BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c87468_g1_i1 len=615 path=[593:0-614]

Length=615
                                                                      Score     E

ref|XP_003611775.1|  hypothetical protein MTR_5g017710                48.9    1e-04   



>ref|XP_003611775.1| hypothetical protein MTR_5g017710 [Medicago truncatula]
 gb|AES94733.1| hypothetical protein MTR_5g017710 [Medicago truncatula]
Length=85

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (63%), Gaps = 8/64 (13%)
 Frame = +1

Query  136  RNLGAPKGSRLMSFNRSVHEKPILNVEHEVRRAKHLSRILQGEVDSFRPTTSGHSPGMGH  315
            +++G+PK + + +  RSV   P        R+ ++  R L+G V++FRPTT GHSPG+GH
Sbjct  30   KSIGSPKAASVETMTRSVVLSP--------RQLQNNGRNLEGSVEAFRPTTPGHSPGVGH  81

Query  316  SKND  327
            S  +
Sbjct  82   SLKN  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 807801807960