BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8766_g2_i1 len=156 path=[134:0-155]

Length=156
                                                                      Score     E

ref|XP_009764431.1|  PREDICTED: cysteine-rich receptor-like prote...    107   1e-25   
ref|XP_009615413.1|  PREDICTED: cysteine-rich receptor-like prote...    107   1e-25   
ref|XP_006352393.1|  PREDICTED: cysteine-rich receptor-like prote...    106   4e-25   
ref|XP_006352473.1|  PREDICTED: probable LRR receptor-like serine...    102   1e-24   
ref|XP_006352395.1|  PREDICTED: cysteine-rich receptor-like prote...    104   2e-24   
ref|XP_004250234.1|  PREDICTED: putative receptor-like protein ki...    104   2e-24   
emb|CDP01668.1|  unnamed protein product                                102   5e-24   
gb|EPS69045.1|  hypothetical protein M569_05722                         101   2e-23   
ref|XP_010940309.1|  PREDICTED: cysteine-rich receptor-like prote...  99.8    9e-23   
ref|XP_006352392.1|  PREDICTED: cysteine-rich receptor-like prote...  99.4    1e-22   
ref|XP_008381407.1|  PREDICTED: cysteine-rich receptor-like prote...  99.0    2e-22   
ref|XP_010911314.1|  PREDICTED: cysteine-rich receptor-like prote...  96.3    2e-22   
ref|XP_011085909.1|  PREDICTED: cysteine-rich receptor-like prote...  98.6    3e-22   
ref|XP_002265619.1|  PREDICTED: cysteine-rich receptor-like prote...  98.2    3e-22   Vitis vinifera
emb|CAN82890.1|  hypothetical protein VITISV_005057                   98.2    4e-22   Vitis vinifera
ref|XP_010234835.1|  PREDICTED: cysteine-rich receptor-like prote...  98.2    4e-22   
ref|XP_009341862.1|  PREDICTED: cysteine-rich receptor-like prote...  98.2    4e-22   
dbj|BAF95165.1|  protein kinase                                       97.4    5e-22   Ipomoea nil [qian niu]
ref|NP_001235591.1|  receptor-like protein kinase                     94.4    8e-22   
gb|KHN08753.1|  Cysteine-rich receptor-like protein kinase 2          97.1    9e-22   
ref|XP_003553121.2|  PREDICTED: cysteine-rich receptor-like prote...  97.1    9e-22   
gb|KHN08751.1|  Cysteine-rich receptor-like protein kinase 2          97.1    9e-22   
ref|XP_003553123.1|  PREDICTED: cysteine-rich receptor-like prote...  97.1    9e-22   
gb|KHN18255.1|  Cysteine-rich receptor-like protein kinase 2          97.1    9e-22   
ref|XP_003537415.1|  PREDICTED: cysteine-rich receptor-like prote...  97.1    9e-22   
ref|XP_008813262.1|  PREDICTED: cysteine-rich receptor-like prote...  96.7    1e-21   
gb|EYU34522.1|  hypothetical protein MIMGU_mgv1a002613mg              96.7    1e-21   
gb|EMS35623.1|  Cysteine-rich receptor-like protein kinase 42         94.7    1e-21   
ref|XP_007048591.1|  Leucine-rich repeat transmembrane protein ki...  94.7    1e-21   
ref|XP_009400308.1|  PREDICTED: cysteine-rich receptor-like prote...  96.3    1e-21   
ref|XP_009400606.1|  PREDICTED: cysteine-rich receptor-like prote...  96.3    1e-21   
ref|XP_002298473.2|  hypothetical protein POPTR_0001s28330g           95.9    2e-21   Populus trichocarpa [western balsam poplar]
gb|EMT32931.1|  Cysteine-rich receptor-like protein kinase 42         94.7    2e-21   
emb|CBI27330.3|  unnamed protein product                              95.5    2e-21   
ref|XP_004293009.1|  PREDICTED: cysteine-rich receptor-like prote...  95.9    2e-21   
gb|ABB47798.1|  expressed protein                                     93.2    2e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CBH32626.1|  protein kinase, putative, expressed                  95.9    2e-21   
emb|CDM80466.1|  unnamed protein product                              95.9    2e-21   
ref|XP_007099567.1|  Serine-threonine protein kinase, plant-type,...  95.1    2e-21   
ref|XP_010648890.1|  PREDICTED: cysteine-rich receptor-like prote...  95.5    3e-21   
gb|KHN45759.1|  Putative LRR receptor-like serine/threonine-prote...  94.0    3e-21   
gb|AAM91884.1|  putative receptor-like protein kinase                 93.6    3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064885.1|  Os10g0483400                                     93.6    3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006591283.1|  PREDICTED: cysteine-rich receptor-like prote...  95.5    3e-21   
ref|XP_006591282.1|  PREDICTED: cysteine-rich receptor-like prote...  95.5    3e-21   
ref|XP_002323759.2|  hypothetical protein POPTR_0017s01840g           95.5    4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_002265819.1|  PREDICTED: cysteine-rich receptor-like prote...  95.5    4e-21   Vitis vinifera
ref|XP_007221536.1|  hypothetical protein PRUPE_ppa022817mg           95.1    4e-21   
ref|XP_008227865.1|  PREDICTED: cysteine-rich receptor-like prote...  95.1    4e-21   
emb|CBI27329.3|  unnamed protein product                              95.5    5e-21   
gb|KDP23802.1|  hypothetical protein JCGZ_00134                       94.0    6e-21   
ref|XP_006591761.1|  PREDICTED: cysteine-rich receptor-like prote...  94.7    6e-21   
ref|XP_002467063.1|  hypothetical protein SORBIDRAFT_01g019010        92.4    7e-21   Sorghum bicolor [broomcorn]
ref|XP_002526197.1|  serine-threonine protein kinase, plant-type,...  94.7    7e-21   Ricinus communis
ref|XP_003600598.1|  Cysteine-rich receptor-like protein kinase       94.4    7e-21   
gb|KHN25160.1|  Cysteine-rich receptor-like protein kinase 2          94.4    7e-21   
ref|XP_006590249.1|  PREDICTED: receptor-like protein kinase isof...  94.4    7e-21   
gb|KHN45755.1|  Cysteine-rich receptor-like protein kinase 2          93.6    1e-20   
ref|XP_011024962.1|  PREDICTED: cysteine-rich receptor-like prote...  94.0    1e-20   
gb|KDP46966.1|  hypothetical protein JCGZ_07983                       94.0    1e-20   
ref|XP_006591756.1|  PREDICTED: cysteine-rich receptor-like prote...  94.0    1e-20   
ref|XP_007146955.1|  hypothetical protein PHAVU_006G084700g           94.0    1e-20   
ref|XP_011015135.1|  PREDICTED: cysteine-rich receptor-like prote...  94.0    1e-20   
ref|XP_011024961.1|  PREDICTED: cysteine-rich receptor-like prote...  94.0    1e-20   
gb|KHN23622.1|  Cysteine-rich receptor-like protein kinase 2          94.0    1e-20   
ref|XP_011015134.1|  PREDICTED: cysteine-rich receptor-like prote...  94.0    1e-20   
ref|XP_011024960.1|  PREDICTED: cysteine-rich receptor-like prote...  94.0    1e-20   
ref|XP_006663435.1|  PREDICTED: cysteine-rich receptor-like prote...  93.2    1e-20   
ref|XP_004500478.1|  PREDICTED: cysteine-rich receptor-like prote...  94.0    1e-20   
gb|EEC68880.1|  hypothetical protein OsI_37506                        93.6    2e-20   Oryza sativa Indica Group [Indian rice]
gb|AES70848.2|  cysteine-rich RLK (receptor-like kinase) protein      93.6    2e-20   
ref|XP_003600597.1|  Cysteine-rich receptor-like protein kinase       93.6    2e-20   
ref|XP_006430413.1|  hypothetical protein CICLE_v10011290mg           93.2    2e-20   
gb|KDO57327.1|  hypothetical protein CISIN_1g006168mg                 93.2    2e-20   
ref|XP_006591762.1|  PREDICTED: cysteine-rich receptor-like prote...  92.8    2e-20   
gb|KHN23631.1|  Cysteine-rich receptor-like protein kinase 2          92.8    2e-20   
ref|XP_006372459.1|  hypothetical protein POPTR_0017s01830g           92.8    3e-20   
gb|EMT32932.1|  Putative LRR receptor-like serine/threonine-prote...  90.5    3e-20   
ref|XP_003552895.1|  PREDICTED: cysteine-rich receptor-like prote...  92.8    3e-20   
ref|XP_004982820.1|  PREDICTED: cysteine-rich receptor-like prote...  92.4    4e-20   
dbj|BAJ94974.1|  predicted protein                                    92.4    4e-20   
ref|XP_006602040.1|  PREDICTED: cysteine-rich receptor-like prote...  92.4    4e-20   
gb|KHN08752.1|  Cysteine-rich receptor-like protein kinase 2          92.4    4e-20   
ref|XP_004500476.1|  PREDICTED: cysteine-rich receptor-like prote...  92.4    4e-20   
gb|KHN45761.1|  Putative LRR receptor-like serine/threonine-prote...  91.7    5e-20   
gb|AES70851.2|  cysteine-rich RLK (receptor-like kinase) protein      92.0    5e-20   
gb|KHN31644.1|  Cysteine-rich receptor-like protein kinase 2          92.0    5e-20   
ref|XP_006591771.1|  PREDICTED: cysteine-rich receptor-like prote...  92.0    5e-20   
ref|XP_006591755.1|  PREDICTED: cysteine-rich receptor-like prote...  91.7    7e-20   
dbj|BAK00647.1|  predicted protein                                    90.5    8e-20   
gb|KHN25159.1|  Cysteine-rich receptor-like protein kinase 2          91.3    8e-20   
ref|XP_010091811.1|  Cysteine-rich receptor-like protein kinase 3     91.3    9e-20   
ref|XP_006481962.1|  PREDICTED: cysteine-rich receptor-like prote...  91.3    1e-19   
ref|XP_007146953.1|  hypothetical protein PHAVU_006G084500g           91.3    1e-19   
ref|XP_004986492.1|  PREDICTED: cysteine-rich receptor-like prote...  91.3    1e-19   
gb|KHN23629.1|  Cysteine-rich receptor-like protein kinase 42         90.5    2e-19   
emb|CBH32625.1|  unnamed protein product                              90.5    2e-19   
ref|XP_007023702.1|  Serine-threonine protein kinase, plant-type,...  90.1    2e-19   
ref|XP_003537407.1|  PREDICTED: cysteine-rich receptor-like prote...  90.5    2e-19   
ref|XP_006591287.1|  PREDICTED: cysteine-rich receptor-like prote...  90.5    2e-19   
ref|XP_010907638.1|  PREDICTED: cysteine-rich receptor-like prote...  90.1    3e-19   
ref|XP_007146952.1|  hypothetical protein PHAVU_006G084400g           90.1    3e-19   
ref|XP_006847936.1|  hypothetical protein AMTR_s00029p00129930        89.4    5e-19   
ref|XP_007146956.1|  hypothetical protein PHAVU_006G084800g           89.0    6e-19   
ref|XP_006591754.1|  PREDICTED: cysteine-rich receptor-like prote...  88.2    1e-18   
gb|KHN45762.1|  Cysteine-rich receptor-like protein kinase 2          88.2    1e-18   
ref|XP_006603110.1|  PREDICTED: cysteine-rich receptor-like prote...  87.4    2e-18   
gb|KHN08747.1|  Cysteine-rich receptor-like protein kinase 2          87.4    3e-18   
ref|XP_006591760.1|  PREDICTED: cysteine-rich receptor-like prote...  87.0    3e-18   
gb|KHN45756.1|  Cysteine-rich receptor-like protein kinase 2          87.0    3e-18   
gb|KHN25165.1|  Cysteine-rich receptor-like protein kinase 3          86.3    4e-18   
ref|XP_006591289.1|  PREDICTED: cysteine-rich receptor-like prote...  86.7    4e-18   
ref|XP_006591288.1|  PREDICTED: cysteine-rich receptor-like prote...  86.7    4e-18   
ref|XP_006591290.1|  PREDICTED: cysteine-rich receptor-like prote...  86.3    5e-18   
ref|XP_006591291.1|  PREDICTED: cysteine-rich receptor-like prote...  86.3    6e-18   
gb|EAZ18316.1|  hypothetical protein OsJ_33848                        84.7    6e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067872.1|  Os11g0470200                                     84.7    6e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006591763.1|  PREDICTED: cysteine-rich receptor-like prote...  85.5    1e-17   
gb|KHN23624.1|  Cysteine-rich receptor-like protein kinase 3          84.7    1e-17   
emb|CDP01669.1|  unnamed protein product                              85.5    1e-17   
ref|XP_007146954.1|  hypothetical protein PHAVU_006G084600g           85.1    2e-17   
gb|ABA93633.2|  Protein kinase domain containing protein, expressed   84.7    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008776726.1|  PREDICTED: cysteine-rich receptor-like prote...  79.7    1e-15   
ref|XP_011079278.1|  PREDICTED: putative serine/threonine-protein...  73.6    8e-14   
ref|XP_011079277.1|  PREDICTED: probable LRR receptor-like serine...  73.6    1e-13   
ref|XP_003600600.1|  Cysteine-rich receptor-like protein kinase       72.4    5e-13   
ref|XP_011023814.1|  PREDICTED: putative receptor-like protein ki...  71.2    5e-13   
ref|XP_011070185.1|  PREDICTED: putative receptor-like protein ki...  71.6    6e-13   
ref|XP_009776021.1|  PREDICTED: putative receptor-like protein ki...  69.3    8e-13   
ref|XP_002311515.2|  hypothetical protein POPTR_0008s13160g           70.5    1e-12   Populus trichocarpa [western balsam poplar]
gb|KDP38086.1|  hypothetical protein JCGZ_04729                       70.1    1e-12   
ref|XP_009776020.1|  PREDICTED: putative receptor-like protein ki...  70.1    2e-12   
ref|XP_011070601.1|  PREDICTED: putative receptor-like protein ki...  70.1    2e-12   
ref|XP_009627951.1|  PREDICTED: putative receptor-like protein ki...  69.7    2e-12   
ref|XP_006833103.1|  hypothetical protein AMTR_s00072p00040840        70.1    2e-12   
ref|XP_010927624.1|  PREDICTED: receptor-like serine/threonine-pr...  70.1    3e-12   
ref|XP_010927616.1|  PREDICTED: receptor-like serine/threonine-pr...  70.1    3e-12   
gb|EAY92001.1|  hypothetical protein OsI_13690                        69.7    4e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_011038603.1|  PREDICTED: putative receptor-like protein ki...  68.9    4e-12   
ref|XP_011038602.1|  PREDICTED: putative receptor-like protein ki...  68.9    4e-12   
ref|XP_002315871.2|  kinase family protein                            68.9    4e-12   Populus trichocarpa [western balsam poplar]
gb|KEH37465.1|  receptor-like kinase                                  68.9    4e-12   
ref|XP_008813655.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  69.7    5e-12   
ref|XP_002976262.1|  hypothetical protein SELMODRAFT_35175            67.4    5e-12   
ref|XP_008442517.1|  PREDICTED: L-type lectin-domain containing r...  69.3    5e-12   
gb|EYU37307.1|  hypothetical protein MIMGU_mgv1a007477mg              68.6    5e-12   
ref|XP_002524667.1|  kinase, putative                                 68.9    6e-12   Ricinus communis
ref|XP_009350401.1|  PREDICTED: G-type lectin S-receptor-like ser...  69.3    6e-12   
ref|XP_003565759.1|  PREDICTED: G-type lectin S-receptor-like ser...  69.3    7e-12   
ref|XP_003567348.2|  PREDICTED: G-type lectin S-receptor-like ser...  69.3    7e-12   
ref|XP_009615472.1|  PREDICTED: probable LRR receptor-like serine...  68.2    7e-12   
ref|XP_002984806.1|  hypothetical protein SELMODRAFT_121148           67.8    9e-12   
ref|XP_006845733.1|  hypothetical protein AMTR_s00019p00245130        68.6    9e-12   
ref|XP_008341942.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.9    9e-12   
gb|KFK36661.1|  hypothetical protein AALP_AA4G153600                  68.6    1e-11   
ref|XP_006453216.1|  hypothetical protein CICLE_v10010318mg           67.8    1e-11   
ref|XP_009143456.1|  PREDICTED: L-type lectin-domain containing r...  68.6    1e-11   
ref|XP_004162810.1|  PREDICTED: probable LRR receptor-like serine...  67.8    1e-11   
ref|XP_006474647.1|  PREDICTED: probable LRR receptor-like serine...  67.8    1e-11   
ref|XP_008444357.1|  PREDICTED: cysteine-rich receptor-like prote...  68.2    1e-11   
gb|AES92207.2|  receptor-like kinase                                  67.8    1e-11   
gb|KDP35490.1|  hypothetical protein JCGZ_10937                       66.6    1e-11   
ref|XP_006840433.1|  hypothetical protein AMTR_s00045p00163010        68.2    1e-11   
ref|NP_001044933.2|  Os01g0870500                                     67.0    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004488031.1|  PREDICTED: probable LRR receptor-like serine...  67.0    1e-11   
ref|XP_004150746.1|  PREDICTED: probable LRR receptor-like serine...  67.8    2e-11   
ref|XP_003610010.1|  Cysteine-rich receptor-like protein kinase       67.4    2e-11   
ref|XP_004243018.2|  PREDICTED: putative serine/threonine-protein...  67.0    2e-11   
emb|CDX91384.1|  BnaC04g07660D                                        67.8    2e-11   
ref|XP_010268917.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.2    2e-11   
ref|XP_001766837.1|  predicted protein                                66.2    2e-11   
ref|XP_010268915.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.2    2e-11   
ref|XP_006355074.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    2e-11   
ref|XP_004236942.1|  PREDICTED: putative receptor-like protein ki...  67.0    2e-11   
ref|XP_007014081.1|  Leucine-rich repeat transmembrane protein ki...  67.0    2e-11   
ref|XP_006833105.1|  hypothetical protein AMTR_s00072p00045010        67.8    2e-11   
emb|CAA65153.1|  receptor like protein kinase                         67.8    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001042449.2|  Os01g0224000                                     67.8    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001775642.1|  predicted protein                                66.2    2e-11   
ref|XP_010066599.1|  PREDICTED: putative receptor-like protein ki...  67.0    2e-11   
ref|XP_002881547.1|  hypothetical protein ARALYDRAFT_482773           67.8    2e-11   
ref|XP_006295761.1|  hypothetical protein CARUB_v10024881mg           67.8    2e-11   
ref|NP_181307.1|  receptor lectin kinase                              67.8    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010023497.1|  PREDICTED: cysteine-rich receptor-like prote...  67.4    2e-11   
gb|KHN17659.1|  Putative LRR receptor-like serine/threonine-prote...  66.6    2e-11   
ref|XP_008453534.1|  PREDICTED: putative serine/threonine-protein...  66.6    2e-11   
ref|XP_006366206.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-11   
ref|XP_008799499.1|  PREDICTED: probable LRR receptor-like serine...  67.0    2e-11   
ref|XP_006469213.1|  PREDICTED: cysteine-rich receptor-like prote...  66.6    3e-11   
ref|XP_006448211.1|  hypothetical protein CICLE_v10015463mg           66.6    3e-11   
ref|XP_006645651.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.4    3e-11   
ref|XP_002985868.1|  hypothetical protein SELMODRAFT_17154            64.3    3e-11   
ref|XP_007045211.1|  Cysteine-rich receptor-like protein kinase 10    66.6    3e-11   
ref|NP_001055037.1|  Os05g0256100                                     65.9    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010909134.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.4    3e-11   
ref|XP_003534911.1|  PREDICTED: probable LRR receptor-like serine...  66.6    3e-11   
ref|XP_006654185.1|  PREDICTED: probable LRR receptor-like serine...  67.4    3e-11   
gb|ABV30772.1|  kinase-like protein                                   63.9    3e-11   Prunus cerasus var. caproniana
gb|ABV30791.1|  kinase-like protein                                   63.9    3e-11   Prunus cerasus var. caproniana
gb|KHN35838.1|  Putative LRR receptor-like serine/threonine-prote...  66.2    3e-11   
ref|XP_006410963.1|  hypothetical protein EUTSA_v10016355mg           67.0    3e-11   
ref|XP_006654184.1|  PREDICTED: probable LRR receptor-like serine...  67.4    3e-11   
gb|ACN93885.1|  putative protein kinase                               65.9    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008230263.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.0    4e-11   
ref|XP_002527785.1|  Serine/threonine-protein kinase PBS1, putative   66.2    4e-11   Ricinus communis
ref|XP_002529279.1|  s-receptor kinase, putative                      67.0    4e-11   Ricinus communis
ref|XP_007021494.1|  S-locus lectin protein kinase family protein...  67.0    4e-11   
ref|XP_008389698.1|  PREDICTED: cysteine-rich receptor-like prote...  66.6    4e-11   
ref|XP_008389695.1|  PREDICTED: cysteine-rich receptor-like prote...  66.6    4e-11   
gb|EPS73296.1|  hypothetical protein M569_01459                       67.0    4e-11   
ref|XP_002985870.1|  hypothetical protein SELMODRAFT_24639            64.7    4e-11   
ref|XP_002527696.1|  serine-threonine protein kinase, plant-type,...  65.9    4e-11   Ricinus communis
ref|XP_006384135.1|  hypothetical protein POPTR_0004s07660g           62.8    5e-11   
ref|XP_001767914.1|  predicted protein                                65.1    5e-11   
ref|XP_006655031.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    5e-11   
gb|KHN24615.1|  Putative LRR receptor-like serine/threonine-prote...  65.9    5e-11   
ref|XP_006597385.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    5e-11   
ref|XP_006597384.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    5e-11   
gb|KDP45316.1|  hypothetical protein JCGZ_09565                       66.6    5e-11   
ref|XP_007223006.1|  hypothetical protein PRUPE_ppa006805mg           65.9    5e-11   
gb|KHN33625.1|  G-type lectin S-receptor-like serine/threonine-pr...  66.6    5e-11   
ref|XP_003589667.1|  Cysteine-rich receptor-like protein kinase       65.9    5e-11   
ref|XP_010093038.1|  putative LRR receptor-like serine/threonine-...  65.1    6e-11   
gb|EAY76778.1|  hypothetical protein OsI_04734                        66.6    6e-11   Oryza sativa Indica Group [Indian rice]
gb|EAZ14437.1|  hypothetical protein OsJ_04357                        66.6    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045048.1|  Os01g0889900                                     66.6    6e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AES59918.2|  receptor-like kinase                                  65.9    6e-11   
ref|XP_010553278.1|  PREDICTED: L-type lectin-domain containing r...  66.2    6e-11   
ref|XP_002529278.1|  s-receptor kinase, putative                      65.5    6e-11   Ricinus communis
ref|XP_008353117.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    6e-11   
ref|XP_010551593.1|  PREDICTED: cysteine-rich receptor-like prote...  66.2    6e-11   
gb|ABR16525.1|  unknown                                               65.9    7e-11   Picea sitchensis
emb|CDM85794.1|  unnamed protein product                              66.2    7e-11   
ref|XP_006646143.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    7e-11   
ref|XP_002324661.2|  hypothetical protein POPTR_0018s13280g           65.1    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010509284.1|  PREDICTED: L-type lectin-domain containing r...  66.2    7e-11   
ref|XP_009133202.1|  PREDICTED: L-type lectin-domain containing r...  66.2    7e-11   
ref|XP_008441808.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    8e-11   
gb|ABK21721.1|  unknown                                               65.5    8e-11   Picea sitchensis
ref|XP_010910912.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  66.2    8e-11   
