + ++A   +V D++QWPLT
Sbjct  30    PEQLKQEILLQIQGCRVHLMDGGEALELANGEFKLERILENEVSLATIVKVGDDLQWPLT  89

Query  1151  KDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI  972
             KD   VKL++ +Y FS    +                              D L+YG+T 
Sbjct  90    KDEPVVKLNSLNYLFSLPMRD-----------------------------GDPLSYGVTF  120

Query  971   ASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGR  792
               +   +L   LD+ L + S FS                      + L +   K ++   
Sbjct  121   LEQNSSSL-NWLDSFLKDNSCFSSSS-------------------SSLCNANNKSMIN--  158

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR---MT  621
                 W   AP ++DY++  A+ +A G+G++++GI  C +   + +  G E++ N    + 
Sbjct  159   ----WKEYAPKIDDYNNILAKAIAEGTGQIVQGIFKCSNSYANQVNKGGEMILNSPPPVA  214

Query  620   SGSKTEVSPETMKR--------IRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSV  465
             S  ++  SP   K         ++RV+++T MTEK++  +L  V   SG     V  S  
Sbjct  215   SVERSVSSPSATKNNKTSINQSLKRVRKMTKMTEKLSKSMLDMVGVASGSVMGPVMKSQA  274

Query  464   GKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSE  285
             G+ F  ++PG+++LA+LD  ++I DA E A K  +  ++  TT +VS+K+G+ A +AT +
Sbjct  275   GRAFFAMVPGQVLLASLDAVNKIMDAAEAAEKQALLATTQATTRMVSNKFGESAGEATGD  334

Query  284   GLEAAGHAMATAWTVFKLRKALNP  213
              L  AGH   TAW VFK+RKA+NP
Sbjct  335   VLATAGHCANTAWNVFKIRKAINP  358



>dbj|BAJ98033.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85676.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=375

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 186/386 (48%), Gaps = 69/386 (18%)
 Frame = -1

Query  1316  EETLLIVPGAILHLI--DKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDL  1143
             EETLL VPGA +HL+    +  +EL+ GDLS+V + + D  V    RV  ++ WPL +D 
Sbjct  24    EETLLRVPGAAVHLVAGGSEGPLELSRGDLSVVRIFKDDVAVTTVVRVGRDLGWPLARDE  83

Query  1142  ASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASK  963
               VKLD  HY F+   P+ D                             +LNYG++ A  
Sbjct  84    PVVKLDRLHYLFTL--PDKD---------------------------GALLNYGVSFADA  114

Query  962   GQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAA  783
                 L+   D +L + S FS   V    S       A     AD                
Sbjct  115   ---TLLPSFDALLKSTSCFSTPSVPSRGSRPPPPASAS----AD---------------G  152

Query  782   YWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK--  609
             YW + +P VE Y+   A+ + +G+G L+KGI  C +     ++ G  ++  +   G+   
Sbjct  153   YWNSFSPRVEGYNGVLAKAIGAGTGHLVKGIFMCSEAYASQVQKGANLMSPQAAGGASKR  212

Query  608   ----------TEVSP----ETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
                       ++  P       K ++RV++++ MTEK++  +L  V+ V+G   + +  S
Sbjct  213   FGGTGGADGSSQTGPVKRGGVNKSLKRVRKLSEMTEKMSKTMLDTVISVTGSMAAPLLRS  272

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKAT  291
             + GK  L  +PGE+VLA+LD  +++ DAVE A +  ++ +S V +G VS +YG+ A +AT
Sbjct  273   NQGKALLATVPGEVVLASLDAINKVMDAVEAAERRSLAATSNVVSGAVSKRYGESAGEAT  332

Query  290   SEGLEAAGHAMATAWTVFKLRKALNP  213
              +     GH + TAW +FK+RKA+ P
Sbjct  333   GDAFATVGHTVGTAWNIFKIRKAVTP  358



>ref|XP_008450779.1| PREDICTED: uncharacterized protein LOC103492259 [Cucumis melo]
Length=370

 Score =   165 bits (418),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 111/378 (29%), Positives = 186/378 (49%), Gaps = 60/378 (16%)
 Frame = -1

Query  1331  PPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLT  1152
             P +  +E LL + G  +HL+D   ++ELA G+  L  + + + ++A   +V D++QWPLT
Sbjct  30    PQKLKQEVLLQIQGCRVHLMDGGEALELANGEFKLERILEDEVSLATIVKVGDDLQWPLT  89

