BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c87673_g1_i1 len=327 path=[1:0-326]

Length=327
                                                                      Score     E

ref|XP_009609429.1|  PREDICTED: purine permease 3-like                67.0    1e-10   
ref|XP_009588639.1|  PREDICTED: purine permease 3-like                65.9    2e-10   
ref|XP_003602862.1|  Purine permease                                  62.8    4e-10   
emb|CDY15687.1|  BnaA07g08580D                                        64.7    5e-10   
ref|XP_006305220.1|  hypothetical protein CARUB_v10009586mg           64.7    6e-10   
gb|KFK44691.1|  hypothetical protein AALP_AA1G290900                  64.7    6e-10   
ref|XP_010499329.1|  PREDICTED: purine permease 3-like                64.7    7e-10   
gb|AES73111.2|  purine permease-like protein                          64.7    7e-10   
ref|NP_174143.1|  purine permease 3                                   64.7    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893512.1|  ATPUP3                                           64.3    8e-10   
ref|XP_010478189.1|  PREDICTED: purine permease 3-like                64.3    8e-10   
ref|XP_010460596.1|  PREDICTED: purine permease 3                     64.3    8e-10   
gb|KHN08292.1|  Purine permease 1                                     62.4    1e-09   
ref|XP_010098675.1|  hypothetical protein L484_026052                 62.0    1e-09   
ref|XP_008219368.1|  PREDICTED: purine permease 3-like                63.9    1e-09   
ref|XP_007227615.1|  hypothetical protein PRUPE_ppa022492mg           63.5    2e-09   
ref|XP_004501676.1|  PREDICTED: purine permease 1-like isoform X1     63.5    2e-09   
ref|XP_006472532.1|  PREDICTED: purine permease 1-like                63.5    2e-09   
ref|XP_003602860.1|  Purine permease                                  63.5    2e-09   
ref|XP_004299692.1|  PREDICTED: purine permease 3-like                63.2    2e-09   
ref|XP_004242795.1|  PREDICTED: purine permease 3-like                63.2    2e-09   
ref|XP_008219366.1|  PREDICTED: purine permease 3-like                63.2    2e-09   
ref|XP_007223326.1|  hypothetical protein PRUPE_ppa007339mg           63.2    2e-09   
ref|XP_002285719.1|  PREDICTED: purine permease 1-like                63.2    2e-09   Vitis vinifera
gb|EPS65699.1|  hypothetical protein M569_09078                       62.8    2e-09   
ref|XP_004299691.1|  PREDICTED: purine permease 3-like                63.2    2e-09   
ref|XP_002285717.1|  PREDICTED: purine permease 1                     63.2    2e-09   Vitis vinifera
gb|AES73112.2|  purine permease-like protein                          63.2    3e-09   
ref|XP_006364706.1|  PREDICTED: purine permease 3-like                63.2    3e-09   
ref|XP_003522775.1|  PREDICTED: purine permease 1-like                62.8    3e-09   
ref|XP_009373619.1|  PREDICTED: purine permease 3-like                63.2    3e-09   
gb|KHG22236.1|  Purine permease 1 -like protein                       62.8    3e-09   
ref|XP_010064227.1|  PREDICTED: purine permease 3-like                62.8    3e-09   
emb|CDP16579.1|  unnamed protein product                              61.6    3e-09   
gb|KHN08969.1|  Purine permease 1                                     60.8    4e-09   
ref|XP_009373503.1|  PREDICTED: purine permease 3-like                62.8    4e-09   
gb|KDP41439.1|  hypothetical protein JCGZ_15846                       62.4    4e-09   
ref|XP_006433898.1|  hypothetical protein CICLE_v10001546mg           62.4    4e-09   
ref|XP_002513994.1|  purine transporter, putative                     62.4    4e-09   Ricinus communis
ref|XP_010322002.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...  62.0    6e-09   
ref|XP_002285718.1|  PREDICTED: purine permease 1                     62.0    6e-09   Vitis vinifera
ref|XP_010538169.1|  PREDICTED: purine permease 3-like                61.6    7e-09   
ref|XP_009766753.1|  PREDICTED: purine permease 3-like                61.6    7e-09   
ref|XP_006357923.1|  PREDICTED: purine permease 3-like                61.6    8e-09   
ref|XP_004252714.1|  PREDICTED: purine permease 3-like                61.6    8e-09   
ref|XP_009763953.1|  PREDICTED: purine permease 3-like                61.2    9e-09   
emb|CDY46286.1|  BnaC05g21700D                                        58.5    1e-08   
ref|XP_007018134.1|  Purine permease 3                                61.2    1e-08   
ref|XP_006357924.1|  PREDICTED: purine permease 3-like                61.2    1e-08   
gb|EYU34538.1|  hypothetical protein MIMGU_mgv1a019697mg              59.3    1e-08   
ref|XP_010499327.1|  PREDICTED: purine permease 1-like isoform X1     61.2    1e-08   
ref|XP_006366415.1|  PREDICTED: purine permease 3-like                60.8    1e-08   
ref|XP_009102926.1|  PREDICTED: purine permease 3                     60.8    2e-08   
emb|CDP19267.1|  unnamed protein product                              60.8    2e-08   
emb|CDX90135.1|  BnaA08g18490D                                        60.5    2e-08   
emb|CDX94595.1|  BnaC07g10630D                                        60.5    2e-08   
emb|CDY46618.1|  BnaA09g27450D                                        58.9    2e-08   
gb|KCW51603.1|  hypothetical protein EUGRSUZ_J01095                   59.7    2e-08   
ref|XP_009109746.1|  PREDICTED: purine permease 1-like                60.1    2e-08   
ref|XP_008444876.1|  PREDICTED: purine permease 3-like                60.1    3e-08   
ref|XP_004164781.1|  PREDICTED: purine permease 3-like                60.1    3e-08   
ref|XP_004152619.1|  PREDICTED: purine permease 3-like                60.1    3e-08   
gb|KFK44702.1|  hypothetical protein AALP_AA1G292000                  60.1    3e-08   
ref|XP_008338896.1|  PREDICTED: purine permease 3-like                59.7    4e-08   
emb|CDP11456.1|  unnamed protein product                              59.7    4e-08   
gb|KHG13700.1|  Purine permease 3 -like protein                       59.7    4e-08   
ref|XP_006357925.1|  PREDICTED: purine permease 3-like                59.3    4e-08   
ref|XP_006305203.1|  hypothetical protein CARUB_v10009570mg           59.3    4e-08   
emb|CDY27947.1|  BnaCnng05320D                                        59.3    5e-08   
ref|XP_009605309.1|  PREDICTED: purine permease 1-like                59.3    6e-08   
ref|XP_009762239.1|  PREDICTED: purine permease 1-like                58.9    6e-08   
ref|XP_006415682.1|  hypothetical protein EUTSA_v10008037mg           58.9    7e-08   
ref|XP_002893513.1|  hypothetical protein ARALYDRAFT_890360           58.9    7e-08   
gb|EYU34537.1|  hypothetical protein MIMGU_mgv1a022801mg              58.9    7e-08   
gb|EYU21537.1|  hypothetical protein MIMGU_mgv1a018814mg              58.9    7e-08   
ref|XP_009113691.1|  PREDICTED: purine permease 1-like                58.9    7e-08   
ref|XP_010098679.1|  Purine permease 3                                58.9    8e-08   
gb|KHG06856.1|  Purine permease 1 -like protein                       58.9    8e-08   
ref|XP_010460601.1|  PREDICTED: purine permease 1                     58.5    8e-08   
gb|AAF64547.1|AF078531_1  purine permease                             58.5    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174144.1|  purine permease 1                                   58.5    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444875.1|  PREDICTED: purine permease 3-like                58.5    8e-08   
ref|XP_004152618.1|  PREDICTED: purine permease 3-like                58.5    9e-08   
ref|XP_011006371.1|  PREDICTED: purine permease 3                     58.5    9e-08   
gb|EEE69871.1|  hypothetical protein OsJ_29685                        55.5    9e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009783837.1|  PREDICTED: purine permease 3-like                58.5    1e-07   
ref|XP_010060067.1|  PREDICTED: purine permease 1-like                58.5    1e-07   
gb|KCW66598.1|  hypothetical protein EUGRSUZ_F00392                   58.9    1e-07   
ref|XP_009148632.1|  PREDICTED: purine permease 2-like                58.5    1e-07   
ref|XP_010549318.1|  PREDICTED: purine permease 3-like                58.2    1e-07   
gb|KDP40942.1|  hypothetical protein JCGZ_24941                       58.2    1e-07   
emb|CDY29741.1|  BnaA01g19250D                                        58.5    1e-07   
ref|XP_011072345.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...  58.2    1e-07   
ref|XP_010060063.1|  PREDICTED: purine permease 3-like isoform X1     58.2    1e-07   
ref|XP_007141230.1|  hypothetical protein PHAVU_008G178300g           58.2    1e-07   
ref|XP_009799246.1|  PREDICTED: purine permease 1-like                55.8    1e-07   
ref|XP_009621473.1|  PREDICTED: purine permease 3-like                58.2    1e-07   
gb|EPS72255.1|  hypothetical protein M569_02503                       56.6    2e-07   
ref|XP_007136297.1|  hypothetical protein PHAVU_009G034400g           57.8    2e-07   
emb|CDY17197.1|  BnaA05g09910D                                        57.8    2e-07   
ref|XP_010538168.1|  PREDICTED: purine permease 1-like                57.8    2e-07   
ref|XP_009109745.1|  PREDICTED: purine permease 1                     57.8    2e-07   
emb|CDY35722.1|  BnaC03g58430D                                        57.8    2e-07   
ref|XP_007018133.1|  Purine permease 3, putative                      57.8    2e-07   
ref|XP_009603730.1|  PREDICTED: purine permease 3-like                57.4    2e-07   
ref|XP_009615076.1|  PREDICTED: purine permease 3-like                57.4    2e-07   
gb|AEX11958.1|  hypothetical protein 0_18228_02                       54.7    2e-07   
ref|XP_010266597.1|  PREDICTED: purine permease 3-like                57.4    2e-07   
gb|AEX11959.1|  hypothetical protein 0_18228_02                       54.7    2e-07   
emb|CDY35721.1|  BnaC03g58420D                                        57.0    2e-07   
ref|XP_003615204.1|  Purine permease                                  57.4    2e-07   
gb|KDP40961.1|  hypothetical protein JCGZ_24960                       57.8    3e-07   
ref|NP_001147096.1|  PUP1                                             57.0    3e-07   Zea mays [maize]
ref|XP_009143833.1|  PREDICTED: purine permease 2 isoform X2          57.0    4e-07   
ref|XP_009143832.1|  PREDICTED: purine permease 2 isoform X1          56.6    4e-07   
ref|XP_004237961.1|  PREDICTED: purine permease 1-like                56.6    4e-07   
ref|XP_003519187.1|  PREDICTED: purine permease 1-like                56.2    5e-07   
ref|XP_002307351.2|  PURINE PERMEASE 1 family protein                 56.2    5e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010939715.1|  PREDICTED: purine permease 3-like                56.2    5e-07   
emb|CDP01126.1|  unnamed protein product                              56.2    6e-07   
ref|XP_009765499.1|  PREDICTED: purine permease 1-like                56.2    6e-07   
