BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8713_g1_i1 len=1583 path=[1:0-1069 1071:1070-1582]

Length=1583
                                                                      Score     E

emb|CCQ71650.1|  cytochrome b6                                          446   8e-152   
ref|YP_007025921.1|  cytochrome b6                                      446   8e-152   
ref|YP_009040830.1|  cytochrome b6 (chloroplast)                        444   2e-151   
gb|AHF71486.1|  cytochrome b6                                           441   3e-150   
ref|YP_008757470.1|  cytochrome b6                                      441   7e-150   
ref|YP_008520169.1|  cytochrome b6                                      440   1e-149   
ref|YP_874682.1|  cytochrome b6                                         440   2e-149   Hordeum vulgare subsp. vulgare [barley]
emb|CAA32267.1|  petB                                                   440   2e-149   Hordeum vulgare [barley]
ref|YP_009000363.1|  petB protein                                       440   2e-149   
ref|NP_043053.1|  cytochrome b6                                         440   2e-149   Zea mays [maize]
ref|YP_003097604.1|  cytochrome b6                                      439   2e-149   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_010089870.1|  Cytochrome b6                                      439   2e-149   
ref|YP_009020167.1|  cytochrome b6                                      439   3e-149   
ref|YP_007475169.1|  cytochrome b6                                      439   3e-149   
gb|AEX65244.1|  cytochrome b6                                           438   4e-149   
ref|YP_005090208.1|  petB gene product                                  439   4e-149   
ref|YP_008994491.1|  cytochrome b6 (chloroplast)                        438   5e-149   
ref|YP_008815780.1|  cytochrome b6                                      439   6e-149   
ref|YP_008992839.1|  cytochrome b6                                      438   1e-148   
ref|YP_008993550.1|  cytochrome b6                                      437   1e-148   
ref|YP_009040435.1|  cytochrome b6 (chloroplast)                        437   1e-148   
ref|YP_740506.1|  cytochrome b6                                         438   1e-148   Citrus sinensis [apfelsine]
ref|YP_009048051.1|  cytochrome b6                                      437   1e-148   
ref|YP_008239121.1|  cytochrome b6 (chloroplast)                        438   1e-148   
ref|YP_008758218.1|  cytochrome b6                                      437   2e-148   
ref|YP_002000515.1|  cytochrome b6                                      437   2e-148   Brachypodium distachyon [annual false brome]
gb|AEJ10366.1|  cytochrome b6                                           436   3e-148   
ref|YP_004286034.1|  cytochrome b6                                      436   5e-148   
gb|AIQ79230.1|  cytochrome b6                                           436   6e-148   
ref|YP_636329.1|  cytochrome b6                                         435   6e-148   Eucalyptus globulus subsp. globulus
gb|AEX65250.1|  cytochrome b6                                           435   6e-148   
gb|ADM92677.1|  cytochrome b6                                           435   6e-148   
gb|AEJ10381.1|  cytochrome b6                                           435   7e-148   
emb|CDP57007.1|  Cytochrome b6-f complex subunit, cytochrome b6         437   7e-148   
ref|YP_538966.1|  cytochrome b6                                         436   7e-148   Gossypium hirsutum [American cotton]
ref|YP_004769658.1|  cytochrome b6                                      435   7e-148   
ref|YP_009073373.1|  cytochrome b6                                      435   8e-148   
ref|YP_004841813.1|  cytochrome b6                                      436   9e-148   
gb|ABI97446.1|  cytochrome b6                                           435   1e-147   Cucumis sativus [cucumbers]
gb|ADD31090.1|  cytochrome b6 protein                                   435   1e-147   Euonymus americanus
gb|AHG24566.1|  cytochrome b6                                           435   1e-147   
ref|YP_004286132.1|  cytochrome b6                                      435   1e-147   
gb|ABU85419.1|  cytochrome b6                                           436   1e-147   Musa acuminata [banana]
gb|AHG24641.1|  cytochrome b6                                           435   1e-147   
ref|YP_009054459.1|  cytochrome b6                                      435   1e-147   
ref|YP_004841978.1|  cytochrome b6                                      434   1e-147   
ref|YP_009048140.1|  cytochrome b6                                      434   1e-147   
gb|ACT67274.1|  cytochrome b6                                           434   2e-147   Joinvillea plicata
ref|NP_084723.2|  cytochrome b6                                         434   2e-147   Oenothera elata subsp. hookeri [Hooker's evening primrose]
ref|YP_009033472.1|  cytochrome b6                                      434   2e-147   
ref|YP_007476380.1|  PetB                                               434   2e-147   
ref|YP_009024367.1|  cytochrome b6                                      435   2e-147   
gb|AEJ10395.1|  cytochrome b6                                           434   2e-147   
ref|XP_011018713.1|  PREDICTED: cytochrome b6                           436   2e-147   
gb|AGM14978.1|  cytochrome b6                                           434   2e-147   
ref|YP_009073290.1|  cytochrome b6                                      434   2e-147   