Query  1151  KDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTI  972
             KD   VKL++ +Y FS    +                              D L+YG+T 
Sbjct  90    KDEPVVKLNSLNYLFSLPMKD-----------------------------GDPLSYGVTF  120

Query  971   ASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGR  792
               +   +L   LD+ L + S FS       A                            +
Sbjct  121   LEQNSSSL-NLLDSFLKDNSCFSSSSSSCNAP-------------------------NNK  154

Query  791   CAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR--MTS  618
                 W   AP ++DY++  A+ +A G+G++++GI  C +   + +  G E++ N   + S
Sbjct  155   SMINWKEYAPKIDDYNNILAKAIAEGTGQIVQGIFKCSNSYANQVNKGGEMILNSPPVAS  214

Query  617   GSKTEVSPETMK---RIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLG  447
               ++  SP   K    ++RV++++ MTEK++  +L  V   SG     V  S  G+ F  
Sbjct  215   VQRSGSSPSATKINKSLKRVRKMSKMTEKLSKSMLDMVGVASGSMMGPVMKSQAGRAFFA  274

Query  446   LLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAG  267
             ++PG+++LA+LD  ++I DA E A K  +  ++  TT +VS+K+G+ A +AT + L  AG
Sbjct  275   MVPGQVLLASLDAVNKIMDAAEAAEKQALMATTQATTRMVSNKFGESAGEATGDVLATAG  334

Query  266   HAMATAWTVFKLRKALNP  213
             H   TAW VFK+RKA+NP
Sbjct  335   HCANTAWNVFKIRKAINP  352



>gb|KEH27196.1| senescence/dehydration-associated-like protein [Medicago truncatula]
Length=374

 Score =   164 bits (415),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 113/394 (29%), Positives = 196/394 (50%), Gaps = 74/394 (19%)
 Frame = -1

Query  1346  HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEI  1167
             +S + P    +E L+ +PG  ++L+D+  + EL  G   ++ +   + ++A   ++ + +
Sbjct  22    NSSTKPKTLRQEILIQIPGCRVYLMDEGEAHELTQGQFMIIKIVDENVSLATIIKIGNNV  81

Query  1166  QWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLN  987
             Q+PLTKD   VK+D+ HY FS    +                            G++ L+
Sbjct  82    QFPLTKDEPVVKVDSLHYLFSLPVKD----------------------------GHEPLS  113

Query  986   YGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKE  807
             YG+T   +   ++   +++ L   S FS                       DLK  KKK 
Sbjct  114   YGVTFPHEFSGSMAL-VESFLKEHSCFS-----------------------DLKLSKKKS  149

Query  806   VLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRN-  630
              L+      W   AP VE+Y+   A+ +A G+G+++KGI  C +   + ++ G + + N 
Sbjct  150   DLD------WEEFAPCVENYNHFLAKAIAGGTGQIVKGIFMCSNAYTNQVQKGGQTILNS  203

Query  629   ------------RMTSGSKTEVSPETMK---RIRRVKRVTSMTEKVATGVLSGVVKVSGF  495
                         + +  +KT  + +  +    + RV+++T+MTE ++  +L+GV  VSG 
Sbjct  204   PSDKKNGGNGMVKESMNNKTAAATKNNRMNENLIRVRKLTNMTEHLSKSLLNGVGIVSGS  263

Query  494   FTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKY  315
               + V  S  G+ FL +LPGE++LA+LD  +++ +A E A K  +S +S   T +VS++Y
Sbjct  264   LMAPVLKSQPGQAFLKMLPGEVLLASLDAVNKVFEAAEAAEKQTLSATSQAATRMVSNRY  323

Query  314   GDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             G+EA +AT      AGHA  TAW V K+RKA+NP
Sbjct  324   GEEAGEATEHVFATAGHAANTAWNVSKIRKAINP  357



>gb|KHG10562.1| Spartin [Gossypium arboreum]
Length=353

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 193/386 (50%), Gaps = 67/386 (17%)
 Frame = -1

Query  1343  SPSAPPEAVEETLLI-VPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEI  1167
             +P  P + +++ LL+ +P   +HL+D   ++EL  G+  LV +   D  +A   +V D++
Sbjct  5     APQPPTKTLKQELLLKIPRCTVHLMDDGDALELGKGEFKLVRVLDDDFPLATIIKVTDDL  64