gb|ABV30802.1|  kinase-like protein                                   62.8    8e-11   Prunus cerasus var. caproniana
ref|XP_010942011.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    8e-11   
ref|XP_002454912.1|  hypothetical protein SORBIDRAFT_03g001300        66.2    8e-11   Sorghum bicolor [broomcorn]
ref|XP_009112581.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    8e-11   
gb|EEE60010.1|  hypothetical protein OsJ_12753                        65.5    8e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010528239.1|  PREDICTED: cysteine-rich receptor-like prote...  65.9    9e-11   
ref|XP_008441803.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    9e-11   
emb|CDP03006.1|  unnamed protein product                              65.5    9e-11   
gb|AAT73676.1|  putative receptor-like serine/threonine kinase (R...  65.9    9e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AGT17045.1|  SHR5-receptor-like kinase                             66.2    9e-11   
ref|XP_010928056.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    9e-11   
ref|XP_004498275.1|  PREDICTED: putative cysteine-rich receptor-l...  65.1    9e-11   
gb|EEE63022.1|  hypothetical protein OsJ_17830                        65.9    9e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643929.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    9e-11   
gb|EEC78858.1|  hypothetical protein OsI_19210                        65.9    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010926208.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_009341455.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_009353216.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
gb|ABV30785.1|  kinase-like protein                                   62.8    1e-10   Prunus cerasus var. caproniana
gb|KGN49629.1|  hypothetical protein Csa_5G033470                     64.7    1e-10   
gb|AAR11300.1|  lectin-like receptor kinase 7;3                       65.5    1e-10   Medicago truncatula
gb|ABV30799.1|  kinase-like protein                                   62.4    1e-10   Prunus cerasus var. caproniana
ref|XP_003631201.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    1e-10   
gb|KEH22962.1|  L-type lectin-domain receptor kinase S.4              65.5    1e-10   
ref|XP_011085039.1|  PREDICTED: L-type lectin-domain containing r...  65.5    1e-10   
ref|XP_004170624.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_010927731.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    1e-10   
ref|XP_010047912.1|  PREDICTED: L-type lectin-domain containing r...  65.5    1e-10   
ref|XP_010942055.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_009377193.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
gb|KGN62311.1|  hypothetical protein Csa_2G348970                     65.5    1e-10   
ref|XP_007043425.1|  S-locus lectin protein kinase family protein...  65.5    1e-10   
ref|XP_010942056.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_004142276.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    1e-10   
ref|XP_009792456.1|  PREDICTED: probable LRR receptor-like serine...  64.7    1e-10   
ref|XP_008662731.1|  PREDICTED: probable LRR receptor-like serine...  65.9    1e-10   
ref|XP_008369987.1|  PREDICTED: L-type lectin-domain containing r...  65.5    1e-10   
ref|XP_009350197.1|  PREDICTED: L-type lectin-domain containing r...  65.5    1e-10   
ref|XP_010681234.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
emb|CDY47811.1|  BnaC07g17020D                                        65.9    1e-10   
ref|XP_007043424.1|  S-locus lectin protein kinase family protein...  65.5    1e-10   
ref|XP_008441839.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
dbj|BAJ98510.1|  predicted protein                                    65.1    1e-10   
ref|XP_008441830.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
gb|ACN39857.1|  unknown                                               65.5    1e-10   
gb|EEE61688.1|  hypothetical protein OsJ_16161                        65.5    1e-10   
ref|XP_004170625.1|  PREDICTED: receptor-like serine/threonine-pr...  65.5    1e-10   
ref|XP_004146622.1|  PREDICTED: receptor-like serine/threonine-pr...  65.5    1e-10   
gb|KCW71350.1|  hypothetical protein EUGRSUZ_F044302                  64.3    1e-10   
ref|XP_010681912.1|  PREDICTED: putative receptor-like protein ki...  64.7    1e-10   
ref|XP_010681911.1|  PREDICTED: putative receptor-like protein ki...  64.7    1e-10   
gb|KHG13311.1|  Cysteine-rich receptor-like protein kinase 25         65.1    1e-10   
gb|AFU06391.1|  S-locus receptor kinase                               62.8    1e-10   
emb|CAH65768.1|  OSIGBa0148I18.5                                      65.5    1e-10   
ref|XP_008441715.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
emb|CAD41884.2|  OSJNBa0093O08.3                                      65.5    1e-10   
gb|ACO25597.1|  protein kinase-coding resistance protein              62.0    1e-10   
ref|XP_008464706.1|  PREDICTED: putative receptor-like protein ki...  64.7    1e-10   
gb|EMT25018.1|  Lectin-domain containing receptor kinase A4.3         65.5    1e-10   
ref|XP_004161086.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  65.5    1e-10   
ref|XP_008221435.1|  PREDICTED: putative cysteine-rich receptor-l...  64.3    2e-10   
ref|XP_007153757.1|  hypothetical protein PHAVU_003G062600g           65.1    2e-10   
ref|XP_009127600.1|  PREDICTED: probable LRR receptor-like serine...  65.5    2e-10   
ref|XP_004146623.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
gb|ACO25575.1|  protein kinase-coding resistance protein              62.0    2e-10   
ref|XP_006360527.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
ref|XP_004243414.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
gb|KDO83960.1|  hypothetical protein CISIN_1g003059mg                 65.5    2e-10   
ref|XP_006473223.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
ref|XP_006434641.1|  hypothetical protein CICLE_v10003606mg           65.5    2e-10   
ref|XP_002274467.3|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_004143063.1|  PREDICTED: uncharacterized protein LOC101210276  65.5    2e-10   
gb|KHN45751.1|  Cysteine-rich receptor-like protein kinase 42         65.1    2e-10   
ref|XP_002315211.2|  hypothetical protein POPTR_0010s20820g           65.1    2e-10   
gb|EEC76625.1|  hypothetical protein OsI_14510                        65.5    2e-10   
ref|XP_007140970.1|  hypothetical protein PHAVU_008G156400g           65.1    2e-10   
ref|XP_011071116.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
emb|CAN77627.1|  hypothetical protein VITISV_029423                   65.1    2e-10   
ref|XP_008464705.1|  PREDICTED: putative receptor-like protein ki...  64.3    2e-10   
ref|XP_003555067.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_002978913.1|  hypothetical protein SELMODRAFT_109677           63.9    2e-10   
ref|XP_004489796.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|NP_198854.3|  cysteine-rich receptor-like protein kinase 42       65.1    2e-10   
ref|XP_002992144.1|  hypothetical protein SELMODRAFT_6842             62.0    2e-10   
ref|XP_004293476.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_009417412.1|  PREDICTED: receptor-like serine/threonine-pr...  65.5    2e-10   
ref|XP_003562945.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_002462992.1|  hypothetical protein SORBIDRAFT_02g035940        65.1    2e-10   
ref|XP_007225117.1|  hypothetical protein PRUPE_ppa002639mg           64.7    2e-10   
ref|XP_004970857.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_002962327.1|  hypothetical protein SELMODRAFT_79019            63.2    2e-10   
ref|XP_006653154.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
emb|CDP14368.1|  unnamed protein product                              64.7    2e-10   
gb|EAY73083.1|  hypothetical protein OsI_00958                        65.1    2e-10   
ref|NP_001042448.1|  Os01g0223900                                     65.1    2e-10   
ref|XP_009351514.1|  PREDICTED: putative receptor-like protein ki...  64.3    2e-10   
gb|KHN08615.1|  Cysteine-rich receptor-like protein kinase 2          64.7    2e-10   
ref|XP_003551216.2|  PREDICTED: cysteine-rich receptor-like prote...  64.7    2e-10   
ref|XP_004164064.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_009777914.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
ref|XP_002461412.1|  hypothetical protein SORBIDRAFT_02g002220        64.7    2e-10   
ref|XP_009609152.1|  PREDICTED: receptor-like serine/threonine-pr...  64.7    2e-10   
gb|EEC78865.1|  hypothetical protein OsI_19220                        64.7    2e-10   
ref|XP_002870713.1|  predicted protein                                64.7    2e-10   
ref|XP_008348279.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_007154668.1|  hypothetical protein PHAVU_003G137700g           64.3    2e-10   
ref|XP_010929306.1|  PREDICTED: probable LRR receptor-like serine...  63.9    2e-10   
ref|XP_009609150.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
ref|XP_009609149.1|  PREDICTED: receptor-like serine/threonine-pr...  64.7    2e-10   
ref|XP_010929305.1|  PREDICTED: putative serine/threonine-protein...  63.9    2e-10   
ref|XP_010684924.1|  PREDICTED: probable LRR receptor-like serine...  65.1    2e-10   
gb|EAY78100.1|  hypothetical protein OsI_33144                        64.7    2e-10   
ref|XP_004146624.1|  PREDICTED: receptor-like serine/threonine-pr...  65.1    2e-10   
ref|XP_009362983.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    2e-10   
ref|NP_001052001.1|  Os04g0103700                                     64.7    2e-10   
ref|NP_001064385.1|  Os10g0342300                                     64.7    2e-10   
gb|EEE60372.1|  hypothetical protein OsJ_13504                        64.7    2e-10   
gb|AAO42880.1|  At3g53810                                             64.7    2e-10   
gb|KDP44923.1|  hypothetical protein JCGZ_01423                       64.7    2e-10   
gb|AAS94091.1|  S-locus receptor kinase                               63.2    2e-10   
ref|XP_010533324.1|  PREDICTED: putative receptor-like protein ki...  63.9    2e-10   
ref|XP_010533320.1|  PREDICTED: putative receptor-like protein ki...  63.9    2e-10   
emb|CDX91325.1|  BnaC02g27360D                                        62.4    2e-10   
ref|XP_007025876.1|  S-locus lectin protein kinase family protein     64.7    2e-10   
ref|XP_007025921.1|  S-locus lectin protein kinase family protein     64.3    2e-10   
dbj|BAK00490.1|  predicted protein                                    64.3    2e-10   
ref|NP_190949.1|  L-type lectin-domain containing receptor kinase...  64.7    3e-10   
ref|XP_008393012.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    3e-10   
ref|XP_002965027.1|  hypothetical protein SELMODRAFT_71170            60.8    3e-10   
ref|XP_002977260.1|  hypothetical protein SELMODRAFT_72636            61.6    3e-10   
ref|XP_010911694.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.5    3e-10   
gb|AFW77897.1|  putative DUF26-domain receptor-like protein kinas...  64.3    3e-10   
ref|XP_006649651.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_004250358.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_010666218.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_004299001.1|  PREDICTED: cysteine-rich receptor-like prote...  64.3    3e-10   
ref|XP_007158801.1|  hypothetical protein PHAVU_002G182900g           63.9    3e-10   
ref|XP_010517048.1|  PREDICTED: L-type lectin-domain containing r...  64.3    3e-10   
ref|XP_004306354.1|  PREDICTED: cysteine-rich receptor-like prote...  64.3    3e-10   
ref|XP_008649611.1|  PREDICTED: cysteine-rich receptor-like prote...  64.3    3e-10   
ref|XP_008649610.1|  PREDICTED: cysteine-rich receptor-like prote...  64.3    3e-10   
ref|XP_008680981.1|  PREDICTED: uncharacterized protein LOC100191...  64.3    3e-10   
ref|NP_001053998.1|  Os04g0634000                                     64.7    3e-10   
gb|KHN22443.1|  G-type lectin S-receptor-like serine/threonine-pr...  63.2    3e-10   
gb|EEE60481.1|  hypothetical protein OsJ_13758                        63.5    3e-10   
ref|XP_008363601.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    3e-10   
ref|XP_009771750.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_011096248.1|  PREDICTED: putative serine/threonine-protein...  63.5    3e-10   
ref|XP_006351182.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_010928107.1|  PREDICTED: receptor-like serine/threonine-pr...  64.7    3e-10   
gb|KHN36583.1|  G-type lectin S-receptor-like serine/threonine-pr...  64.3    3e-10   
dbj|BAK07631.1|  predicted protein                                    64.3    3e-10   
ref|XP_010320561.1|  PREDICTED: cysteine-rich receptor-like prote...  64.3    3e-10   
gb|EAZ14440.1|  hypothetical protein OsJ_04360                        64.3    3e-10   
gb|EEE63030.1|  hypothetical protein OsJ_17838                        64.7    3e-10   
ref|XP_006403652.1|  hypothetical protein EUTSA_v10010174mg           64.3    3e-10   
ref|XP_002877942.1|  hypothetical protein ARALYDRAFT_485775           64.3    3e-10   
ref|XP_006601306.1|  PREDICTED: inactive protein kinase SELMODRAF...  64.3    3e-10   
ref|XP_004955905.1|  PREDICTED: probable LRR receptor-like serine...  64.7    3e-10   
dbj|BAD82381.1|  putative S-receptor kinase                           64.3    3e-10   
ref|XP_006582220.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    3e-10   
ref|XP_006594871.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    3e-10   
ref|XP_004955904.1|  PREDICTED: probable LRR receptor-like serine...  64.7    3e-10   
ref|XP_004955903.1|  PREDICTED: probable LRR receptor-like serine...  64.7    3e-10   
gb|KHN12744.1|  Inactive protein kinase                               64.3    3e-10   
ref|XP_003550356.1|  PREDICTED: inactive protein kinase SELMODRAF...  64.3    3e-10   
ref|XP_004955902.1|  PREDICTED: probable LRR receptor-like serine...  64.7    3e-10   
ref|XP_010908956.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    3e-10   
ref|XP_006594870.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    3e-10   
dbj|BAJ88697.1|  predicted protein                                    64.3    3e-10   
dbj|BAJ85953.1|  predicted protein                                    64.3    3e-10   
gb|EYU28432.1|  hypothetical protein MIMGU_mgv1a002644mg              64.3    3e-10   
ref|XP_004238642.1|  PREDICTED: cysteine-rich receptor-like prote...  64.3    3e-10   
ref|XP_006356405.1|  PREDICTED: cysteine-rich receptor-like prote...  64.3    3e-10   
gb|EEE61760.1|  hypothetical protein OsJ_16301                        64.7    3e-10   
ref|XP_004169457.1|  PREDICTED: L-type lectin-domain containing r...  64.3    3e-10   
ref|XP_004137931.1|  PREDICTED: L-type lectin-domain containing r...  64.3    3e-10   
ref|XP_006849528.1|  hypothetical protein AMTR_s00024p00153540        62.8    3e-10   
ref|XP_010674103.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    3e-10   
emb|CAH67726.1|  H0613A10.9                                           64.3    4e-10   
ref|XP_002447174.1|  hypothetical protein SORBIDRAFT_06g029800        64.3    4e-10   
ref|XP_006643928.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    4e-10   
ref|XP_010050925.1|  PREDICTED: putative serine/threonine-protein...  63.5    4e-10   
ref|XP_009587214.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    4e-10   
ref|XP_008446536.1|  PREDICTED: receptor-like serine/threonine-pr...  64.3    4e-10   
ref|XP_010515881.1|  PREDICTED: L-type lectin-domain containing r...  63.9    4e-10   
ref|XP_010233221.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    4e-10   
emb|CDM85425.1|  unnamed protein product                              64.3    4e-10   
gb|KCW49572.1|  hypothetical protein EUGRSUZ_K03097                   63.9    4e-10   
ref|XP_006658677.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    4e-10   
ref|XP_007133113.1|  hypothetical protein PHAVU_011G152400g           64.3    4e-10   
gb|AAL17689.1|  S-locus receptor kinase                               62.4    4e-10   
gb|ACI05949.1|  kinase-like protein pac.ptd.8.23                      61.2    4e-10   
ref|XP_002976405.1|  hypothetical protein SELMODRAFT_104776           63.2    4e-10   
ref|XP_002987238.1|  hypothetical protein SELMODRAFT_125579           63.2    4e-10   
gb|AAN01254.1|  Putative S-receptor kinase                            64.3    4e-10   
emb|CDP14356.1|  unnamed protein product                              63.2    4e-10   
gb|KCW73353.1|  hypothetical protein EUGRSUZ_E01822                   62.0    4e-10   
ref|XP_006293079.1|  hypothetical protein CARUB_v10019366mg           63.9    4e-10   
gb|AAU87884.1|  serine/theronine protein kinase 2                     61.2    4e-10   
dbj|BAA34233.1|  SRK23Bol                                             64.3    4e-10   
ref|XP_011020361.1|  PREDICTED: probable LRR receptor-like serine...  63.5    4e-10   
ref|XP_010100422.1|  Cysteine-rich receptor-like protein kinase 2     63.9    4e-10   
gb|EEE67374.1|  hypothetical protein OsJ_24675                        63.9    4e-10   
gb|EAY78098.1|  hypothetical protein OsI_33142                        63.9    4e-10   
ref|NP_001059942.1|  Os07g0551300                                     63.9    4e-10   
gb|EEC76736.1|  hypothetical protein OsI_14783                        63.2    4e-10   
ref|XP_009409023.1|  PREDICTED: L-type lectin-domain containing r...  63.9    4e-10   
ref|XP_010108803.1|  Cysteine-rich receptor-like protein kinase 42    63.9    4e-10   
ref|XP_002308093.2|  hypothetical protein POPTR_0006s07070g           63.5    4e-10   
ref|XP_010101970.1|  Cysteine-rich receptor-like protein kinase 10    63.2    4e-10   
emb|CDY65835.1|  BnaA09g54750D                                        63.9    4e-10   
dbj|BAC20090.1|  putative protein kinase homolog                      63.9    4e-10   
gb|EEC71874.1|  hypothetical protein OsI_04594                        63.9    4e-10   
ref|XP_009116078.1|  PREDICTED: L-type lectin-domain containing r...  63.9    4e-10   
gb|EEE55736.1|  hypothetical protein OsJ_04234                        63.9    4e-10   
dbj|BAD81714.1|  putative S-domain receptor-like protein kinase       63.9    4e-10   
ref|XP_003524143.1|  PREDICTED: cysteine-rich receptor-like prote...  63.2    4e-10   
ref|XP_010656850.1|  PREDICTED: putative receptor-like protein ki...  63.5    4e-10   
gb|EMT01912.1|  Putative serine/threonine-protein kinase receptor     63.9    4e-10   
ref|XP_010427040.1|  PREDICTED: L-type lectin-domain containing r...  63.9    4e-10   
ref|XP_002273718.1|  PREDICTED: cysteine-rich receptor-like prote...  63.9    4e-10   
emb|CAN83581.1|  hypothetical protein VITISV_001563                   63.5    4e-10   
gb|KFK34629.1|  hypothetical protein AALP_AA5G171000                  63.9    4e-10   
gb|EMT16740.1|  Putative serine/threonine-protein kinase receptor     63.9    5e-10   
ref|XP_010656849.1|  PREDICTED: putative receptor-like protein ki...  63.5    5e-10   
ref|XP_010504152.1|  PREDICTED: L-type lectin-domain containing r...  63.9    5e-10   
gb|EMT00902.1|  Putative serine/threonine-protein kinase receptor     63.9    5e-10   
ref|XP_010649524.1|  PREDICTED: cysteine-rich receptor-like prote...  63.9    5e-10   
ref|XP_010649523.1|  PREDICTED: cysteine-rich receptor-like prote...  63.9    5e-10   
ref|XP_007133112.1|  hypothetical protein PHAVU_011G152300g           63.5    5e-10   
ref|XP_002272353.2|  PREDICTED: cysteine-rich receptor-like prote...  63.9    5e-10   
ref|XP_010504154.1|  PREDICTED: L-type lectin-domain containing r...  63.9    5e-10   
emb|CBI22893.3|  unnamed protein product                              63.9    5e-10   
ref|XP_010656848.1|  PREDICTED: putative receptor-like protein ki...  63.5    5e-10   
ref|XP_008341436.1|  PREDICTED: cysteine-rich receptor-like prote...  63.9    5e-10   
ref|XP_004146625.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    5e-10   
ref|XP_004299787.1|  PREDICTED: probable LRR receptor-like serine...  63.2    5e-10   
ref|XP_002458897.1|  hypothetical protein SORBIDRAFT_03g042320        63.9    5e-10   
gb|EEC83073.1|  hypothetical protein OsI_28196                        63.9    5e-10   
dbj|BAF91393.1|  S-locus receptor kinase (kinase domain)              63.2    5e-10   
ref|XP_002300041.2|  hypothetical protein POPTR_0001s35060g           63.5    5e-10   
ref|XP_008441911.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    5e-10   
gb|AFR53389.1|  S-locus receptor kinase                               61.2    5e-10   
ref|XP_003613180.1|  Cysteine-rich receptor-like protein kinase       63.5    5e-10   
gb|KHN28393.1|  G-type lectin S-receptor-like serine/threonine-pr...  63.5    5e-10   
ref|NP_001058835.1|  Os07g0132500                                     61.6    5e-10   
ref|XP_010504155.1|  PREDICTED: L-type lectin-domain containing r...  63.5    5e-10   
ref|XP_007207858.1|  hypothetical protein PRUPE_ppa022557mg           63.5    5e-10   
ref|XP_011100325.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    5e-10   
ref|NP_001058823.2|  Os07g0130400                                     63.2    5e-10   
ref|XP_002971456.1|  hypothetical protein SELMODRAFT_37866            60.8    5e-10   
ref|XP_004164065.1|  PREDICTED: uncharacterized protein LOC101230426  63.9    5e-10   
ref|XP_010932258.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    5e-10   
ref|XP_008230190.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    5e-10   
ref|XP_008441902.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    5e-10   
ref|XP_008441894.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    5e-10   
ref|XP_009616730.1|  PREDICTED: cysteine-rich receptor-like prote...  63.5    5e-10   
ref|XP_002265829.1|  PREDICTED: cysteine-rich receptor-like prote...  63.5    5e-10   
gb|KDP20849.1|  hypothetical protein JCGZ_21320                       63.9    5e-10   



