BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c87488_g1_i1 len=1058 path=[1036:0-1057]

Length=1058
                                                                      Score     E

ref|XP_009588691.1|  PREDICTED: lysine-specific demethylase JMJ70...    131   6e-30   
ref|XP_009588690.1|  PREDICTED: lysine-specific demethylase JMJ70...    131   6e-30   
ref|XP_009785276.1|  PREDICTED: lysine-specific demethylase JMJ70...    123   3e-27   
ref|XP_010325573.1|  PREDICTED: lysine-specific demethylase JMJ70...    117   3e-25   
ref|XP_006352908.1|  PREDICTED: uncharacterized protein LOC102585838    117   4e-25   
ref|XP_009790011.1|  PREDICTED: lysine-specific demethylase JMJ70...    114   3e-24   
ref|XP_009625994.1|  PREDICTED: lysine-specific demethylase JMJ70...    106   2e-21   
ref|XP_010663114.1|  PREDICTED: lysine-specific demethylase JMJ70...    102   2e-20   
ref|XP_010663122.1|  PREDICTED: lysine-specific demethylase JMJ70...    102   2e-20   
ref|XP_002303434.2|  hypothetical protein POPTR_0003s09480g             102   3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011028125.1|  PREDICTED: lysine-specific demethylase JMJ70...    101   7e-20   
ref|XP_011028124.1|  PREDICTED: lysine-specific demethylase JMJ70...    101   7e-20   
ref|XP_002518977.1|  transcription factor, putative                   99.0    3e-19   Ricinus communis
ref|XP_006368360.1|  hypothetical protein POPTR_0001s02020g           98.6    4e-19   
ref|XP_011069691.1|  PREDICTED: lysine-specific demethylase JMJ706    98.6    5e-19   
ref|XP_007040690.1|  Jumonji domain protein isoform 3                 97.1    1e-18   
ref|XP_011018500.1|  PREDICTED: lysine-specific demethylase JMJ70...  96.7    2e-18   
ref|XP_007040688.1|  Jumonji domain protein isoform 1                 96.7    2e-18   
ref|XP_007040689.1|  Jumonji domain protein isoform 2                 96.7    2e-18   
ref|XP_011018501.1|  PREDICTED: lysine-specific demethylase JMJ70...  96.7    2e-18   
ref|XP_009373475.1|  PREDICTED: lysine-specific demethylase JMJ70...  93.2    3e-17   
ref|XP_009373476.1|  PREDICTED: lysine-specific demethylase JMJ70...  93.2    3e-17   
gb|KDO50346.1|  hypothetical protein CISIN_1g042974mg                 90.9    1e-16   
ref|XP_006432744.1|  hypothetical protein CICLE_v10000262mg           89.4    4e-16   
ref|XP_006471520.1|  PREDICTED: lysine-specific demethylase 5D-li...  89.4    5e-16   
ref|XP_006471521.1|  PREDICTED: lysine-specific demethylase 5D-li...  89.0    5e-16   
gb|KDP30391.1|  hypothetical protein JCGZ_17120                       88.6    8e-16   
ref|XP_010096930.1|  Lysine-specific demethylase REF6                 87.8    1e-15   
ref|XP_004244665.1|  PREDICTED: lysine-specific demethylase JMJ70...  87.4    2e-15   
gb|KHG08371.1|  Lysine-specific demethylase REF6 -like protein        85.9    6e-15   
ref|XP_008341057.1|  PREDICTED: lysine-specific demethylase 5D-like   80.5    3e-13   
ref|XP_008373685.1|  PREDICTED: probable lysine-specific demethyl...  78.6    2e-12   
emb|CDP18547.1|  unnamed protein product                              78.2    2e-12   
ref|XP_008238182.1|  PREDICTED: lysine-specific demethylase 5C        77.8    3e-12   
ref|XP_007210900.1|  hypothetical protein PRUPE_ppa001299mg           75.5    2e-11   
ref|XP_010053634.1|  PREDICTED: lysine-specific demethylase JMJ706    73.2    1e-10   
gb|KCW77980.1|  hypothetical protein EUGRSUZ_D02224                   73.2    1e-10   
ref|XP_010677367.1|  PREDICTED: lysine-specific demethylase JMJ706    70.5    7e-10   
ref|XP_004300206.1|  PREDICTED: probable lysine-specific demethyl...  69.3    2e-09   
gb|KHG27791.1|  Lysine-specific demethylase REF6 -like protein        64.3    7e-08   
gb|EYU45270.1|  hypothetical protein MIMGU_mgv1a001473mg              61.2    6e-07   
ref|XP_010245223.1|  PREDICTED: lysine-specific demethylase JMJ70...  52.8    3e-04   
ref|XP_010245224.1|  PREDICTED: lysine-specific demethylase JMJ70...  52.8    3e-04   
ref|XP_006572813.1|  PREDICTED: uncharacterized protein LOC100306...  52.8    4e-04   
ref|XP_006572811.1|  PREDICTED: uncharacterized protein LOC100306...  52.8    4e-04   
gb|KHN04851.1|  Lysine-specific demethylase REF6                      52.4    5e-04   
ref|XP_010276830.1|  PREDICTED: lysine-specific demethylase JMJ70...  52.0    7e-04   
ref|XP_010276831.1|  PREDICTED: lysine-specific demethylase JMJ70...  51.6    7e-04   



>ref|XP_009588691.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X2 
[Nicotiana tomentosiformis]
Length=846

 Score =   131 bits (330),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 3/175 (2%)
 Frame = +1

Query  34   DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRSRVEQKSTHDSNYCN-EYQSLKR  210
            D+   VH+ V   +  RTVVD+D DESD+EIFRVKRR R E ++ +DS   N E+QS KR
Sbjct  670  DNNFKVHQKVAHETDCRTVVDQDSDESDTEIFRVKRRPRAEHRNGYDSISINIEHQSFKR  729

Query  211  LKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANRILVKN  390
            LKK +Q + R G LS PECST+    ++ + NSS  KE   + PRD+S RGG   + +K 
Sbjct  730  LKK-RQSEGRLGPLSFPECSTANEAIYSSIANSSQSKEALDFHPRDKSVRGGTVPVSIKL  788

Query  391  KKLTA-EESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILGFTG  552
            KK+ A E++  K  E K++ + + ELG ++REPP  E+G +RLKVRGPS+LGF G
Sbjct  789  KKVAAKEQALSKQDEHKRDHKFQFELGENMREPPRIESGSKRLKVRGPSVLGFGG  843



>ref|XP_009588690.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X1 
[Nicotiana tomentosiformis]
Length=848

 Score =   131 bits (330),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 3/175 (2%)
 Frame = +1

Query  34   DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRSRVEQKSTHDSNYCN-EYQSLKR  210
            D+   VH+ V   +  RTVVD+D DESD+EIFRVKRR R E ++ +DS   N E+QS KR
Sbjct  672  DNNFKVHQKVAHETDCRTVVDQDSDESDTEIFRVKRRPRAEHRNGYDSISINIEHQSFKR  731

Query  211  LKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANRILVKN  390
            LKK +Q + R G LS PECST+    ++ + NSS  KE   + PRD+S RGG   + +K 
Sbjct  732  LKK-RQSEGRLGPLSFPECSTANEAIYSSIANSSQSKEALDFHPRDKSVRGGTVPVSIKL  790

Query  391  KKLTA-EESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILGFTG  552
            KK+ A E++  K  E K++ + + ELG ++REPP  E+G +RLKVRGPS+LGF G
Sbjct  791  KKVAAKEQALSKQDEHKRDHKFQFELGENMREPPRIESGSKRLKVRGPSVLGFGG  845



>ref|XP_009785276.1| PREDICTED: lysine-specific demethylase JMJ706-like [Nicotiana 
sylvestris]
Length=845

 Score =   123 bits (309),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 115/175 (66%), Gaps = 3/175 (2%)
 Frame = +1

Query  34   DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRSRVEQKSTHDSNYCN-EYQSLKR  210
            D+   VH  V   +  +TVVD+D DESD+EIFRVKRR R E ++ +DS   N E+QS KR
Sbjct  670  DNNFKVHPKVAHETDCKTVVDQDSDESDTEIFRVKRRPRAEHRNGYDSVSINIEHQSFKR  729