ref|YP_009027809.1|  cytochrome b6                                      434   2e-147   
ref|YP_008577778.1|  cytochrome b6                                      434   2e-147   
gb|ADM92676.1|  cytochrome b6                                           434   2e-147   
sp|P06247.2|CYB6_TOBAC  RecName: Full=Cytochrome b6                     434   2e-147   Nicotiana tabacum [American tobacco]
gb|ADD31091.1|  cytochrome b6 protein                                   434   3e-147   Ficus sp. Moore 315
ref|YP_001123060.1|  cytochrome B6                                      434   3e-147   Aethionema grandiflorum
gb|AHF72016.1|  cytochrome b6                                           434   3e-147   
gb|AGX28873.2|  cytochrome b6                                           434   3e-147   
gb|AAZ04013.1|  cytochrome b6                                           434   3e-147   Typha latifolia [common cattail]
gb|AEX65247.1|  cytochrome b6                                           434   3e-147   
ref|YP_007025498.1|  cytochrome b6                                      434   3e-147   
gb|ABU85327.1|  cytochrome b6                                           434   3e-147   Elaeis oleifera
gb|AFU96002.1|  PetB                                                    433   3e-147   
gb|AGQ50366.1|  cytochrome b6                                           433   3e-147   
ref|YP_008992753.1|  cytochrome b6                                      434   4e-147   
ref|YP_008080525.1|  cytochrome b6/f complex subunit IV                 433   4e-147   
ref|XP_010421234.1|  PREDICTED: cytochrome b6                           433   4e-147   
gb|AHM88865.1|  cytochrome b6                                           434   4e-147   
gb|AHV90354.1|  cytochrome b6                                           433   4e-147   
ref|YP_001936547.1|  cytochrome b6                                      433   4e-147   Fagopyrum esculentum subsp. ancestrale
gb|AEJ10368.1|  cytochrome b6                                           433   4e-147   
gb|AHY80570.1|  cytochrome b6                                           434   4e-147   
ref|NP_039415.1|  cytochrome b6                                         433   5e-147   Oryza sativa Japonica Group [Japonica rice]
ref|YP_008592670.1|  cytochrome b6                                      434   5e-147   
ref|YP_762291.1|  cytochrome b6                                         433   5e-147   Morus indica
gb|AEJ10357.1|  cytochrome b6                                           433   5e-147   
dbj|BAP59064.1|  cytochrome b6                                          433   5e-147   
gb|AIA76986.1|  cytochrome b6 (chloroplast)                             433   5e-147   
ref|YP_002720142.1|  petB                                               433   6e-147   Jatropha curcas
ref|YP_009111685.1|  cytochrome b6                                      433   6e-147   
ref|YP_003587697.1|  cytochrome b6                                      433   6e-147   
gb|AAZ04009.1|  cytochrome b6                                           433   6e-147   Acorus americanus [sweetflag]
gb|AEJ10358.1|  cytochrome b6                                           432   7e-147   
ref|YP_009072958.1|  cytochrome b6                                      432   8e-147   
ref|YP_009114478.1|  cytochrome b6                                      432   8e-147   
ref|YP_001718467.1|  cytochrome b6                                      432   8e-147   Manihot esculenta [manioc]
gb|AEJ10359.1|  cytochrome b6                                           432   9e-147   
ref|YP_004563897.1|  cytochrome b6                                      432   1e-146   
ref|NP_051088.1|  cytochrome b6                                         432   1e-146   Arabidopsis thaliana [mouse-ear cress]
gb|AEX65246.1|  cytochrome b6                                           432   1e-146   
ref|YP_003540961.1|  cytochrome b6                                      432   1e-146   Phoenix dactylifera
gb|AII17940.1|  cytochrome b6                                           432   1e-146   
ref|YP_008992667.1|  cytochrome b6                                      433   1e-146   
gb|AEX65248.1|  cytochrome b6                                           432   1e-146   
ref|YP_009019918.1|  cytochrome b6                                      432   1e-146   
ref|XP_002888340.1|  predicted protein                                  433   1e-146   
ref|YP_001122976.1|  cytochrome B6                                      432   1e-146   Aethionema cordifolium
gb|AHF71930.1|  cytochrome b6                                           432   2e-146   
gb|ADD31092.1|  cytochrome b6 protein                                   432   2e-146   Gunnera manicata
gb|ABU85495.1|  cytochrome b6                                           432   2e-146   Passiflora biflora
gb|AEX10215.1|  cytochrome b6                                           431   2e-146   
gb|AFU95984.1|  PetB                                                    431   2e-146   
gb|AHA13212.1|  cytochrome b6                                           432   2e-146   
ref|YP_009027917.1|  cytochrome b6 (chloroplast)                        431   2e-146   
gb|AEJ10377.1|  cytochrome b6                                           431   2e-146   
ref|YP_005097904.1|  cytochrome b6                                      431   2e-146   
ref|XP_008467004.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome b6      433   2e-146   
gb|AGN71995.1|  cytochrome b6                                           431   2e-146   