Query  1166  QWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLN  987
             QWPLTKD   VKLD+ HY FS    +                                L+
Sbjct  65    QWPLTKDEPVVKLDSVHYLFSLPVKD-----------------------------GKPLS  95

Query  986   YGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKE  807
             YG+T   +G  N +  LD++L   S F+                      A + S   K 
Sbjct  96    YGVTFVGRGHGNSLSSLDSLLKEHSCFA----------------------AGVGSTGDKH  133

Query  806   VLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR  627
             V        W   AP +EDY++  A+ +A G+G+++KGI  C +  +  ++ G E +  +
Sbjct  134   V-------DWKAYAPRIEDYNNVLAKAIAGGTGQIVKGIFTCSNAYISQVQKGGETILRQ  186

Query  626   --------MTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANS  471
                     ++S S    S      ++RV+ ++ MTEK++  +L  V   SG   + + +S
Sbjct  187   PPGKTHGIISSKSNKSKSEANNNNLKRVRNLSIMTEKMSKTMLDMVGIASGTVMAPLLSS  246

Query  470   SVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKAT  291
               G+ FL +LPG+++LA+LD  +++ DAVEVA K  +S +ST  T +++ +YG+ A +AT
Sbjct  247   KPGQAFLSMLPGQVLLASLDAVNKVLDAVEVAEKQALSATSTAATRMMTDRYGERAGEAT  306

Query  290   SEGLEAAGHAMATAWTVFKLRKALNP  213
              + L  AG+  +TAW VFK+RKA+ P
Sbjct  307   EDVLATAGNLASTAWNVFKIRKAITP  332



>ref|XP_007013036.1| Senescence/dehydration-associated protein-related isoform 1 [Theobroma 
cacao]
 gb|EOY30655.1| Senescence/dehydration-associated protein-related isoform 1 [Theobroma 
cacao]
Length=371

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 114/379 (30%), Positives = 186/379 (49%), Gaps = 74/379 (20%)
 Frame = -1

Query  1313  ETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASV  1134
             E LL + G  +HL+D+  ++ELA G  +LV +      +A   +V +++QWPLTKD   V
Sbjct  35    EVLLQIAGCTVHLMDEGEALELAKGVFTLVRILDEGVPLATIVKVGEDLQWPLTKDEPVV  94

Query  1133  KLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQD  954
             KLD+ HY FS    +                            GN  L+YG+T + +   
Sbjct  95    KLDSFHYLFSLPMKD----------------------------GNP-LSYGVTFSGQYGS  125

Query  953   NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWT  774
             +L   LD+ L + S FS                          S   K V        W 
Sbjct  126   SL---LDSFLKDHSCFS-----------------------GAASTGDKHV-------DWK  152

Query  773   TLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNR-------MTSG  615
               AP +EDY++  A+ +A G+G+++KGI  C +     ++ G E++  +       +T+ 
Sbjct  153   VYAPRIEDYNNFLAKAIAGGTGQIVKGIFICTNAYTSQVQKGGEIILTQAPAENKGITAS  212

Query  614   SKTEVSPETMKR-----IRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFL  450
             +    S  T K      ++RV++++ MTEK++  +L  V   SG   + + NS  GK  L
Sbjct  213   NGYRNSGATRKSGANKSLKRVRKLSKMTEKMSKAMLDMVGVASGTVMAPLVNSKPGKALL  272

Query  449   GLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAA  270
              ++PGE++LA+LD  +++ DA EVA K   S +ST  T +++ ++G+ A +AT + L  A
Sbjct  273   SMVPGEVLLASLDAVNKVLDAAEVAEKQAFSATSTAATRVMTERFGERAGEATEDVLATA  332

Query  269   GHAMATAWTVFKLRKALNP  213
             GH  + AW +FK+RKA+ P
Sbjct  333   GHCASAAWNIFKIRKAITP  351



>gb|EMS55362.1| hypothetical protein TRIUR3_02144 [Triticum urartu]
Length=213

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 126/184 (68%), Gaps = 30/184 (16%)
 Frame = -1

Query  674  VTVDSLKSGDEVLRNRMTSG-SKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSG  498
            +TVD L+ G EVLR R+  G ++ EVSPE ++RI+R K+VT M+EKVATG+LSGVVK++ 
Sbjct  1    MTVDRLRWGQEVLRKRIQPGDTEAEVSPEMLRRIKRAKKVTKMSEKVATGILSGVVKLTS  60