Query  211  LKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANRILVKN  390
            LKK +Q + R G LS PECST+     + + NSS  KE   + PRD+S RGG   + +K 
Sbjct  730  LKK-RQSEGRLGPLSFPECSTANDATHSSIANSSQSKEAPDFHPRDKSVRGGPVPVSIKL  788

Query  391  KKLTA-EESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILGFTG  552
            KK+   E++  K  E K++ +++ ELG+++RE P  ++G +RLKVRGPS+LGF G
Sbjct  789  KKVAVNEQALSKQDEYKRDHKIQFELGQNMRESPRIQSGSKRLKVRGPSVLGFGG  843



>ref|XP_010325573.1| PREDICTED: lysine-specific demethylase JMJ706-like [Solanum lycopersicum]
Length=846

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 109/170 (64%), Gaps = 8/170 (5%)
 Frame = +1

Query  49   VHRNVIQGSKIRTVVdededesdseIFRVKRRSRVEQKSTHDSNYCN-EYQSLKRLKKHQ  225
            VH+ V Q +  RT++D+D DESD+E+FRVKRR R E +S HDS   N E QS KRLKKHQ
Sbjct  676  VHQKVAQETDCRTIIDQDSDESDTEVFRVKRRPRAEHRSVHDSMSINVENQSFKRLKKHQ  735

Query  226  QPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTA  405
                R GSL  PE S++   N   V  SS  KE   + PRD+S RGG   + +K KK   
Sbjct  736  S--GRLGSLCLPEHSSTCDINHRSVAISSQSKEALDFHPRDKSVRGGTVPVCIKLKKGVG  793

Query  406  EESRDKHRELKKNDRLKHELGRSI-REPPCPETGERRLKVRGPSILGFTG  552
             E +D+H   K++DRL  ELG+S  REP   E+G +RLKVRGPS+LGF G
Sbjct  794  YE-QDEH---KRDDRLPFELGQSKRREPGRTESGSKRLKVRGPSVLGFGG  839



>ref|XP_006352908.1| PREDICTED: uncharacterized protein LOC102585838 [Solanum tuberosum]
Length=847

 Score =   117 bits (293),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 109/172 (63%), Gaps = 5/172 (3%)
 Frame = +1

Query  46   NVHRNVIQGSKIRTVVdededesdseIFRVKRRSRVEQKSTHDSNYCN-EYQSLKRLKKH  222
            NVH+ V   +  RTV+D+D DESD+E+FRVKRR R E +S HDS   N E QS KRLKKH
Sbjct  675  NVHQKVAHEADCRTVIDQDSDESDTEVFRVKRRPRAEHRSVHDSMSINVENQSFKRLKKH  734

Query  223  QQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKK-L  399
            Q    R G L  PE S++   N   V  SS  KE   + PRD+S RGG   + +K KK +
Sbjct  735  QS--GRLGPLCLPEHSSTYDINHRSVAISSQSKEALDFHPRDKSVRGGTVPVSIKLKKGV  792

Query  400  TAEESRDKHRELKKNDRLKHELGRSIR-EPPCPETGERRLKVRGPSILGFTG  552
              E++  K  E K++ RL+ ELG+S R EP   E+G +RLKVRGPS+LGF G
Sbjct  793  GYEQALSKQDEHKRDHRLQFELGQSKRGEPRGIESGSKRLKVRGPSVLGFGG  844



>ref|XP_009790011.1| PREDICTED: lysine-specific demethylase JMJ706-like [Nicotiana 
sylvestris]
Length=841

 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 105/174 (60%), Gaps = 6/174 (3%)
 Frame = +1

Query  34   DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRSRVEQ--KSTHDSNYCN-EYQSL  204
            DDY  VH  V   S  RTVVD+D DESD+EIFRVKRRSR E   +STHDS   N E+Q  
Sbjct  664  DDYLKVHEKVAHVSDARTVVDQDSDESDTEIFRVKRRSRTEHGRRSTHDSISVNVEHQGY  723

Query  205  KRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANRILV  384
            KRLKKHQ  + R G LSS +CS ++    +Y GNS   KE   YP RD+S R G   I +
Sbjct  724  KRLKKHQT-EGRHGPLSSSDCSMADDATHSYNGNSIHSKEALDYPLRDKSARSGTVPISI  782

Query  385  KNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILGF  546
            K+KK   + +  K  E K+++   + LG+++ EPP  E G +RLKV+    L  
Sbjct  783  KSKK--GDNASSKQNENKRDENFDYGLGKTVGEPPPIEIGPKRLKVKTLQFLSL  834



>ref|XP_009625994.1| PREDICTED: lysine-specific demethylase JMJ706-like [Nicotiana 
tomentosiformis]
Length=847

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 107/181 (59%), Gaps = 5/181 (3%)
 Frame = +1

Query  16   QESSCS--DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRSRVEQ-KSTHDS-NY  183
            + S CS  DDY  VH  V   S  RTVVD+D DESD+EIFRVKRRSR E  +STHD  + 
Sbjct  661  ERSVCSSGDDYLKVHEKVAHVSDARTVVDQDSDESDTEIFRVKRRSRTEHGRSTHDPISV  720

Query  184  CNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRG  363
              E+Q  KRLKKHQ  + R G LSS + S ++    +   NS   KE   YP RD+S R 
Sbjct  721  SVEHQGYKRLKKHQT-EGRLGPLSSSDRSMADDVTHSSNANSIHSKEALDYPLRDKSARN  779

Query  364  GANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILG  543
            G   I +K+KK   EE+  K  E K+++  ++ LG+++ EPP  E G +RLKV+    L 
Sbjct  780  GTVPISIKSKKGANEEASSKQSEDKRDESFEYGLGKTVGEPPPIEIGPKRLKVKTLQFLS  839

Query  544  F  546
             
Sbjct  840  L  840



>ref|XP_010663114.1| PREDICTED: lysine-specific demethylase JMJ706 isoform X1 [Vitis 
vinifera]
Length=876

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 112/186 (60%), Gaps = 11/186 (6%)
 Frame = +1

Query  1    CVNNVQESSCSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHD  174
            C++++    C   + N H     GS+++ ++D+D D+SDSEIFRVKRRS  +VE+++ +D
Sbjct  693  CLSSLSCDECLSTHQNFH-----GSEVKPIIDQDSDDSDSEIFRVKRRSSVKVEKRNAND  747

Query  175  SNYCNEY--QSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRD  348
            ++    +  Q LKRLKK  QP  R G L+  ECS +  +N ++  +S   K      PRD
Sbjct  748  ASSVKHFDHQGLKRLKK-LQPQGRCGQLTLSECSMTNEQNRSFSSSSHHSKRSTDNVPRD  806

Query  349  ESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRG  528
                G    I +K KK+  EE+  + RE  + DR  H+LG+++REPP  E G +RLKVRG
Sbjct  807  RFSAGTTMPISIKFKKMANEEAMSRQREHHRKDRF-HDLGKTMREPPSIEIGPKRLKVRG  865

Query  529  PSILGF  546
            PS LG+
Sbjct  866  PSFLGW  871



>ref|XP_010663122.1| PREDICTED: lysine-specific demethylase JMJ706 isoform X2 [Vitis 
vinifera]
Length=874

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 112/186 (60%), Gaps = 11/186 (6%)
 Frame = +1

Query  1    CVNNVQESSCSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHD  174
            C++++    C   + N H     GS+++ ++D+D D+SDSEIFRVKRRS  +VE+++ +D
Sbjct  691  CLSSLSCDECLSTHQNFH-----GSEVKPIIDQDSDDSDSEIFRVKRRSSVKVEKRNAND  745

Query  175  SNYCNEY--QSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRD  348
            ++    +  Q LKRLKK  QP  R G L+  ECS +  +N ++  +S   K      PRD
Sbjct  746  ASSVKHFDHQGLKRLKK-LQPQGRCGQLTLSECSMTNEQNRSFSSSSHHSKRSTDNVPRD  804