ref|XP_009599635.1|  PREDICTED: purine permease 1-like                56.2    6e-07   
ref|XP_009776518.1|  PREDICTED: purine permease 1-like                56.2    7e-07   
ref|XP_009611006.1|  PREDICTED: purine permease 1-like                56.2    7e-07   
ref|XP_010244043.1|  PREDICTED: purine permease 1-like                53.9    7e-07   
ref|XP_009769306.1|  PREDICTED: purine permease 1-like                55.8    7e-07   
ref|XP_009795252.1|  PREDICTED: purine permease 1-like                55.8    7e-07   
gb|KFK31021.1|  hypothetical protein AALP_AA6G057800                  55.8    7e-07   
ref|XP_010478191.1|  PREDICTED: purine permease 1-like                55.8    7e-07   
ref|XP_009380884.1|  PREDICTED: purine permease 3-like                53.5    7e-07   
ref|XP_006338103.1|  PREDICTED: purine permease 1-like                55.8    7e-07   
ref|XP_009598031.1|  PREDICTED: purine permease 1-like                55.8    8e-07   
gb|ADP30798.1|  nicotine uptake permease 1                            55.8    8e-07   
emb|CDY12422.1|  BnaC08g09110D                                        55.8    8e-07   
emb|CDY16284.1|  BnaC01g23190D                                        55.8    9e-07   
gb|EMS67133.1|  hypothetical protein TRIUR3_29861                     53.1    1e-06   
ref|XP_010266586.1|  PREDICTED: purine permease 3-like                55.5    1e-06   
gb|EMT03626.1|  hypothetical protein F775_30132                       53.1    1e-06   
ref|XP_006661330.1|  PREDICTED: purine permease 3-like                55.5    1e-06   
ref|XP_010549316.1|  PREDICTED: purine permease 3                     55.5    1e-06   
ref|XP_010060066.1|  PREDICTED: purine permease 1-like                55.1    1e-06   
ref|XP_010939717.1|  PREDICTED: purine permease 3-like isoform X2     55.1    2e-06   
ref|XP_008667894.1|  PREDICTED: PUP1 isoform X1                       55.1    2e-06   
ref|XP_006661331.1|  PREDICTED: purine permease 3-like                53.9    2e-06   
gb|EPS58880.1|  hypothetical protein M569_15931                       52.4    2e-06   
ref|XP_009380886.1|  PREDICTED: purine permease 3-like                54.7    2e-06   
gb|EPS67422.1|  hypothetical protein M569_07351                       53.9    3e-06   
ref|XP_010675382.1|  PREDICTED: purine permease 3-like                54.3    3e-06   
gb|EAZ09425.1|  hypothetical protein OsI_31698                        54.3    3e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001063424.1|  Os09g0467300                                     54.3    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579811.2|  PREDICTED: purine permease 3-like                53.9    4e-06   
ref|XP_002462514.1|  hypothetical protein SORBIDRAFT_02g027090        53.9    4e-06   Sorghum bicolor [broomcorn]
gb|KGN64615.1|  hypothetical protein Csa_1G071290                     53.9    4e-06   
tpg|DAA40287.1|  TPA: hypothetical protein ZEAMMB73_258363            50.8    5e-06   
ref|XP_002531513.1|  purine transporter, putative                     53.5    5e-06   Ricinus communis
ref|XP_008446590.1|  PREDICTED: purine permease 3-like                53.5    5e-06   
ref|XP_006410518.1|  hypothetical protein EUTSA_v10017788mg           53.5    5e-06   
ref|XP_004959530.1|  PREDICTED: purine permease 1-like                53.1    6e-06   
ref|XP_004146629.1|  PREDICTED: purine permease 3-like                53.1    6e-06   
gb|EMS54152.1|  hypothetical protein TRIUR3_17062                     51.2    7e-06   
ref|XP_006415683.1|  hypothetical protein EUTSA_v10009673mg           53.1    7e-06   
gb|EPS74474.1|  hypothetical protein M569_00285                       52.8    7e-06   
ref|XP_010469434.1|  PREDICTED: purine permease 2-like                52.8    8e-06   
ref|XP_003578263.2|  PREDICTED: purine permease 3-like                52.8    9e-06   
ref|XP_010509840.1|  PREDICTED: purine permease 2-like                52.8    9e-06   
ref|XP_010244044.1|  PREDICTED: purine permease 1-like                52.8    9e-06   
ref|XP_004490401.1|  PREDICTED: purine permease 1-like                52.8    1e-05   
ref|XP_006661332.1|  PREDICTED: purine permease 3-like                52.0    1e-05   
dbj|BAJ86755.1|  predicted protein                                    52.4    1e-05   
ref|XP_009401279.1|  PREDICTED: purine permease 1-like                52.4    1e-05   
dbj|BAK04933.1|  predicted protein                                    52.4    1e-05   
gb|EEE69873.1|  hypothetical protein OsJ_29687                        52.0    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010413817.1|  PREDICTED: purine permease 2-like                52.0    2e-05   
gb|EPS58319.1|  hypothetical protein M569_16495                       50.1    2e-05   
ref|XP_009770717.1|  PREDICTED: purine permease 1-like                52.0    2e-05   
dbj|BAD19737.1|  putative purine permease                             52.0    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010234593.1|  PREDICTED: purine permease 3-like isoform X1     52.0    2e-05   
gb|EEC84724.1|  hypothetical protein OsI_31699                        52.0    2e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001063425.1|  Os09g0467400                                     52.0    2e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ88843.1|  predicted protein                                    52.0    2e-05   
ref|XP_008667169.1|  PREDICTED: uncharacterized protein LOC100193...  51.6    2e-05   
gb|EYU38177.1|  hypothetical protein MIMGU_mgv1a023817mg              51.6    2e-05   
gb|EMT19524.1|  Purine permease 3                                     51.6    2e-05   
dbj|BAJ87663.1|  predicted protein                                    51.6    2e-05   
ref|NP_001131978.1|  uncharacterized protein LOC100193377             51.6    2e-05   Zea mays [maize]
ref|XP_010509839.1|  PREDICTED: purine permease 2-like                51.2    3e-05   
gb|EMS56376.1|  hypothetical protein TRIUR3_06437                     48.9    3e-05   
ref|XP_010509841.1|  PREDICTED: purine permease 2-like                51.2    3e-05   
gb|AFG48576.1|  hypothetical protein 0_17711_02                       48.9    3e-05   
ref|XP_010413821.1|  PREDICTED: purine permease 2                     50.8    4e-05   
gb|EPS58788.1|  hypothetical protein M569_16026                       50.8    4e-05   
gb|EYU21538.1|  hypothetical protein MIMGU_mgv1a020196mg              50.8    4e-05   
gb|EMS56377.1|  hypothetical protein TRIUR3_06438                     48.9    4e-05   
ref|XP_007042880.1|  Purine permease 3                                50.8    4e-05   
ref|NP_001136854.1|  hypothetical protein                             50.8    4e-05   Zea mays [maize]
ref|XP_007042882.1|  Purine permease 3 isoform 2                      50.8    4e-05   
gb|EMT04632.1|  hypothetical protein F775_02042                       48.5    5e-05   
ref|XP_002881298.1|  ATPUP2                                           50.4    5e-05   
gb|EMS59470.1|  hypothetical protein TRIUR3_33863                     48.9    5e-05   
ref|XP_006295883.1|  hypothetical protein CARUB_v10025013mg           50.4    5e-05   
tpg|DAA43787.1|  TPA: hypothetical protein ZEAMMB73_057798            50.1    6e-05   
ref|NP_973592.1|  purine permease 2                                   50.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180931.2|  purine permease 2                                   50.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAC69140.1|  hypothetical protein                                  50.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841261.1|  hypothetical protein AMTR_s00135p00099660        50.4    6e-05   
ref|XP_010926344.1|  PREDICTED: purine permease 3-like isoform X1     50.4    6e-05   
dbj|BAJ94351.1|  predicted protein                                    50.1    9e-05   
ref|XP_002462515.1|  hypothetical protein SORBIDRAFT_02g027100        49.7    9e-05   Sorghum bicolor [broomcorn]
dbj|BAJ95836.1|  predicted protein                                    49.7    9e-05   
ref|XP_006841259.1|  hypothetical protein AMTR_s00135p00097090        49.7    1e-04   
ref|XP_004959525.1|  PREDICTED: purine permease 3-like                49.7    1e-04   
ref|XP_006841262.1|  hypothetical protein AMTR_s00135p00100890        49.7    1e-04   
ref|XP_006358992.1|  PREDICTED: purine permease 1-like                49.3    1e-04   
ref|XP_004957086.1|  PREDICTED: purine permease 3-like                49.3    1e-04   
ref|XP_010263028.1|  PREDICTED: purine permease 1-like                49.3    1e-04   
ref|XP_008795222.1|  PREDICTED: purine permease 3-like                49.3    1e-04   
ref|XP_006373040.1|  hypothetical protein POPTR_0017s07610g           48.9    1e-04   
gb|EMT04631.1|  hypothetical protein F775_14106                       47.4    1e-04   
ref|XP_010247465.1|  PREDICTED: purine permease 3-like                49.3    1e-04   
ref|XP_008651823.1|  PREDICTED: purine permease 3                     49.3    2e-04   
ref|XP_002465736.1|  hypothetical protein SORBIDRAFT_01g044690        49.3    2e-04   Sorghum bicolor [broomcorn]
ref|XP_004985416.1|  PREDICTED: purine permease 3-like                49.3    2e-04   
ref|XP_003561966.2|  PREDICTED: purine permease 3-like                48.9    2e-04   
ref|XP_006651115.1|  PREDICTED: purine permease 3-like                48.9    2e-04   
gb|EAY88839.1|  hypothetical protein OsI_10311                        48.9    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_008812221.1|  PREDICTED: purine permease 3-like                48.9    2e-04   
ref|NP_001049213.1|  Os03g0187800                                     48.9    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010248452.1|  PREDICTED: purine permease 3-like                48.5    2e-04   
ref|XP_003558629.1|  PREDICTED: purine permease 3-like                48.9    2e-04   
ref|XP_004985414.1|  PREDICTED: purine permease 3-like                48.5    3e-04   
gb|EEE58463.1|  hypothetical protein OsJ_09707                        48.1    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010942638.1|  PREDICTED: purine permease 3-like isoform X2     48.5    3e-04   
ref|XP_010942637.1|  PREDICTED: purine permease 3-like isoform X1     48.5    3e-04   
ref|XP_010263027.1|  PREDICTED: purine permease 3-like                48.1    4e-04   
emb|CDP08377.1|  unnamed protein product                              47.8    4e-04   
tpg|DAA61854.1|  TPA: hypothetical protein ZEAMMB73_233624            47.8    4e-04   
dbj|BAJ96346.1|  predicted protein                                    47.8    5e-04   
gb|EPS67075.1|  hypothetical protein M569_07701                       45.1    5e-04   
ref|XP_006338102.1|  PREDICTED: purine permease 1-like                47.0    7e-04   
ref|XP_004985415.1|  PREDICTED: purine permease 3-like                47.0    8e-04   
ref|XP_008652812.1|  PREDICTED: purine permease 3-like                47.0    8e-04   