Query  497  FFTSSVANSSVGKKFLGLLPGEM-----------------------------VLATLDGF  405
              TSS+ NS  GKKF  LLPGE+                             +  +L   
Sbjct  61   SVTSSLVNSKAGKKFFSLLPGELYGISVCLNIILENNRGTYFLLVFDYASPLMYISLVST  120

Query  404  SRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRK  225
             +I DAVEVAGK+V+STSSTVTTGLVSHKYG++AA AT+EGL+AAGHA+ TAW VFKLR+
Sbjct  121  GKISDAVEVAGKDVLSTSSTVTTGLVSHKYGEKAAAATNEGLDAAGHAIGTAWAVFKLRQ  180

Query  224  ALNP  213
            ALNP
Sbjct  181  ALNP  184



>gb|EPS67503.1| hypothetical protein M569_07274, partial [Genlisea aurea]
Length=329

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 115/374 (31%), Positives = 175/374 (47%), Gaps = 67/374 (18%)
 Frame = -1

Query  1313  ETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLASV  1134
             E LL +P   +HL+ +  ++ LATGD  L+ + + +  +A+  RV DEI+WPLTKD   V
Sbjct  2     EILLRIPDCRVHLVTEGEALPLATGDFELLRVSEENVALAILIRVGDEIRWPLTKDEPVV  61

Query  1133  KLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQD  954
             KLD S+Y FS    +                            GN +  Y ++    G  
Sbjct  62    KLDASNYLFSLPIGD----------------------------GNPI-TYAVSF---GSI  89

Query  953   NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYWT  774
               +  LD+ L   S F+              P  KE S  D                 W 
Sbjct  90    ESLGSLDSFLSENSLFNSR-----------CPAQKEGSVID-----------------WK  121

Query  773   TLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVL-------RNRMTSG  615
               AP ++DY++   + +A G+G+++KG+  C +   + +K G E             T+ 
Sbjct  122   EFAPAIDDYNTFLGKAVAKGTGQIVKGVFRCSNAYANQVKRGSEKFLGVPPAAPPPKTTA  181

Query  614   SKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGKKFLGLLPG  435
              K   +    K I+R + V+ ++ K++      V   +G   + +A S+VGK  L  LPG
Sbjct  182   DKKSKASAINKTIKRARAVSKLSHKISGTAFRFVGIATGSVVTPIARSTVGKTVLSALPG  241

Query  434   EMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGLEAAGHAMA  255
             E+ LA+LD  ++I DAVE AGK  M  SS   T +VS+K G+ A +AT + L   G+ + 
Sbjct  242   EVALASLDSLNKILDAVEAAGKQAMEGSSEAVTRIVSNKLGESAGEATEDALATTGNCLG  301

Query  254   TAWTVFKLRKALNP  213
             T W VFK+RKALNP
Sbjct  302   TVWNVFKIRKALNP  315



>ref|XP_007160288.1| hypothetical protein PHAVU_002G308900g [Phaseolus vulgaris]
 gb|ESW32282.1| hypothetical protein PHAVU_002G308900g [Phaseolus vulgaris]
Length=417

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 114/382 (30%), Positives = 181/382 (47%), Gaps = 74/382 (19%)
 Frame = -1

Query  1316  EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLAS  1137
             +E L+ VP   +HL+D+  ++ELA G   +V   + + ++A   +V  ++QWPLTKD   
Sbjct  77    QEVLIQVPACKVHLMDEGEALELAQGHFMIVKNFEENVSLATVIKVGHDLQWPLTKDEPV  136

Query  1136  VKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKGQ  957
             VKLD  HY FS    +                              + L+YG+T +    
Sbjct  137   VKLDALHYLFSLVVKD-----------------------------GEPLSYGVTFSETTL  167

Query  956   DNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAYW  777
              +L   LD+ L + S FS             G      +  D                 W
Sbjct  168   GSL-SLLDSFLKDHSCFS-------------GLNLNNKNNLD-----------------W  196

Query  776   TTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSKTEVS  597
                AP V++Y+   A+++A G+G+++KGI  C +   + ++ G E + N         V 
Sbjct  197   REFAPKVDNYNHFLAKVIAGGTGQIVKGIFICSNAYTNKVQKGGETILNSSADEKNGVVV  256