Query  349  ESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRG  528
                G    I +K KK+  EE+  + RE  + DR  H+LG+++REPP  E G +RLKVRG
Sbjct  805  RFSAGTTMPISIKFKKMANEEAMSRQREHHRKDRF-HDLGKTMREPPSIEIGPKRLKVRG  863

Query  529  PSILGF  546
            PS LG+
Sbjct  864  PSFLGW  869



>ref|XP_002303434.2| hypothetical protein POPTR_0003s09480g [Populus trichocarpa]
 gb|EEE78413.2| hypothetical protein POPTR_0003s09480g [Populus trichocarpa]
Length=873

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 110/182 (60%), Gaps = 5/182 (3%)
 Frame = +1

Query  10   NVQESSCSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHD--S  177
            +V   S  D++  + ++  +G ++++ VDE  D+SDSEIFRVKRRS  +VE++  +D  S
Sbjct  687  SVSSQSHDDEFLRIQKSNPRGLEVKSSVDEQSDDSDSEIFRVKRRSSLKVEKRVVNDAAS  746

Query  178  NYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESH  357
            +  +E+Q LKRLKK Q   R   + SS  C   E  N     ++SDYKE  +   +D   
Sbjct  747  SKNSEHQGLKRLKKLQHEGRYGQTTSSEYCRADES-NHGSTSSNSDYKEAPECASKDRVA  805

Query  358  RGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSI  537
            RG      +K KKLT++E   + RE  + DR +HELG++ REPP  E G +RLKVRGPS 
Sbjct  806  RGSTIPFSIKFKKLTSKEEMGRQREHHRLDRFQHELGKTTREPPPIEIGPKRLKVRGPSS  865

Query  538  LG  543
            LG
Sbjct  866  LG  867



>ref|XP_011028125.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X2 
[Populus euphratica]
Length=870

 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 109/182 (60%), Gaps = 5/182 (3%)
 Frame = +1

Query  10   NVQESSCSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHD--S  177
            +V   S  D++  + ++  +G ++++ VDE  D+SDSEIFRVKRRS  +VE++  +D  S
Sbjct  684  SVSSLSHDDEFLRIQKSNPRGLEVKSSVDEQSDDSDSEIFRVKRRSSLKVEKRVVNDTAS  743

Query  178  NYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESH  357
            +  +E+Q LKRLKK Q   R   + SS  C   E  N     ++ DYK   K   +D   
Sbjct  744  SKYSEHQGLKRLKKLQHEGRYGQTTSSEYCRADES-NHGSTSSTLDYKAPPKSASKDRVA  802

Query  358  RGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSI  537
            RG      +K KKLT++E   + RE  + DR +HELG+++REPP  E G +RLKVRGPS 
Sbjct  803  RGSTIPFSIKFKKLTSKEEMGRQREHHRLDRFQHELGKTMREPPPIEIGPKRLKVRGPSY  862

Query  538  LG  543
            LG
Sbjct  863  LG  864



>ref|XP_011028124.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X1 
[Populus euphratica]
Length=872

 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 109/182 (60%), Gaps = 5/182 (3%)
 Frame = +1

Query  10   NVQESSCSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHD--S  177
            +V   S  D++  + ++  +G ++++ VDE  D+SDSEIFRVKRRS  +VE++  +D  S
Sbjct  686  SVSSLSHDDEFLRIQKSNPRGLEVKSSVDEQSDDSDSEIFRVKRRSSLKVEKRVVNDTAS  745

Query  178  NYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESH  357
            +  +E+Q LKRLKK Q   R   + SS  C   E  N     ++ DYK   K   +D   
Sbjct  746  SKYSEHQGLKRLKKLQHEGRYGQTTSSEYCRADES-NHGSTSSTLDYKAPPKSASKDRVA  804

Query  358  RGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSI  537
            RG      +K KKLT++E   + RE  + DR +HELG+++REPP  E G +RLKVRGPS 
Sbjct  805  RGSTIPFSIKFKKLTSKEEMGRQREHHRLDRFQHELGKTMREPPPIEIGPKRLKVRGPSY  864

Query  538  LG  543
            LG
Sbjct  865  LG  866



>ref|XP_002518977.1| transcription factor, putative [Ricinus communis]
 gb|EEF43510.1| transcription factor, putative [Ricinus communis]
Length=780

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 108/174 (62%), Gaps = 12/174 (7%)
 Frame = +1

Query  46   NVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHD--SNYCNEYQSLKRL  213
            ++ +  + GS +R  VD+  D+SDSEIFRVKRRS  +V++++ +D  S+  +E+Q LKRL
Sbjct  605  SIQQGDLHGSDVRRSVDQHSDDSDSEIFRVKRRSSLKVDKRTVNDNVSSKNSEHQGLKRL  664

Query  214  KKHQQPDRRSGSLSSPECSTSEG----RNFTYVGNSSDYKEGRKYPPRDESHRGGANRIL  381
            KK  Q + R G +SS  CS+       RN T   ++S ++E  +   RD         I 
Sbjct  665  KK-LQFEGRYGQISSECCSSQTDDETTRNLT---STSHFREAPESASRDRFAGASTIPIS  720

Query  382  VKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILG  543
            +K KKL  EE+  +HR+  + D+ +HELG+++REPP  E G +RLKVRGPS LG
Sbjct  721  IKFKKLVKEEAMSRHRDHLRVDKFQHELGKTMREPPLIEIGPKRLKVRGPSFLG  774



>ref|XP_006368360.1| hypothetical protein POPTR_0001s02020g [Populus trichocarpa]
 gb|ERP64929.1| hypothetical protein POPTR_0001s02020g [Populus trichocarpa]
Length=847

 Score = 98.6 bits (244),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 107/176 (61%), Gaps = 10/176 (6%)
 Frame = +1

Query  34   DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHDS----NYCNEY  195
            D++    ++ I G + +  VDE  D+SDSEIFRVKRRS  +VE++  +D+    NY  E+
Sbjct  670  DEFLRTQQSNICGLEAKPSVDEQSDDSDSEIFRVKRRSSLKVEKRVVNDASSSKNY--EH  727

Query  196  QSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANR  375
            Q LKRLKK  QP+ R G  +S EC  ++  N +   + SDYKE  +   +D   RG    
Sbjct  728  QGLKRLKK-LQPEGRYGQTTSSECCRTDESNRSST-SGSDYKEAPESASKDRFARGSIIP  785

Query  376  ILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILG  543
            I +K KKL  EE+  + RE  + DR + ELG+++R+PP  E G +RLKVR PS LG
Sbjct  786  ISIKFKKLINEEAMSRQREQHRRDRFQDELGKTMRKPPPIEIGPKRLKVRSPSFLG  841



>ref|XP_011069691.1| PREDICTED: lysine-specific demethylase JMJ706 [Sesamum indicum]
Length=852

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 97/165 (59%), Gaps = 12/165 (7%)
 Frame = +1

Query  67   QGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHDSNYCN-EYQSLKRLKKHQQPDR  237
            Q    R+ ++E+ D+SDSEIFRVKRRS  +VEQK    S   N E QS KRLKKHQ  + 
Sbjct  694  QSGDARSTINEESDDSDSEIFRVKRRSSSKVEQKIAQSSVSVNAEQQSFKRLKKHQPHEW  753

Query  238  RSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEESR  417
                     CST++  N     NS++ +E      RD S RG    I +K KK   EE  
Sbjct  754  ---------CSTTDDPNRNSSSNSTESREVPLGGSRDRSSRGSGIPISIKFKKTPNEEVL  804

Query  418  DKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILGFTG  552
             KH E+ ++ R +HELGR++REPP  E G +RLKVRGPS+LG  G
Sbjct  805  SKHGEVHRDQRHQHELGRTMREPPPLEIGPKRLKVRGPSVLGNDG  849



>ref|XP_007040690.1| Jumonji domain protein isoform 3 [Theobroma cacao]
 gb|EOY25191.1| Jumonji domain protein isoform 3 [Theobroma cacao]
Length=593

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 109/188 (58%), Gaps = 14/188 (7%)
 Frame = +1