ref|YP_009107006.1|  cytochrome b6                                      431   2e-146   
sp|Q09ME7.2|CYB6_CITSI  RecName: Full=Cytochrome b6                     431   2e-146   Citrus sinensis [apfelsine]
ref|YP_004021346.1|  cytochrome b6                                      431   2e-146   
gb|AEJ10376.1|  cytochrome b6                                           431   3e-146   
gb|AFU95992.1|  PetB                                                    431   3e-146   
ref|YP_054659.1|  cytochrome b6                                         431   3e-146   Saccharum officinarum [noble cane]
gb|ACH47639.1|  cytochrome b6                                           431   3e-146   Erodium chrysanthum
gb|ABI98775.1|  cytochrome b6                                           431   3e-146   Cucumis sativus [cucumbers]
gb|AEX65252.1|  cytochrome b6                                           431   3e-146   
ref|YP_358611.1|  cytochrome b6                                         431   3e-146   Phalaenopsis aphrodite subsp. formosana
ref|NP_783261.1|  cytochrome b6                                         431   3e-146   Atropa belladonna [deadly nightshade]
gb|AEX58485.1|  cytochrome b6                                           431   3e-146   
ref|YP_001001564.1|  cytochrome b6                                      431   3e-146   Nuphar advena
ref|YP_784503.1|  cytochrome b6                                         431   3e-146   Piper cenocladum
gb|ADD31088.1|  cytochrome b6 protein                                   431   4e-146   Bulnesia arborea [verawood]
gb|AGW04695.1|  cytochrome b6                                           431   4e-146   
ref|YP_004769841.1|  cytochrome b6                                      431   4e-146   
gb|AAZ04014.1|  cytochrome b6                                           431   4e-146   Yucca schidigera [Mohave yucca]
ref|YP_001123492.1|  cytochrome b6                                      431   4e-146   Crucihimalaya wallichii
gb|AER52851.1|  cytochrome b6                                           431   5e-146   
gb|AEX93422.1|  cytochrome b/b6                                         431   5e-146   
gb|AFU95973.1|  PetB                                                    430   5e-146   
ref|YP_008963425.1|  cytochrome b6                                      431   5e-146   
ref|YP_008378812.1|  cytochrome b6                                      430   5e-146   
ref|YP_006073134.1|  cytochrome b6                                      431   5e-146   
ref|YP_009041117.1|  cytochrome b6                                      430   5e-146   
gb|AEX65245.1|  cytochrome b6                                           430   5e-146   
ref|NP_054530.1|  cytochrome b6                                         430   6e-146   Nicotiana tabacum [American tobacco]
gb|ADD31095.1|  cytochrome b6 protein                                   430   6e-146   Oxalis latifolia
ref|NP_862783.1|  cytochrome b6                                         430   6e-146   Calycanthus floridus var. glaucus
gb|AEP94890.1|  cytochrome b6                                           430   6e-146   
ref|YP_001294382.1|  cytochrome b6                                      430   6e-146   Dioscorea elephantipes [elephant's-foot]
ref|YP_007475649.1|  cytochrome b6                                      430   6e-146   
gb|AFU95980.1|  PetB                                                    430   6e-146   
gb|ADD31098.1|  cytochrome b6 protein                                   430   6e-146   Staphylea colchica
gb|AEJ10356.1|  cytochrome b6                                           430   6e-146   
ref|YP_009057181.1|  cytochrome b6                                      430   7e-146   
ref|YP_005352737.1|  petB gene product                                  430   7e-146   
ref|YP_053184.1|  cytochrome b6                                         430   8e-146   Nymphaea alba [white water-lily]
sp|A7M993.2|CYB6_CUSRE  RecName: Full=Cytochrome b6                     430   8e-146   Cuscuta reflexa [giant dodder]
gb|AFU95977.1|  PetB                                                    430   8e-146   
ref|YP_002836120.1|  cytochrome b6                                      430   9e-146   Megaleranthis saniculifolia
ref|NP_114287.1|  cytochrome b6                                         430   9e-146   Triticum aestivum [Canadian hard winter wheat]
ref|YP_007476077.1|  cytochrome b6                                      430   9e-146   
ref|YP_588147.1|  cytochrome b6                                         430   9e-146   Helianthus annuus
gb|AIZ57558.1|  cytochrome b6                                           430   9e-146   
gb|AEJ10367.1|  cytochrome b6                                           430   1e-145   
ref|YP_009020774.1|  cytochrome b6                                      430   1e-145   
ref|YP_001294128.1|  cytochrome b6                                      430   1e-145   Chloranthus spicatus [cha-ran]
gb|AEJ10365.1|  cytochrome b6                                           429   1e-145   
gb|AFU96012.1|  PetB                                                    429   1e-145   
ref|YP_009108527.1|  cytochrome b6                                      429   1e-145   
gb|AJE71246.1|  cytochrome b6                                           429   1e-145   
gb|AFK36715.1|  unknown                                                 429   1e-145   
ref|YP_009109920.1|  cytochrome b6                                      429   1e-145   