>ref|XP_009764431.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Nicotiana 
sylvestris]
Length=643

 Score =   107 bits (268),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SL+RY+YGDK+G+LNWKQR DIIFGTARGLAYLH+QFHVCIIH
Sbjct  396  LVYEYMANGSLERYLYGDKRGMLNWKQRFDIIFGTARGLAYLHEQFHVCIIH  447



>ref|XP_009615413.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Nicotiana 
tomentosiformis]
Length=643

 Score =   107 bits (268),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SL+RY+YGDK+G+LNWKQR DIIFGTARGLAYLH+QFHVCIIH
Sbjct  396  LVYEYMANGSLERYLYGDKRGMLNWKQRFDIIFGTARGLAYLHEQFHVCIIH  447



>ref|XP_006352393.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X2 [Solanum tuberosum]
Length=681

 Score =   106 bits (265),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SL+RY+YGDKQG+LNWKQR DII GTARGLAYLH+QFHVCIIH
Sbjct  437  LVYEYMANGSLERYLYGDKQGMLNWKQRYDIIIGTARGLAYLHEQFHVCIIH  488



>ref|XP_006352473.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Solanum tuberosum]
Length=368

 Score =   102 bits (255),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SL+RY+YGDKQG+LNWKQR D+I GTARGLAYLH+QFHVCIIH
Sbjct  168  LVYEYMANGSLERYLYGDKQGMLNWKQRYDMIIGTARGLAYLHEQFHVCIIH  219



>ref|XP_006352395.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Solanum tuberosum]
Length=642

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SL+RY+YGD++G+LNWKQR +IIFGTARGLAYLH+QFHVCIIH
Sbjct  395  LVYEYMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIH  446



>ref|XP_004250234.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Solanum 
lycopersicum]
Length=642

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SL+RY+YGD++G+LNWKQR +IIFGTARGLAYLH+QFHVCIIH
Sbjct  395  LVYEYMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIH  446



>emb|CDP01668.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 44/52 (85%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LV+EYMAN SLDRY+YGDK+G LNWKQR DIIFGTARGLAYLHDQ+HV IIH
Sbjct  313  LVHEYMANGSLDRYLYGDKKGYLNWKQRFDIIFGTARGLAYLHDQYHVSIIH  364



>gb|EPS69045.1| hypothetical protein M569_05722, partial [Genlisea aurea]
Length=579

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLDRY+YGDK+GIL+WKQR+DIIFG ARGLAYLH+Q+HV +IH
Sbjct  373  LVYEYMANGSLDRYLYGDKKGILSWKQRLDIIFGMARGLAYLHEQYHVTVIH  424



>ref|XP_010940309.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Elaeis 
guineensis]
Length=646

 Score = 99.8 bits (247),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD+ +YGDK+GILNWKQR DII G ARGLAYLH +FHVCIIH
Sbjct  394  LVYEYMANSSLDKVLYGDKRGILNWKQRFDIIVGIARGLAYLHQEFHVCIIH  445



>ref|XP_006352392.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X1 [Solanum tuberosum]
Length=689

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 49/60 (82%), Gaps = 8/60 (13%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY--------GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SL+RY+Y        GDKQG+LNWKQR DII GTARGLAYLH+QFHVCIIH
Sbjct  437  LVYEYMANGSLERYLYDPTSHGFAGDKQGMLNWKQRYDIIIGTARGLAYLHEQFHVCIIH  496