>ref|XP_009609429.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=359

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQ  147
            +TEVL V FYGEKF ++KG+SLALSLWGF+SYFYGD           ++Q+ E +M  ++
Sbjct  300  ITEVLAVFFYGEKFSAEKGVSLALSLWGFLSYFYGDM----KKSKKKENQSPETEMIDSK  355

Query  146  TLT  138
            T T
Sbjct  356  TCT  358



>ref|XP_009588639.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=356

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+FYGEKF ++KG+SLALS+WGF+SYFYGD
Sbjct  307  VTEVLAVIFYGEKFTAEKGVSLALSMWGFISYFYGD  342



>ref|XP_003602862.1| Purine permease [Medicago truncatula]
Length=131

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 3/59 (5%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQT  150
            +TEVL VVFY EKFQ++KG+SL LSLWGFVSYFYG+ K +K  K      ++E +M QT
Sbjct  69   LTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEIKHAKAEKKKC---SLEIKMGQT  124



>emb|CDY15687.1| BnaA07g08580D [Brassica napus]
Length=303

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+FY EKFQ +KG+SLALSLWGFVSYFYG+
Sbjct  241  ITEVLAVIFYHEKFQKEKGLSLALSLWGFVSYFYGE  276



>ref|XP_006305220.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
 gb|EOA38118.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
Length=351

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+FY EKFQ++KG+SLALSLWGFVSYFYG+
Sbjct  286  ITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFYGE  321



>gb|KFK44691.1| hypothetical protein AALP_AA1G290900 [Arabis alpina]
Length=351

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+FY EKFQ++KG+SLALSLWGFVSYFYG+
Sbjct  290  ITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFYGE  325



>ref|XP_010499329.1| PREDICTED: purine permease 3-like [Camelina sativa]
 ref|XP_010499330.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=355

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQ  147
            +TEVL V+FY EKFQ++KG+SLALSLWGFVSYFYG+    K++    + Q  E +  +T+
Sbjct  287  ITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFYGEI---KSDNDKRRIQQEEKESQETE  343

Query  146  TLTM*STTI  120
              ++ S TI
Sbjct  344  LPSLSSRTI  352



>gb|AES73111.2| purine permease-like protein [Medicago truncatula]
Length=371

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 3/59 (5%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQT  150
            +TEVL VVFY EKFQ++KG+SL LSLWGFVSYFYG+    K  K   K +++E +M QT
Sbjct  309  LTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEI---KHAKAEKKKRSLEIEMGQT  364



>ref|NP_174143.1| purine permease 3 [Arabidopsis thaliana]
 sp|Q9FZ95.1|PUP3_ARATH RecName: Full=Purine permease 3; Short=AtPUP3 [Arabidopsis thaliana]
 gb|AAF98433.1|AC021044_12 Similar to purine permease [Arabidopsis thaliana]
 gb|AEE30933.1| purine permease 3 [Arabidopsis thaliana]
Length=351

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+FY EKFQ++KG+SLALSLWGFVSYFYG+
Sbjct  286  ITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFYGE  321



>ref|XP_002893512.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69771.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+FY EKFQ++KG+SLALSLWGFVSYFYG+
Sbjct  286  ITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFYGE  321



>ref|XP_010478189.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=345

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+FY EKFQ++KG+SLALSLWGFVSYFYG+
Sbjct  285  ITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFYGE  320



>ref|XP_010460596.1| PREDICTED: purine permease 3 [Camelina sativa]
Length=353

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+FY EKFQ++KG+SLALSLWGFVSYFYG+
Sbjct  287  ITEVLAVIFYHEKFQAEKGLSLALSLWGFVSYFYGE  322



>gb|KHN08292.1| Purine permease 1 [Glycine soja]
Length=176

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQ  153
            VTEVL V+FY EKFQ++KG+SL LSLWG VSYFYG+     + K   K+ + EA++AQ
Sbjct  118  VTEVLAVIFYKEKFQAEKGVSLLLSLWGMVSYFYGEI--KHSKKMKMKNSDTEAELAQ  173



>ref|XP_010098675.1| hypothetical protein L484_026052 [Morus notabilis]
 gb|EXB75578.1| hypothetical protein L484_026052 [Morus notabilis]
Length=204

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+FY E FQ++KG+SL LSLWGF+SYFYG+F
Sbjct  136  VTEVLAVIFYQENFQAEKGVSLVLSLWGFISYFYGEF  172



>ref|XP_008219368.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=370

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+FY EKFQ++KG++LALSLWGFVSYFYG+
Sbjct  298  VTEILAVIFYHEKFQAEKGVALALSLWGFVSYFYGE  333



>ref|XP_007227615.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
 gb|EMJ28814.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
Length=368

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+FY EKFQ++KG++LALSLWGFVSYFYG+
Sbjct  296  VTEILAVIFYHEKFQAEKGVALALSLWGFVSYFYGE  331



>ref|XP_004501676.1| PREDICTED: purine permease 1-like isoform X1 [Cicer arietinum]
 ref|XP_004501677.1| PREDICTED: purine permease 1-like isoform X2 [Cicer arietinum]
Length=367

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQ  147
            +TEVL V+FY E FQ++K +SL LSLWGFVSYFYG+F   ++ +   K+ ++E Q+AQT 
Sbjct  304  LTEVLAVIFYKEHFQAEKAVSLILSLWGFVSYFYGEF--KESKELKKKNPDLETQLAQTS  361



>ref|XP_006472532.1| PREDICTED: purine permease 1-like [Citrus sinensis]
 gb|KDO81081.1| hypothetical protein CISIN_1g017456mg [Citrus sinensis]
Length=371

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE+L V+FY EKFQ++KG+SLALSLWGF SYFYG+ 
Sbjct  313  VTEILAVIFYKEKFQAEKGVSLALSLWGFASYFYGEI  349



>ref|XP_003602860.1| Purine permease [Medicago truncatula]
Length=440

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 3/59 (5%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQT  150
            +TEVL VVFY EKFQ++KG+SL LSLWGFVSYFYG+    K  K   K +++E +M QT
Sbjct  309  LTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEI---KHAKAEKKKRSLEIEMGQT  364



>ref|XP_004299692.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE+  V+FY EKFQ++KG+SLALSLWGFVSYFYG+ 
Sbjct  302  VTEIFAVIFYHEKFQAEKGVSLALSLWGFVSYFYGEM  338



>ref|XP_004242795.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=367

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+LGVVFYGEKF  +KG+SL LS+WGF+SY YGD
Sbjct  307  VTEILGVVFYGEKFTPEKGVSLVLSIWGFISYLYGD  342



>ref|XP_008219366.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=368

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TE+L V+FY EKFQ++KG++LALSLWGFVSYFYG+ 
Sbjct  296  ITEILAVIFYHEKFQAEKGVALALSLWGFVSYFYGEI  332



>ref|XP_007223326.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
 gb|EMJ24525.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
Length=372

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TE+L V+FY EKFQ++KG++LALSLWGFVSYFYG+ 
Sbjct  296  ITEILAVIFYHEKFQAEKGVALALSLWGFVSYFYGEI  332



>ref|XP_002285719.1| PREDICTED: purine permease 1-like [Vitis vinifera]
Length=351

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+F+ EKFQ++KG+SLALSLWGFVSYFYG+
Sbjct  294  VTEILAVIFFREKFQAEKGVSLALSLWGFVSYFYGE  329



>gb|EPS65699.1| hypothetical protein M569_09078, partial [Genlisea aurea]
Length=327

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            V E+LGV+FYGEKF SQKG+SL LSLWGF+SYFYG++
Sbjct  278  VNELLGVIFYGEKFGSQKGVSLGLSLWGFLSYFYGEY  314



>ref|XP_004299691.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE+  V+FY EKFQ++KG+SLALSLWGFVSYFYG+ 
Sbjct  302  VTEIFAVIFYHEKFQAEKGVSLALSLWGFVSYFYGEI  338



>ref|XP_002285717.1| PREDICTED: purine permease 1 [Vitis vinifera]
 emb|CAN64392.1| hypothetical protein VITISV_015235 [Vitis vinifera]
Length=349

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+F+ EKFQ++KG+SLALSLWGFVSYFYG+
Sbjct  292  VTEILAVIFFQEKFQAEKGVSLALSLWGFVSYFYGE  327



>gb|AES73112.2| purine permease-like protein [Medicago truncatula]
Length=370

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL VVFY EKFQ++KG+SL LSLWGFVSYFYG+
Sbjct  308  LTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGE  343



>ref|XP_006364706.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=362

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TE+LGVVFYGEKF  +KG+SL LS+WGF+SY YGD 
Sbjct  302  ITEILGVVFYGEKFTPEKGVSLVLSIWGFISYLYGDI  338



>ref|XP_003522775.1| PREDICTED: purine permease 1-like [Glycine max]
Length=357

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQ  153
            VTEVL V+FY EKFQ++KG+SL LSLWG VSYFYG+     + K   K+ + EA++AQ
Sbjct  299  VTEVLAVIFYKEKFQAEKGVSLLLSLWGMVSYFYGEI--KHSKKMKMKNSDTEAELAQ  354



>ref|XP_009373619.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=380

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VT++L V+FY EKFQ++KG+SLALSLWGF+SYFYG+
Sbjct  298  VTQILAVIFYHEKFQAEKGVSLALSLWGFISYFYGE  333



>gb|KHG22236.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=357

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V F+ EKFQ++KG+SLALSLWGF+SYFYGD
Sbjct  294  VTEILAVFFFNEKFQAEKGVSLALSLWGFLSYFYGD  329



>ref|XP_010064227.1| PREDICTED: purine permease 3-like [Eucalyptus grandis]
 gb|KCW66596.1| hypothetical protein EUGRSUZ_F00390 [Eucalyptus grandis]
Length=379

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE+LGV+ + EKFQ++KG+SLALSLWGF SYFYG+F
Sbjct  292  VTEILGVICFHEKFQAEKGVSLALSLWGFASYFYGEF  328



>emb|CDP16579.1| unnamed protein product [Coffea canephora]
Length=271

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+F+ EKFQ++K ++L LSLWGFVSYFYGD
Sbjct  212  VTEILAVIFFNEKFQAEKAVALVLSLWGFVSYFYGD  247



>gb|KHN08969.1| Purine permease 1, partial [Glycine soja]
Length=206

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+FY EKFQ++KG+SL LSLWG VSYFYG+ 
Sbjct  149  VTEVLAVIFYKEKFQAEKGVSLLLSLWGMVSYFYGEI  185



>ref|XP_009373503.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=378

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TE+L V+FY EKFQ +KG+SLALS+WGFVSYFYG+
Sbjct  296  ITEILAVIFYHEKFQPEKGVSLALSVWGFVSYFYGE  331



>gb|KDP41439.1| hypothetical protein JCGZ_15846 [Jatropha curcas]
Length=359

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE+L V+FY EKFQ++KG++LALSLWGF+SYFYG+ 
Sbjct  299  VTEILAVIFYQEKFQAEKGVALALSLWGFLSYFYGEI  335



>ref|XP_006433898.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
 gb|ESR47138.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
Length=371

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+FY EKFQ++KG+SLALSLWGF SYFYG+
Sbjct  313  VTEILAVIFYKEKFQAEKGVSLALSLWGFASYFYGE  348



>ref|XP_002513994.1| purine transporter, putative [Ricinus communis]
 gb|EEF48577.1| purine transporter, putative [Ricinus communis]
Length=356

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+FY E FQ++KG++LALSLWGFVSYFYG+
Sbjct  296  VTEVLAVIFYQENFQAEKGVALALSLWGFVSYFYGE  331



>ref|XP_010322002.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Solanum 
lycopersicum]
Length=346

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TEVL V  YGEKF ++KG+SLALSLWGF SYFYGD+
Sbjct  285  ITEVLAVFLYGEKFNAEKGVSLALSLWGFASYFYGDY  321



>ref|XP_002285718.1| PREDICTED: purine permease 1 [Vitis vinifera]
Length=351

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+F+ +KFQ++KG+SLALSLWGFVSYFYG+
Sbjct  294  VTEILAVIFFHDKFQAEKGVSLALSLWGFVSYFYGE  329



>ref|XP_010538169.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=346

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TE+L VVF+GEKFQ++KG+SL LSLWGF SYFYG+
Sbjct  286  LTEILAVVFFGEKFQAEKGVSLVLSLWGFASYFYGE  321