gb|AEJ10396.1|  cytochrome b6                                           429   1e-145   
ref|YP_001122836.2|  cytochrome b6                                      429   1e-145   Phaseolus vulgaris [French bean]
ref|YP_005089525.1|  petB gene product                                  429   1e-145   
gb|AFU95974.1|  PetB                                                    429   1e-145   
ref|YP_006665810.1|  cytochrome b6                                      429   1e-145   
gb|AFU95997.1|  PetB                                                    429   1e-145   
gb|AEJ10389.1|  cytochrome b6                                           429   1e-145   
ref|YP_009115445.1|  PetB; cytochrome b6                                429   1e-145   
ref|YP_009109234.1|  cytochrome b6                                      429   1e-145   
gb|AFU95969.1|  PetB                                                    429   1e-145   
ref|NP_054964.1|  cytochrome b6                                         429   1e-145   Spinacia oleracea
ref|YP_004733273.1|  cytochrome b6                                      429   2e-145   
gb|AHA12868.1|  cytochrome b6                                           429   2e-145   
ref|YP_001468338.1|  cytochrome b6                                      429   2e-145   Ipomoea purpurea
gb|ACH47645.1|  cytochrome b6                                           429   2e-145   
ref|YP_001004216.1|  cytochrome b6                                      429   2e-145   Ranunculus macranthus
ref|YP_009053277.1|  cytochrome b6                                      429   2e-145   
gb|AFU95976.1|  PetB                                                    429   2e-145   
ref|YP_913217.1|  cytochrome b6                                         429   2e-145   Gossypium barbadense [Egyptian cotton]
ref|YP_001023731.1|  cytochrome b6                                      429   2e-145   Angiopteris evecta
ref|YP_004221951.1|  cytochrome b6                                      429   2e-145   
gb|AFU96006.1|  PetB                                                    429   2e-145   
gb|ADD31080.1|  cytochrome b6 protein                                   429   2e-145   Lonicera japonica [Japanese honeysuckle]
ref|YP_003934064.1|  cytochrome b6/f complex subunit II                 429   2e-145   
gb|AFW65461.1|  hypothetical protein ZEAMMB73_679753                    429   2e-145   
gb|AAZ04011.1|  cytochrome b6                                           429   2e-145   Nuphar advena
gb|AEJ10362.1|  cytochrome b6                                           429   2e-145   
ref|YP_005089982.1|  petB gene product                                  429   2e-145   
gb|AFM83323.1|  cytochrome b6                                           429   2e-145   
ref|YP_009114264.1|  cytochrome b6                                      429   3e-145   
gb|AHA12954.1|  cytochrome b6                                           429   3e-145   
ref|YP_665588.1|  cytochrome b6                                         429   3e-145   Populus alba [abele]
ref|YP_009113540.1|  cytochrome b6                                      428   3e-145   
gb|AFU95971.1|  PetB                                                    428   3e-145   
ref|YP_008994598.1|  cytochrome b6 (chloroplast)                        428   3e-145   
gb|AEJ10378.1|  cytochrome b6                                           428   3e-145   
gb|AHH29757.1|  cytochrome b6                                           429   3e-145   
gb|AFU95990.1|  PetB                                                    428   3e-145   
gb|AEZ01454.1|  cytochrome b6                                           428   3e-145   
ref|YP_009033915.1|  cytochrome b6                                      428   3e-145   
ref|YP_001595538.1|  cytochrome b6/f complex PetB protein               428   3e-145   Lemna minor
gb|EMS62069.1|  Cytochrome b6                                           429   3e-145   
ref|YP_003778188.1|  cytochrome b6                                      428   3e-145   
ref|YP_003934304.1|  cytochrome b6                                      428   3e-145   
gb|EPS74506.1|  hypothetical protein M569_00223                         428   3e-145   
gb|AEJ10371.1|  cytochrome b6                                           428   3e-145   
ref|YP_001381699.1|  cytochrome b6                                      428   3e-145   Medicago truncatula
ref|YP_005089363.1|  petB gene product                                  428   3e-145   
ref|YP_008963631.1|  cytochrome b6                                      428   4e-145   
gb|AFU96000.1|  PetB                                                    428   4e-145   
ref|YP_009109307.1|  cytochrome b6                                      428   4e-145   
ref|YP_247630.1|  cytochrome b6                                         428   4e-145   Cucumis sativus [cucumbers]
ref|YP_007026582.1|  cytochrome b6                                      428   4e-145   
gb|ACH47646.1|  cytochrome b6                                           428   4e-145   Pelargonium cotyledonis
ref|YP_538795.1|  cytochrome b6                                         428   5e-145   Glycine max [soybeans]
gb|AGW97216.1|  cytochrome b6                                           428   5e-145   
gb|AHA12710.1|  cytochrome b6                                           428   5e-145   
ref|YP_007889891.1|  cytochrome b6                                      428   5e-145   
gb|ACH47642.1|  cytochrome b6                                           428   6e-145   Geranium macrorrhizum