Query  596   PETMKR--------------IRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSSVGK  459
              E+M                ++RV++++ MTEK++  +L+GV  VSG   + V  S  GK
Sbjct  257   RESMNNKTISASKKNKINKNLKRVRKLSKMTEKLSKSLLNGVGIVSGSVMAPVLKSQPGK  316

Query  458   KFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATSEGL  279
              FL +LPGE++LA+LD  +++ DA E A K  +S +S   +  VS+++G+ A +AT    
Sbjct  317   AFLKMLPGEVLLASLDAVNKVLDAAEAAEKQTLSATSKAASRAVSNRFGESAGEATEHVF  376

Query  278   EAAGHAMATAWTVFKLRKALNP  213
               AGHA  TAW VFK+RKA  P
Sbjct  377   ATAGHAANTAWNVFKIRKAFTP  398



>gb|ACZ74699.1| hypothetical protein [Phaseolus vulgaris]
Length=361

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/394 (29%), Positives = 183/394 (46%), Gaps = 77/394 (20%)
 Frame = -1

Query  1358  GYYH-HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
             G+ H   P  P    ++ LL +PG  LHL+++  +++LA G  ++  +   +  +A   +
Sbjct  10    GFQHLQKPKTP---TQQLLLQIPGCKLHLMEQGEALQLAQGHFTITRVMDQNVALATVVK  66

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             V   +QWPLTKD   VK+D  HY FS                                 G
Sbjct  67    VGSSVQWPLTKDEPVVKVDALHYLFSLPVKK----------------------------G  98

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKS  822
              + L+YG+T   +   N+   LD+ L     FS                        L+ 
Sbjct  99    GEPLSYGVTFPEECDGNM-GMLDSFLKEHCCFS-----------------------GLER  134

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
              KK ++        W   AP VEDY+   AR +A G+G+++KGI  C +   + ++ G E
Sbjct  135   SKKSDL-------DWEDFAPRVEDYNHFIARAIAGGTGQIVKGIFICSNAYTNQIQKGGE  187

Query  641   VLRN-----------RMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGF  495
              + N                +K     E +KR+R++   T+MTEK+   +  GV  +SG 
Sbjct  188   AILNSAAEKNNANMNNRNDATKNSGMNENLKRVRKL---TNMTEKLTNSLHDGVGTMSGS  244

Query  494   FTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKY  315
               + V  S  G+ FL +LPGE++LA+LD  +R+ +A E A K   S +S   T +VS+++
Sbjct  245   VMARVIKSQPGQTFLKMLPGEVLLASLDAVNRVFEAAEAAEKQTFSATSKAATRMVSNRF  304

Query  314   GDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             G+EA +AT   L +AG A+ TA  V K+ K +NP
Sbjct  305   GEEAGEATEHVLASAGQAVNTARNVSKIWKVINP  338



>emb|CDM84159.1| unnamed protein product [Triticum aestivum]
Length=374

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 183/385 (48%), Gaps = 68/385 (18%)
 Frame = -1

Query  1316  EETLLIVPGAILHLI-DKQYSVELATGDLSLVSLRQGDSNVAVFARVADEIQWPLTKDLA  1140
             EETLL VPGA +HL+   +  +EL  G+LS+V + + D  V    RV  E+ WPL +D  
Sbjct  24    EETLLRVPGASVHLVAGSEGPLELGRGELSVVRIFKDDVAVTTVVRVGRELGWPLARDEP  83

Query  1139  SVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVLNYGLTIASKG  960
              VKLD  HY F+   P+ D                             +LNYG++ A   
Sbjct  84    VVKLDRLHYLFTL--PDKD---------------------------GGLLNYGVSFADA-  113

Query  959   QDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKKEVLEGRCAAY  780
                L+   D +L + S FS                      A  +  +          AY
Sbjct  114   --TLLPSFDALLKSNSCFSTPS-------------------APSRGSRPPPPASASPDAY  152

Query  779   WTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLRNRMTSGSK---  609
             W   +P V  Y++  A+ + +G+G L+KGI  C +     ++ G  ++  +   G+    
Sbjct  153   WNDFSPKVGSYNNVLAKAIGAGTGHLVKGIFMCSEAYASQVQKGANLISPQAAGGASKRF  212