>ref|XP_008381407.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Malus 
domestica]
Length=657

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+YEYMAN+SLDR+I+G ++G LNWKQR DII GTARGLAYLH++FHVCIIH
Sbjct  410  LIYEYMANSSLDRFIFGPRKGSLNWKQRTDIIIGTARGLAYLHEEFHVCIIH  461



>ref|XP_010911314.1| PREDICTED: cysteine-rich receptor-like protein kinase 2, partial 
[Elaeis guineensis]
Length=292

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD+ +YGD++GILNWKQR DII G ARGLAYLH +FHVCIIH
Sbjct  149  LVYEYMANSSLDKVLYGDRRGILNWKQRFDIIVGIARGLAYLHQEFHVCIIH  200



>ref|XP_011085909.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Sesamum 
indicum]
Length=706

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLDR++YGDK+G L WKQR +IIFGTARGLAYLH+Q+H CIIH
Sbjct  458  LVYEYMANGSLDRFLYGDKRGALTWKQRYNIIFGTARGLAYLHEQYHECIIH  509



>ref|XP_002265619.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Vitis 
vinifera]
 emb|CBI31122.3| unnamed protein product [Vitis vinifera]
Length=645

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+++G LNWKQR+DII GTARGLAYLH++FHVCIIH
Sbjct  398  LVYEYMANSSLDKFLFGERRGALNWKQRLDIIAGTARGLAYLHEEFHVCIIH  449



>emb|CAN82890.1| hypothetical protein VITISV_005057 [Vitis vinifera]
Length=671

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+++G LNWKQR+DII GTARGLAYLH++FHVCIIH
Sbjct  424  LVYEYMANSSLDKFLFGERRGALNWKQRLDIIAGTARGLAYLHEEFHVCIIH  475



>ref|XP_010234835.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Brachypodium 
distachyon]
Length=646

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++GD++GILNWKQR +II G ARGLAYLH++FHVCIIH
Sbjct  400  LVYEYMANSSLDKFLFGDRRGILNWKQRFNIIVGMARGLAYLHEEFHVCIIH  451



>ref|XP_009341862.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Pyrus 
x bretschneideri]
Length=657

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+YEYMAN+SLDR+++G ++G LNWKQR DII GTARGLAYLH++FHVCIIH
Sbjct  410  LIYEYMANSSLDRFLFGPRKGSLNWKQRTDIIIGTARGLAYLHEEFHVCIIH  461



>dbj|BAF95165.1| protein kinase [Ipomoea nil]
Length=603

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 3/52 (6%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SL+RYIYGDK+G+LNWKQRVDIIFGTARGL+YLHD   +CIIH
Sbjct  411  LVYEYMANASLERYIYGDKRGMLNWKQRVDIIFGTARGLSYLHD---ICIIH  459



>ref|NP_001235591.1| receptor-like protein kinase [Glycine max]
 gb|ACM89612.1| receptor-like protein kinase [Glycine max]
Length=287

 Score = 94.4 bits (233),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G K+G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  42   LVYEYMANSSLDKFLFGSKKGSLNWKQRYDIILGTARGLAYLHEEFHVSIIH  93



>gb|KHN08753.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=638

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++GDK+G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  393  LVYEYMANSSLDKFLFGDKKGSLNWKQRYDIILGTARGLAYLHEEFHVSIIH  444



>ref|XP_003553121.2| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=638

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++GDK+G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  393  LVYEYMANSSLDKFLFGDKKGSLNWKQRYDIILGTARGLAYLHEEFHVSIIH  444



>gb|KHN08751.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=639

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++GDK+G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  395  LVYEYMANSSLDKFLFGDKKGSLNWKQRYDIILGTARGLAYLHEEFHVSIIH  446



>ref|XP_003553123.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=640

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++GDK+G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  396  LVYEYMANSSLDKFLFGDKKGSLNWKQRYDIILGTARGLAYLHEEFHVSIIH  447



>gb|KHN18255.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=641

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++GDK+G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  397  LVYEYMANSSLDKFLFGDKKGSLNWKQRYDIILGTARGLAYLHEEFHVSIIH  448



>ref|XP_003537415.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=641

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++GDK+G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  397  LVYEYMANSSLDKFLFGDKKGSLNWKQRYDIILGTARGLAYLHEEFHVSIIH  448



>ref|XP_008813262.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Phoenix 
dactylifera]
Length=639

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD+ ++GD++GILNWKQR D+I G ARGLAYLH +FHVCIIH
Sbjct  392  LVYEYMANSSLDKVLFGDRRGILNWKQRFDVIVGIARGLAYLHQEFHVCIIH  443



>gb|EYU34522.1| hypothetical protein MIMGU_mgv1a002613mg [Erythranthe guttata]
Length=654

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLDR++YGDK+G L WKQR DIIFG ARGLAYLH+Q+HV IIH
Sbjct  407  LVYEYMANGSLDRFLYGDKRGSLTWKQRFDIIFGIARGLAYLHEQYHVTIIH  458



>gb|EMS35623.1| Cysteine-rich receptor-like protein kinase 42 [Triticum urartu]
Length=392

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD+++YG+++G LNWKQR +II G ARGLAYLH +FHVCIIH
Sbjct  205  LVYEYMANSSLDKFLYGERRGTLNWKQRFNIIVGMARGLAYLHQEFHVCIIH  256



>ref|XP_007048591.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOX92748.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=419

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+++G LNWKQR  II GTARGLAYLH++FHVCIIH
Sbjct  135  LVYEYMANSSLDKFLFGERRGSLNWKQRYGIILGTARGLAYLHEEFHVCIIH  186



>ref|XP_009400308.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Musa 
acuminata subsp. malaccensis]
Length=638

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SL+++I+GD+QG LNWKQR +II G ARGLAYLH +FHVCIIH
Sbjct  390  LVYEYMANSSLNKFIFGDRQGFLNWKQRFNIIVGMARGLAYLHQEFHVCIIH  441



>ref|XP_009400606.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Musa 
acuminata subsp. malaccensis]
Length=641

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SL+++I+GD+QG LNWKQR +II G ARGLAYLH +FHVCIIH
Sbjct  393  LVYEYMANSSLNKFIFGDRQGFLNWKQRFNIIVGMARGLAYLHQEFHVCIIH  444



>ref|XP_002298473.2| hypothetical protein POPTR_0001s28330g [Populus trichocarpa]
 gb|EEE83278.2| hypothetical protein POPTR_0001s28330g [Populus trichocarpa]
Length=630

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD ++YGDK+G L+WKQR DII GTARGL+YLH+ FH+CIIH
Sbjct  382  LVYEYMANSSLDNFLYGDKKGSLSWKQRFDIILGTARGLSYLHEDFHLCIIH  433



>gb|EMT32931.1| Cysteine-rich receptor-like protein kinase 42 [Aegilops tauschii]
Length=436

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD+++YG+++G LNWKQR +II G ARGLAYLH +FHVCIIH
Sbjct  205  LVYEYMANSSLDKFLYGERRGTLNWKQRFNIIVGMARGLAYLHQEFHVCIIH  256



>emb|CBI27330.3| unnamed protein product [Vitis vinifera]
Length=566

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+K+G LNWKQR++II G ARGLAYLH++FHVCIIH
Sbjct  319  LVYEYMANSSLDKFLFGEKRGALNWKQRLNIIVGIARGLAYLHEEFHVCIIH  370



>ref|XP_004293009.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Fragaria vesca subsp. vesca]
Length=644

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L++EYMAN SLD+Y++G K+G LNWKQR DII GTARGLAYLH++FHVCIIH
Sbjct  396  LIFEYMANNSLDKYLFGPKRGSLNWKQRNDIILGTARGLAYLHEEFHVCIIH  447



>gb|ABB47798.1| expressed protein [Oryza sativa Japonica Group]
Length=286

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++GDK+G LNWKQR +II G ARGL YLH +FHVCIIH
Sbjct  40   LVYEYMANGSLDKFLFGDKRGTLNWKQRFNIIVGMARGLGYLHQEFHVCIIH  91



>emb|CBH32626.1| protein kinase, putative, expressed [Triticum aestivum]
Length=634

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD+++YG+++G LNWKQR +II G ARGLAYLH++FHVCIIH
Sbjct  391  LVYEYMANSSLDKFLYGERRGTLNWKQRFNIIVGMARGLAYLHEEFHVCIIH  442



>emb|CDM80466.1| unnamed protein product [Triticum aestivum]
Length=640

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD+++YG+++G LNWKQR +II G ARGLAYLH++FHVCIIH
Sbjct  394  LVYEYMANSSLDKFLYGERRGTLNWKQRFNIIVGMARGLAYLHEEFHVCIIH  445



>ref|XP_007099567.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
 gb|EOY20463.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
Length=499

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+++G LNWKQR  II GTARGLAYLH++FHVCIIH
Sbjct  406  LVYEYMANSSLDKFLFGERRGSLNWKQRYGIILGTARGLAYLHEEFHVCIIH  457



>ref|XP_010648890.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Vitis 
vinifera]
Length=648

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+K+G LNWKQR++II G ARGLAYLH++FHVCIIH
Sbjct  401  LVYEYMANSSLDKFLFGEKRGALNWKQRLNIIVGIARGLAYLHEEFHVCIIH  452



>gb|KHN45759.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=414

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMANTSLD++I+G ++G LNWKQR DII GTARGL YLH++FHV IIH
Sbjct  165  LVYEYMANTSLDKFIFGKRKGSLNWKQRYDIILGTARGLTYLHEEFHVSIIH  216



>gb|AAM91884.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=373

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++GDK+G LNWKQR +II G ARGL YLH +FHVCIIH
Sbjct  127  LVYEYMANGSLDKFLFGDKRGTLNWKQRFNIIVGMARGLGYLHQEFHVCIIH  178



>ref|NP_001064885.1| Os10g0483400 [Oryza sativa Japonica Group]
 dbj|BAF26799.1| Os10g0483400, partial [Oryza sativa Japonica Group]
Length=387

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++GDK+G LNWKQR +II G ARGL YLH +FHVCIIH
Sbjct  141  LVYEYMANGSLDKFLFGDKRGTLNWKQRFNIIVGMARGLGYLHQEFHVCIIH  192



>ref|XP_006591283.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Glycine max]
Length=653

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLDR+++G+ +G LNWKQR DII GTA+GLAYLH+ FHVCIIH
Sbjct  405  LVYEYMANKSLDRFLFGENKGSLNWKQRYDIILGTAKGLAYLHEDFHVCIIH  456



>ref|XP_006591282.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Glycine max]
Length=653

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLDR+++G+ +G LNWKQR DII GTA+GLAYLH+ FHVCIIH
Sbjct  405  LVYEYMANKSLDRFLFGENKGSLNWKQRYDIILGTAKGLAYLHEDFHVCIIH  456



>ref|XP_002323759.2| hypothetical protein POPTR_0017s01840g [Populus trichocarpa]
 gb|EEF03892.2| hypothetical protein POPTR_0017s01840g [Populus trichocarpa]
Length=651

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLDR+++G+K+G L WKQR DII G A+GLAYLH+QFHVCIIH
Sbjct  404  LVYEYMANSSLDRFLFGEKRGSLRWKQRFDIILGIAQGLAYLHEQFHVCIIH  455



>ref|XP_002265819.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Vitis 
vinifera]
Length=647

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N+SLD++++G+++G LNW+QR DII GTARGLAYLH++FHVCIIH
Sbjct  399  LVYEYMVNSSLDKFLFGERRGALNWRQRFDIIVGTARGLAYLHEEFHVCIIH  450



>ref|XP_007221536.1| hypothetical protein PRUPE_ppa022817mg [Prunus persica]
 gb|EMJ22735.1| hypothetical protein PRUPE_ppa022817mg [Prunus persica]
Length=639

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+YEYMAN SLDR+I+G K+G LNWKQ  DII GTARGLAYLH++FHVCIIH
Sbjct  392  LIYEYMANNSLDRFIFGPKRGSLNWKQLNDIILGTARGLAYLHEEFHVCIIH  443



>ref|XP_008227865.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Prunus 
mume]
Length=663

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+YEYMAN SLDR+I+G K+G LNWKQ  DII GTARGLAYLH++FHVCIIH
Sbjct  416  LIYEYMANNSLDRFIFGPKRGSLNWKQLNDIILGTARGLAYLHEEFHVCIIH  467



>emb|CBI27329.3| unnamed protein product [Vitis vinifera]
Length=765

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N+SLD++++G+++G LNW+QR DII GTARGLAYLH++FHVCIIH
Sbjct  474  LVYEYMVNSSLDKFLFGERRGALNWRQRFDIIVGTARGLAYLHEEFHVCIIH  525



>gb|KDP23802.1| hypothetical protein JCGZ_00134 [Jatropha curcas]
Length=504

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM NTSLDR+++G ++G L WKQR DII GTA+GLAYLH+QFHVCIIH
Sbjct  282  LVYEYMENTSLDRFLFGKRKGSLVWKQRFDIILGTAQGLAYLHEQFHVCIIH  333



>ref|XP_006591761.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=645

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMANTSLD++++G ++G LNWKQR DII G ARGL YLH++FHVCIIH
Sbjct  396  LVYEYMANTSLDKFVFGRRKGSLNWKQRYDIILGIARGLTYLHEEFHVCIIH  447



>ref|XP_002467063.1| hypothetical protein SORBIDRAFT_01g019010 [Sorghum bicolor]
 gb|EER94061.1| hypothetical protein SORBIDRAFT_01g019010 [Sorghum bicolor]
Length=350

 Score = 92.4 bits (228),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++GD++G LNW+QR +II G ARGLAYLH +FHVCIIH
Sbjct  104  LVYEYMANGSLDKFLFGDRRGTLNWRQRFNIIVGMARGLAYLHQEFHVCIIH  155



>ref|XP_002526197.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF36201.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=650

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLDR ++G++QG L WKQR D+I GTA+GLAYLH+Q+HVCIIH
Sbjct  401  LVYEYMANSSLDRLLFGNRQGSLTWKQRFDVIIGTAQGLAYLHEQYHVCIIH  452



>ref|XP_003600598.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES70849.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=646

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+KQG LNWKQR +II GTARGLAYLH++FH+ IIH
Sbjct  400  LVYEYMANSSLDKFLFGNKQGSLNWKQRCNIILGTARGLAYLHEEFHISIIH  451



>gb|KHN25160.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=642

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G K+G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  397  LVYEYMANSSLDKFLFGSKKGSLNWKQRYDIILGTARGLAYLHEEFHVSIIH  448



>ref|XP_006590249.1| PREDICTED: receptor-like protein kinase isoform X1 [Glycine max]
Length=642

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G K+G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  397  LVYEYMANSSLDKFLFGSKKGSLNWKQRYDIILGTARGLAYLHEEFHVSIIH  448



>gb|KHN45755.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=517

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMANTSLD++++G ++G LNWKQR DII G ARGL YLH++FHVCIIH
Sbjct  357  LVYEYMANTSLDKFVFGRRKGSLNWKQRYDIILGIARGLTYLHEEFHVCIIH  408



>ref|XP_011024962.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X3 [Populus euphratica]
Length=596

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD ++YGDK+G L+WKQR DII G ARGL+YLH+ FH+CIIH
Sbjct  348  LVYEYMANSSLDNFLYGDKKGSLSWKQRFDIILGIARGLSYLHEDFHLCIIH  399



>gb|KDP46966.1| hypothetical protein JCGZ_07983 [Jatropha curcas]
Length=629

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM NTSLDR+++G ++G L WKQR DII GTA+GLAYLH+QFHVCIIH
Sbjct  380  LVYEYMENTSLDRFLFGKRKGSLIWKQRFDIILGTAQGLAYLHEQFHVCIIH  431



>ref|XP_006591756.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=646

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMANTSLD++I+G ++G LNWKQR DII GTARGL YLH++FHV IIH
Sbjct  397  LVYEYMANTSLDKFIFGKRKGSLNWKQRYDIILGTARGLTYLHEEFHVSIIH  448



>ref|XP_007146955.1| hypothetical protein PHAVU_006G084700g [Phaseolus vulgaris]
 gb|ESW18949.1| hypothetical protein PHAVU_006G084700g [Phaseolus vulgaris]
Length=681