Query  10   NVQESS----CSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTH  171
            N  ESS    C +D    H   +   + R+ VD+D D SDSEIFRVKRRS  ++E+++ +
Sbjct  404  NTYESSASCLCREDCPGNHHGNVHEPESRSTVDQDSDGSDSEIFRVKRRSFLKIEKRNAN  463

Query  172  D---SNYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSE-GRNFTYVGNSSDYKEGRKYP  339
            D   S  C E+Q LKRLKK Q   R   S SS  C T E  RN   + ++SD KE  +  
Sbjct  464  DTMSSKNC-EHQGLKRLKKLQHEGRCGQSTSSEGCRTDEPSRN---INSTSDCKEAPENA  519

Query  340  PRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLK  519
             ++   RGGA  I +K KKL  EE+  + RE ++ DR  HE G+S RE P  E G +RLK
Sbjct  520  VKERFGRGGALPISIKYKKLGNEETMSRQREHQRYDRFHHEFGKSTRETPPLEIGPKRLK  579

Query  520  VRGPSILG  543
            VRGP+ LG
Sbjct  580  VRGPTSLG  587



>ref|XP_011018500.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X1 
[Populus euphratica]
Length=873

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 106/176 (60%), Gaps = 10/176 (6%)
 Frame = +1

Query  34   DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHDS----NYCNEY  195
            D++    ++ + G + +  VDE  D+SD EIFRVKRRS  +VE++  +D+    NY  E+
Sbjct  696  DEFLRTQQSNLCGLEAKPSVDEQSDDSDLEIFRVKRRSSLKVEKRVVNDASSSKNY--EH  753

Query  196  QSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANR  375
            Q L+RLKK  QP+ R G  +S EC  ++  N +   + SDYKE  +   +D   RG    
Sbjct  754  QGLRRLKK-LQPEGRYGQRTSSECCRTDESNRSST-SGSDYKEAPESSLKDRFARGSIIP  811

Query  376  ILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILG  543
            I +K KKL  EE+  + RE  + DR +HELG+++R+PP    G +RLKVR PS LG
Sbjct  812  ISIKFKKLINEEAMSRQREQHRRDRFQHELGKTVRKPPPIAIGPKRLKVRSPSFLG  867



>ref|XP_007040688.1| Jumonji domain protein isoform 1 [Theobroma cacao]
 gb|EOY25189.1| Jumonji domain protein isoform 1 [Theobroma cacao]
Length=872

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 109/188 (58%), Gaps = 14/188 (7%)
 Frame = +1

Query  10   NVQESS----CSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTH  171
            N  ESS    C +D    H   +   + R+ VD+D D SDSEIFRVKRRS  ++E+++ +
Sbjct  683  NTYESSASCLCREDCPGNHHGNVHEPESRSTVDQDSDGSDSEIFRVKRRSFLKIEKRNAN  742

Query  172  D---SNYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSE-GRNFTYVGNSSDYKEGRKYP  339
            D   S  C E+Q LKRLKK Q   R   S SS  C T E  RN   + ++SD KE  +  
Sbjct  743  DTMSSKNC-EHQGLKRLKKLQHEGRCGQSTSSEGCRTDEPSRN---INSTSDCKEAPENA  798

Query  340  PRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLK  519
             ++   RGGA  I +K KKL  EE+  + RE ++ DR  HE G+S RE P  E G +RLK
Sbjct  799  VKERFGRGGALPISIKYKKLGNEETMSRQREHQRYDRFHHEFGKSTRETPPLEIGPKRLK  858

Query  520  VRGPSILG  543
            VRGP+ LG
Sbjct  859  VRGPTSLG  866



>ref|XP_007040689.1| Jumonji domain protein isoform 2 [Theobroma cacao]
 gb|EOY25190.1| Jumonji domain protein isoform 2 [Theobroma cacao]
Length=871

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 109/188 (58%), Gaps = 14/188 (7%)
 Frame = +1

Query  10   NVQESS----CSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTH  171
            N  ESS    C +D    H   +   + R+ VD+D D SDSEIFRVKRRS  ++E+++ +
Sbjct  682  NTYESSASCLCREDCPGNHHGNVHEPESRSTVDQDSDGSDSEIFRVKRRSFLKIEKRNAN  741

Query  172  D---SNYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSE-GRNFTYVGNSSDYKEGRKYP  339
            D   S  C E+Q LKRLKK Q   R   S SS  C T E  RN   + ++SD KE  +  
Sbjct  742  DTMSSKNC-EHQGLKRLKKLQHEGRCGQSTSSEGCRTDEPSRN---INSTSDCKEAPENA  797

Query  340  PRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLK  519
             ++   RGGA  I +K KKL  EE+  + RE ++ DR  HE G+S RE P  E G +RLK
Sbjct  798  VKERFGRGGALPISIKYKKLGNEETMSRQREHQRYDRFHHEFGKSTRETPPLEIGPKRLK  857

Query  520  VRGPSILG  543
            VRGP+ LG
Sbjct  858  VRGPTSLG  865



>ref|XP_011018501.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X2 
[Populus euphratica]
Length=789

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 106/176 (60%), Gaps = 10/176 (6%)
 Frame = +1

Query  34   DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHDS----NYCNEY  195
            D++    ++ + G + +  VDE  D+SD EIFRVKRRS  +VE++  +D+    NY  E+
Sbjct  612  DEFLRTQQSNLCGLEAKPSVDEQSDDSDLEIFRVKRRSSLKVEKRVVNDASSSKNY--EH  669

Query  196  QSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANR  375
            Q L+RLKK  QP+ R G  +S EC  ++  N +   + SDYKE  +   +D   RG    
Sbjct  670  QGLRRLKK-LQPEGRYGQRTSSECCRTDESNRSST-SGSDYKEAPESSLKDRFARGSIIP  727

Query  376  ILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILG  543
            I +K KKL  EE+  + RE  + DR +HELG+++R+PP    G +RLKVR PS LG
Sbjct  728  ISIKFKKLINEEAMSRQREQHRRDRFQHELGKTVRKPPPIAIGPKRLKVRSPSFLG  783



>ref|XP_009373475.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X1 
[Pyrus x bretschneideri]
Length=904

 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 113/197 (57%), Gaps = 19/197 (10%)
 Frame = +1

Query  4    VNNVQESSCS----DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRSR---VEQK  162
            V +V +SS S    D+ S+       GS++R VVD+  D+SDSEIFRVKRRS    V+++
Sbjct  683  VRSVYDSSLSSPSYDECSSARPGNSNGSEVRRVVDQGSDDSDSEIFRVKRRSSLKVVDKR  742

Query  163  STHDSNYCN--EYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYK-----  321
            S +D +  N  E +  KRLKK  QP+RR G  S P    S G + T   ++++Y+     
Sbjct  743  SVNDVSASNHSESKGFKRLKK-MQPERRCGRSSVPLDYYSPGESNTKFVSTTNYRGFPDS  801

Query  322  ---EGRKYPPRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPC  492
               EGR       + RGG   I +K KKL  E+S  K RE  + DR + ELGRS R+PP 
Sbjct  802  AALEGR-LSTGSSAPRGGNVPISIKFKKLATEDSARKQREHHRRDRYQDELGRSRRQPPP  860

Query  493  PETGERRLKVRGPSILG  543
             E G +R+KVRGPS LG
Sbjct  861  MEVGAKRIKVRGPSFLG  877



>ref|XP_009373476.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X2 
[Pyrus x bretschneideri]
Length=902

 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 113/197 (57%), Gaps = 19/197 (10%)
 Frame = +1

Query  4    VNNVQESSCS----DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRSR---VEQK  162
            V +V +SS S    D+ S+       GS++R VVD+  D+SDSEIFRVKRRS    V+++
Sbjct  681  VRSVYDSSLSSPSYDECSSARPGNSNGSEVRRVVDQGSDDSDSEIFRVKRRSSLKVVDKR  740

Query  163  STHDSNYCN--EYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYK-----  321
            S +D +  N  E +  KRLKK  QP+RR G  S P    S G + T   ++++Y+     
Sbjct  741  SVNDVSASNHSESKGFKRLKK-MQPERRCGRSSVPLDYYSPGESNTKFVSTTNYRGFPDS  799