Query  608   ---------TEVSPETM----KRIRRVKRVTSMTEKVATGVLSGVVKVSGFFTSSVANSS  468
                      ++  P       K ++RV++++ MTEK++  +L  V+ V+G   + +  S+
Sbjct  213   GGAGGADGSSQAGPAKRGGVNKSLKRVRKMSEMTEKMSKTMLDTVISVTGSMAAPLLRSN  272

Query  467   VGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYGDEAAKATS  288
              GK  L  +PGE+V+A+LD  +++ DAVE A +  ++ +S V +G VS +YG+ A +AT 
Sbjct  273   QGKALLSTVPGEVVIASLDAINKVMDAVEAAERRSLAATSNVVSGAVSKRYGESAGEATG  332

Query  287   EGLEAAGHAMATAWTVFKLRKALNP  213
             +     GH + TAW +FK+RKA+ P
Sbjct  333   DAFATVGHTVGTAWNIFKIRKAVTP  357



>ref|XP_007151050.1| hypothetical protein PHAVU_004G014300g [Phaseolus vulgaris]
 gb|ESW23044.1| hypothetical protein PHAVU_004G014300g [Phaseolus vulgaris]
Length=361

 Score =   159 bits (402),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/394 (29%), Positives = 182/394 (46%), Gaps = 77/394 (20%)
 Frame = -1

Query  1358  GYYH-HSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFAR  1182
             G+ H   P  P    ++ LL +PG  LHL+++  +++LA G  ++  +   +  +A   +
Sbjct  10    GFQHLQKPKTP---TQQLLLQIPGCKLHLMEQGEALQLAQGHFTITRVMDQNVALATVIK  66

Query  1181  VADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMG  1002
             V   +QWPLTKD   VK+D  HY FS                                 G
Sbjct  67    VGSSVQWPLTKDEPVVKVDALHYLFSLPVKK----------------------------G  98

Query  1001  NDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKS  822
              + L+YG+T   +   N+   LD+ L     FS                        L+ 
Sbjct  99    GEPLSYGVTFPEECDGNM-GMLDSFLKEHCCFS-----------------------GLER  134

Query  821   EKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDE  642
              KK ++        W   AP VEDY+   AR +A G+G+++KGI  C +   + ++ G E
Sbjct  135   SKKSDL-------DWEDFAPRVEDYNHFIARAIAGGTGQIVKGIFICSNAYTNQIQKGGE  187

Query  641   VLRN-----------RMTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGVLSGVVKVSGF  495
              + N                +K     E +KR+R++   T+MTEK+   +  GV  +SG 
Sbjct  188   AILNSAAEKNNANMNNRNDATKNSGMNENLKRVRKL---TNMTEKLTNSLHDGVGTMSGS  244

Query  494   FTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKY  315
               + V  S  G+ FL +LPGE++LA+LD  +R+ +A E A K     +S   T +VS+++
Sbjct  245   VMARVIKSQPGQTFLKMLPGEVLLASLDAVNRVFEAAEAAEKQTFFATSKAATRMVSNRF  304

Query  314   GDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             G+EA +AT   L +AG A+ TA  V K+ K +NP
Sbjct  305   GEEAGEATEHVLASAGQAVNTARNVSKIWKVINP  338



>emb|CDY49296.1| BnaC01g22450D [Brassica napus]
Length=370

 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 117/393 (30%), Positives = 181/393 (46%), Gaps = 68/393 (17%)
 Frame = -1

Query  1355  YYHHSPSAPPEAVEETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVFARVA  1176
             Y H          EE LL + G   HLID   +VELA GD  LV +      +A+  R+ 
Sbjct  19    YGHQGAIYHQTVREEVLLQIQGCRAHLIDGSEAVELAAGDFELVQVSDNGVALAMVVRIG  78

Query  1175  DEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGND  996
             +++QWP+ KD   VKLD   Y F+    +                              D
Sbjct  79    NDLQWPMIKDEPVVKLDARDYLFTLPVKD-----------------------------GD  109

Query  995   VLNYGLTIASKGQD-----NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPAD  831
              L+YG+T   +  D     N ++ LD  L   S FS      +   V  G          
Sbjct  110   PLSYGVTFFPRDPDDVVFVNSLELLDDFLRENSCFSSSSSSSSG--VNNG----------  157

Query  830   LKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKS  651
                              W   AP +EDY++  A+ +A G+G +I+G+  C +   + +  
Sbjct  158   ---------------IDWKEFAPRIEDYNNVVAKAIAGGTGHIIRGMFKCSNAYTNQVNK  202