>ref|XP_009766753.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=358

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQ  147
            +TEVL V  YGEKF ++KG+SLALSLWGF+SYFYGD           + Q+ E +M  ++
Sbjct  299  ITEVLAVFIYGEKFSAEKGVSLALSLWGFLSYFYGDI----KESKKKEEQSPETEMIDSK  354

Query  146  TLT  138
              T
Sbjct  355  ACT  357



>ref|XP_006357923.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=341

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TEVL V  YGEKF ++KG+SLALSLWGF SYFYGD+
Sbjct  283  LTEVLAVFLYGEKFNAEKGVSLALSLWGFASYFYGDY  319



>ref|XP_004252714.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=356

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TE+LGV+F+ EKF S+KG+SL LSLWGFVSYFYG+F
Sbjct  295  ITEILGVIFFDEKFSSEKGLSLFLSLWGFVSYFYGEF  331



>ref|XP_009763953.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
 gb|ADP30799.1| nicotine uptake permease 2 [Nicotiana tabacum]
Length=352

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 4/61 (7%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQ  147
            VTEVL V+F+ EKF  +KG++L LSLWGFVSYFYG+F          K+++ EA+M  T 
Sbjct  293  VTEVLAVIFFKEKFSGEKGLALFLSLWGFVSYFYGEF----RQTKKEKNKSPEAEMTTTH  348

Query  146  T  144
            T
Sbjct  349  T  349



>emb|CDY46286.1| BnaC05g21700D [Brassica napus]
 emb|CDY26364.1| BnaA02g24060D [Brassica napus]
Length=99

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ +KG++L LSLWGFVSYFYG+F
Sbjct  35   VTEVLAVVCFREKFQVEKGVALLLSLWGFVSYFYGEF  71



>ref|XP_007018134.1| Purine permease 3 [Theobroma cacao]
 gb|EOY15359.1| Purine permease 3 [Theobroma cacao]
Length=356

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+F  EKFQ++KG++LALSLWGFVSYFYG+
Sbjct  296  VTEILAVIFLKEKFQAEKGVALALSLWGFVSYFYGE  331



>ref|XP_006357924.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TEVL V+ Y E F ++KGISLALSLWGFVSYFYGD+
Sbjct  295  LTEVLAVILYRENFSAEKGISLALSLWGFVSYFYGDY  331



>gb|EYU34538.1| hypothetical protein MIMGU_mgv1a019697mg, partial [Erythranthe 
guttata]
Length=161

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 6/59 (10%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQ  147
            TE+L ++FY EKFQ++KG+SL LSLWGF+SYFYG+       K      N++    QTQ
Sbjct  98   TEILAIIFYHEKFQAEKGLSLFLSLWGFISYFYGEM------KKNKSKNNIDQSNDQTQ  150



>ref|XP_010499327.1| PREDICTED: purine permease 1-like isoform X1 [Camelina sativa]
 ref|XP_010499328.1| PREDICTED: purine permease 1-like isoform X2 [Camelina sativa]
Length=354

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ++KG+SL LSLWGFVSYFYG+F
Sbjct  289  VTEVLAVVCFREKFQAEKGVSLLLSLWGFVSYFYGEF  325



>ref|XP_006366415.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TEVLGV+F+ EKF ++KG+SL LSLWGFVSYFYG+F
Sbjct  294  ITEVLGVIFFDEKFSAEKGLSLFLSLWGFVSYFYGEF  330



>ref|XP_009102926.1| PREDICTED: purine permease 3 [Brassica rapa]
 ref|XP_009102927.1| PREDICTED: purine permease 3 [Brassica rapa]
 emb|CDX94594.1| BnaC07g10640D [Brassica napus]
Length=349

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+FY EKFQ +KG+SLALSLWGFVSYFYG+
Sbjct  287  ITEVLAVIFYHEKFQKEKGLSLALSLWGFVSYFYGE  322



>emb|CDP19267.1| unnamed protein product [Coffea canephora]
Length=349

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+F+ EKFQ++KG++L LSLWGF+SYFYGD
Sbjct  286  VTELLAVIFFNEKFQAEKGVALFLSLWGFISYFYGD  321



>emb|CDX90135.1| BnaA08g18490D [Brassica napus]
Length=323

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ++KG++L LSLWGFVSYFYG+F
Sbjct  259  VTEVLAVVCFREKFQAEKGVALLLSLWGFVSYFYGEF  295



>emb|CDX94595.1| BnaC07g10630D [Brassica napus]
Length=349

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+FY EKFQ +KG+SLALSLWGFVSYFYG+
Sbjct  287  ITEVLAVIFYHEKFQKEKGLSLALSLWGFVSYFYGE  322



>emb|CDY46618.1| BnaA09g27450D [Brassica napus]
Length=227

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ +KG++L LSLWGFVSYFYG+F
Sbjct  163  VTEVLAVVCFREKFQVEKGVALLLSLWGFVSYFYGEF  199



>gb|KCW51603.1| hypothetical protein EUGRSUZ_J01095 [Eucalyptus grandis]
Length=302

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE+L V+ + EKFQ++KG++LALSLWGF SYFYG+F
Sbjct  238  VTEILAVICFQEKFQAEKGVALALSLWGFASYFYGEF  274



>ref|XP_009109746.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=356

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ++KG++L LSLWGFVSYFYG+F
Sbjct  292  VTEVLAVVCFREKFQAEKGVALLLSLWGFVSYFYGEF  328



>ref|XP_008444876.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=359

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 6/61 (10%)
 Frame = -2

Query  320  EVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQTL  141
            E+L V+F+ EKFQ++KG+SLAL+LWGFVSYFYG++      K   K +++E Q A+  T 
Sbjct  298  EILAVIFFREKFQAEKGVSLALNLWGFVSYFYGEY------KQTKKVKSIELQKAELGTT  351

Query  140  T  138
            T
Sbjct  352  T  352



>ref|XP_004164781.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=371

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 12/69 (17%)
 Frame = -2

Query  320  EVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQTL  141
            E+L VVF+ EKFQ +KG+SLAL+LWGFVSYFYG+F      K   K ++ E Q AQ    
Sbjct  311  EILAVVFFREKFQVEKGVSLALNLWGFVSYFYGEF------KQTKKMKSKELQKAQA---  361

Query  140  TM*STTIIQ  114
               STT IQ
Sbjct  362  ---STTPIQ  367



>ref|XP_004152619.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62723.1| hypothetical protein Csa_2G369740 [Cucumis sativus]
Length=371

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 12/69 (17%)
 Frame = -2

Query  320  EVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQTL  141
            E+L VVF+ EKFQ +KG+SLAL+LWGFVSYFYG+F      K   K ++ E Q AQ    
Sbjct  311  EILAVVFFREKFQVEKGVSLALNLWGFVSYFYGEF------KQTKKMKSKELQKAQA---  361

Query  140  TM*STTIIQ  114
               STT IQ
Sbjct  362  ---STTPIQ  367



>gb|KFK44702.1| hypothetical protein AALP_AA1G292000 [Arabis alpina]
Length=354

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ++KG++L LSLWGFVSYFYG+F
Sbjct  290  VTEVLAVVCFREKFQAEKGVALLLSLWGFVSYFYGEF  326



>ref|XP_008338896.1| PREDICTED: purine permease 3-like [Malus domestica]
Length=378

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VT++L V+FY EKFQ++KG+SLALSLWGF+ YFYG+
Sbjct  298  VTQILAVIFYHEKFQAEKGVSLALSLWGFIFYFYGE  333



>emb|CDP11456.1| unnamed protein product [Coffea canephora]
Length=345

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYG  222
            +TEVL V+FY EKFQ++KGI+LALSLWGF+S+FYG
Sbjct  295  ITEVLAVIFYHEKFQAEKGIALALSLWGFISHFYG  329



>gb|KHG13700.1| Purine permease 3 -like protein [Gossypium arboreum]
 gb|KHG19122.1| Purine permease 3 -like protein [Gossypium arboreum]
Length=358

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE+L V+FY E F ++KG++LALSLWGF+SYFYG+ 
Sbjct  298  VTEILAVIFYNESFHAEKGVALALSLWGFLSYFYGEI  334



>ref|XP_006357925.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=343

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            V EVL V  Y EKF ++KGISLALSLWGF SYFYGD+
Sbjct  283  VNEVLAVFLYSEKFSAEKGISLALSLWGFASYFYGDY  319



>ref|XP_006305203.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
 gb|EOA38101.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
Length=355

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ++KG+SL LS+WGFVSYFYG+F
Sbjct  291  VTEVLAVVCFREKFQAEKGVSLFLSMWGFVSYFYGEF  327



>emb|CDY27947.1| BnaCnng05320D [Brassica napus]
Length=349

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 6/60 (10%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQ  147
            +TEVL V+F+ EKFQ++KG+SL LSLWGFVSYFYG        ++  + +  EAQ++Q Q
Sbjct  290  LTEVLAVLFFREKFQAEKGVSLFLSLWGFVSYFYGKI------QSEKEKRTQEAQLSQLQ  343



>ref|XP_009605309.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL +VF+ EKF  +KG+SL LSLWGFVSYFYG+F
Sbjct  293  VTEVLAIVFFSEKFSGEKGVSLFLSLWGFVSYFYGEF  329



>ref|XP_009762239.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL +VF+ EKF  +KG+SL LSLWGFVSYFYG+F
Sbjct  293  VTEVLAIVFFSEKFSGEKGVSLFLSLWGFVSYFYGEF  329



>ref|XP_006415682.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
 gb|ESQ34035.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
Length=356

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ+ KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVVCFREKFQADKGVALLLSLWGFVSYFYGEF  329



>ref|XP_002893513.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69772.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL VV + EKFQ++KG+SL LSLWGFVSYFYG+
Sbjct  293  VTEVLAVVCFREKFQAEKGVSLLLSLWGFVSYFYGE  328



>gb|EYU34537.1| hypothetical protein MIMGU_mgv1a022801mg, partial [Erythranthe 
guttata]
Length=349

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            TE+L ++FY EKFQ++KG+SL LSLWGF+SYFYG+ 
Sbjct  286  TEILAIIFYHEKFQAEKGLSLFLSLWGFISYFYGEM  321



>gb|EYU21537.1| hypothetical protein MIMGU_mgv1a018814mg [Erythranthe guttata]
Length=354

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            TE+L ++FY EKFQ++KG+SL LSLWGF+SYFYG+ 
Sbjct  286  TEILAIIFYHEKFQAEKGLSLFLSLWGFISYFYGEM  321



>ref|XP_009113691.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=355

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ +KG++L LSLWGFVSYFYG+F
Sbjct  291  VTEVLAVVCFREKFQVEKGVALLLSLWGFVSYFYGEF  327



>ref|XP_010098679.1| Purine permease 3 [Morus notabilis]
 gb|EXB75582.1| Purine permease 3 [Morus notabilis]
Length=377

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV GV+FY E F ++KG+SL LSLWGF SYFYG+F
Sbjct  309  VTEVFGVIFYKESFPAEKGLSLVLSLWGFASYFYGEF  345



>gb|KHG06856.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=374

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE+L +  + EKFQ++KG+SLALSLWGFVSYFYG+ 
Sbjct  311  VTEILAIFSFNEKFQAEKGVSLALSLWGFVSYFYGEI  347



>ref|XP_010460601.1| PREDICTED: purine permease 1 [Camelina sativa]
Length=354

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ++K +SL LSLWGFVSYFYG+F
Sbjct  289  VTEVLAVVCFREKFQAEKCVSLLLSLWGFVSYFYGEF  325