Query  322  ---EGRKYPPRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPC  492
               EGR       + RGG   I +K KKL  E+S  K RE  + DR + ELGRS R+PP 
Sbjct  800  AALEGR-LSTGSSAPRGGNVPISIKFKKLATEDSARKQREHHRRDRYQDELGRSRRQPPP  858

Query  493  PETGERRLKVRGPSILG  543
             E G +R+KVRGPS LG
Sbjct  859  MEVGAKRIKVRGPSFLG  875



>gb|KDO50346.1| hypothetical protein CISIN_1g042974mg [Citrus sinensis]
Length=821

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 105/171 (61%), Gaps = 11/171 (6%)
 Frame = +1

Query  43   SNVHRNVIQGSKIRTVVdededesdseIFRVKRR-SRVEQKSTHD--SNYCNEYQSLKRL  213
            SN HR     S++  V+++  D+SDSEIFRVKRR S+V+++  +D  S+   E+Q LKRL
Sbjct  653  SNFHR-----SEVGAVMNQYSDDSDSEIFRVKRRPSKVDKRCMNDVTSSTHTEHQGLKRL  707

Query  214  KKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHR-GGANRILVKN  390
            KK  QP+ R G L   E   ++  N     ++S+YKE  +   +D   R GGA  I +K 
Sbjct  708  KK-LQPEGRCGQLMLTEFRRTDESNHK-SSHTSNYKETSERGSKDRFARVGGAVPISIKF  765

Query  391  KKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILG  543
            KKL  EE+  + +E  + +R +HE G++ REPP  E G +RLKVRGPS +G
Sbjct  766  KKLADEEAISRQQENCRKERFQHEFGKATREPPPIEMGPKRLKVRGPSFIG  816



>ref|XP_006432744.1| hypothetical protein CICLE_v10000262mg [Citrus clementina]
 gb|ESR45984.1| hypothetical protein CICLE_v10000262mg [Citrus clementina]
Length=848

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 105/171 (61%), Gaps = 11/171 (6%)
 Frame = +1

Query  43   SNVHRNVIQGSKIRTVVdededesdseIFRVKRR-SRVEQKSTHD--SNYCNEYQSLKRL  213
            SN HR     S++  V+++  D+SDSEIFRVKRR S+V+++  +D  S+   E+Q LKRL
Sbjct  680  SNFHR-----SEVGAVMNQYSDDSDSEIFRVKRRPSKVDKRCMNDVTSSTHTEHQGLKRL  734

Query  214  KKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHR-GGANRILVKN  390
            KK  QP+ R G L   E   ++  N     ++S+YKE  +   +D   R GGA  I +K 
Sbjct  735  KK-LQPEGRCGQLMLTEFRRTDESNHK-SSHTSNYKETSERGSKDRFARVGGAVPISIKF  792

Query  391  KKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILG  543
            KKL  EE+  + +E  + +R +HE G++ REPP  E G +RLKVRGPS +G
Sbjct  793  KKLADEEANSRQQENCRKERFQHECGKAPREPPPIEMGPKRLKVRGPSFIG  843



>ref|XP_006471520.1| PREDICTED: lysine-specific demethylase 5D-like isoform X1 [Citrus 
sinensis]
Length=874

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 105/171 (61%), Gaps = 11/171 (6%)
 Frame = +1

Query  43   SNVHRNVIQGSKIRTVVdededesdseIFRVKRR-SRVEQKSTHD--SNYCNEYQSLKRL  213
            SN HR     S++  V+++  D+SDSEIFRVKRR S+V+++  +D  S+   E+Q LKRL
Sbjct  706  SNFHR-----SEVGAVMNQYSDDSDSEIFRVKRRPSKVDKRCMNDVTSSTHTEHQGLKRL  760

Query  214  KKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHR-GGANRILVKN  390
            KK  QP+ R G L   E   ++  N     ++S+YKE  +   +D   R GGA  I +K 
Sbjct  761  KK-LQPEGRCGQLMLTEFRRTDESNHK-SSHTSNYKETSERGSKDRFARVGGAVPISIKF  818

Query  391  KKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILG  543
            KKL  EE+  + +E  + +R +HE G++ REPP  E G +RLKVRGPS +G
Sbjct  819  KKLADEEANSRQQENCRKERFQHECGKAPREPPPIEMGPKRLKVRGPSFIG  869



>ref|XP_006471521.1| PREDICTED: lysine-specific demethylase 5D-like isoform X2 [Citrus 
sinensis]
Length=856

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 105/171 (61%), Gaps = 11/171 (6%)
 Frame = +1

Query  43   SNVHRNVIQGSKIRTVVdededesdseIFRVKRR-SRVEQKSTHD--SNYCNEYQSLKRL  213
            SN HR     S++  V+++  D+SDSEIFRVKRR S+V+++  +D  S+   E+Q LKRL
Sbjct  688  SNFHR-----SEVGAVMNQYSDDSDSEIFRVKRRPSKVDKRCMNDVTSSTHTEHQGLKRL  742

Query  214  KKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHR-GGANRILVKN  390
            KK  QP+ R G L   E   ++  N     ++S+YKE  +   +D   R GGA  I +K 
Sbjct  743  KK-LQPEGRCGQLMLTEFRRTDESNHK-SSHTSNYKETSERGSKDRFARVGGAVPISIKF  800

Query  391  KKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILG  543
            KKL  EE+  + +E  + +R +HE G++ REPP  E G +RLKVRGPS +G
Sbjct  801  KKLADEEANSRQQENCRKERFQHECGKAPREPPPIEMGPKRLKVRGPSFIG  851



>gb|KDP30391.1| hypothetical protein JCGZ_17120 [Jatropha curcas]
Length=874

 Score = 88.6 bits (218),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 100/185 (54%), Gaps = 11/185 (6%)
 Frame = +1

Query  10   NVQESSCS----DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTH  171
            NV ESS S    D+  +    V  GS+ R  VD   D+SD EIFRVKRRS  +VE++   
Sbjct  685  NVHESSLSSFSHDECRSTQHGVRYGSEARPSVDNHSDDSDLEIFRVKRRSSLKVEKRVVT  744

Query  172  D---SNYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPP  342
            D   S  C EYQ LKRLKK Q   R + ++SS    T +  N  Y   +   KE  +   
Sbjct  745  DNGSSKNC-EYQGLKRLKKLQFEGRIAQTMSSEYSQTDDESNHNYT-PTVHCKETPENGS  802

Query  343  RDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKV  522
            RD   RG    I +K KK   +E+  +  E  + DR  HELG+++REPP  E G +RLKV
Sbjct  803  RDRFARGSGIPISIKFKKWVNDEAMSRQPEHHRVDRFHHELGKTMREPPPIEIGPKRLKV  862

Query  523  RGPSI  537
            RGP +
Sbjct  863  RGPFL  867



>ref|XP_010096930.1| Lysine-specific demethylase REF6 [Morus notabilis]
 gb|EXB66507.1| Lysine-specific demethylase REF6 [Morus notabilis]
Length=1195

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 108/188 (57%), Gaps = 16/188 (9%)
 Frame = +1

Query  4     VNNVQESSCSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHDS  177
             V +   SS  D++ N + +  + +  R  V +D D+SDSEIFRVKRRS  +V++++T+D 
Sbjct  1010  VESCLSSSSCDEHLNAYPDNFRATNARPAVHQDSDDSDSEIFRVKRRSTQKVDKRNTNDG  1069

Query  178   --NYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPR--  345
               +  +++Q  KRLKK Q P+ R+G ++S +C       F  V ++S         P   
Sbjct  1070  KKSMHSDHQGFKRLKKFQ-PEGRTGGVTSSDC-------FRIVESNSKLTTTNHRAPEIA  1121

Query  346   --DESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLK  519
               D S RG    I +K KKLT++   ++ RE  + DRL+ E  +S+RE P  E G +RLK
Sbjct  1122  LADRSARGSTIPISIKFKKLTSDHDINRQREQPRKDRLQLEFSKSMRESPPIEIGPKRLK  1181