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G+K+G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  438  LVYEYMANKSLDKFLFGNKKGSLNWKQRSDIILGTARGLAYLHEEFHVSIIH  489



>ref|XP_011015135.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X2 [Populus euphratica]
Length=637

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD ++YGDK+G L+WKQR DII G ARGL+YLH+ FH+CIIH
Sbjct  389  LVYEYMANSSLDNFLYGDKKGSLSWKQRFDIILGIARGLSYLHEDFHLCIIH  440



>ref|XP_011024961.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X2 [Populus euphratica]
Length=637

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD ++YGDK+G L+WKQR DII G ARGL+YLH+ FH+CIIH
Sbjct  389  LVYEYMANSSLDNFLYGDKKGSLSWKQRFDIILGIARGLSYLHEDFHLCIIH  440



>gb|KHN23622.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=637

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++GDK G+LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  393  LVYEYMANSSLDKFLFGDK-GVLNWKQRYDIILGTARGLAYLHEEFHVSIIH  443



>ref|XP_011015134.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Populus euphratica]
Length=638

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD ++YGDK+G L+WKQR DII G ARGL+YLH+ FH+CIIH
Sbjct  390  LVYEYMANSSLDNFLYGDKKGSLSWKQRFDIILGIARGLSYLHEDFHLCIIH  441



>ref|XP_011024960.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Populus euphratica]
Length=638

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD ++YGDK+G L+WKQR DII G ARGL+YLH+ FH+CIIH
Sbjct  390  LVYEYMANSSLDNFLYGDKKGSLSWKQRFDIILGIARGLSYLHEDFHLCIIH  441



>ref|XP_006663435.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Oryza brachyantha]
Length=505

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G+K+G LNWKQR +II G ARGLAYLH +FHVCIIH
Sbjct  259  LVYEYMANGSLDKFLFGEKRGTLNWKQRFNIIVGMARGLAYLHQEFHVCIIH  310



>ref|XP_004500478.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Cicer arietinum]
Length=649

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++ +KQG LNWKQR DII GTARGLAYLH++FH+ IIH
Sbjct  402  LVYEYMANSSLDKFLFSNKQGSLNWKQRYDIILGTARGLAYLHEEFHISIIH  453



>gb|EEC68880.1| hypothetical protein OsI_37506 [Oryza sativa Indica Group]
Length=619

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++GDK+G LNWKQR +II G ARGL YLH +FHVCIIH
Sbjct  373  LVYEYMANGSLDKFLFGDKRGTLNWKQRFNIIVGMARGLGYLHQEFHVCIIH  424



>gb|AES70848.2| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=644

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLDR+++G+ +G LNW QR DII GTARGL+YLH+ FHVCIIH
Sbjct  397  LVYEYMANSSLDRFLFGENKGSLNWIQRYDIILGTARGLSYLHEDFHVCIIH  448



>ref|XP_003600597.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=682

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLDR+++G+ +G LNW QR DII GTARGL+YLH+ FHVCIIH
Sbjct  435  LVYEYMANSSLDRFLFGENKGSLNWIQRYDIILGTARGLSYLHEDFHVCIIH  486



>ref|XP_006430413.1| hypothetical protein CICLE_v10011290mg [Citrus clementina]
 gb|ESR43653.1| hypothetical protein CICLE_v10011290mg [Citrus clementina]
Length=627

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+K+G LNWKQR DII GTARGLAYLH+ FHV IIH
Sbjct  378  LVYEYMANSSLDKFLFGEKRGSLNWKQRFDIILGTARGLAYLHEDFHVRIIH  429



>gb|KDO57327.1| hypothetical protein CISIN_1g006168mg [Citrus sinensis]
Length=658

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+K+G LNWKQR DII GTARGLAYLH+ FHV IIH
Sbjct  393  LVYEYMANSSLDKFLFGEKRGSLNWKQRFDIILGTARGLAYLHEDFHVRIIH  444



>ref|XP_006591762.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=611

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++GDK G+LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  392  LVYEYMANSSLDKFLFGDK-GVLNWKQRYDIILGTARGLAYLHEEFHVSIIH  442



>gb|KHN23631.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=624

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMANTSLD++++G ++G LNW+QR DII GTARGLAYLH++FHV +IH
Sbjct  398  LVYEYMANTSLDKFLFGKRKGSLNWRQRYDIILGTARGLAYLHEEFHVSVIH  449



>ref|XP_006372459.1| hypothetical protein POPTR_0017s01830g [Populus trichocarpa]
 gb|ERP50256.1| hypothetical protein POPTR_0017s01830g [Populus trichocarpa]
Length=667

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 40/53 (75%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLDR+++ G+K+G L WKQR DII GTA+GLAYLH+QFHVCIIH
Sbjct  419  LVYEYMANSSLDRFLFAGEKRGSLRWKQRFDIILGTAQGLAYLHEQFHVCIIH  471



>gb|EMT32932.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=346

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD+ ++G+++G LNWKQR +I+ G ARGLAYLH +FHVCIIH
Sbjct  100  LVYEYMANSSLDKLLFGERRGTLNWKQRFNIMVGMARGLAYLHQEFHVCIIH  151



>ref|XP_003552895.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=649

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G ++G LNWKQR DII GTARGLAYLH++FHV IIH
Sbjct  400  LVYEYMANASLDKFLFGKRKGSLNWKQRYDIILGTARGLAYLHEEFHVSIIH  451



>ref|XP_004982820.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Setaria italica]
Length=647

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD+++YG++ G LNW+QR +II G ARGLAYLH +FHVCIIH
Sbjct  401  LVYEYMANGSLDKFLYGERHGTLNWRQRFNIIVGMARGLAYLHQEFHVCIIH  452



>dbj|BAJ94974.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=640

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N+SLD++++G+++G LNWKQR +II G ARGLAYLH++FHVCIIH
Sbjct  394  LVYEYMVNSSLDKFLFGERRGTLNWKQRFNIIVGMARGLAYLHEEFHVCIIH  445



>ref|XP_006602040.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=629

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G ++G LNW+QR+DII GTARGLAYLH++FHV IIH
Sbjct  398  LVYEYMANNSLDKFLFGKRKGSLNWRQRLDIILGTARGLAYLHEEFHVSIIH  449



>gb|KHN08752.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=630

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G ++G LNW+QR+DII GTARGLAYLH++FHV IIH
Sbjct  398  LVYEYMANNSLDKFLFGKRKGSLNWRQRLDIILGTARGLAYLHEEFHVSIIH  449



>ref|XP_004500476.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Cicer arietinum]
Length=674

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLDR+++G+K G LNW QR DII GTARGLAYLH+ F+VCIIH
Sbjct  427  LVYEYMANKSLDRFLFGEKTGSLNWIQRYDIILGTARGLAYLHEDFYVCIIH  478



>gb|KHN45761.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=511

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YMANTSLD++++G ++G LNWKQR DII GTARGL YLH++FHV IIH
Sbjct  265  LVYQYMANTSLDKFLFGKRKGSLNWKQRYDIILGTARGLTYLHEEFHVSIIH  316



>gb|AES70851.2| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=660

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+KQG LNWKQR DII GTARGLA LH++FH+ IIH
Sbjct  412  LVYEYMANSSLDKFLFGNKQGSLNWKQRCDIILGTARGLACLHEEFHISIIH  463



>gb|KHN31644.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=624

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G K+G LNW+QR DII GTARGLAYLH++FHV +IH
Sbjct  398  LVYEYMANNSLDKFLFGKKKGSLNWRQRYDIILGTARGLAYLHEEFHVSVIH  449



>ref|XP_006591771.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=625

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G K+G LNW+QR DII GTARGLAYLH++FHV +IH
Sbjct  399  LVYEYMANNSLDKFLFGKKKGSLNWRQRYDIILGTARGLAYLHEEFHVSVIH  450



>ref|XP_006591755.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=602

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YMANTSLD++++G ++G LNWKQR DII GTARGL YLH++FHV IIH
Sbjct  356  LVYQYMANTSLDKFLFGKRKGSLNWKQRYDIILGTARGLTYLHEEFHVSIIH  407



>dbj|BAK00647.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=461

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD+ ++G+++G LNWKQR +I+ G ARGLAYLH +FHVCIIH
Sbjct  215  LVYEYMANSSLDKLLFGERRGTLNWKQRFNIMVGMARGLAYLHQEFHVCIIH  266



>gb|KHN25159.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=633

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G ++G LNW+QR DII GTARGLAYLH++FHV IIH
Sbjct  399  LVYEYMANNSLDKFLFGKRKGSLNWRQRYDIILGTARGLAYLHEEFHVLIIH  450



>ref|XP_010091811.1| Cysteine-rich receptor-like protein kinase 3 [Morus notabilis]
 gb|EXB46019.1| Cysteine-rich receptor-like protein kinase 3 [Morus notabilis]
Length=641

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLDR+++G+++G L W QR DII GTARGLAYLH+ FH+CIIH
Sbjct  393  LVYEYMANSSLDRFLFGERRGSLRWTQRHDIITGTARGLAYLHEDFHICIIH  444



>ref|XP_006481962.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Citrus sinensis]
Length=660

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SL+++++G+K+G LNWKQR DII GTARGLAYLH+ FHV IIH
Sbjct  411  LVYEYMANSSLNKFLFGEKRGSLNWKQRFDIILGTARGLAYLHEDFHVRIIH  462



>ref|XP_007146953.1| hypothetical protein PHAVU_006G084500g [Phaseolus vulgaris]
 gb|ESW18947.1| hypothetical protein PHAVU_006G084500g [Phaseolus vulgaris]
Length=638

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G ++G L+WKQR DII GTARGLAYLH++FHV IIH
Sbjct  394  LVYEYMANSSLDKFLFGHRKGCLSWKQRYDIILGTARGLAYLHEEFHVSIIH  445



>ref|XP_004986492.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Setaria italica]
Length=642

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G+++G LNW+QR +II G ARGLAYLH +FHVCIIH
Sbjct  396  LVYEYMANGSLDKFLFGERRGTLNWRQRFNIIVGMARGLAYLHQEFHVCIIH  447



>gb|KHN23629.1| Cysteine-rich receptor-like protein kinase 42 [Glycine soja]
Length=568

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G ++G LNWKQR DII GTARGL YLH++FHV IIH
Sbjct  316  LVYEYMANASLDKFLFGKRKGSLNWKQRYDIILGTARGLNYLHEEFHVSIIH  367



>emb|CBH32625.1| unnamed protein product [Triticum aestivum]
Length=639

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD+ ++G+++G LNWKQR +I+ G ARGLAYLH +FHVCIIH
Sbjct  393  LVYEYMANSSLDKLLFGERRGTLNWKQRFNIMVGMARGLAYLHQEFHVCIIH  444



>ref|XP_007023702.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
 gb|EOY26324.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
Length=641

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YMAN SLD++++G+  G LNWKQR DII GTA+GLAYLH++FH CIIH
Sbjct  395  LVYQYMANGSLDKHLFGEGHGSLNWKQRFDIILGTAKGLAYLHEEFHACIIH  446



>ref|XP_003537407.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X1 [Glycine max]
Length=658

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G ++G LNWKQR DII GTARGL YLH++FHV IIH
Sbjct  406  LVYEYMANASLDKFLFGKRKGSLNWKQRYDIILGTARGLNYLHEEFHVSIIH  457



>ref|XP_006591287.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X2 [Glycine max]
Length=659

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G ++G LNWKQR DII GTARGL YLH++FHV IIH
Sbjct  407  LVYEYMANASLDKFLFGKRKGSLNWKQRYDIILGTARGLNYLHEEFHVSIIH  458



>ref|XP_010907638.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Elaeis 
guineensis]
Length=638

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++GDK G LNWKQR DII G ARGL YLH++FH  IIH
Sbjct  391  LVYEYMANSSLDKFLFGDKHGTLNWKQRFDIIVGMARGLVYLHEEFHFRIIH  442



>ref|XP_007146952.1| hypothetical protein PHAVU_006G084400g [Phaseolus vulgaris]
 gb|ESW18946.1| hypothetical protein PHAVU_006G084400g [Phaseolus vulgaris]
Length=682

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLDR+++G+ +  L+WKQR DII GTA+GLAYLH+ FHVCIIH
Sbjct  434  LVYEYMANNSLDRFLFGEGKDSLSWKQRYDIILGTAKGLAYLHEDFHVCIIH  485



>ref|XP_006847936.1| hypothetical protein AMTR_s00029p00129930 [Amborella trichopoda]
 gb|ERN09517.1| hypothetical protein AMTR_s00029p00129930 [Amborella trichopoda]
Length=617

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD+Y++G++ G LNWK R DII G ARGLAYLHD+FHV IIH
Sbjct  372  LVYEYMANGSLDKYLFGEEHGKLNWKMRFDIIVGMARGLAYLHDEFHVRIIH  423



>ref|XP_007146956.1| hypothetical protein PHAVU_006G084800g [Phaseolus vulgaris]
 gb|ESW18950.1| hypothetical protein PHAVU_006G084800g [Phaseolus vulgaris]
Length=640

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN+SLD++++G+++G L+WKQR DII GTA GLAYLH++FHV IIH
Sbjct  392  LVYEYMANSSLDKFLFGNRKGSLSWKQRYDIILGTAMGLAYLHEEFHVSIIH  443



>ref|XP_006591754.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=621

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G+++  LNWKQR DII GTARGL YLH++FHV IIH
Sbjct  374  LVYEYMANNSLDKFLFGNRRCSLNWKQRYDIILGTARGLTYLHEEFHVSIIH  425



>gb|KHN45762.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=645

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G+++  LNWKQR DII GTARGL YLH++FHV IIH
Sbjct  398  LVYEYMANNSLDKFLFGNRRCSLNWKQRYDIILGTARGLTYLHEEFHVSIIH  449



>ref|XP_006603110.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=535

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G ++G LNWKQ  DII GTARGL YLH++FHV IIH
Sbjct  316  LVYEYMANASLDKFLFGKRKGSLNWKQCYDIILGTARGLTYLHEEFHVSIIH  367



>gb|KHN08747.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=624

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G ++G LNWKQ  DII GTARGL YLH++FHV IIH
Sbjct  405  LVYEYMANASLDKFLFGKRKGSLNWKQCYDIILGTARGLTYLHEEFHVSIIH  456



>ref|XP_006591760.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=630

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YMANTSLD++++G ++G L+WK R DII GTARGL YLH++FHV IIH
Sbjct  397  LVYQYMANTSLDKFLFGKRKGSLHWKNRYDIILGTARGLTYLHEEFHVSIIH  448



>gb|KHN45756.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=632

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YMANTSLD++++G ++G L+WK R DII GTARGL YLH++FHV IIH
Sbjct  399  LVYQYMANTSLDKFLFGKRKGSLHWKNRYDIILGTARGLTYLHEEFHVSIIH  450



>gb|KHN25165.1| Cysteine-rich receptor-like protein kinase 3 [Glycine soja]
Length=505

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SL+++++G ++  LNW+QR DII GTARGLAYLH++FHV IIH
Sbjct  255  LVYEYMANNSLEKFLFGIRKNSLNWRQRYDIILGTARGLAYLHEEFHVSIIH  306



>ref|XP_006591289.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X2 [Glycine max]
 gb|KHN18263.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=650

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD+ ++G ++G LNWKQR DII GTARGL YLH++FHV I H
Sbjct  400  LVYEYMANASLDKLLFGQRKGSLNWKQRRDIILGTARGLTYLHEEFHVSITH  451



>ref|XP_006591288.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X1 [Glycine max]
Length=651

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD+ ++G ++G LNWKQR DII GTARGL YLH++FHV I H
Sbjct  401  LVYEYMANASLDKLLFGQRKGSLNWKQRRDIILGTARGLTYLHEEFHVSITH  452



>ref|XP_006591290.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X3 [Glycine max]
Length=543

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD+ ++G ++G LNWKQR DII GTARGL YLH++FHV I H
Sbjct  401  LVYEYMANASLDKLLFGQRKGSLNWKQRRDIILGTARGLTYLHEEFHVSITH  452



>ref|XP_006591291.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=652

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SL+++++G ++  LNW+QR DII GTARGLAYLH++FHV IIH
Sbjct  402  LVYEYMANNSLEKFLFGIRKNSLNWRQRYDIILGTARGLAYLHEEFHVSIIH  453



>gb|EAZ18316.1| hypothetical protein OsJ_33848 [Oryza sativa Japonica Group]
Length=404