>gb|AAF64547.1|AF078531_1 purine permease [Arabidopsis thaliana]
Length=356

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  VV + EKFQ++KG+SL LSLWGFVSYFYG+F
Sbjct  293  VTEVFAVVCFREKFQAEKGVSLLLSLWGFVSYFYGEF  329



>ref|NP_174144.1| purine permease 1 [Arabidopsis thaliana]
 sp|Q9FZ96.1|PUP1_ARATH RecName: Full=Purine permease 1; Short=AtPUP1 [Arabidopsis thaliana]
 gb|AAF98432.1|AC021044_11 purine permease [Arabidopsis thaliana]
 dbj|BAC42317.1| putative purine permease [Arabidopsis thaliana]
 gb|AAO63924.1| putative purine permease [Arabidopsis thaliana]
 gb|AEE30934.1| purine permease 1 [Arabidopsis thaliana]
Length=356

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  VV + EKFQ++KG+SL LSLWGFVSYFYG+F
Sbjct  293  VTEVFAVVCFREKFQAEKGVSLLLSLWGFVSYFYGEF  329



>ref|XP_008444875.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=365

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+ + EKFQ++K +SLAL+LWGFVSYFYG+
Sbjct  305  VTEILAVIIFNEKFQAEKAVSLALNLWGFVSYFYGE  340



>ref|XP_004152618.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 ref|XP_004174047.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62722.1| hypothetical protein Csa_2G369730 [Cucumis sativus]
Length=363

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+ + E+FQ++KG+SLAL+LWGF+SYFYG+
Sbjct  303  VTEILAVIIFNERFQAEKGVSLALNLWGFLSYFYGE  338



>ref|XP_011006371.1| PREDICTED: purine permease 3 [Populus euphratica]
Length=356

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            TE+L V+F+ EKFQ++KG++L LSLWGFVSYFYG+ 
Sbjct  296  TEILSVIFFQEKFQAEKGVALGLSLWGFVSYFYGEM  331



>gb|EEE69871.1| hypothetical protein OsJ_29685 [Oryza sativa Japonica Group]
Length=90

 Score = 55.5 bits (132),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+F+ E F   KG++LALSLWGFVSYFYG+
Sbjct  31   VTEVLAVMFFHEPFNGTKGVALALSLWGFVSYFYGE  66



>ref|XP_009783837.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=353

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VVF+ EKF  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVVFFNEKFSGEKGLALFLSLWGFVSYFYGEF  329



>ref|XP_010060067.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=360

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            TE+L V+ + EKFQ++KG++LALSLWGF SYFYG+F
Sbjct  297  TEILAVICFQEKFQAEKGVALALSLWGFASYFYGEF  332



>gb|KCW66598.1| hypothetical protein EUGRSUZ_F00392 [Eucalyptus grandis]
Length=480

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            TE+L V+ + EKFQ++KG++LALSLWGF SYFYG+F
Sbjct  417  TEILAVICFQEKFQAEKGVALALSLWGFASYFYGEF  452



>ref|XP_009148632.1| PREDICTED: purine permease 2-like [Brassica rapa]
Length=376

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQ  153
            +TEVL V F+ EKFQ++KG+SL LSLWGFVSYFYG       ++   ++Q+ EAQ++Q
Sbjct  315  LTEVLAVFFFREKFQAEKGLSLFLSLWGFVSYFYGQI----KSENKTETQDQEAQLSQ  368



>ref|XP_010549318.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=347

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL VVFY E F S+KG+SL LSLWGF SYFYG+
Sbjct  288  VTEVLAVVFYHETFSSEKGVSLVLSLWGFASYFYGE  323



>gb|KDP40942.1| hypothetical protein JCGZ_24941 [Jatropha curcas]
Length=355

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE LGV+FY EKF  +KGISL LSLWGF+SYFYG+ 
Sbjct  304  VTESLGVMFYHEKFHFEKGISLVLSLWGFISYFYGEL  340



>emb|CDY29741.1| BnaA01g19250D [Brassica napus]
Length=377

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 4/58 (7%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQ  153
            +TEVL V F+ EKFQ++KG+SL LSLWGFVSYFYG       ++   ++Q+ EAQ++Q
Sbjct  316  LTEVLAVFFFREKFQAEKGLSLFLSLWGFVSYFYGQI----KSENKTETQDQEAQLSQ  369



>ref|XP_011072345.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Sesamum 
indicum]
Length=341

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            TEVL V+FY EKFQ++KG+SL LSLWGF+SYF+G+
Sbjct  274  TEVLAVIFYHEKFQAEKGVSLFLSLWGFISYFFGE  308



>ref|XP_010060063.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 ref|XP_010060064.1| PREDICTED: purine permease 3-like isoform X2 [Eucalyptus grandis]
 ref|XP_010060065.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 gb|KCW66595.1| hypothetical protein EUGRSUZ_F00389 [Eucalyptus grandis]
Length=360

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TE+LGV+ + EKFQ +K +SL LSLWGFVSYFYG+F
Sbjct  296  ITEILGVICFHEKFQVEKAVSLVLSLWGFVSYFYGEF  332



>ref|XP_007141230.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
 gb|ESW13224.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
Length=344

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVLGV+ Y E F+++KG++L LSLWGFVSYFYG+
Sbjct  284  VTEVLGVIVYKENFEAEKGVALLLSLWGFVSYFYGE  319



>ref|XP_009799246.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=130

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VVF+ E F  +KG++L LSLWGFVSYFYG+F
Sbjct  71   VTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEF  107



>ref|XP_009621473.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+F+ EKF  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVIFFNEKFSGEKGLALFLSLWGFVSYFYGEF  329



>gb|EPS72255.1| hypothetical protein M569_02503, partial [Genlisea aurea]
Length=232

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            TE+L VVF+ EKFQ +KG+SL L+LWGFVSYFYG+
Sbjct  198  TEILAVVFFHEKFQVEKGVSLFLALWGFVSYFYGE  232



>ref|XP_007136297.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
 gb|ESW08291.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
Length=366

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+ Y EKF+++KG+SL LSLWG VSYFYG+ 
Sbjct  300  VTEVLAVILYREKFKAEKGVSLLLSLWGMVSYFYGEI  336



>emb|CDY17197.1| BnaA05g09910D [Brassica napus]
Length=351

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+F+ EKFQ++KG+SL LSLWGFVSYFYG 
Sbjct  291  LTEVLAVLFFKEKFQAEKGVSLFLSLWGFVSYFYGK  326



>ref|XP_010538168.1| PREDICTED: purine permease 1-like [Tarenaya hassleriana]
Length=359

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL VV + E+FQ++KG+SL LSLWGFVSYFYG+
Sbjct  296  LTEVLAVVCFKERFQAEKGVSLVLSLWGFVSYFYGE  331



>ref|XP_009109745.1| PREDICTED: purine permease 1 [Brassica rapa]
 emb|CDX90136.1| BnaA08g18480D [Brassica napus]
Length=352

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+ + EKFQ++KG+SL LS+WGFVSYFYG++
Sbjct  289  VTEVLAVICFREKFQAEKGVSLFLSIWGFVSYFYGEY  325



>emb|CDY35722.1| BnaC03g58430D [Brassica napus]
Length=354

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+ + EKFQ++KG+SL LS+WGFVSYFYG++
Sbjct  291  VTEVLAVICFREKFQAEKGVSLFLSIWGFVSYFYGEY  327



>ref|XP_007018133.1| Purine permease 3, putative [Theobroma cacao]
 gb|EOY15358.1| Purine permease 3, putative [Theobroma cacao]
Length=410

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            V E+L V+FY E FQ++KG++LALS+WGF+SYFYG+
Sbjct  285  VIEILAVIFYKENFQAEKGVALALSVWGFISYFYGN  320



>ref|XP_009603730.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=352

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VVFY E F  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVVFYRENFSGEKGLALFLSLWGFVSYFYGEF  329



>ref|XP_009615076.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 5/63 (8%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQ  147
            VTEVL V+ + EKFQ +KG++L LS+WGF+SYFYG+       +   + Q ++ +M  TQ
Sbjct  290  VTEVLAVIIFHEKFQPEKGVALFLSIWGFISYFYGEM-----KQHKKEKQTLKLEMTNTQ  344

Query  146  TLT  138
            + T
Sbjct  345  SST  347



>gb|AEX11958.1| hypothetical protein 0_18228_02 [Pinus taeda]
Length=98

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TEVLGVV + EKF ++KG+SL L+LWGF SY YG++
Sbjct  26   ITEVLGVVLFHEKFSAEKGMSLVLALWGFASYLYGEY  62



>ref|XP_010266597.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=369

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+F  EKF+++KGISLAL LWGF SYFYG+
Sbjct  314  VTEILAVIFCREKFKAEKGISLALCLWGFTSYFYGE  349



>gb|AEX11959.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11960.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11961.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11962.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11963.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11964.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11965.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11966.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11967.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11968.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11969.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11970.1| hypothetical protein 0_18228_02 [Pinus taeda]
 gb|AEX11971.1| hypothetical protein 0_18228_02 [Pinus taeda]
Length=98

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TEVLGVV + EKF ++KG+SL L+LWGF SY YG++
Sbjct  26   ITEVLGVVLFHEKFSAEKGMSLVLALWGFASYLYGEY  62



>emb|CDY35721.1| BnaC03g58420D [Brassica napus]
Length=319

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VV + EKFQ++KG++L LSLWGFVSYF G+F
Sbjct  255  VTEVLAVVCFREKFQAKKGVALLLSLWGFVSYFSGEF  291



>ref|XP_003615204.1| Purine permease [Medicago truncatula]
 gb|AES98162.1| purine permease [Medicago truncatula]
Length=364

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 6/59 (10%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQT  150
            +TE+L V+ Y EKFQ++KG++L LSLWGFVSYFY +       K   K +N E ++ Q+
Sbjct  307  ITEILAVIVYKEKFQAEKGVALVLSLWGFVSYFYDEI------KEAKKMKNREMELPQS  359



>gb|KDP40961.1| hypothetical protein JCGZ_24960 [Jatropha curcas]
Length=472

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE LGV+FY EKF  +K ISL LSLWGFVSYFYG+ 
Sbjct  421  VTESLGVMFYHEKFHFEKAISLVLSLWGFVSYFYGEL  457



>ref|NP_001147096.1| PUP1 [Zea mays]
 gb|ACG25423.1| PUP1 [Zea mays]
Length=373

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL VVF+ E F   KG++LALSLWGFVSYFYG+
Sbjct  317  VTEVLAVVFFHEPFNGTKGVALALSLWGFVSYFYGE  352



>ref|XP_009143833.1| PREDICTED: purine permease 2 isoform X2 [Brassica rapa]
Length=362

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+F+ EKFQ+ KG+SL LSLWGFVSYFYG 
Sbjct  302  LTEVLAVLFFKEKFQAAKGVSLFLSLWGFVSYFYGK  337



>ref|XP_009143832.1| PREDICTED: purine permease 2 isoform X1 [Brassica rapa]
Length=351

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+F+ EKFQ+ KG+SL LSLWGFVSYFYG 
Sbjct  291  LTEVLAVLFFKEKFQAAKGVSLFLSLWGFVSYFYGK  326



>ref|XP_004237961.1| PREDICTED: purine permease 1-like [Solanum lycopersicum]
Length=374

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+ + EKFQ++KG+++ L+LWGFVSYFYG++
Sbjct  305  VTEVLAVILFHEKFQAEKGVAIFLALWGFVSYFYGEY  341