Query  520   VRGPSILG  543
             VRGP+ LG
Sbjct  1182  VRGPTFLG  1189



>ref|XP_004244665.1| PREDICTED: lysine-specific demethylase JMJ706-like [Solanum lycopersicum]
 ref|XP_010324469.1| PREDICTED: lysine-specific demethylase JMJ706-like [Solanum lycopersicum]
Length=831

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 96/166 (58%), Gaps = 19/166 (11%)
 Frame = +1

Query  31   SDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRSRVEQKSTHDSNYCN-EYQSLK  207
            S DY  VH  +   S +RTV+D+D+DESDSEIFRVKRR R E  S  DS   N E+Q  K
Sbjct  670  SADYLKVHEKIAHVSDVRTVIDQDDDESDSEIFRVKRRFRAENGSRRDSTSVNIEHQGYK  729

Query  208  RLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANRILVK  387
            RL+KHQ      GSL S + S +         NSS  KE       D+S RGG   I VK
Sbjct  730  RLRKHQT--EGVGSLYSSDRSNA---------NSSHSKE-------DKSSRGGTLAISVK  771

Query  388  NKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVR  525
             KK   EE+  K  E K++++  +ELG+++ EPP  E G +RLKV+
Sbjct  772  FKKGANEEASSKQNEHKRDEKSGYELGKTVGEPPPIEIGPKRLKVK  817



>gb|KHG08371.1| Lysine-specific demethylase REF6 -like protein [Gossypium arboreum]
Length=871

 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 99/158 (63%), Gaps = 7/158 (4%)
 Frame = +1

Query  82   RTVVdededesdseIFRVKRRS--RVEQKSTHDSNYCN--EYQSLKRLKKHQQPDRRSGS  249
            R++VD D D SDSEIFRVKRRS  +VE+++ + +   N  E+Q LKRLKK Q  ++RSG 
Sbjct  711  RSIVDHDSDSSDSEIFRVKRRSFLKVEKRNGNHTMASNSSEHQGLKRLKKLQH-EKRSGQ  769

Query  250  LSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEESRDKHR  429
                +CS ++  N      +S+YKE  +   +D   R     I +K KKL  EE+  + R
Sbjct  770  SMPSDCSRNDEPNRN-TNRASNYKESPENTLKDRYGRSNLP-ISIKYKKLGNEEAMIRQR  827

Query  430  ELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILG  543
            E  +NDRLKHE+G+  REPP  E G +R+KVRGP+ +G
Sbjct  828  EHHRNDRLKHEVGKYTREPPPLENGPKRIKVRGPTYVG  865



>ref|XP_008341057.1| PREDICTED: lysine-specific demethylase 5D-like [Malus domestica]
Length=888

 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 102/189 (54%), Gaps = 15/189 (8%)
 Frame = +1

Query  16   QESSCSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS---RVEQKSTHDSNYC  186
            Q S   D+YS+     + GS++R VVD+  D+SDSEIFRVKRRS    V+++S +D    
Sbjct  695  QSSLSYDEYSSARPGNLNGSEVRHVVDQGSDDSDSEIFRVKRRSSLKTVDKRSVNDVLSS  754

Query  187  N--EYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYK--------EGRKY  336
            N  E +  KRLKK  QPDRR G  S P    S G        +S+YK        EGR +
Sbjct  755  NHSENKGFKRLKK-LQPDRRCGRSSVPLDYCSPGEPNAKFIATSNYKGVPESASLEGR-F  812

Query  337  PPRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRL  516
                 +  G    I +K KKL  E++  + RE  + D  + ELG+S R+P   E G +RL
Sbjct  813  STGSSAPTGSNVPISIKFKKLANEDAARQQRERHRKDGYEVELGKSRRQPTPMEIGAKRL  872

Query  517  KVRGPSILG  543
            KV+ PS LG
Sbjct  873  KVKAPSFLG  881



>ref|XP_008373685.1| PREDICTED: probable lysine-specific demethylase JMJ14 [Malus 
domestica]
Length=897

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 113/203 (56%), Gaps = 25/203 (12%)
 Frame = +1

Query  4    VNNVQESSCS----DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRSR---VEQK  162
            V +V +SS S    D+ S+       GS++R VVD+  D+SDSEIFRVKRRS    V ++
Sbjct  690  VRSVYDSSLSSPSYDECSSARPGNSNGSEVRRVVDQGSDDSDSEIFRVKRRSSLKVVGKR  749

Query  163  STHDSNYCN--EYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYK-----  321
            S +D    N  E +  KRLKK  QP+RR G  S P    S G + T   ++++Y+     
Sbjct  750  SVNDVXASNHSENKGFKRLKK-MQPERRCGRSSVPLDYYSPGESNTKFLSTTNYRGFPES  808

Query  322  ---EGRKYPPRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPC  492
               EGR +     + RGG   I +K KKL  E+S  K RE  + DR + ELGRS R+PP 
Sbjct  809  AASEGR-FSTGSSAPRGGNVPISIKFKKLATEDSARKQREHHRKDRYQDELGRSRRQPPP  867

Query  493  P------ETGERRLKVRGPSILG  543
            P      E G +R+KV+GPS LG
Sbjct  868  PPPPPPMEVGAKRIKVKGPSFLG  890



>emb|CDP18547.1| unnamed protein product [Coffea canephora]
Length=880

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 104/180 (58%), Gaps = 5/180 (3%)
 Frame = +1

Query  19   ESSCSDDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHDS-NYCN  189
            ES  SD+++  H    Q   +R   D + DESDSEIFRVKRRS  ++EQ+   D  +   
Sbjct  697  ESLMSDEHAGGHLRENQRKDVRPTEDNESDESDSEIFRVKRRSSVKIEQRYGLDPLSISF  756

Query  190  EYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGA  369
            ++Q  KRLKK Q  +  +G L + E S ++  ++T    S+++KE      RD       
Sbjct  757  DHQGFKRLKKCQS-EASNGQLIASEPSVADIPSYTSRPKSNNFKEVADNGLRDRFANRNT  815

Query  370  NRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCP-ETGERRLKVRGPSILGF  546
              + +K KK+  +E   K+ E +++DR +H+LGR++REP  P E G +RLKV+GPS +G 
Sbjct  816  GTLSIKIKKVGNDEMMSKNGEHQRSDRCQHDLGRTVREPQPPLEMGPKRLKVKGPSFIGL  875



>ref|XP_008238182.1| PREDICTED: lysine-specific demethylase 5C [Prunus mume]
Length=887

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 95/169 (56%), Gaps = 12/169 (7%)
 Frame = +1

Query  70   GSKIRTVVdededesdseIFRVKRRS--RVEQKSTHD--SNYCNEYQSLKRLKKHQQPDR  237
            GS++R VVD+  D+SDSEIFRVKRRS  +V+++S +D  S+  +E Q  KRLKK Q   R
Sbjct  712  GSEVRHVVDQGSDDSDSEIFRVKRRSSLKVDKRSVNDISSSKHSENQGFKRLKKLQAERR  771

Query  238  RSGSLSSPECSTSEGRNF----TYVGNS-SDYKEGRKYPPRDESHRGGANRILVKNKKLT  402
               S+    CST E   F     Y G S S   EGR         RG    I +K KKL 
Sbjct  772  CGPSVPQYSCSTGESTKFLTASAYKGVSESAPMEGRFSRGSTVVPRGSTIPISIKFKKLA  831

Query  403  AEESRDKHRELKKNDRLKHEL--GRSIREPPCPETGERRLKVRGPSILG  543
             EES  + RE  + DR  H+L  G+  R PP  E G +RLKV+GPS LG
Sbjct  832  NEESVSRQREHHRKDRY-HQLESGKRRRGPPPIEIGPKRLKVKGPSFLG  879



>ref|XP_007210900.1| hypothetical protein PRUPE_ppa001299mg [Prunus persica]
 gb|EMJ12099.1| hypothetical protein PRUPE_ppa001299mg [Prunus persica]
Length=860

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 96/169 (57%), Gaps = 13/169 (8%)
 Frame = +1

Query  70   GSKIRTVVdededesdseIFRVKRRS--RVEQKSTHD--SNYCNEYQSLKRLKKHQQPDR  237
            GS++R VVD+  D+SDSEIFRVKRRS  +V+++S +D  S+  +E Q  KRLKK Q  +R
Sbjct  686  GSEVRPVVDQGSDDSDSEIFRVKRRSSLKVDKRSVNDISSSKHSENQGFKRLKKLQA-ER  744