Query  650   GDE--VLRNRMTSGSKTEVSPETMKR-----IRRVKRVTSMTEKVATGVLSGVVKVSGFF  492
             G E  V +    SG+ ++ +  T K      ++RV++++  TEK++  +L+GV  VSG  
Sbjct  203   GGETMVTKAEKKSGASSKRNATTNKNQINKNLQRVRKLSRATEKLSKTMLNGVGVVSGSV  262

Query  491   TSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKYG  312
              + +  S  GK F  ++PGE++LA++D  ++I DA E A +   S +S  TT +VS + G
Sbjct  263   MAPIVKSKPGKAFFSMVPGEVLLASVDALNKILDAAEAAERQTFSATSNATTRMVSERLG  322

Query  311   DEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             + A +AT + L+  GHA  TAW V K+RKAL P
Sbjct  323   ESAGEATRDVLDTVGHAAGTAWNVLKIRKALYP  355



>ref|XP_011078253.1| PREDICTED: uncharacterized protein LOC105162045 [Sesamum indicum]
Length=377

 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 116/399 (29%), Positives = 190/399 (48%), Gaps = 83/399 (21%)
 Frame = -1

Query  1337  SAPPEAVEET----------LLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAVF  1188
             S PP+ ++E           L+ +P   +HL+D   ++ELA  D  L+ +   + ++A  
Sbjct  20    SPPPQQIQEIPENKNVKHEILMRIPSCRVHLMDGGEALELAAADFELLRILDENVSLATT  79

Query  1187  ARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkD  1008
              +V +E+QWPLTKD   VKLD  HY FS    +                           
Sbjct  80    IKVGEELQWPLTKDEPVVKLDALHYLFSLPMKD---------------------------  112

Query  1007  MGNDVLNYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADL  828
                + L+YG++  S G    +  LD+ L   S FS      ++    G    KE +PA  
Sbjct  113   --GEPLSYGVSF-SDGNGADLGLLDSFLKENSLFSSS----SSRSRKGDINWKEFAPA--  163

Query  827   KSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSG  648
                                    V+DY+S  A+ +A G+G+++KGI +C +   + ++ G
Sbjct  164   -----------------------VDDYNSVLAKAIAGGTGQIVKGIFYCSNAYTNQVQKG  200

Query  647   DEVL-------RNRMTSGSKTEVSPE-------TMKRIRRVKRVTSMTEKVATGVLSGVV  510
              E +       +N++     T+ +           K ++RV++++ MTEK++  +L  V 
Sbjct  201   GETILIRAAEEKNQVALKDSTKSNSNGANKKSAVNKSLKRVRKLSKMTEKMSKAMLDVVG  260

Query  509   KVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttgl  330
               SG   + V  S  GK  L ++PGE++LA+LD  ++I DA E A K  M+ +S   T +
Sbjct  261   VASGSVMAPVVRSQAGKTLLSMVPGEVLLASLDAVNKIIDAAEAAEKQAMTATSGAVTRM  320

Query  329   vSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
             V+++ G+ A +AT + L  AGH   TAW VFK+RKA+NP
Sbjct  321   VTNRLGESAGEATEDALATAGHCAGTAWNVFKIRKAINP  359



>ref|XP_009387041.1| PREDICTED: uncharacterized protein LOC103974036 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 115/391 (29%), Positives = 192/391 (49%), Gaps = 71/391 (18%)
 Frame = -1

Query  1343  SPSAPPEAVEETLLIVPGAILHLIDK--QYSVELATGDLSLVSLRQGDSNVAVFARVADE  1170
             SP+      E+ LL +PGA ++L++      VELA GD +++ + + D  +A   RV  +
Sbjct  10    SPTRRSNRREDLLLQIPGASVYLMEDGGDAPVELAKGDFTVLRITEDDMVLATVVRVGAD  69

Query  1169  IQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqkDMGNDVL  990
             ++WPLTKD   +KLD  HY F+    +                                L
Sbjct  70    LRWPLTKDEPVIKLDLLHYLFTLPCKD-----------------------------GGFL  100

Query  989   NYGLTIASKGQDNLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEVSPADLKSEKKK  810
             NYG++ A+      +  L+  L   + FS                    +P+D  S  K+
Sbjct  101   NYGVSFAA--PHGGLASLEMFLKENACFS--------------------APSDASSSLKR  138