>ref|XP_003519187.1| PREDICTED: purine permease 1-like [Glycine max]
Length=344

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+ Y E F ++KG++L LSLWGFVSYFYG+
Sbjct  284  VTEVLAVIVYKESFHAEKGVALVLSLWGFVSYFYGE  319



>ref|XP_002307351.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
 gb|EEE94347.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
Length=356

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            TE+L V+F+ EKFQ +KG++L LSLWGFVSYFYG+
Sbjct  296  TEILAVIFFQEKFQVEKGVALGLSLWGFVSYFYGE  330



>ref|XP_010939715.1| PREDICTED: purine permease 3-like [Elaeis guineensis]
Length=362

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VVF+ E F   KG++LAL+LWGFVSYFYG+F
Sbjct  306  VTEVLAVVFFHEPFSGGKGVALALALWGFVSYFYGEF  342



>emb|CDP01126.1| unnamed protein product [Coffea canephora]
Length=353

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV+ V+ + EKFQ++KG++L LSLWGFVSYFYG+ 
Sbjct  292  VTEVIAVIVFQEKFQAEKGVALFLSLWGFVSYFYGEI  328



>ref|XP_009765499.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VVF+ E F  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEF  329



>ref|XP_009599635.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VVF+ E F  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEF  329



>ref|XP_009776518.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VVF+ E F  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEF  329



>ref|XP_009611006.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VVF+ E F  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEF  329



>ref|XP_010244043.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=139

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            V E+L VVF+ EKF ++KG++L LSLWGF SYFYG +
Sbjct  82   VLEILAVVFFREKFTAEKGVALVLSLWGFTSYFYGQY  118



>ref|XP_009769306.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VVF+ E F  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEF  329



>ref|XP_009795252.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL VVF+ E F  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVVFFRENFSGEKGLALFLSLWGFVSYFYGEF  329



>gb|KFK31021.1| hypothetical protein AALP_AA6G057800 [Arabis alpina]
Length=317

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 6/56 (11%)
 Frame = -2

Query  320  EVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQ  153
            E+L ++F+ EKFQ++KG+SL LSLWGFVSYFYG        K+ NK+Q+ E Q++Q
Sbjct  260  ELLAILFFREKFQAEKGVSLGLSLWGFVSYFYGQI------KSENKTQDHETQLSQ  309



>ref|XP_010478191.1| PREDICTED: purine permease 1-like [Camelina sativa]
Length=354

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TEVL VV + EKFQ++K  SL LSLWGFVSYFYG+F
Sbjct  289  MTEVLAVVCFREKFQAEKCASLLLSLWGFVSYFYGEF  325



>ref|XP_009380884.1| PREDICTED: purine permease 3-like [Musa acuminata subsp. malaccensis]
Length=117

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVLGVVF+ E F S+KG++LALSLWG  SY  G++
Sbjct  64   VTEVLGVVFFKENFSSEKGVALALSLWGLASYCCGEY  100



>ref|XP_006338103.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=354

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+ + EKFQ++KG+++ L+LWGFVSYFYG++
Sbjct  285  VTEVLAVILFHEKFQAEKGVAIFLALWGFVSYFYGEY  321



>ref|XP_009598031.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=353

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+F+ E F  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVIFFKENFSGEKGLALFLSLWGFVSYFYGEF  329



>gb|ADP30798.1| nicotine uptake permease 1 [Nicotiana tabacum]
Length=353

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+F+ E F  +KG++L LSLWGFVSYFYG+F
Sbjct  293  VTEVLAVIFFKENFSGEKGLALFLSLWGFVSYFYGEF  329



>emb|CDY12422.1| BnaC08g09110D [Brassica napus]
Length=376

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQ  153
            +TEVL V F+ EKFQ++K ISL LSLWGFVSYFYG        +   ++ + EAQ++Q
Sbjct  317  LTEVLAVFFFREKFQAEKSISLFLSLWGFVSYFYGQI----KAENKTETPDQEAQLSQ  370



>emb|CDY16284.1| BnaC01g23190D [Brassica napus]
Length=377

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQ  153
            +TEVL V F+ EKFQ++K ISL LSLWGFVSYFYG        +   ++ + EAQ++Q
Sbjct  318  LTEVLAVFFFREKFQAEKSISLFLSLWGFVSYFYGQI----KAENKTETPDQEAQLSQ  371



>gb|EMS67133.1| hypothetical protein TRIUR3_29861 [Triticum urartu]
Length=136

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+F  EKF S+KG++LALSLWG  SY YG++
Sbjct  82   VTEVLAVIFLHEKFTSEKGVALALSLWGLASYSYGEY  118



>ref|XP_010266586.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=373

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            + E+L V+FY EKF+ +KGISL L+LWGF SYFYG+ 
Sbjct  313  ILEILAVIFYKEKFKGEKGISLTLALWGFTSYFYGEL  349



>gb|EMT03626.1| hypothetical protein F775_30132 [Aegilops tauschii]
Length=116

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+F  EKF S+KG++LALSLWG  SY YG++
Sbjct  63   VTEVLAVIFLHEKFTSEKGVALALSLWGLASYSYGEY  99



>ref|XP_006661330.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=377

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+F+ E F   KG++LALSLWGFVSYFYG+
Sbjct  321  VTEVLAVMFFHEPFNGTKGVALALSLWGFVSYFYGE  356



>ref|XP_010549316.1| PREDICTED: purine permease 3 [Tarenaya hassleriana]
Length=340

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+ + EKF  +K +SL LSLWGFVSYFYG+
Sbjct  283  ITEVLAVIIFHEKFPPEKAVSLVLSLWGFVSYFYGE  318



>ref|XP_010060066.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=367

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE+L ++ + E FQ+ KG+SLALSLWG  SYFYG+F
Sbjct  314  VTEILAIICFRETFQAAKGVSLALSLWGLASYFYGEF  350



>ref|XP_010939717.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=362

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            V++VL VVF+ E F ++KG++LAL+LWGF SYFYG+F
Sbjct  306  VSQVLAVVFFHEPFSAEKGVALALALWGFASYFYGEF  342



>ref|XP_008667894.1| PREDICTED: PUP1 isoform X1 [Zea mays]
 tpg|DAA40285.1| TPA: PUP1 [Zea mays]
Length=387

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL VVF+ E F   KG++LALSLWGFVSYFYG+
Sbjct  330  VTEVLAVVFFHEPFNGTKGVALALSLWGFVSYFYGE  365



>ref|XP_006661331.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=269

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TEVLGV+F  EKF S+KG++L LSLWG  SY YG++
Sbjct  217  ITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYGEY  253



>gb|EPS58880.1| hypothetical protein M569_15931, partial [Genlisea aurea]
Length=137

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
             E+LG +F+ EKF ++KGISL L LWGFVSY+YG+
Sbjct  101  VEILGAIFFREKFDAEKGISLFLCLWGFVSYYYGE  135



>ref|XP_009380886.1| PREDICTED: purine permease 3-like [Musa acuminata subsp. malaccensis]
Length=365

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVLGVVF+ E F S+KGI+L LSLWG  SY YG++
Sbjct  312  VTEVLGVVFFKENFSSEKGIALVLSLWGLASYSYGEY  348



>gb|EPS67422.1| hypothetical protein M569_07351, partial [Genlisea aurea]
Length=319

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            TE+L V+F+ EKFQ++KG+SL LSL+GFVSYFYG++
Sbjct  283  TEILAVLFFREKFQAEKGVSLFLSLFGFVSYFYGEY  318



>ref|XP_010675382.1| PREDICTED: purine permease 3-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TE+  + FY EKFQ +KG+SL LSLWGF SYFYG+
Sbjct  331  ITEIAAIFFYHEKFQVEKGVSLVLSLWGFFSYFYGE  366



>gb|EAZ09425.1| hypothetical protein OsI_31698 [Oryza sativa Indica Group]
Length=388

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+F+ E F   KG++LALSLWGFVSYFYG+
Sbjct  329  VTEVLAVMFFHEPFNGTKGVALALSLWGFVSYFYGE  364



>ref|NP_001063424.1| Os09g0467300 [Oryza sativa Japonica Group]
 dbj|BAD17524.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAD19735.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25338.1| Os09g0467300 [Oryza sativa Japonica Group]
Length=390

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+F+ E F   KG++LALSLWGFVSYFYG+
Sbjct  331  VTEVLAVMFFHEPFNGTKGVALALSLWGFVSYFYGE  366



>ref|XP_003579811.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=365

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVLGV+F  EKF S+KG++L LSLWG  SY YG++
Sbjct  312  VTEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYGEY  348



>ref|XP_002462514.1| hypothetical protein SORBIDRAFT_02g027090 [Sorghum bicolor]
 gb|EER99035.1| hypothetical protein SORBIDRAFT_02g027090 [Sorghum bicolor]
Length=378

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+F+ E F   KG++LALSLWGFVSYFYG+
Sbjct  318  VTEVLAVMFFHEPFNGTKGVALALSLWGFVSYFYGE  353



>gb|KGN64615.1| hypothetical protein Csa_1G071290 [Cucumis sativus]
Length=366

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L VV + EKFQ++K ISL L+LWGFVSYFYG+
Sbjct  304  VTEILAVVTFNEKFQAEKTISLILNLWGFVSYFYGE  339



>tpg|DAA40287.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=98

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  V+F  EKF S+KG++LALSLWG  SY YG++
Sbjct  39   VTEVAAVIFLHEKFSSEKGVALALSLWGLASYSYGEW  75



>ref|XP_002531513.1| purine transporter, putative [Ricinus communis]
 gb|EEF30867.1| purine transporter, putative [Ricinus communis]
Length=380

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE L V FY EKF+ +KGISL LSLWGF+ YFYG+ 
Sbjct  329  VTETLAVFFYHEKFRVEKGISLVLSLWGFMFYFYGEL  365



>ref|XP_008446590.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=366

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L V+ + EKFQ++K ISL L+LWGFVSYFYG+
Sbjct  305  VTEILAVIIFNEKFQAEKTISLILNLWGFVSYFYGE  340



>ref|XP_006410518.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
 gb|ESQ51971.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
Length=372

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +TEVL V+ + EKFQ++KG+SL LSLWGF+SYFYG 
Sbjct  310  LTEVLAVLCFREKFQAEKGLSLFLSLWGFLSYFYGQ  345



>ref|XP_004959530.1| PREDICTED: purine permease 1-like [Setaria italica]
Length=378

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+ + E F   KG++LALSLWGFVSYFYG+
Sbjct  320  VTEVLAVMLFSEPFNGTKGVALALSLWGFVSYFYGE  355



>ref|XP_004146629.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=355

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE+L VV + EKFQ++K ISL L+LWGFVSYFYG+
Sbjct  293  VTEILAVVTFNEKFQAEKTISLILNLWGFVSYFYGE  328



>gb|EMS54152.1| hypothetical protein TRIUR3_17062 [Triticum urartu]
Length=156

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEV  ++F+ E F   KG++LA+S+WGF+SYFYG+
Sbjct  102  VTEVFAILFFHEPFNGTKGVALAISIWGFISYFYGE  137



>ref|XP_006415683.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
 gb|ESQ34036.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
Length=338

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  314  LGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            L   FY EKFQ++KG+SLALSLWGFVSYFYG+
Sbjct  281  LSCYFYHEKFQAEKGLSLALSLWGFVSYFYGE  312



>gb|EPS74474.1| hypothetical protein M569_00285, partial [Genlisea aurea]
Length=311

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            + E+L VV + EKF+ +KG+SL LSLWG VSYFYG+F
Sbjct  275  LCEILAVVLFREKFRPEKGVSLLLSLWGSVSYFYGEF  311