gb|AFU96008.1|  PetB                                                    427   6e-145   
ref|YP_009024711.1|  cytochrome b6                                      428   6e-145   
gb|AFU95993.1|  PetB                                                    427   6e-145   
gb|AGE93227.1|  cytochrome b6                                           427   6e-145   
ref|YP_740232.1|  cytochrome b6                                         427   6e-145   Liriodendron tulipifera
ref|YP_008082611.1|  cytochrome b6                                      427   6e-145   
ref|YP_007475734.1|  cytochrome b6                                      427   7e-145   
gb|AEJ10372.1|  cytochrome b6                                           427   7e-145   
ref|YP_009026467.1|  cytochrome b6                                      427   7e-145   
gb|AHI87558.1|  cytochrome b6                                           427   8e-145   
ref|YP_005089606.1|  petB gene product                                  427   8e-145   
gb|AAZ04012.1|  cytochrome b6                                           427   8e-145   Ranunculus macranthus
ref|YP_001837390.1|  cytochrome b6                                      427   8e-145   Guizotia abyssinica [niger]
gb|ADN86073.1|  cytochrome b6                                           427   8e-145   
gb|AFM54180.1|  PetB                                                    427   9e-145   
ref|YP_009051591.1|  cytochrome b6                                      427   9e-145   
gb|AFU95975.1|  PetB                                                    427   9e-145   
ref|YP_003434005.1|  cytochrome b6                                      427   9e-145   Typha latifolia [common cattail]
gb|AHF21105.1|  cytochrome b6                                           427   9e-145   
ref|YP_009000126.1|  cytochrome b6 (chloroplast)                        427   9e-145   
ref|YP_009059549.1|  cytochrome b6                                      427   9e-145   
gb|AFK41288.1|  unknown                                                 427   1e-144   
gb|AEJ10375.1|  cytochrome b6                                           427   1e-144   
ref|YP_008592518.1|  cytochrome b6                                      427   1e-144   
gb|AEJ10398.1|  cytochrome b6                                           427   1e-144   
ref|YP_009027302.1|  cytochrome b6                                      427   1e-144   
gb|AFU95999.1|  PetB                                                    427   1e-144   
ref|YP_009109161.1|  cytochrome b6                                      427   1e-144   
ref|NP_084827.1|  cytochrome b6                                         427   1e-144   Lotus japonicus
ref|YP_001718657.1|  cytochrome b6                                      427   1e-144   Trachelium caeruleum
gb|AFK38093.1|  unknown                                                 427   1e-144   
ref|YP_007474826.1|  cytochrome b6                                      427   1e-144   
gb|AEJ10392.1|  cytochrome b6                                           427   1e-144   
ref|YP_009111605.1|  cytochrome b6                                      427   1e-144   
ref|YP_009040996.1|  PetB                                               427   1e-144   
ref|YP_001294214.1|  cytochrome b6                                      427   1e-144   Buxus microphylla
ref|YP_004021755.1|  cytochrome b6                                      427   1e-144   
ref|YP_008145373.1|  cytochrome b6                                      427   1e-144   
gb|AGQ55704.2|  cytochrome f                                            427   1e-144   
ref|YP_009053962.1|  cytochrome b6                                      427   1e-144   
gb|AFU95991.1|  PetB                                                    427   1e-144   
ref|XP_006290032.1|  hypothetical protein CARUB_v10003666mg             426   1e-144   
ref|YP_009111511.1|  cytochrome b6                                      427   1e-144   
ref|YP_006503821.1|  cytochrome b6                                      427   2e-144   
ref|YP_086995.1|  cytochrome b6                                         427   2e-144   Panax ginseng [Chinese ginseng]
gb|AFU96014.1|  PetB                                                    426   2e-144   
gb|AHH24303.1|  cytochrome b6/f complex subunit                         426   2e-144   
ref|YP_008081914.1|  cytochrome b6                                      426   2e-144   
ref|YP_005089444.1|  petB gene product                                  426   2e-144   
gb|AFU95989.1|  PetB                                                    426   2e-144   
ref|YP_319793.1|  cytochrome b6                                         426   2e-144   Acorus calamus [flagroot]
ref|YP_003359388.1|  cytochrome b6                                      426   2e-144   
ref|YP_009002285.1|  cytochrome b6                                      426   2e-144   
ref|YP_005087723.1|  cytochrome b6                                      426   2e-144   
ref|YP_002364527.1|  cytochrome b6                                      426   2e-144   
ref|YP_007475553.1|  PetB                                               426   2e-144   
ref|YP_008963509.1|  cytochrome b6                                      426   2e-144   
gb|AAO74062.1|  ORF233                                                  427   2e-144   
ref|YP_784113.1|  cytochrome b6/f complex subunit II                    426   2e-144   
ref|YP_008145821.1|  cytochrome b6                                      426   2e-144   