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G+K   LNWKQR +II G ARGLAYLH++FHV IIH
Sbjct  158  LVYEYMANGSLDKFLFGEKSVALNWKQRFNIIIGMARGLAYLHEEFHVRIIH  209



>ref|NP_001067872.1| Os11g0470200 [Oryza sativa Japonica Group]
 dbj|BAF28235.1| Os11g0470200 [Oryza sativa Japonica Group]
Length=407

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G+K   LNWKQR +II G ARGLAYLH++FHV IIH
Sbjct  161  LVYEYMANGSLDKFLFGEKSVALNWKQRFNIIIGMARGLAYLHEEFHVRIIH  212



>ref|XP_006591763.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Glycine max]
Length=647

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD+++ G  +G LNW+QR DII GTARGLAYLH+ FH+ IIH
Sbjct  397  LVYEYMANNSLDKFLSGKIKGSLNWRQRYDIILGTARGLAYLHEDFHIPIIH  448



>gb|KHN23624.1| Cysteine-rich receptor-like protein kinase 3 [Glycine soja]
Length=447

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD+++   ++G LNW+QR DII GTARGLAYLH+ FH+ IIH
Sbjct  257  LVYEYMANNSLDKFLSDKRKGSLNWRQRYDIILGTARGLAYLHEDFHIPIIH  308



>emb|CDP01669.1| unnamed protein product [Coffea canephora]
Length=699

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 9/61 (15%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY---------GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCII  4
            LVYEYMAN SLD+++Y         GDK+G LNWKQR DI+FGTAR LAYLH+Q+H  +I
Sbjct  468  LVYEYMANGSLDKFLYESPHHTSYRGDKRGYLNWKQRFDIVFGTARCLAYLHEQYHFSLI  527

Query  3    H  1
            H
Sbjct  528  H  528



>ref|XP_007146954.1| hypothetical protein PHAVU_006G084600g [Phaseolus vulgaris]
 gb|ESW18948.1| hypothetical protein PHAVU_006G084600g [Phaseolus vulgaris]
Length=646

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+MAN SLD++++G ++G L+WKQR DII G ARGL YLH++FHV IIH
Sbjct  397  LVYEFMANNSLDKFLFGKRKGSLSWKQRYDIILGIARGLTYLHEEFHVSIIH  448



>gb|ABA93633.2| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=643

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYMAN SLD++++G+K   LNWKQR +II G ARGLAYLH++FHV IIH
Sbjct  397  LVYEYMANGSLDKFLFGEKSVALNWKQRFNIIIGMARGLAYLHEEFHVRIIH  448



>ref|XP_008776726.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Phoenix 
dactylifera]
Length=702

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY YMAN+SLD++++G K    NWKQR DII G ARGL YLH +FHV IIH
Sbjct  455  LVYVYMANSSLDKFLFGTKLSSFNWKQRFDIIVGMARGLTYLHQEFHVRIIH  506



>ref|XP_011079278.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Sesamum indicum]
Length=406

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLDR IYG+ Q  LNW  R  II G ARGL YLH+  HV I+H
Sbjct  156  LVYEYMKNRSLDRIIYGESQIFLNWTTRFQIILGIARGLQYLHEDSHVRIVH  207



>ref|XP_011079277.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Sesamum indicum]
Length=472

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLDR IYG+ Q  LNW  R  II G ARGL YLH+  HV I+H
Sbjct  222  LVYEYMKNRSLDRIIYGESQIFLNWTTRFQIILGIARGLQYLHEDSHVRIVH  273



>ref|XP_003600600.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=693

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 38/91 (42%), Positives = 47/91 (52%), Gaps = 39/91 (43%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYG---------------------------------------DKQG  94
            LVYEYMAN+SLD++++G                                       +KQG
Sbjct  512  LVYEYMANSSLDKFLFGISIYFEFQNKTSVTLITIRSNNHHTRPFFLFKVKLLLTCNKQG  571

Query  93   ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
             LNWKQR DII GTARGLA LH++FH+ IIH
Sbjct  572  SLNWKQRCDIILGTARGLACLHEEFHISIIH  602



>ref|XP_011023814.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Populus 
euphratica]
Length=394

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD+ ++  DK+G L+WK+R +II G ARGL YLH   H CIIH
Sbjct  123  LVYEYVANESLDKLLFKSDKRGQLDWKKRYNIIIGIARGLLYLHQDSHSCIIH  175



>ref|XP_011070185.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Sesamum 
indicum]
Length=506

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLDR IYG+    LNW  R  II G ARGL YLH+  HV I+H
Sbjct  256  LVYEYMKNRSLDRIIYGNSDVFLNWSTRFQIILGIARGLQYLHEDSHVRIVH  307



>ref|XP_009776021.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009776022.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Nicotiana sylvestris]
Length=270

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD+ ++    + +LNWKQR DII G ARGL YLH+  H CIIH
Sbjct  122  LVYEYVANESLDKILFKSTNRDVLNWKQRHDIIIGIARGLLYLHEGSHNCIIH  174



>ref|XP_002311515.2| hypothetical protein POPTR_0008s13160g [Populus trichocarpa]
 gb|EEE88882.2| hypothetical protein POPTR_0008s13160g [Populus trichocarpa]
Length=393

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD+ ++  DK+G L+WK R +II G ARGL YLH   H CIIH
Sbjct  123  LVYEYVANESLDKLLFKSDKRGQLDWKTRYNIIIGIARGLLYLHQDSHSCIIH  175



>gb|KDP38086.1| hypothetical protein JCGZ_04729 [Jatropha curcas]
Length=397

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD++++  +K+  L+WKQR DII G ARGL YLH+  H CIIH
Sbjct  123  LVYEYVANESLDKFLFKSNKREQLDWKQRHDIITGIARGLLYLHEDSHNCIIH  175



>ref|XP_009776020.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nicotiana sylvestris]
Length=398

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD+ ++    + +LNWKQR DII G ARGL YLH+  H CIIH
Sbjct  122  LVYEYVANESLDKILFKSTNRDVLNWKQRHDIIIGIARGLLYLHEGSHNCIIH  174



>ref|XP_011070601.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Sesamum 
indicum]
Length=439

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLD+ ++  DK+ +L+WKQR DII GTARGL YLH++   CIIH
Sbjct  122  LVYEYVVNESLDKILFRSDKRELLDWKQRHDIIVGTARGLRYLHEEAPRCIIH  174



>ref|XP_009627951.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Nicotiana 
tomentosiformis]
Length=398

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGD-KQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD+ ++    + +LNWKQR DII G ARGL YLH+  H CIIH
Sbjct  122  LVYEYVANESLDKILFKSANRDVLNWKQRHDIIIGIARGLLYLHEGSHNCIIH  174



>ref|XP_006833103.1| hypothetical protein AMTR_s00072p00040840 [Amborella trichopoda]
 gb|ERM98381.1| hypothetical protein AMTR_s00072p00040840 [Amborella trichopoda]
Length=592

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLDR ++ +   ILNWK R +I  GTARG+AYLH++   CIIH
Sbjct  399  LVYDYMPNGSLDRLLFQEGSTILNWKTRYEIALGTARGIAYLHEKCRDCIIH  450



>ref|XP_010927624.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
isoform X2 [Elaeis guineensis]
Length=686

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+YEYM N SLD +I+  KQG +LNW++R+DII G ARGL YLH    + IIH
Sbjct  439  LIYEYMQNKSLDTFIFDKKQGALLNWRKRLDIIIGIARGLLYLHQDSRLTIIH  491



>ref|XP_010927616.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
isoform X1 [Elaeis guineensis]
Length=822

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+YEYM N SLD +I+  KQG +LNW++R+DII G ARGL YLH    + IIH
Sbjct  575  LIYEYMQNKSLDTFIFDKKQGALLNWRKRLDIIIGIARGLLYLHQDSRLTIIH  627



>gb|EAY92001.1| hypothetical protein OsI_13690 [Oryza sativa Indica Group]
Length=645

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD+Y+YG+ + ILNW QR++II G + GL YLH+++   +IH
Sbjct  391  LVYDYMINGSLDKYLYGEGKPILNWAQRINIIKGASSGLLYLHEEWEQVVIH  442



>ref|XP_011038603.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Populus euphratica]
Length=403

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD+ ++  DK+ +L+W +R DI+ G ARGL YLH+  H CIIH
Sbjct  122  LVYEYVANESLDKLLFKSDKRQLLDWNRRYDILIGIARGLLYLHEDSHNCIIH  174



>ref|XP_011038602.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Populus euphratica]
Length=404

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD+ ++  DK+ +L+W +R DI+ G ARGL YLH+  H CIIH
Sbjct  123  LVYEYVANESLDKLLFKSDKRQLLDWNRRYDILIGIARGLLYLHEDSHNCIIH  175



>ref|XP_002315871.2| kinase family protein [Populus trichocarpa]
 gb|EEF02042.2| kinase family protein [Populus trichocarpa]
Length=404

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD+ ++  DK+ +L+W +R DI+ G ARGL YLH+  H CIIH
Sbjct  123  LVYEYVANESLDKLLFKSDKRQLLDWNRRYDILIGIARGLLYLHEDSHNCIIH  175



>gb|KEH37465.1| receptor-like kinase [Medicago truncatula]
Length=422

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+YEYM N SLD +IYG+    LNW  R  II G ARGL YLH+  H+ I+H
Sbjct  186  LIYEYMKNRSLDLFIYGNNDRFLNWSTRYQIILGVARGLQYLHEDSHLRIVH  237



>ref|XP_008813655.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-6 [Phoenix dactylifera]
Length=786

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+YEYM N SLD +I+  KQG +LNW++R+DII G ARGL YLH    + IIH
Sbjct  539  LIYEYMQNKSLDAFIFDKKQGALLNWQKRLDIIIGIARGLLYLHQDSRLTIIH  591



>ref|XP_002976262.1| hypothetical protein SELMODRAFT_35175, partial [Selaginella moellendorffii]
 gb|EFJ22522.1| hypothetical protein SELMODRAFT_35175, partial [Selaginella moellendorffii]
Length=295

 Score = 67.4 bits (163),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGD--KQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLD++IY D  +Q +LNW+QR++I+ G ARGLAYLH++    IIH
Sbjct  92   LVYEHMENGSLDKWIYQDCVEQKVLNWEQRMEIMLGMARGLAYLHEECVEKIIH  145



>ref|XP_008442517.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like 
[Cucumis melo]
Length=661

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+MAN SLD YI+G  + IL+WKQRV II G A GL YLH+ +   +IH
Sbjct  414  LVYEFMANGSLDSYIFGKPKVILSWKQRVKIINGVASGLLYLHEGYEQVVIH  465



>gb|EYU37307.1| hypothetical protein MIMGU_mgv1a007477mg [Erythranthe guttata]
Length=406

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  IYG     LNW  R+ II G+ARGL YLH+  HV I+H
Sbjct  153  LVYEYMKNRSLDLIIYGKSDVFLNWGTRLQIILGSARGLQYLHEDSHVRIVH  204



>ref|XP_002524667.1| kinase, putative [Ricinus communis]
 gb|EEF37686.1| kinase, putative [Ricinus communis]
Length=605

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYG-DKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLD++I+G DK   LNWKQR DII GTA GLAYLH      IIH
Sbjct  337  LVYEYVPNKSLDQFIFGKDKPTTLNWKQRFDIIVGTAEGLAYLHGGSQERIIH  389



>ref|XP_009350401.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 [Pyrus x bretschneideri]
Length=835

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDK-QGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD +++ DK  G+L+WK R  I  GTARGLAYLH++   CIIH
Sbjct  567  LVYDYMPNGSLDSHLFNDKGPGVLDWKTRYQIALGTARGLAYLHEKCRDCIIH  619



>ref|XP_003565759.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 [Brachypodium distachyon]
Length=788

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +++ DK G+L+W  R  I  G A+GLAYLH++   CIIH
Sbjct  561  LVYEYMPNGSLDAHLFADKSGLLSWNVRYQIALGIAKGLAYLHEECEDCIIH  612



>ref|XP_003567348.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 [Brachypodium distachyon]
Length=966

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM+NTSLDR ++G  Q +L+W  R  I  G ARGL YLH++   CIIH
Sbjct  741  LVYEYMSNTSLDRCLFGSNQLVLSWGMRYQIALGIARGLHYLHEKCRDCIIH  792



>ref|XP_009615472.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Nicotiana tomentosiformis]
Length=416

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD+ +YG     LNWK R  II G ARGL YLH+  H+ I+H
Sbjct  171  LVYEYMKNRSLDQILYGKSNIFLNWKTRHQIILGIARGLQYLHEDSHIRIVH  222



>ref|XP_002984806.1| hypothetical protein SELMODRAFT_121148 [Selaginella moellendorffii]
 gb|EFJ14056.1| hypothetical protein SELMODRAFT_121148 [Selaginella moellendorffii]
Length=372

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGD--KQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLD++IY D  +Q +LNW+QR++I+ G ARGLAYLH++    IIH
Sbjct  120  LVYEHMENGSLDKWIYQDFLEQKVLNWQQRMEIMLGMARGLAYLHEECVEKIIH  173



>ref|XP_006845733.1| hypothetical protein AMTR_s00019p00245130 [Amborella trichopoda]
 gb|ERN07408.1| hypothetical protein AMTR_s00019p00245130 [Amborella trichopoda]
Length=665

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM+N SLDR +YG     LNW+ R  II G ARGL YLH+  H  I+H
Sbjct  406  LVYEYMSNGSLDRILYGKSDKFLNWQIRYQIILGIARGLQYLHEDSHFRIVH  457



>ref|XP_008341942.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 [Malus domestica]
Length=835

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDK-QGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD +++ DK  G+L+WK R  I  GTARGLAYLH++   CIIH
Sbjct  567  LVYDYMPNGSLDSHLFNDKGPGLLDWKTRYQIALGTARGLAYLHEKCRDCIIH  619



>gb|KFK36661.1| hypothetical protein AALP_AA4G153600 [Arabis alpina]
Length=672

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD+Y+Y + +  LNWKQR+ +I G A GL YLH+++   +IH
Sbjct  416  LVYDYMPNGSLDKYLYNNPEVTLNWKQRIKVILGVASGLFYLHEEWEQVVIH  467



>ref|XP_006453216.1| hypothetical protein CICLE_v10010318mg [Citrus clementina]
 gb|ESR66456.1| hypothetical protein CICLE_v10010318mg [Citrus clementina]
 gb|KDO61972.1| hypothetical protein CISIN_1g040557mg [Citrus sinensis]
Length=407

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  IYG+    LNW  R  II G ARGL YLH+  H  I+H
Sbjct  156  LVYEYMKNRSLDLLIYGESDKFLNWSTRFQIILGIARGLQYLHEDSHTRIVH  207



>ref|XP_009143456.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1 
[Brassica rapa]
Length=673

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY++M N SLDRY+Y   +  LNWKQR+++I G A GL YLH+++   +IH
Sbjct  417  LVYDFMPNGSLDRYLYNKPEVTLNWKQRINVILGVASGLFYLHEEWEQVVIH  468



>ref|XP_004162810.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like, partial [Cucumis sativus]
Length=410

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  IYG  + ILNW  R+ II G A+GL YLH+  H+ IIH
Sbjct  171  LVYEYMENRSLDLIIYGGSEQILNWNTRLKIIRGIAKGLQYLHEDSHLRIIH  222



>ref|XP_006474647.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Citrus sinensis]
Length=424

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  IYG+    LNW  R  II G ARGL YLH+  H  I+H
Sbjct  173  LVYEYMKNRSLDLLIYGESDKFLNWSTRFQIILGIARGLQYLHEDSHTRIVH  224



>ref|XP_008444357.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Cucumis 
melo]
Length=646

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYG-DKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLDR+I+  D+  +LNW++R DII GT  GLAYLH+     IIH
Sbjct  391  LVYEYLANKSLDRFIFDRDRGKVLNWEKRYDIIVGTVEGLAYLHENSKTKIIH  443



>gb|AES92207.2| receptor-like kinase [Medicago truncatula]
Length=453

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +I+G     LNW  R  II G ARGL YLH+  HV I+H
Sbjct  208  LVYEYMKNRSLDFFIHGKSDEFLNWSTRFQIILGVARGLQYLHEDSHVRIVH  259