>ref|XP_010469434.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=350

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VT VL V+ + EKFQ+ KG++LALSLWG VSYFYG F
Sbjct  288  VTVVLAVICFQEKFQAGKGVALALSLWGSVSYFYGQF  324



>ref|XP_003578263.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=397

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+F+ E F   KGI+LALSLWGFVSY YG+
Sbjct  338  VTEVLAVMFFHEPFNGTKGIALALSLWGFVSYLYGE  373



>ref|XP_010509840.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=380

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VT VL V+ + EKFQ+ KG++LALSLWG VSYFYG F
Sbjct  318  VTVVLAVICFQEKFQAGKGVALALSLWGSVSYFYGQF  354



>ref|XP_010244044.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=357

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            V E+L VV + EKF ++KGI+L LSLWGF SYFYG +
Sbjct  302  VLEILAVVLFREKFTAEKGIALVLSLWGFTSYFYGQY  338



>ref|XP_004490401.1| PREDICTED: purine permease 1-like [Cicer arietinum]
Length=361

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTE++ V+ Y E F ++KG++L LSLWGFVSYFYG+
Sbjct  304  VTEIMAVIVYKENFHAEKGVALVLSLWGFVSYFYGE  339



>ref|XP_006661332.1| PREDICTED: purine permease 3-like, partial [Oryza brachyantha]
Length=265

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TEVL VVF  EKF S+KG++L LSLWG  SY YG++
Sbjct  209  ITEVLSVVFLHEKFSSEKGVALVLSLWGLASYSYGEY  245



>dbj|BAJ86755.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEVL V+F  EKF S+KG++L LSLWG  SY YG++
Sbjct  307  VTEVLAVIFLHEKFSSEKGVALVLSLWGLASYSYGEY  343



>ref|XP_009401279.1| PREDICTED: purine permease 1-like [Musa acuminata subsp. malaccensis]
Length=368

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  V+F+ EKF S+KG++LALSLWG  SY YG++
Sbjct  314  VTEVFAVIFFKEKFGSEKGVALALSLWGLASYSYGEY  350



>dbj|BAK04933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+F+ E F   KG++LALSLWGFVSY YG+
Sbjct  323  VTEVLAVMFFHEPFNGTKGVALALSLWGFVSYLYGE  358



>gb|EEE69873.1| hypothetical protein OsJ_29687 [Oryza sativa Japonica Group]
Length=341

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYG  222
            +TEVLGV+F  EKF S+KG++L LSLWG  SY YG
Sbjct  288  ITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYG  322



>ref|XP_010413817.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=349

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VT VL V+ + EKFQ+ KGI+L LSLWG VSYFYG F
Sbjct  287  VTVVLAVICFQEKFQAGKGIALTLSLWGSVSYFYGQF  323



>gb|EPS58319.1| hypothetical protein M569_16495 [Genlisea aurea]
Length=163

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -2

Query  320  EVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            E+LG +F+ EKF ++KGISL L LWGF SY+YG+
Sbjct  92   EILGAIFFREKFGAEKGISLFLCLWGFASYYYGE  125



>ref|XP_009770717.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=350

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQ  147
            VTEVL VVF+ E F  +KG++L L LWGFVS FYG+F          K+++++++M  T+
Sbjct  293  VTEVLAVVFFRENFLVEKGLALFLCLWGFVSCFYGEF----RQTKKQKNKSLKSEMTTTR  348

Query  146  TL  141
            T+
Sbjct  349  TV  350



>dbj|BAD19737.1| putative purine permease [Oryza sativa Japonica Group]
Length=361

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYG  222
            +TEVLGV+F  EKF S+KG++L LSLWG  SY YG
Sbjct  308  ITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYG  342



>ref|XP_010234593.1| PREDICTED: purine permease 3-like isoform X1 [Brachypodium distachyon]
Length=375

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            V+EVL V+F+ E F   KGI+L LSLWG +SYFYGD
Sbjct  320  VSEVLAVIFFHEPFSPTKGIALGLSLWGLISYFYGD  355



>gb|EEC84724.1| hypothetical protein OsI_31699 [Oryza sativa Indica Group]
Length=361

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYG  222
            +TEVLGV+F  EKF S+KG++L LSLWG  SY YG
Sbjct  308  ITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYG  342



>ref|NP_001063425.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAD19736.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25339.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAG90051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYG  222
            +TEVLGV+F  EKF S+KG++L LSLWG  SY YG
Sbjct  308  ITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYG  342



>dbj|BAJ88843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL VVF+ E F   KG++L LSLWG  SYFYG+
Sbjct  360  VTEVLAVVFFHEPFSGTKGVALGLSLWGLASYFYGE  395



>ref|XP_008667169.1| PREDICTED: uncharacterized protein LOC100193377 isoform X1 [Zea 
mays]
 gb|ACR36679.1| unknown [Zea mays]
 tpg|DAA40290.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=363

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  V+F  EKF S+KG++LALSLWG  SY YG++
Sbjct  304  VTEVAAVIFLHEKFSSEKGVALALSLWGLASYSYGEW  340



>gb|EYU38177.1| hypothetical protein MIMGU_mgv1a023817mg [Erythranthe guttata]
Length=357

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 9/59 (15%)
 Frame = -2

Query  314  LGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQTLT  138
            LGV  Y EKFQ++KGI+L LSLWGF+SYF+G+           K++N      QT+T T
Sbjct  296  LGVFIYNEKFQAEKGIALFLSLWGFISYFFGEI---------TKTKNSNENNDQTRTTT  345



>gb|EMT19524.1| Purine permease 3 [Aegilops tauschii]
Length=333

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL V+F+ E F   KG++LALSLWGFVSY YG+
Sbjct  279  VTEVLAVLFFHEPFNGTKGVALALSLWGFVSYLYGE  314



>dbj|BAJ87663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VTEVL VVF+ E F   KG++L LSLWG  SYFYG+
Sbjct  331  VTEVLAVVFFHEPFSGTKGVALGLSLWGLASYFYGE  366



>ref|NP_001131978.1| uncharacterized protein LOC100193377 [Zea mays]
 gb|ACF80629.1| unknown [Zea mays]
 gb|ACG41442.1| ATPUP3 [Zea mays]
 tpg|DAA40288.1| TPA: ATPUP3 [Zea mays]
Length=361

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  V+F  EKF S+KG++LALSLWG  SY YG++
Sbjct  302  VTEVAAVIFLHEKFSSEKGVALALSLWGLASYSYGEW  338



>ref|XP_010509839.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=351

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VT VL V+ + EKFQ+ KG++LALSLWG VSYFYG 
Sbjct  289  VTVVLAVICFQEKFQAGKGVALALSLWGSVSYFYGQ  324



>gb|EMS56376.1| hypothetical protein TRIUR3_06437 [Triticum urartu]
Length=139

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++E+L V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  73   LSEILAVLFLHEKFDGPKGIALVLSLWGFASYMYGE  108



>ref|XP_010509841.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=347

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VT VL V+ + EKFQ+ KG++LALSLWG VSYFYG 
Sbjct  285  VTVVLAVICFQEKFQAGKGVALALSLWGSVSYFYGQ  320



>gb|AFG48576.1| hypothetical protein 0_17711_02, partial [Pinus taeda]
 gb|AFG48577.1| hypothetical protein 0_17711_02, partial [Pinus taeda]
 gb|AFG48578.1| hypothetical protein 0_17711_02, partial [Pinus taeda]
 gb|AFG48579.1| hypothetical protein 0_17711_02, partial [Pinus taeda]
 gb|AFG48580.1| hypothetical protein 0_17711_02, partial [Pinus taeda]
 gb|AFG48581.1| hypothetical protein 0_17711_02, partial [Pinus taeda]
 gb|AFG48582.1| hypothetical protein 0_17711_02, partial [Pinus taeda]
 gb|AFG48583.1| hypothetical protein 0_17711_02, partial [Pinus taeda]
 gb|AFG48584.1| hypothetical protein 0_17711_02, partial [Pinus taeda]
 gb|AFG48585.1| hypothetical protein 0_17711_02, partial [Pinus taeda]
Length=142

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            TEVL V+ + EKF ++KG+SL L+LWG  SY YG++
Sbjct  79   TEVLAVLLFHEKFSAEKGMSLVLALWGLASYLYGEY  114



>ref|XP_010413821.1| PREDICTED: purine permease 2 [Camelina sativa]
Length=351

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VT VL V+ + EKFQ+ KG++LALSLWG VSYFYG 
Sbjct  292  VTVVLAVICFQEKFQAGKGVALALSLWGSVSYFYGQ  327



>gb|EPS58788.1| hypothetical protein M569_16026, partial [Genlisea aurea]
Length=330

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            + EVL VVF+ +++  +KGI+L LSLWGFVSYFYG++
Sbjct  287  LVEVLAVVFFKDEYPPEKGIALFLSLWGFVSYFYGEY  323



>gb|EYU21538.1| hypothetical protein MIMGU_mgv1a020196mg [Erythranthe guttata]
Length=353

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  314  LGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            LGV  Y EKFQ++KGI+L LSLWGF+SYF+G+
Sbjct  292  LGVFIYNEKFQAEKGIALFLSLWGFISYFFGE  323



>gb|EMS56377.1| hypothetical protein TRIUR3_06438 [Triticum urartu]
Length=142

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++E+L V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  76   LSEILAVLFLHEKFDGPKGIALVLSLWGFASYMYGE  111



>ref|XP_007042880.1| Purine permease 3 [Theobroma cacao]
 gb|EOX98711.1| Purine permease 3 [Theobroma cacao]
Length=419

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE L V+F+ EKFQ +K IS+ LSLWG +SYFYG+ 
Sbjct  369  VTESLAVLFFHEKFQVEKAISVVLSLWGSLSYFYGEL  405



>ref|NP_001136854.1| hypothetical protein [Zea mays]
 gb|ACF82767.1| unknown [Zea mays]
 gb|AFW89428.1| hypothetical protein ZEAMMB73_630266 [Zea mays]
Length=394

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 35/62 (56%), Gaps = 14/62 (23%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQ  147
            ++EVL V+F  EKF   KGI+L LSLWGF SY YG              +  +++M QTQ
Sbjct  332  LSEVLAVIFLHEKFDGPKGIALVLSLWGFASYLYG--------------EKAQSKMQQTQ  377

Query  146  TL  141
             +
Sbjct  378  KM  379



>ref|XP_007042882.1| Purine permease 3 isoform 2 [Theobroma cacao]
 gb|EOX98713.1| Purine permease 3 isoform 2 [Theobroma cacao]
Length=338

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE L V+F+ EKFQ +K IS+ LSLWG +SYFYG+ 
Sbjct  288  VTESLAVLFFHEKFQVEKAISVVLSLWGSLSYFYGEL  324



>gb|EMT04632.1| hypothetical protein F775_02042 [Aegilops tauschii]
Length=148

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++E+L V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  82   LSEILAVLFLHEKFDGPKGIALVLSLWGFASYMYGE  117



>ref|XP_002881298.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57557.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
Length=358

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VT +L V+ + EKFQ+ KG++LALSLWG VSYFYG 
Sbjct  299  VTVILAVICFQEKFQAGKGVALALSLWGSVSYFYGQ  334



>gb|EMS59470.1| hypothetical protein TRIUR3_33863 [Triticum urartu]
Length=169

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++EVL V+F  EKF   KGI+L L LWGF SY YG+
Sbjct  103  LSEVLAVIFLHEKFDGPKGIALVLCLWGFASYMYGE  138



>ref|XP_006295883.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
 gb|EOA28781.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
Length=349