Query  809   EVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVDSLKSGDEVLR-  633
                      YW    P +EDY+   A+ +A G+G+++KGI  C +     ++ G  +L+ 
Sbjct  139   N---SSYEVYWKDYTPRIEDYNGVLAKAIAGGTGEIVKGIFKCSNAYTSQVQKGATLLQP  195

Query  632   -------NRMTSGSKTEVSPETMKR-------IRRVKRVTSMTEKVATGVLSGVVKVSGF  495
                    N     +K++   E+MK+       IRRV++++ MTEK++  +L GVV V+  
Sbjct  196   QDAASNTNASAGRNKSDNRSESMKKSGEINKAIRRVRKLSEMTEKMSRTLLDGVVLVTSS  255

Query  494   FTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsstvttglvSHKY  315
              +  +  S  GK  L  +PGE++LA+LD  +++ DAVE A ++ ++ +S V +G VS ++
Sbjct  256   VSVPLVRSKAGKSLLATIPGEVLLASLDAINKVLDAVEAAERSTLAATSNVVSGAVSKRF  315

Query  314   GDEAAKATSEGLEAAGHAMATAWTVFKLRKA  222
             G+ A +AT +    AGHA+ TAW +FK+RKA
Sbjct  316   GESAGEATDDVFATAGHAIGTAWNLFKIRKA  346



>ref|XP_010524496.1| PREDICTED: uncharacterized protein LOC104802547 isoform X1 [Tarenaya 
hassleriana]
Length=379

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 124/404 (31%), Positives = 190/404 (47%), Gaps = 79/404 (20%)
 Frame = -1

Query  1361  QGYYHHSPSAPPEAV---EETLLIVPGAILHLIDKQYSVELATGDLSLVSLRQGDSNVAV  1191
             QG    S    P A+   E+ LL +PG  +HLID   +++LA GD +LV +     ++A+
Sbjct  19    QGTILPSTRQIPSAMSVREDVLLQIPGCRVHLIDGPEALQLAAGDFNLVQVSDNGVSLAM  78

Query  1190  FARVADEIQWPLTKDLASVKLDNSHYFFSFRFPNVdddsdssdeekskgkkegkhkekqk  1011
               RV  ++QWP+TKD   VKLD+  Y F+    +                          
Sbjct  79    IIRVGRDLQWPVTKDEPVVKLDSRDYLFTLPVKD--------------------------  112

Query  1010  DMGNDVLNYGLTIASKGQD----NLIKDLDTILDNCSSFSVHKVEETASVVMGGPVAKEV  843
                 D L+YG+T +    D    N ++ LD  L   S FS    ++  S +         
Sbjct  113   ---GDPLSYGVTFSGHENDVEVVNSLELLDDFLKENSCFSASFGKKMDSGI---------  160

Query  842   SPADLKSEKKKEVLEGRCAAYWTTLAPNVEDYSSSAARLMASGSGKLIKGILWCGDVTVD  663
                                  W   AP +EDY++  A+ +A G+G +I+GI  C +   +
Sbjct  161   --------------------DWKEFAPKIEDYNNVLAKAIAGGTGHIIRGIFRCSNAYTN  200

Query  662   SLKSGDEVL-------------RNR-MTSGSKTEVSPETMKRIRRVKRVTSMTEKVATGV  525
              ++ G E +             RN   +SGS +       + + RV++++  TEK++  +
Sbjct  201   QVQKGGETMITSAEEKKNGGYQRNGGYSSGSDSRRKSGINRNLARVRKLSKATEKLSKSM  260

Query  524   LSGVVKVSGFFTSSVANSSVGKKFLGLLPGEMVLATLDGFSRICDAVEVAGKNvmstsst  345
             L+GV  VSG   + V  S  GK F  ++PGE++LA+LD  ++I DA E A K   S +S 
Sbjct  261   LNGVGIVSGSVMAPVMKSKPGKAFFSMVPGEVLLASLDAINKILDAAEAAEKQAFSATSK  320

Query  344   vttglvSHKYGDEAAKATSEGLEAAGHAMATAWTVFKLRKALNP  213
               T +VS ++G+ A +AT E L  AGHA  TAW V K+RKAL P
Sbjct  321   AATRMVSQRFGESAGEATGEVLATAGHAAGTAWNVVKIRKALYP  364



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4306464265376