>gb|KDP35490.1| hypothetical protein JCGZ_10937 [Jatropha curcas]
Length=314

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  IYG+    L+W  R +II G ARGL YLH+  H+ I+H
Sbjct  64   LVYEYMKNRSLDLIIYGNNSKFLDWNTRFNIILGIARGLQYLHEDSHLRIVH  115



>ref|XP_006840433.1| hypothetical protein AMTR_s00045p00163010 [Amborella trichopoda]
 gb|ERN02108.1| hypothetical protein AMTR_s00045p00163010 [Amborella trichopoda]
Length=644

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGD-KQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY++N+SLDR+++   ++ +L+W++R DII GTA GLAYLHD   V IIH
Sbjct  389  LVYEYLSNSSLDRFLFDPFRRKLLDWRRRFDIIVGTAEGLAYLHDASEVRIIH  441



>ref|NP_001044933.2| Os01g0870500 [Oryza sativa Japonica Group]
 gb|EEE55737.1| hypothetical protein OsJ_04235 [Oryza sativa Japonica Group]
 dbj|BAF06847.2| Os01g0870500 [Oryza sativa Japonica Group]
Length=349

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD++++G  Q +L+W  R  I  G ARGL YLH++   CIIH
Sbjct  107  LVYEYMPNGSLDKHLFGSNQHVLSWNTRYKIALGIARGLDYLHEKCRDCIIH  158



>ref|XP_004488031.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Cicer arietinum]
Length=349

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLD +IYG+    +NW+ R  II G ARGL YLH+  H+ I+H
Sbjct  113  LVYEYIKNKSLDLFIYGNSDQFINWRTRFQIILGVARGLQYLHEDSHLRIVH  164



>ref|XP_004150746.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Cucumis sativus]
Length=509

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  IYG  + ILNW  R+ II G A+GL YLH+  H+ IIH
Sbjct  270  LVYEYMENRSLDLIIYGGSEQILNWNTRLKIIRGIAKGLQYLHEDSHLRIIH  321



>ref|XP_003610010.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=463

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +I+G     LNW  R  II G ARGL YLH+  HV I+H
Sbjct  218  LVYEYMKNRSLDFFIHGKSDEFLNWSTRFQIILGVARGLQYLHEDSHVRIVH  269



>ref|XP_004243018.2| PREDICTED: putative serine/threonine-protein kinase [Solanum 
lycopersicum]
Length=375

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD+ +YG  +  L+WK R  II G ARGL YLH+  H+ I+H
Sbjct  145  LVYEYMKNRSLDQILYGKSKIFLDWKTRYQIILGIARGLQYLHEDSHIRIVH  196



>emb|CDX91384.1| BnaC04g07660D [Brassica napus]
Length=673

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+Y++M N SLDRY+Y   +  LNWKQR+++I G A GL YLH+++   +IH
Sbjct  417  LIYDFMPNGSLDRYLYNKPEVTLNWKQRINVILGVASGLFYLHEEWEQVVIH  468



>ref|XP_010268917.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 isoform X2 [Nelumbo nucifera]
Length=826

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD +++ ++ G L+WK R  I  GTARGLAYLH++   CIIH
Sbjct  566  LVYDYMPNGSLDFHLFREESGTLDWKTRYQIALGTARGLAYLHEKCRDCIIH  617



>ref|XP_001766837.1| predicted protein [Physcomitrella patens]
 gb|EDQ68239.1| predicted protein [Physcomitrella patens]
Length=317

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG--ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N S+D +++G KQG  +L+W+QR++I  GTAR LAYLH++    IIH
Sbjct  110  LVYEYMPNGSVDAWLFGKKQGEKLLDWEQRLNIALGTARALAYLHEECSDHIIH  163



>ref|XP_010268915.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 isoform X1 [Nelumbo nucifera]
Length=853

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD +++ ++ G L+WK R  I  GTARGLAYLH++   CIIH
Sbjct  566  LVYDYMPNGSLDFHLFREESGTLDWKTRYQIALGTARGLAYLHEKCRDCIIH  617



>ref|XP_006355074.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Solanum tuberosum]
Length=398

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGD-KQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD+ ++    +  L+WKQR DII G ARGL YLH+  H CIIH
Sbjct  121  LVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIH  173



>ref|XP_004236942.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Solanum 
lycopersicum]
Length=399

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGD-KQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+AN SLD+ ++    +  L+WKQR DII G ARGL YLH+  H CIIH
Sbjct  122  LVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIH  174



>ref|XP_007014081.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY31700.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=446

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLDR IYG     LNW  R  II G ARGL YLH+  H+ I+H
Sbjct  192  LVYEFMENGSLDRLIYGKSDVFLNWDTRFQIIVGIARGLQYLHEDSHLRIVH  243



>ref|XP_006833105.1| hypothetical protein AMTR_s00072p00045010 [Amborella trichopoda]
 gb|ERM98383.1| hypothetical protein AMTR_s00072p00045010 [Amborella trichopoda]
Length=802

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD+ ++ +   I+NWK R +I  GTARG+AYLH++   CIIH
Sbjct  553  LVYDYMPNGSLDKLLFQEGSTIINWKARYEIALGTARGIAYLHEKCRDCIIH  604



>emb|CAA65153.1| receptor like protein kinase [Arabidopsis thaliana]
Length=635

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD+Y+Y   +  LNWKQR+ +I G A GL YLH+++   +IH
Sbjct  418  LVYDYMPNGSLDKYLYNTPEVTLNWKQRIKVILGVASGLFYLHEEWEQVVIH  469



>ref|NP_001042449.2| Os01g0224000 [Oryza sativa Japonica Group]
 dbj|BAD81458.1| putative S-domain receptor-like protein kinase [Oryza sativa 
Japonica Group]
 dbj|BAD81313.1| putative S-domain receptor-like protein kinase [Oryza sativa 
Japonica Group]
 gb|EEE54145.1| hypothetical protein OsJ_00939 [Oryza sativa Japonica Group]
 dbj|BAF04363.2| Os01g0224000 [Oryza sativa Japonica Group]
Length=805

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM+N SLD +I+ +K  +L+W  R  I  G ARGLAYLH++   CIIH
Sbjct  567  LVYEYMSNGSLDAHIFSEKSSLLSWHVRYQIALGIARGLAYLHEECEDCIIH  618



>ref|XP_001775642.1| predicted protein [Physcomitrella patens]
 gb|EDQ59589.1| predicted protein [Physcomitrella patens]
Length=317

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG--ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLD +++G KQG  +L+W+QR++I  GTAR LAYLH++    IIH
Sbjct  110  LVYEFMPNGSLDAWLFGKKQGEKLLDWEQRLNIALGTARALAYLHEECSDHIIH  163



>ref|XP_010066599.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
 gb|KCW64553.1| hypothetical protein EUGRSUZ_G02158 [Eucalyptus grandis]
Length=407

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY--GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLD+ ++    K+ +L+WK+R DII G ARGL YLH+  H CIIH
Sbjct  123  LVYEYVPNESLDKLLFKSNSKKELLDWKRRFDIIAGIARGLLYLHEDSHSCIIH  176



>ref|XP_002881547.1| hypothetical protein ARALYDRAFT_482773 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57806.1| hypothetical protein ARALYDRAFT_482773 [Arabidopsis lyrata subsp. 
lyrata]
Length=670

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD+Y+Y   +  LNWKQR+ +I G A GL YLH+++   +IH
Sbjct  414  LVYDYMPNGSLDKYLYNTPEVTLNWKQRIKVILGVASGLFYLHEEWEQVVIH  465



>ref|XP_006295761.1| hypothetical protein CARUB_v10024881mg [Capsella rubella]
 gb|EOA28659.1| hypothetical protein CARUB_v10024881mg [Capsella rubella]
Length=675

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD+Y+Y   +  LNWKQR+ +I G A GL YLH+++   +IH
Sbjct  419  LVYDYMPNGSLDKYLYNTPEVTLNWKQRIKVILGVASGLFYLHEEWEQVVIH  470



>ref|NP_181307.1| receptor lectin kinase [Arabidopsis thaliana]
 sp|O80939.1|LRK41_ARATH RecName: Full=L-type lectin-domain containing receptor kinase 
IV.1; Short=Arabidopsis thaliana lectin-receptor kinase e; 
Short=AthlecRK-e; Short=LecRK-IV.1; AltName: Full=Lectin Receptor 
Kinase 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC23641.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAM13890.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AEC09438.1| receptor lectin kinase [Arabidopsis thaliana]
Length=675

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD+Y+Y   +  LNWKQR+ +I G A GL YLH+++   +IH
Sbjct  419  LVYDYMPNGSLDKYLYNTPEVTLNWKQRIKVILGVASGLFYLHEEWEQVVIH  470



>ref|XP_010023497.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
 ref|XP_010023498.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
 ref|XP_010023499.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
 gb|KCW59789.1| hypothetical protein EUGRSUZ_H02538 [Eucalyptus grandis]
Length=651

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE++ N SLDR+I+   +G  LNW++RVDII GTA GL YLH+ F   IIH
Sbjct  394  LVYEFLPNRSLDRFIFDANKGKALNWEKRVDIIVGTAEGLVYLHENFKNKIIH  446



>gb|KHN17659.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=355

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  IYG     LNW  R  II G ARGL YLH+  H+ I+H
Sbjct  111  LVYEYMKNRSLDLIIYGKSDQFLNWSTRFQIILGVARGLQYLHEDSHLRIVH  162



>ref|XP_008453534.1| PREDICTED: putative serine/threonine-protein kinase [Cucumis 
melo]
Length=405

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  IYG    ILNW  R+ II G A+GL YLH+  H+ IIH
Sbjct  166  LVYEYMENRSLDLIIYGGSDQILNWNTRLKIIRGIAKGLQYLHEDSHLRIIH  217



>ref|XP_006366206.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Solanum tuberosum]
Length=377

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD+ +YG     L+WK R  II G ARGL YLH+  H+ I+H
Sbjct  148  LVYEYMKNRSLDQILYGKSNIFLDWKTRYQIILGIARGLQYLHEDSHIRIVH  199



>ref|XP_008799499.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Phoenix dactylifera]
Length=422

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  IYG+ +  LNWK R  II G ARGL YLH+  ++ I+H
Sbjct  161  LVYEYMKNGSLDSLIYGNCKTFLNWKTRFQIILGIARGLQYLHEDSNLRIVH  212



>ref|XP_006469213.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Citrus sinensis]
Length=404

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+YEY+ N SLD+ ++  ++   LNWKQR DII G ARGL YLH+  H CIIH
Sbjct  123  LIYEYVINESLDKVLFKSRRNHELNWKQRYDIITGIARGLLYLHEDSHNCIIH  175



>ref|XP_006448211.1| hypothetical protein CICLE_v10015463mg [Citrus clementina]
 gb|ESR61451.1| hypothetical protein CICLE_v10015463mg [Citrus clementina]
Length=404

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            L+YEY+ N SLD+ ++  ++   LNWKQR DII G ARGL YLH+  H CIIH
Sbjct  123  LIYEYVINESLDKVLFKSRRNHELNWKQRYDIITGIARGLLYLHEDSHNCIIH  175



>ref|XP_006645651.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130-like [Oryza brachyantha]
Length=798

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM+N SLD +I+ +K  +L+W  R  I  G ARGLAYLH++   CIIH
Sbjct  562  LVYEYMSNGSLDAHIFSEKSSLLSWPVRYQIAIGIARGLAYLHEECEDCIIH  613



>ref|XP_002985868.1| hypothetical protein SELMODRAFT_17154, partial [Selaginella moellendorffii]
 gb|EFJ13045.1| hypothetical protein SELMODRAFT_17154, partial [Selaginella moellendorffii]
Length=184

 Score = 64.3 bits (155),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGD--KQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLD++IY D  ++ +LNW+QR++I+ G ARGLAYLH++    IIH
Sbjct  84   LVYEHMENGSLDKWIYQDFLEERVLNWEQRMEIMLGMARGLAYLHEECVEKIIH  137



>ref|XP_007045211.1| Cysteine-rich receptor-like protein kinase 10 [Theobroma cacao]
 gb|EOY01043.1| Cysteine-rich receptor-like protein kinase 10 [Theobroma cacao]
Length=404

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLD+ ++  +++  L+WKQR DII G ARGL YLH+  H CIIH
Sbjct  125  LVYEYVTNESLDKLLFKSNRKEELDWKQRYDIITGIARGLLYLHEDSHNCIIH  177



>ref|NP_001055037.1| Os05g0256100 [Oryza sativa Japonica Group]
 dbj|BAF16951.1| Os05g0256100, partial [Oryza sativa Japonica Group]
Length=340

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLD+ I+G     L+W  R +II G ARGL+YLH++  VCI+H
Sbjct  82   LVYEYLENGSLDQAIFGHSSLNLDWAMRFEIILGIARGLSYLHEESSVCIVH  133



>ref|XP_010909134.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 [Elaeis guineensis]
Length=790

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLD Y++ +   ILNW+ R +I  G ARGLAYLH++   CIIH
Sbjct  558  LVYEFMPNGSLDSYLFKNNCMILNWRTRYEIFLGIARGLAYLHEECIQCIIH  609



>ref|XP_003534911.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Glycine max]
Length=412

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +I+G+    LNW  R  II G ARGL YLH+  H  I+H
Sbjct  167  LVYEYMKNRSLDLFIHGNSDQFLNWSTRFQIILGVARGLQYLHEDSHPRIVH  218



>ref|XP_006654185.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X2 [Oryza brachyantha]
Length=808

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLDR I+G     L+W  R +II G ARGL+YLH++  VCI+H
Sbjct  715  LVYEYLENGSLDRAIFGHSSLNLDWVMRFEIILGIARGLSYLHEESSVCIVH  766



>gb|ABV30772.1| kinase-like protein [Prunus cerasus var. caproniana]
Length=148

 Score = 63.9 bits (154),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGD-KQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YMAN SLD +++ D +  +L+WK R  I  GTARGLAYLH++   CIIH
Sbjct  54   LVYDYMANGSLDSHLFHDTRPNVLDWKTRYQIALGTARGLAYLHEKCRDCIIH  106



>gb|ABV30791.1| kinase-like protein [Prunus cerasus var. caproniana]
Length=150

 Score = 63.9 bits (154),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGD-KQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YMAN SLD +++ D +  +L+WK R  I  GTARGLAYLH++   CIIH
Sbjct  56   LVYDYMANGSLDSHLFHDTRPNVLDWKTRYQIALGTARGLAYLHEKCRDCIIH  108



>gb|KHN35838.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=376

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +I+G+    LNW  R  II G ARGL YLH+  H  I+H
Sbjct  131  LVYEYMKNRSLDLFIHGNSDQFLNWSTRFQIILGVARGLQYLHEDSHPRIVH  182



>ref|XP_006410963.1| hypothetical protein EUTSA_v10016355mg [Eutrema salsugineum]
 gb|ESQ52416.1| hypothetical protein EUTSA_v10016355mg [Eutrema salsugineum]
Length=674

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY++M N SLD+Y+Y + +  LNWKQR+ +I G A GL YLH+++   +IH
Sbjct  418  LVYDFMPNGSLDKYLYNNPEVTLNWKQRIKVILGVASGLFYLHEEWEQVVIH  469



>ref|XP_006654184.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X1 [Oryza brachyantha]
Length=957

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLDR I+G     L+W  R +II G ARGL+YLH++  VCI+H
Sbjct  715  LVYEYLENGSLDRAIFGHSSLNLDWVMRFEIILGIARGLSYLHEESSVCIVH  766



>gb|ACN93885.1| putative protein kinase [Oryza sativa Japonica Group]
Length=359

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLD+ I+G     L+W  R +II G ARGL+YLH++  VCI+H
Sbjct  101  LVYEYLENGSLDQAIFGHSSLNLDWAMRFEIILGIARGLSYLHEESSVCIVH  152



>ref|XP_008230263.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 [Prunus mume]
Length=717

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQ-GILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD +++ DK+  +L+WK R  I  GTARGLAYLH++   CIIH
Sbjct  565  LVYDYMPNGSLDSHLFHDKRPNVLDWKTRYQIALGTARGLAYLHEKCRDCIIH  617



>ref|XP_002527785.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF34595.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=411