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VT +L V+ + EKFQ+ KG++LALSLWG VSYFYG 
Sbjct  288  VTVILAVICFREKFQAGKGVALALSLWGSVSYFYGQ  323



>tpg|DAA43787.1| TPA: hypothetical protein ZEAMMB73_057798 [Zea mays]
Length=312

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++EVL V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  250  LSEVLAVIFLHEKFDGPKGIALVLSLWGFASYLYGE  285



>ref|NP_973592.1| purine permease 2 [Arabidopsis thaliana]
 gb|AEC08879.1| purine permease 2 [Arabidopsis thaliana]
Length=347

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VT +L V+ + EKFQ+ KG++LALSLWG VSYFYG 
Sbjct  288  VTVILAVICFQEKFQAGKGVALALSLWGSVSYFYGQ  323



>ref|NP_180931.2| purine permease 2 [Arabidopsis thaliana]
 sp|Q94GB1.1|PUP2_ARATH RecName: Full=Purine permease 2; Short=AtPUP2 [Arabidopsis thaliana]
 gb|AAK61813.1|AF078532_1 putative purine permease [Arabidopsis thaliana]
 gb|AEC08880.1| purine permease 2 [Arabidopsis thaliana]
Length=358

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VT +L V+ + EKFQ+ KG++LALSLWG VSYFYG 
Sbjct  299  VTVILAVICFQEKFQAGKGVALALSLWGSVSYFYGQ  334



>gb|AAC69140.1| hypothetical protein [Arabidopsis thaliana]
Length=356

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            VT +L V+ + EKFQ+ KG++LALSLWG VSYFYG 
Sbjct  297  VTVILAVICFQEKFQAGKGVALALSLWGSVSYFYGQ  332



>ref|XP_006841261.1| hypothetical protein AMTR_s00135p00099660 [Amborella trichopoda]
 gb|ERN02936.1| hypothetical protein AMTR_s00135p00099660 [Amborella trichopoda]
Length=366

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++E+L V+F+ EKF  +KG++L LS+WGFVSYFYG+
Sbjct  312  LSELLVVIFFHEKFTGEKGMALVLSMWGFVSYFYGE  347



>ref|XP_010926344.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=367

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            V E+L V+F  EKF   KG++LAL LWGF SY YG+ 
Sbjct  312  VGEILAVIFLNEKFNGSKGVALALCLWGFASYMYGEM  348



>dbj|BAJ94351.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  V+ + E F   KG++LA+S+WGF+SYFYG+ 
Sbjct  341  VTEVFAVLLFHEPFNGTKGVALAISIWGFISYFYGEI  377



>ref|XP_002462515.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
 gb|EER99036.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
Length=365

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  V+F  EKF S+KG++L LSLWG  SY YG++
Sbjct  305  VTEVAAVIFLHEKFSSEKGVALVLSLWGLASYSYGEW  341



>dbj|BAJ95836.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95854.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97308.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++EVL V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  324  LSEVLAVIFLHEKFDGPKGIALVLSLWGFASYMYGE  359



>ref|XP_006841259.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
 gb|ERN02934.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
Length=362

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYG  222
            +TE+L V+FY EKF  +K ++L +SLWGF SY YG
Sbjct  304  ITEILAVIFYHEKFTGEKAMALIMSLWGFASYIYG  338



>ref|XP_004959525.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=409

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  V+F  EKF S+KG++L LSLWG  SY YG++
Sbjct  355  VTEVAAVIFLHEKFSSEKGVALVLSLWGLASYSYGEW  391



>ref|XP_006841262.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
 gb|ERN02937.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
Length=357

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +T +L V+F+ EKF ++KG++L L LWGF SY+YG+
Sbjct  303  LTSILAVIFFHEKFSAEKGMALVLCLWGFASYYYGE  338



>ref|XP_006358992.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=358

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTE+L +V + EKFQ +KG+++ L+L GFVSYFYG+ 
Sbjct  297  VTEILAIVLFHEKFQVEKGVAIFLALCGFVSYFYGEI  333



>ref|XP_004957086.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=356

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  V+F  EKF S+KG++L LSLWG  SY YG++
Sbjct  302  VTEVAAVIFLHEKFSSEKGVALVLSLWGLASYSYGEW  338



>ref|XP_010263028.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=365

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TE+  V+ Y EKF  +KG++LAL  WGF+SYFYG +
Sbjct  314  LTEIAAVIVYHEKFTGEKGMALALCSWGFISYFYGSY  350



>ref|XP_008795222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=351

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -2

Query  320  EVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            E+L V+F  EKF   K ++LALSLWGF SY YG+ 
Sbjct  298  EILPVIFLNEKFNGSKAVALALSLWGFASYLYGEL  332



>ref|XP_006373040.1| hypothetical protein POPTR_0017s07610g, partial [Populus trichocarpa]
 gb|ERP50837.1| hypothetical protein POPTR_0017s07610g, partial [Populus trichocarpa]
Length=251

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  311  GVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
             V+FY EKF ++K ISL LSLWGF SYFYG+
Sbjct  193  AVLFYHEKFHAEKAISLVLSLWGFFSYFYGE  223



>gb|EMT04631.1| hypothetical protein F775_14106 [Aegilops tauschii]
Length=151

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++++L V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  82   LSQILAVMFLHEKFDGPKGIALVLSLWGFASYMYGE  117



>ref|XP_010247465.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=364

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  320  EVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            EV  V+ Y EKF  +KGI+LAL LWGF SYFYG++
Sbjct  312  EVGAVIAYHEKFTGEKGIALALCLWGFTSYFYGEY  346



>ref|XP_008651823.1| PREDICTED: purine permease 3 [Zea mays]
 tpg|DAA43786.1| TPA: hypothetical protein ZEAMMB73_889347 [Zea mays]
Length=391

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++E+L V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  329  LSEILAVIFLHEKFDGPKGIALVLSLWGFASYLYGE  364



>ref|XP_002465736.1| hypothetical protein SORBIDRAFT_01g044690 [Sorghum bicolor]
 gb|EER92734.1| hypothetical protein SORBIDRAFT_01g044690 [Sorghum bicolor]
Length=370

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++EVL VVF  EKF   KG++L L LWGFVSY YG+
Sbjct  309  LSEVLAVVFLHEKFDGVKGVALVLCLWGFVSYLYGE  344



>ref|XP_004985416.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=392

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +++VL V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  328  LSQVLSVIFLHEKFNGPKGIALVLSLWGFASYLYGE  363



>ref|XP_003561966.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=383

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++E+L V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  315  LSEILAVMFLHEKFDGPKGIALVLSLWGFASYIYGE  350



>ref|XP_006651115.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=354

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +++VL V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  288  LSQVLAVIFLHEKFDGTKGIALVLSLWGFASYLYGE  323



>gb|EAY88839.1| hypothetical protein OsI_10311 [Oryza sativa Indica Group]
Length=398

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYG  222
            +++VL V+F  EKF   KGI+L LSLWGF SY YG
Sbjct  331  LSQVLAVIFLHEKFDGTKGIALVLSLWGFASYLYG  365



>ref|XP_008812221.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=361

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            V EVL V+F+ E F   KG++L L+LWG  SYFYG+F
Sbjct  305  VAEVLAVIFFHESFSGGKGVALVLALWGLASYFYGEF  341



>ref|NP_001049213.1| Os03g0187800 [Oryza sativa Japonica Group]
 gb|AAN64138.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94375.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11127.1| Os03g0187800 [Oryza sativa Japonica Group]
Length=399

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYG  222
            +++VL V+F  EKF   KGI+L LSLWGF SY YG
Sbjct  332  LSQVLAVIFLHEKFDGTKGIALVLSLWGFASYLYG  366



>ref|XP_010248452.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=326

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  323  TEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
             E+  V+ Y EKF  +KGI+LAL LWGF SYFYG++
Sbjct  273  AEIGAVIAYHEKFTGEKGIALALCLWGFTSYFYGEY  308



>ref|XP_003558629.1| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=389

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++E+L V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  321  LSEILAVMFLHEKFDGPKGIALVLSLWGFASYIYGE  356



>ref|XP_004985414.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=376

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++EVL V+F  EKF   KGI+L L LWGFVSY YG+
Sbjct  311  LSEVLAVIFLHEKFDGVKGIALVLCLWGFVSYLYGE  346



>gb|EEE58463.1| hypothetical protein OsJ_09707 [Oryza sativa Japonica Group]
Length=299

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQ  153
            +++VL V+F  EKF   KGI+L LSLWGF SY YG+    K      + +  E  +AQ
Sbjct  232  LSQVLAVIFLHEKFDGTKGIALVLSLWGFASYLYGEKAQKKKEAQKMREREQEVALAQ  289



>ref|XP_010942638.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
 ref|XP_010942639.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=365

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            V E+ G +F  EKF S+KG+SLAL LWG  SY YG++
Sbjct  307  VIELFGAIFLHEKFTSEKGVSLALCLWGLASYSYGEY  343



>ref|XP_010942637.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=448

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            V E+ G +F  EKF S+KG+SLAL LWG  SY YG++
Sbjct  390  VIELFGAIFLHEKFTSEKGVSLALCLWGLASYSYGEY  426



>ref|XP_010263027.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=365

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            +TE   V+ Y EKF  +KG++LAL  WGF+SYFYG +
Sbjct  314  LTETAAVIVYHEKFTGEKGMALALCSWGFISYFYGSY  350



>emb|CDP08377.1| unnamed protein product [Coffea canephora]
Length=356

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYG  222
            VT  + VV + EKF  +KG++L LSLWGFVSYFYG
Sbjct  292  VTGAIAVVAFDEKFPPEKGVALFLSLWGFVSYFYG  326



>tpg|DAA61854.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=394

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  V+F  E+F S+KG++L LSLWG  SY YG++
Sbjct  331  VTEVAAVIFLRERFSSEKGVALVLSLWGLASYSYGEW  367



>dbj|BAJ96346.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            ++++L V+F  EKF   KGI+L LSLWGF SY YG+
Sbjct  325  LSQILAVLFLHEKFDGPKGIALVLSLWGFASYMYGE  360



>gb|EPS67075.1| hypothetical protein M569_07701, partial [Genlisea aurea]
Length=94

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQK-GISLALSLWGFVSYFYGDF  216
            + EVL VVF+ + +  +K G++L LSLWGFVSYFYG++
Sbjct  57   LVEVLAVVFFKDPYPPEKKGVALFLSLWGFVSYFYGEY  94



>ref|XP_006338102.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=352

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = -2

Query  311  GVVFYGEKFQSQKGISLALSLWGFVSYFYGDFkssktnktinkSQNVEAQMAQTQTL  141
            GV+ Y E FQ  KG+++ LSLWGFVSYFYG+ K SK  +     Q    +M QT  L
Sbjct  296  GVILYHETFQVTKGLAIFLSLWGFVSYFYGEMKQSKKKEESPIPQT---EMVQTSPL  349



>ref|XP_004985415.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=389

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGD  219
            +++VL V+F  EKF   KGI+L L LWGF SY YG+
Sbjct  326  LSQVLSVIFLHEKFDGPKGIALVLCLWGFASYLYGE  361



>ref|XP_008652812.1| PREDICTED: purine permease 3-like [Zea mays]
 tpg|DAA61853.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=367

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  326  VTEVLGVVFYGEKFQSQKGISLALSLWGFVSYFYGDF  216
            VTEV  V+F  E+F S+KG++L LSLWG  SY YG++
Sbjct  304  VTEVAAVIFLRERFSSEKGVALVLSLWGLASYSYGEW  340



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 534011108320