Query  238  RSGSLSSPECSTSEGRNF----TYVGNS-SDYKEGRKYPPRDESHRGGANRILVKNKKLT  402
               S+    CST E   F    TY G S S   EGR         RG    I +K KKL 
Sbjct  745  CGPSVPQYSCSTGESTRFLTTSTYKGVSESAPMEGRFSRGSTVVPRGSTVPISIKFKKLA  804

Query  403  AEESRDKHRELKKNDRLKHEL--GRSIREPPCPETGERRLKVRGPSILG  543
             EES  + RE  + DR  H+L  G+  R PP  E G + LKV+GPS LG
Sbjct  805  NEESVSRQREHHRKDRY-HQLESGKRRRGPPPIEIGPKHLKVKGPSFLG  852



>ref|XP_010053634.1| PREDICTED: lysine-specific demethylase JMJ706 [Eucalyptus grandis]
 gb|KCW77979.1| hypothetical protein EUGRSUZ_D02224 [Eucalyptus grandis]
Length=864

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 103/183 (56%), Gaps = 14/183 (8%)
 Frame = +1

Query  10   NVQESSCS----DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTH  171
            N  ESS S    DD ++  ++ +  S  R +  +  D+SD+EIFRVKRRS  + E++S H
Sbjct  679  NAYESSVSSLSYDDCTSADQDRLHDSARRPLSGQYSDDSDTEIFRVKRRSSMKAEKRSRH  738

Query  172  DSNYCNE--YQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPR  345
            DS       +Q LKRL+K QQ DR  G L    C  S+   +  VG S+ ++E       
Sbjct  739  DSLPLQHSGHQGLKRLRK-QQSDR--GQLMQSHCYRSDEARYG-VGASAIHRETPGTSAG  794

Query  346  DESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVR  525
            D   +G ++ I +K KKL+ EE  +K  E +  DR + ELG+++ EPP  E G +RLKVR
Sbjct  795  DRFAKG-SSVISIKFKKLSNEELTNK-AECQAKDRFQDELGKAMSEPPPLEIGPKRLKVR  852

Query  526  GPS  534
             PS
Sbjct  853  CPS  855



>gb|KCW77980.1| hypothetical protein EUGRSUZ_D02224 [Eucalyptus grandis]
Length=838

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 103/183 (56%), Gaps = 14/183 (8%)
 Frame = +1

Query  10   NVQESSCS----DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTH  171
            N  ESS S    DD ++  ++ +  S  R +  +  D+SD+EIFRVKRRS  + E++S H
Sbjct  653  NAYESSVSSLSYDDCTSADQDRLHDSARRPLSGQYSDDSDTEIFRVKRRSSMKAEKRSRH  712

Query  172  DSNYCNE--YQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPR  345
            DS       +Q LKRL+K QQ DR  G L    C  S+   +  VG S+ ++E       
Sbjct  713  DSLPLQHSGHQGLKRLRK-QQSDR--GQLMQSHCYRSDEARYG-VGASAIHRETPGTSAG  768

Query  346  DESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVR  525
            D   +G ++ I +K KKL+ EE  +K  E +  DR + ELG+++ EPP  E G +RLKVR
Sbjct  769  DRFAKG-SSVISIKFKKLSNEELTNK-AECQAKDRFQDELGKAMSEPPPLEIGPKRLKVR  826

Query  526  GPS  534
             PS
Sbjct  827  CPS  829



>ref|XP_010677367.1| PREDICTED: lysine-specific demethylase JMJ706 [Beta vulgaris 
subsp. vulgaris]
Length=858

 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 80/144 (56%), Gaps = 13/144 (9%)
 Frame = +1

Query  124  IFRVKRRS--RVEQKSTHDSNYCNE--YQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNF  291
            IFRVKRRS  +VE+K+       ++  +Q  KRLKK  QP+ R G   + +C +++  + 
Sbjct  718  IFRVKRRSTLKVERKNVISEIKSDQIKHQGFKRLKK-IQPEGRFGETVN-DCESNKKWD-  774

Query  292  TYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGR  471
                    +K+G+   PR++ +RG    + +K K+ +   S  K+RE   NDR + + GR
Sbjct  775  ------GHFKDGKVSAPRNQYNRGSIMPVSIKVKRTSGNGSSIKYREHSMNDRFQQDFGR  828

Query  472  SIREPPCPETGERRLKVRGPSILG  543
              RE    E G +RLKV+GPS LG
Sbjct  829  IPREAAPIEIGPKRLKVKGPSFLG  852



>ref|XP_004300206.1| PREDICTED: probable lysine-specific demethylase JMJ14-like [Fragaria 
vesca subsp. vesca]
Length=878

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 81/145 (56%), Gaps = 11/145 (8%)
 Frame = +1

Query  124  IFRVKRRS--RVEQKSTHDSNYCN--EYQSLKRLKKHQQPDRRSG-SLSSPECSTSEGRN  288
            IFRVKRRS  ++E+++  D++  N  E +  KRLKK  QPD R G S+     STS  + 
Sbjct  734  IFRVKRRSSLKMEKRTISDASPSNVSENKGFKRLKK-LQPDIRCGRSVPLQSSSTSNNKG  792

Query  289  FTYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELG  468
               + +  D     ++   +   RG    + +K KKLT E+S  + R+  ++D  + ELG
Sbjct  793  APEIASRDD-----RFARGNTISRGSTVPLSIKFKKLTNEDSVRRQRDHHRSDLRQLELG  847

Query  469  RSIREPPCPETGERRLKVRGPSILG  543
            +S REPP  E G +R KV+GPS L 
Sbjct  848  KSRREPPPIEIGLKRFKVKGPSFLA  872



>gb|KHG27791.1| Lysine-specific demethylase REF6 -like protein [Gossypium arboreum]
Length=792

 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 99/175 (57%), Gaps = 12/175 (7%)
 Frame = +1

Query  34   DDYSNVHRNVIQGSKIRTVVdededesdseIFRVKR-RSRVEQKSTHD--SNYCNEYQSL  204
            +D+ ++H++ +     R++VDE+ D SDS IFRVKR  S+VE++  +D  S+  +E+Q+ 
Sbjct  602  EDHRSIHQDNVHDPVSRSIVDENSDSSDSPIFRVKRPFSKVEKRFGNDTISSKNSEHQAF  661

Query  205  KRLKKHQQPDR--RSGSLSSPECSTSE-GRNFTYVGNSSDYKEGRKYPPRDESHRGGANR  375
            KRLKK Q   R  R  +  S  C   E  RN      SSD KE  +   +D   RG    
Sbjct  662  KRLKKLQHEGRCGRPVAYESECCRNDEPNRN---TNCSSDSKEALENAVKDRLGRGTLPI  718

Query  376  -ILVKNKKLTAEESRD-KHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPS  534
             I +K KK+ +E     + RE  +NDR + ELG+  R+ P  E G +RLKVRGPS
Sbjct  719  PISIKYKKMGSEAGMSSRRREHHRNDRFQQELGKRKRDSPS-EIGPKRLKVRGPS  772



>gb|EYU45270.1| hypothetical protein MIMGU_mgv1a001473mg [Erythranthe guttata]
Length=812

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 88/166 (53%), Gaps = 21/166 (13%)
 Frame = +1

Query  64   IQGSKIRTVVdededesdseIFRVKRRS--RVEQKSTHDS-NYCNEYQSLKRLKKHQQPD  234
            +QG   R  + E+ D+SDSEIFRVKRRS  +VEQK  HDS +   + Q  KRLKK+Q+ +
Sbjct  663  VQGVDSRNTISENSDDSDSEIFRVKRRSSAKVEQKIAHDSVSATTDQQGFKRLKKNQR-E  721

Query  235  RRSGSLSSPECSTSEGRNFTYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEES  414
             R G LSS    +S+  N T         E R+    ++  RG    I +K KK   EE 
Sbjct  722  VRCGQLSS----SSKCLNST---------ESRQVSVGNKFGRGTGIPISIKFKKTRNEEV  768