ref|NP_039329.1|  cytochrome b6                                         426   2e-144   
ref|YP_740680.1|  cytochrome b6                                         426   2e-144   
ref|YP_567107.1|  cytochrome b6                                         426   3e-144   
gb|ADD31086.1|  cytochrome b6 protein                                   426   3e-144   
ref|YP_007474400.1|  cytochrome b6                                      426   3e-144   
ref|YP_009024822.1|  cytochrome b6                                      426   3e-144   
ref|YP_007475905.1|  cytochrome b6                                      426   3e-144   
ref|YP_001542558.1|  cytochrome b6                                      426   3e-144   
ref|YP_008081836.1|  cytochrome b6                                      426   3e-144   
ref|YP_002456455.1|  cytochrome b6                                      426   3e-144   
ref|YP_006503719.1|  cytochrome b6                                      426   3e-144   
gb|ADD31085.1|  cytochrome b6 protein                                   426   3e-144   
ref|YP_005088837.1|  cytochrome b6                                      426   3e-144   
gb|AEX37321.1|  cytochrome b6                                           426   3e-144   
ref|NP_904171.1|  cytochrome b6                                         426   4e-144   
gb|AFU96001.1|  PetB                                                    426   4e-144   
ref|YP_004769976.1|  cytochrome b6                                      426   4e-144   
gb|AFS64471.1|  cytochrome b6                                           426   4e-144   
ref|YP_004465217.1|  cytochrome b6                                      425   5e-144   
ref|YP_002149762.1|  cytochrome b6                                      425   5e-144   
ref|YP_009116372.1|  cytochrome b6                                      425   6e-144   
ref|YP_008081680.1|  cytochrome b6                                      425   6e-144   
ref|YP_009000204.1|  cytochrome b6 (chloroplast)                        425   6e-144   
gb|AEJ10379.1|  cytochrome b6                                           425   6e-144   
gb|AFR53236.1|  cytochrome b6                                           425   6e-144   
ref|YP_784416.1|  cytochrome b6                                         425   6e-144   
gb|AJE70966.1|  cytochrome b6                                           425   6e-144   
gb|AGQ55787.2|  cytochrome f                                            425   7e-144   
gb|AFR45470.1|  cytochrome b6                                           425   7e-144   
ref|YP_778519.1|  cytochrome b6                                         425   7e-144   
ref|YP_398358.1|  cytochrome b6                                         425   7e-144   
sp|Q71KN3.1|CYB6_KLEBI  RecName: Full=Cytochrome b6                     425   7e-144   
gb|ABU85640.1|  cytochrome b6                                           425   8e-144   
ref|YP_009109027.1|  cytochrome b6                                      425   8e-144   
ref|YP_004021695.1|  cytochrome b6                                      425   9e-144   
ref|YP_009033811.1|  apocytochrome b6 of cytochrome b6/f complex        425   9e-144   
ref|YP_003587756.1|  cytochrome b6                                      425   9e-144   
gb|AFU95995.1|  PetB                                                    424   1e-143   
ref|YP_001294300.1|  cytochrome b6                                      424   1e-143   
ref|NP_569658.1|  cytochrome b6                                         424   1e-143   
ref|YP_009033593.1|  apocytochrome b6 of cytochrome b6/f complex ...    424   1e-143   
ref|YP_007353796.1|  cytochrome b6                                      424   1e-143   
ref|YP_009048604.1|  cytochrome b6                                      424   2e-143   
ref|NP_904128.1|  cytochrome b6                                         424   2e-143   
ref|YP_009048229.1|  cytochrome b6                                      424   2e-143   
ref|YP_008994103.1|  cytochrome b6                                      424   2e-143   
ref|YP_001542477.1|  cytochrome b6                                      424   2e-143   
gb|AFU95968.1|  PetB                                                    424   2e-143   
dbj|BAF64863.1|  cytochrome b6                                          424   2e-143   
ref|YP_635776.1|  cytochrome b6                                         424   2e-143   
gb|AAZ04010.1|  cytochrome b6                                           424   2e-143   
ref|YP_001312236.1|  cytochrome b6                                      424   2e-143   
gb|AFU95978.1|  PetB                                                    423   2e-143   
ref|YP_009092797.1|  cytochrome f                                       424   2e-143   
ref|YP_008082137.1|  cytochrome b6                                      423   3e-143   
ref|YP_004276324.1|  cytochrome b6                                      423   3e-143   
ref|YP_004891521.1|  cytochrome b6                                      423   3e-143   
dbj|BAK86708.1|  cytochrome b6                                          423   3e-143   
ref|YP_009092711.1|  cytochrome b6                                      423   4e-143   
ref|YP_003933877.1|  cytochrome b6/f complex subunit II                 423   4e-143   
gb|ADO33477.1|  cytochrome f                                            423   4e-143   
ref|YP_001876606.1|  cytochrome b6                                      423   4e-143   
gb|AJE71561.1|  cytochrome b6                                           423   4e-143   