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY++N SLD+ ++  +K+  L+WK+R DII G ARGL YLH+  H CIIH
Sbjct  123  LVYEYVSNESLDKLLFKSNKREQLDWKRRYDIITGIARGLLYLHEDSHNCIIH  175



>ref|XP_002529279.1| s-receptor kinase, putative [Ricinus communis]
 gb|EEF33111.1| s-receptor kinase, putative [Ricinus communis]
Length=787

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD +++ G+K  +L+WK R +I  GTA+GLAYLHD+   CIIH
Sbjct  560  LVYDYMPNGSLDSFLFQGNKLIVLDWKTRYNIALGTAKGLAYLHDKCKDCIIH  612



>ref|XP_007021494.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY13019.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=787

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +++     IL+WK R  I  G ARGLAYLHD+   CIIH
Sbjct  562  LVYEYMPNGSLDSHLFYKDSKILDWKTRYHIALGIARGLAYLHDKCRECIIH  613



>ref|XP_008389698.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X2 [Malus domestica]
Length=626

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLDR+I+  ++   LNW++R DII GTA GLAYLHD     IIH
Sbjct  370  LVYEYLPNRSLDRFIFDQERAKTLNWERRYDIIVGTAEGLAYLHDNSKTRIIH  422



>ref|XP_008389695.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Malus domestica]
 ref|XP_008389697.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Malus domestica]
Length=649

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLDR+I+  ++   LNW++R DII GTA GLAYLHD     IIH
Sbjct  393  LVYEYLPNRSLDRFIFDQERAKTLNWERRYDIIVGTAEGLAYLHDNSKTRIIH  445



>gb|EPS73296.1| hypothetical protein M569_01459 [Genlisea aurea]
Length=1136

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+Y+ N SLD+ ++  DK+ +L+WK+R DII G A+GL YLHD+ H  IIH
Sbjct  875  LVYQYIPNESLDKLLFKSDKRDLLDWKRRFDIILGVAKGLLYLHDEAHCRIIH  927



>ref|XP_002985870.1| hypothetical protein SELMODRAFT_24639, partial [Selaginella moellendorffii]
 gb|EFJ13047.1| hypothetical protein SELMODRAFT_24639, partial [Selaginella moellendorffii]
Length=279

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDK--QGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLD++I+ D+  Q +LNW+QR++I+ G A GLAYLH++    IIH
Sbjct  76   LVYEHMENGSLDKWIFQDRVEQKVLNWEQRMEIVLGMANGLAYLHEECVQKIIH  129



>ref|XP_002527696.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF34695.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=415

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  +YG+    L+W  R  II G ARGL YLH+  H+ I+H
Sbjct  165  LVYEYMKNRSLDNIVYGNSDQFLDWNTRFQIILGIARGLQYLHEDSHLRIVH  216



>ref|XP_006384135.1| hypothetical protein POPTR_0004s07660g, partial [Populus trichocarpa]
 gb|ERP61932.1| hypothetical protein POPTR_0004s07660g, partial [Populus trichocarpa]
Length=91

 Score = 62.8 bits (151),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 6/50 (12%)
 Frame = -1

Query  135  NTSLDRYIYG-----DKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            N+SL+++++G     D  G L W+QR DII GTA+GLAY H+QFHVCIIH
Sbjct  1    NSSLNKFLFGMVKNEDPSG-LRWEQRFDIILGTAQGLAYPHEQFHVCIIH  49



>ref|XP_001767914.1| predicted protein [Physcomitrella patens]
 gb|EDQ67189.1| predicted protein [Physcomitrella patens]
Length=317

 Score = 65.1 bits (157),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG--ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLD +++G KQG  +L+W QR++I  GTAR LAYLH++    IIH
Sbjct  110  LVYEFMPNGSLDSWLFGKKQGGKLLDWAQRLNIAVGTARALAYLHEECSDHIIH  163



>ref|XP_006655031.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130-like [Oryza brachyantha]
Length=687

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLD  ++     +LNW  R DII G ARGL+YLH   H CIIH
Sbjct  501  LVYEHMLNGSLDSLLFQSNGPVLNWTTRYDIIIGVARGLSYLHQSCHECIIH  552



>gb|KHN24615.1| Putative LRR receptor-like serine/threonine-protein kinase, partial 
[Glycine soja]
Length=416

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +I+G+    LNW  R  II G ARGL YLH+  H  I+H
Sbjct  171  LVYEYMKNRSLDLFIHGNSDQFLNWSTRFQIILGVARGLQYLHEDSHQRIVH  222



>ref|XP_006597385.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Glycine max]
Length=820

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N+SLD +I+  KQG  L W++R DII G ARGL YLH    + IIH
Sbjct  573  LVYEYMPNSSLDHFIFDPKQGKTLKWRKRYDIIVGIARGLLYLHQDSKLTIIH  625



>ref|XP_006597384.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Glycine max]
Length=822

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N+SLD +I+  KQG  L W++R DII G ARGL YLH    + IIH
Sbjct  575  LVYEYMPNSSLDHFIFDPKQGKTLKWRKRYDIIVGIARGLLYLHQDSKLTIIH  627



>gb|KDP45316.1| hypothetical protein JCGZ_09565 [Jatropha curcas]
Length=669

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGD-KQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLD++I+G+ K   LNWK+R +II GTA GLAYLH    V IIH
Sbjct  398  LVYEYIPNKSLDQFIFGNTKTRTLNWKERFNIIVGTAEGLAYLHGGSQVRIIH  450



>ref|XP_007223006.1| hypothetical protein PRUPE_ppa006805mg [Prunus persica]
 gb|EMJ24205.1| hypothetical protein PRUPE_ppa006805mg [Prunus persica]
Length=394

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+A+ SLD+ ++  ++Q  L+WK+R DII G ARGL YLH+  H CIIH
Sbjct  123  LVYEYVAHESLDKLLFKSNRQEELDWKRRYDIICGIARGLLYLHEDSHNCIIH  175



>gb|KHN33625.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=1040

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N+SLD +I+  KQG  L W++R DII G ARGL YLH    + IIH
Sbjct  527  LVYEYMPNSSLDHFIFDPKQGKTLKWRKRYDIIVGIARGLLYLHQDSKLTIIH  579



>ref|XP_003589667.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=398

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+   SLD++++  +K+  L+WK+R DII G ARGL YLH+  H+CIIH
Sbjct  123  LVYEYVPLESLDKFLFRSNKKQELDWKRRFDIINGVARGLLYLHEDSHICIIH  175



>ref|XP_010093038.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB53366.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=332

 Score = 65.1 bits (157),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLDR ++GD    LNW  R  I  G ARGLAYLH++  + I+H
Sbjct  91   LVYEYLENNSLDRALFGDHGMKLNWSTRFSICLGVARGLAYLHEESRIRIVH  142



>gb|EAY76778.1| hypothetical protein OsI_04734 [Oryza sativa Indica Group]
Length=822

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLDR+++G   G+L+W+ R  I  G ARGL YLH++   CIIH
Sbjct  589  LVYEHMPNGSLDRHLFGHGGGVLSWEARYQIALGVARGLDYLHEKCRDCIIH  640



>gb|EAZ14437.1| hypothetical protein OsJ_04357 [Oryza sativa Japonica Group]
Length=826

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLDR+++G   G+L+W+ R  I  G ARGL YLH++   CIIH
Sbjct  593  LVYEHMPNGSLDRHLFGHGGGVLSWEARYQIALGVARGLDYLHEKCRDCIIH  644



>ref|NP_001045048.1| Os01g0889900 [Oryza sativa Japonica Group]
 dbj|BAB92650.1| putative S-receptor kinase [Oryza sativa Japonica Group]
 dbj|BAF06962.1| Os01g0889900 [Oryza sativa Japonica Group]
 dbj|BAG94366.1| unnamed protein product [Oryza sativa Japonica Group]
Length=826

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLDR+++G   G+L+W+ R  I  G ARGL YLH++   CIIH
Sbjct  593  LVYEHMPNGSLDRHLFGHGGGVLSWEARYQIALGVARGLDYLHEKCRDCIIH  644



>gb|AES59918.2| receptor-like kinase [Medicago truncatula]
Length=408

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+   SLD++++  +K+  L+WK+R DII G ARGL YLH+  H+CIIH
Sbjct  123  LVYEYVPLESLDKFLFRSNKKQELDWKRRFDIINGVARGLLYLHEDSHICIIH  175



>ref|XP_010553278.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like 
[Tarenaya hassleriana]
Length=674

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLDRY+Y + +  L+W+QR  +I G A GL YLHD++   ++H
Sbjct  418  LVYDYMPNGSLDRYLYNNPEVTLDWRQRFKVIKGVASGLTYLHDEWEQVVVH  469



>ref|XP_002529278.1| s-receptor kinase, putative [Ricinus communis]
 gb|EEF33110.1| s-receptor kinase, putative [Ricinus communis]
Length=367

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD +++ G+K  +L+WK R +I  GTA+GLAYLH++   CIIH
Sbjct  140  LVYDYMPNGSLDSFLFQGNKLIVLDWKTRCNIALGTAKGLAYLHEKCKDCIIH  192



>ref|XP_008353117.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=340

 Score = 65.1 bits (157),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY-GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLD++++  +++  L+WK+R DII G A+GL YLH+  H CIIH
Sbjct  67   LVYEYVLNESLDKFLFKSNRREELDWKRRFDIICGVAKGLLYLHEHSHKCIIH  119



>ref|XP_010551593.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Tarenaya 
hassleriana]
Length=640

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE++ N SLDR+I+  ++G ILNW +R  II GTA GL YLH+Q  V IIH
Sbjct  387  LVYEFLPNKSLDRFIFDTERGKILNWHRRFTIIVGTAEGLVYLHEQSSVRIIH  439



>gb|ABR16525.1| unknown [Picea sitchensis]
Length=505

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYG-DKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N+SLD+ I+   K+ +L+W++R +II GTARGLAYLH++  + IIH
Sbjct  408  LVYEYLQNSSLDKIIFDITKRHLLDWRERYEIIVGTARGLAYLHEESEIRIIH  460



>emb|CDM85794.1| unnamed protein product [Triticum aestivum]
Length=783

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +++  K G+L+W  R  I  G A+GLAYLH++   CIIH
Sbjct  555  LVYEYMPNGSLDAHLFSKKSGLLSWNVRYQIALGIAKGLAYLHEECEDCIIH  606



>ref|XP_006646143.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130-like [Oryza brachyantha]
Length=912

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+M N SLDRY++G     L+W  R  I  G A+GLAYLH++   CIIH
Sbjct  572  LVYEFMPNGSLDRYMFGSNTVALSWSTRYQIALGVAKGLAYLHEKCRSCIIH  623



>ref|XP_002324661.2| hypothetical protein POPTR_0018s13280g [Populus trichocarpa]
 gb|EEF03226.2| hypothetical protein POPTR_0018s13280g [Populus trichocarpa]
Length=384

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  +YG+    L+W+ R  II G ARGL YLH+  H+ I+H
Sbjct  134  LVYEYMKNRSLDLIVYGNGDKFLDWETRFQIILGIARGLQYLHEDSHLRIVH  185



>ref|XP_010509284.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1 
[Camelina sativa]
Length=676

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY++M N SLD+Y+Y   +  LNWKQR+ +I G A GL YLH+++   +IH
Sbjct  420  LVYDFMPNGSLDKYLYNTPEVTLNWKQRIKVILGVASGLFYLHEEWEQVVIH  471



>ref|XP_009133202.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1 
[Brassica rapa]
Length=676

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY++M N SLD+Y+Y   +  LNWKQR+ +I G A GL YLH+++   +IH
Sbjct  421  LVYDFMPNGSLDKYLYNTPEVTLNWKQRIKVILGVASGLFYLHEEWEQVVIH  472



>ref|XP_008441808.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Cucumis melo]
Length=653

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQ-GILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +++ DK+  +L+WK+R+DII G ARGL YLH    + IIH
Sbjct  559  LVYEYMPNKSLDYFLFDDKKRSLLSWKKRMDIIIGIARGLLYLHRDSRLIIIH  611



>gb|ABK21721.1| unknown [Picea sitchensis]
Length=431

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE+MAN SLDR+++ D    L+WK R  I   TARGLAYLH++  +CI+H
Sbjct  184  LVYEFMANGSLDRWLF-DSDKWLDWKTRYSIALDTARGLAYLHEESRLCILH  234



>ref|XP_010910912.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase At2g19130, partial [Elaeis 
guineensis]
Length=810

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM+  SLD +++ +   +L WK R  II G ARGLAYLH++   CIIH
Sbjct  566  LVYEYMSGGSLDSHLFRNNSTVLGWKMRYQIILGIARGLAYLHEKCRECIIH  617



>gb|ABV30802.1| kinase-like protein [Prunus cerasus var. caproniana]
Length=149

 Score = 62.8 bits (151),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SL+  ++     +L+WK R +I  GTARGLAYLHD+   CIIH
Sbjct  56   LVYDYMPNGSLESVLFQKSPIVLDWKARYNIAAGTARGLAYLHDECRECIIH  107



>ref|XP_010942011.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 [Elaeis guineensis]
Length=822

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM+  SLD +++ +   +L WK R  II G ARGLAYLH++   CIIH
Sbjct  566  LVYEYMSGGSLDSHLFRNNSTVLGWKMRYQIILGIARGLAYLHEKCRECIIH  617



>ref|XP_002454912.1| hypothetical protein SORBIDRAFT_03g001300 [Sorghum bicolor]
 gb|EES00032.1| hypothetical protein SORBIDRAFT_03g001300 [Sorghum bicolor]
Length=780

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +++ ++  +LNW  R  I  G A+GLAYLH++   CIIH
Sbjct  551  LVYEYMPNGSLDSHLFSERSSLLNWDLRFQIALGIAKGLAYLHEECEDCIIH  602



>ref|XP_009112581.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 [Brassica rapa]
Length=819

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIY----GDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVY+YM N SLD +++    G+++ +L WK R  I  GTARGLAYLHD+   CIIH
Sbjct  553  LVYDYMPNGSLDSHLFITQTGEEKTVLGWKLRYQIALGTARGLAYLHDECRDCIIH  608



>gb|EEE60010.1| hypothetical protein OsJ_12753 [Oryza sativa Japonica Group]
Length=437

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQF  19
            LVY+YM N SLD+Y+YG+ + ILNW QR++II G A GL YLH+++
Sbjct  391  LVYDYMINGSLDKYLYGEGKPILNWAQRINIIKGAASGLLYLHEEW  436



>ref|XP_010528239.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Tarenaya 
hassleriana]
Length=654

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQG-ILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYE++ N SLD++++ DK+  +LNWKQR++II GTA GLAYLH    V IIH
Sbjct  391  LVYEFVPNKSLDQFLFDDKRSKVLNWKQRLNIIKGTAEGLAYLHGGSPVRIIH  443



>ref|XP_008441803.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Cucumis melo]
Length=805

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQ-GILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD +++ DK+  +L+WK+R+DII G ARGL YLH    + IIH
Sbjct  559  LVYEYMPNKSLDYFLFDDKKRSLLSWKKRMDIIIGIARGLLYLHRDSRLIIIH  611



>emb|CDP03006.1| unnamed protein product [Coffea canephora]
Length=447

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEYM N SLD  IYG     LNW  R  II G ARGL YLH+  H  I+H
Sbjct  173  LVYEYMKNRSLDIIIYGKSDVFLNWSTRFQIIIGVARGLQYLHEDSHFRIVH  224



>gb|AAT73676.1| putative receptor-like serine/threonine kinase (RFK1) [Oryza 
sativa Japonica Group]
Length=850

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLD+ I+G     L+W  R +II G ARGL+YLH++  VCI+H
Sbjct  592  LVYEYLENGSLDQAIFGHSSLNLDWAMRFEIILGIARGLSYLHEESSVCIVH  643



>gb|AGT17045.1| SHR5-receptor-like kinase [Saccharum hybrid cultivar R570]
Length=949

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LVYEYMANTSLDRYIYGDKQGILNWKQRVDIIFGTARGLAYLHDQFHVCIIH  1
            LVYEY+ N SLDR ++GD    L+W  R +II G ARGLAYLH++ ++ I+H
Sbjct  767  LVYEYLENGSLDRALFGDGSLKLDWSTRFEIILGVARGLAYLHEESNIRIVH  818



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520930743318