Query  415  RDKHRELKKNDRLKHELGRSIREPPCPETGERRLKVRGPSILGFTG  552
              KH E+  N+    +  R        E G +RLKVRGPS+LG  G
Sbjct  769  LTKHGEVHNNNNNSRDHNRQQHN----ELGSKRLKVRGPSVLGHEG  810



>ref|XP_010245223.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X1 
[Nelumbo nucifera]
Length=870

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 79/155 (51%), Gaps = 25/155 (16%)
 Frame = +1

Query  124  IFRVKRRS--RVEQKSTHD--SNYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNF  291
            IFRVKRRS  ++E+++ ++  S+  +E Q LKRLK+   P+ R G       S+S  R  
Sbjct  696  IFRVKRRSSVKIEKRNVNNVLSSKFSEQQGLKRLKR-LHPEGRFG------LSSSSDRYI  748

Query  292  T-----YVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEES---RDKHRELKKND  447
            T     +   S + KE   + P+D    G    I +K++ L  +     +D    ++ N 
Sbjct  749  TDKAERHASPSVNSKEVSGFGPKDRFSGGSFTSISMKSRPLLTDLKVVYKDDDNIVRVNP  808

Query  448  R------LKHELGRSIREPPCPETGERRLKVRGPS  534
            R       +  +G++ REPP  E G +RLKVRGPS
Sbjct  809  REHIRKNFEDYVGQTTREPPPIEIGPKRLKVRGPS  843



>ref|XP_010245224.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X2 
[Nelumbo nucifera]
Length=728

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 79/155 (51%), Gaps = 25/155 (16%)
 Frame = +1

Query  124  IFRVKRRS--RVEQKSTHD--SNYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNF  291
            IFRVKRRS  ++E+++ ++  S+  +E Q LKRLK+   P+ R G       S+S  R  
Sbjct  554  IFRVKRRSSVKIEKRNVNNVLSSKFSEQQGLKRLKR-LHPEGRFG------LSSSSDRYI  606

Query  292  T-----YVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEES---RDKHRELKKND  447
            T     +   S + KE   + P+D    G    I +K++ L  +     +D    ++ N 
Sbjct  607  TDKAERHASPSVNSKEVSGFGPKDRFSGGSFTSISMKSRPLLTDLKVVYKDDDNIVRVNP  666

Query  448  R------LKHELGRSIREPPCPETGERRLKVRGPS  534
            R       +  +G++ REPP  E G +RLKVRGPS
Sbjct  667  REHIRKNFEDYVGQTTREPPPIEIGPKRLKVRGPS  701



>ref|XP_006572813.1| PREDICTED: uncharacterized protein LOC100306287 isoform X3 [Glycine 
max]
Length=858

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 76/146 (52%), Gaps = 14/146 (10%)
 Frame = +1

Query  124  IFRVKRRS--RVEQKSTHD---SNYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRN  288
            IFRVKR S  + E+++ +D   S +  + Q LKRLKK   P+ +SG     + S S   +
Sbjct  716  IFRVKRPSSLKAERRNMNDAMSSKHTAQQQGLKRLKK-ILPEGKSGQ--PMDFSRSNESS  772

Query  289  FTYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELG  468
            + Y G+  ++K   +   RD    G    I ++ KKL  EE     R+  + DRL+    
Sbjct  773  YKY-GHPVNHKGHAEISSRDRFATGNGIPISIRCKKLGNEEI-SMQRDHNRRDRLQ----  826

Query  469  RSIREPPCPETGERRLKVRGPSILGF  546
            ++ REPP  E   + LKVRGPS LG 
Sbjct  827  QTFREPPSMELEPKHLKVRGPSFLGL  852



>ref|XP_006572811.1| PREDICTED: uncharacterized protein LOC100306287 isoform X1 [Glycine 
max]
Length=859

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 76/146 (52%), Gaps = 14/146 (10%)
 Frame = +1

Query  124  IFRVKRRS--RVEQKSTHD---SNYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRN  288
            IFRVKR S  + E+++ +D   S +  + Q LKRLKK   P+ +SG     + S S   +
Sbjct  717  IFRVKRPSSLKAERRNMNDAMSSKHTAQQQGLKRLKK-ILPEGKSGQ--PMDFSRSNESS  773

Query  289  FTYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELG  468
            + Y G+  ++K   +   RD    G    I ++ KKL  EE     R+  + DRL+    
Sbjct  774  YKY-GHPVNHKGHAEISSRDRFATGNGIPISIRCKKLGNEEI-SMQRDHNRRDRLQ----  827

Query  469  RSIREPPCPETGERRLKVRGPSILGF  546
            ++ REPP  E   + LKVRGPS LG 
Sbjct  828  QTFREPPSMELEPKHLKVRGPSFLGL  853



>gb|KHN04851.1| Lysine-specific demethylase REF6 [Glycine soja]
Length=864

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 76/145 (52%), Gaps = 13/145 (9%)
 Frame = +1

Query  124  IFRVKRRS--RVEQKSTHD--SNYCNEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNF  291
            IFRVKR S  + E+++ +D  S+     Q LKRLKK   P+ +SG     + S S   ++
Sbjct  723  IFRVKRPSSLKAERRNMNDAMSSKHTAQQGLKRLKK-ILPEGKSGQ--PMDFSRSNESSY  779

Query  292  TYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEESRDKHRELKKNDRLKHELGR  471
             Y G+  ++K   +   RD    G    I ++ KKL  EE     R+  + DRL+    +
Sbjct  780  KY-GHPVNHKGHAEISSRDRFATGNGIPISIRCKKLGNEEI-SMQRDHNRRDRLQ----Q  833

Query  472  SIREPPCPETGERRLKVRGPSILGF  546
            + REPP  E   +RLKVRGPS LG 
Sbjct  834  TFREPPSMELEPKRLKVRGPSFLGL  858



>ref|XP_010276830.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X1 
[Nelumbo nucifera]
Length=844

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 11/145 (8%)
 Frame = +1

Query  124  IFRVKRRSRVEQKSTHDSNYC----NEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNF  291
            IFRVKRRS V+ K    +N      +E Q LKRLK+  QP+ R G  SS + ST++    
Sbjct  676  IFRVKRRSSVKVKKRTVNNVMTSKFSEQQGLKRLKR-LQPEGRFGQSSSSDSSTTKTEQ-  733

Query  292  TYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEESR----DKHRELKKNDRLKH  459
             +   S + KE     P++    G    I +K + L  +       D  R     +  + 
Sbjct  734  -HASASVNSKEVSGLGPKNRFAGGNITPITMKFRPLLTDSKMVYKEDAVRVKPVKNDFED  792

Query  460  ELGRSIREPPCPETGERRLKVRGPS  534
             +G+++REP   E G +RLKVRGPS
Sbjct  793  YIGQTMREPQSIEIGPKRLKVRGPS  817



>ref|XP_010276831.1| PREDICTED: lysine-specific demethylase JMJ706-like isoform X2 
[Nelumbo nucifera]
Length=703

 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 11/145 (8%)
 Frame = +1

Query  124  IFRVKRRSRVEQKSTHDSNYC----NEYQSLKRLKKHQQPDRRSGSLSSPECSTSEGRNF  291
            IFRVKRRS V+ K    +N      +E Q LKRLK+  QP+ R G  SS + ST++    
Sbjct  535  IFRVKRRSSVKVKKRTVNNVMTSKFSEQQGLKRLKR-LQPEGRFGQSSSSDSSTTKTEQ-  592

Query  292  TYVGNSSDYKEGRKYPPRDESHRGGANRILVKNKKLTAEESR----DKHRELKKNDRLKH  459
             +   S + KE     P++    G    I +K + L  +       D  R     +  + 
Sbjct  593  -HASASVNSKEVSGLGPKNRFAGGNITPITMKFRPLLTDSKMVYKEDAVRVKPVKNDFED  651

Query  460  ELGRSIREPPCPETGERRLKVRGPS  534
             +G+++REP   E G +RLKVRGPS
Sbjct  652  YIGQTMREPQSIEIGPKRLKVRGPS  676



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2436594696768