gb|AAQ05906.1|AF482496_5  cytochrome b6                                 423   5e-143   
gb|AFU95967.1|  PetB                                                    423   5e-143   
ref|YP_001430134.1|  cytochrome b6                                      423   5e-143   
ref|YP_002586906.1|  cytochrome b6                                      423   5e-143   
ref|YP_007026168.1|  cytochrome b6                                      422   5e-143   
gb|AGW45931.1|  cytochrome b6/f complex subunit IV                      422   6e-143   
ref|YP_008965149.1|  cytochrome b6                                      422   6e-143   
ref|YP_008965231.1|  cytochrome b6                                      422   6e-143   
gb|AIN75572.1|  cytochrome b6                                           422   8e-143   
gb|AFU95994.1|  PetB                                                    422   9e-143   
ref|YP_009059770.1|  cytochrome b6                                      421   2e-142   
ref|YP_001806638.1|  cytochrome b6                                      421   2e-142   
ref|NP_777443.1|  cytochrome b6                                         421   2e-142   
gb|AET44614.1|  cytochrome b6                                           421   2e-142   
ref|YP_004376540.1|  cytochrome b6                                      421   2e-142   
ref|YP_009116161.1|  cytochrome b6                                      421   2e-142   
ref|NP_848089.2|  cytochrome b6                                         421   2e-142   
ref|YP_003934143.1|  cytochrome b6                                      421   2e-142   
gb|ABU85250.2|  cytochrome b6                                           421   2e-142   
ref|YP_209499.1|  cytochrome b6                                         421   2e-142   
ref|YP_008965060.1|  cytochrome b6                                      421   3e-142   
gb|AER45626.1|  petB                                                    421   3e-142   
ref|YP_002519983.1|  cytochrome b6                                      421   3e-142   
ref|YP_004891206.1|  cytochrome b6                                      420   4e-142   
ref|YP_003587495.1|  cytochrome b6                                      420   5e-142   
ref|YP_004891317.1|  cytochrome b6                                      420   6e-142   
gb|AHZ58092.1|  cytochrome b6                                           420   7e-142   
dbj|BAP47828.1|  cytochrome b6                                          419   9e-142   
ref|NP_817212.1|  cytochrome b6                                         419   1e-141   
gb|AER45627.1|  petB                                                    419   1e-141   
ref|YP_636562.1|  cytochrome b6                                         419   1e-141   
ref|YP_009109089.1|  cytochrome b6                                      419   2e-141   
ref|XP_009123576.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome b       428   2e-141   
dbj|BAN16910.1|  cytochrome b6                                          418   3e-141   
gb|AFU96005.1|  PetB                                                    418   3e-141   
gb|AIS38268.1|  cytochrome b6                                           418   3e-141   
sp|Q71KP4.1|CYB6_SPIMX  RecName: Full=Cytochrome b6                     418   4e-141   
gb|ACP51911.1|  cytochrome b6                                           418   4e-141   
ref|YP_002519755.1|  cytochrome b6                                      418   4e-141   
gb|AFU95998.1|  PetB                                                    417   5e-141   
ref|XP_001757311.1|  predicted protein                                  417   7e-141   
gb|ACH68569.1|  cytochrome b6/f cytb subunit                            417   8e-141   
ref|YP_001430068.1|  cytochrome b6                                      417   8e-141   
ref|NP_042433.1|  cytochrome b6                                         417   1e-140   
ref|NP_050814.1|  cytochrome b6                                         417   1e-140   
ref|YP_007374828.1|  cytochrome b6                                      417   1e-140   
gb|ACH68567.1|  cytochrome b6/f cytb subunit                            416   1e-140   
sp|Q9XQR2.3|CYB6_PEA  RecName: Full=Cytochrome b6                       416   2e-140   
gb|ACP52534.1|  cytochrome b6                                           416   3e-140   
ref|YP_001531243.1|  cytochrome b6                                      416   3e-140   
gb|ACH68566.1|  cytochrome b6/f cytb subunit                            416   3e-140   
sp|Q71KQ6.1|CYB6_COLOB  RecName: Full=Cytochrome b6                     416   3e-140   
gb|ACP50787.1|  cytochrome b6                                           415   5e-140   
ref|YP_003934457.1|  cytochrome b6                                      415   6e-140   
ref|YP_002519568.1|  cytochrome b6                                      415   7e-140   
ref|YP_008474504.1|  cytochrome b6                                      415   7e-140   
gb|AET45541.1|  cytochrome b6                                           415   7e-140   
ref|YP_008082355.1|  cytochrome b6                                      414   8e-140   
gb|AEJ10386.1|  cytochrome b6                                           414   9e-140   
gb|ADD31084.1|  cytochrome b6 protein                                   414   1e-139   
ref|YP_008474593.1|  cytochrome b6                                      414   2e-139   
ref|YP_009105853.1|  apocytochrome b6 of cytochrome b6/f complex        414   2e-139   
ref|YP_002905164.1|  cytochrome b6                                      414   2e-139   
ref|NP_043175.1|  cytochrome b6                                         414   2e-139   
ref|YP_002600887.1|  apocytochrome b6 of cytochrome b6/f complex        413   2e-139   
gb|AET46542.1|  cytochrome b6                                           413   3e-139   
ref|YP_009033719.1|  apocytochrome b6 of cytochrome b6/f complex ...    413   3e-139   
gb|AET47189.1|  cytochrome b6                                           413   4e-139   
ref|YP_004891438.1|  cytochrome b6                                      412   5e-139   
ref|YP_009106558.1|  apocytochrome b6 of cytochrome b6/f complex        412   6e-139   
gb|AAQ05931.1|AF482501_5  cytochrome b6                                 412   6e-139   
ref|NP_683792.1|  cytochrome b6                                         412   7e-139   
gb|AET47046.1|  cytochrome b6                                           412   9e-139   
ref|YP_009057768.1|  apocytochrome b6 of cytochrome b6/f complex        412   1e-138   
gb|AFU96011.1|  PetB                                                    411   1e-138   
gb|ACH68568.1|  cytochrome b6/f cytb subunit                            411   2e-138   
ref|YP_009105693.1|  apocytochrome b6 of cytochrome b6/f complex        411   2e-138   
ref|YP_004021224.1|  cytochrome b6                                      411   2e-138   
gb|ACH68565.1|  cytochrome b6/f cytb subunit                            410   2e-138   
gb|AFU95987.1|  PetB                                                    410   2e-138   
ref|YP_009105347.1|  apocytochrome b6 of cytochrome b6/f complex        410   3e-138   
ref|YP_005089778.1|  petB gene product                                  410   3e-138   
gb|AFU96010.1|  PetB                                                    410   4e-138   
ref|YP_009106385.1|  apocytochrome b6 of cytochrome b6/f complex        410   4e-138   
gb|AIT94571.1|  apocytochrome b6 of cytochrome b6/f complex             410   6e-138   
ref|YP_009105574.1|  apocytochrome b6 of cytochrome b6/f complex        410   7e-138   
gb|ACQ90762.1|  apocytochrome b6 of cytochrome b6/f complex             410   7e-138   
ref|YP_002905102.1|  cytochrome b6                                      409   1e-137   
ref|YP_636431.1|  cytochrome b6                                         409   2e-137   
ref|YP_009106820.1|  apocytochrome b6 of cytochrome b6/f complex        409   2e-137   
ref|YP_009106168.1|  apocytochrome b6 of cytochrome b6/f complex        409   2e-137   
gb|ABU88295.1|  cytochrome b6/f complex apocytochrome b6                408   2e-137   
ref|YP_001019078.1|  apocytochrome b6 of cytochrome b6/f complex        408   2e-137   
ref|YP_009105020.1|  apocytochrome b6 of cytochrome b6/f complex        408   2e-137   
ref|YP_004222053.1|  cytochrome b6                                      408   3e-137   
ref|YP_635992.1|  cytochrome b6                                         408   4e-137   
ref|YP_002808654.1|  cytochrome b6                                      407   5e-137   
ref|YP_009105105.1|  apocytochrome b6 of cytochrome b6/f complex        407   5e-137   
ref|YP_009105183.1|  apocytochrome b6 of cytochrome b6/f complex        407   6e-137   
gb|AEZ03784.1|  hypothetical protein                                    407   6e-137   
ref|YP_006666442.1|  cytochrome b6                                      407   7e-137   
gb|AFU96007.1|  PetB                                                    407   7e-137   
ref|YP_004891719.1|  cytochrome b6                                      407   7e-137   
ref|YP_008144798.1|  cytochrome b6                                      407   9e-137   
ref|YP_009104977.1|  apocytochrome b6 of cytochrome b6/f complex        406   1e-136   
ref|YP_717215.1|  PetB                                                  406   2e-136   
ref|YP_009106267.1|  apocytochrome b6 of cytochrome b6/f complex        406   2e-136   
ref|YP_007627338.1|  cytochrome b6                                      406   2e-136   
ref|YP_009104881.1|  apocytochrome b6 of cytochrome b6/f complex        406   2e-136   
gb|AEZ03760.1|  hypothetical protein                                    406   2e-136   
ref|YP_009106700.1|  apocytochrome b6 of cytochrome b6/f complex        405   3e-136   
emb|CDI27967.1|  cytochrome b6                                          405   3e-136   
ref|YP_005089862.1|  petB gene product                                  405   3e-136   
gb|AIT93482.1|  apocytochrome b6 of cytochrome b6/f complex             405   4e-136   
ref|YP_007890135.1|  apocytochrome b6 of cytochrome b6/f complex        405   4e-136   
gb|AAD41888.1|AF153442_5  cytochrome b6 apoprotein                      405   5e-136   
ref|YP_009105935.1|  apocytochrome b6 of cytochrome b6/f complex        405   5e-136   
gb|ACI31243.1|  cytochrome b6                                           404   7e-136   
ref|YP_009105262.1|  apocytochrome b6 of cytochrome b6/f complex        404   1e-135   
ref|YP_009105439.1|  apocytochrome b6 of cytochrome b6/f complex        404   1e-135   
gb|AET45469.1|  cytochrome b6                                           404   1e-135   
ref|YP_009057843.1|  apocytochrome b6 of cytochrome b6/f complex        404   1e-135   
ref|YP_007507283.1|  cytochrome b6                                      404   2e-135   
ref|NP_045838.1|  cytochrome b6                                         403   2e-135   
ref|YP_009105810.1|  apocytochrome b6 of cytochrome b6/f complex        403   2e-135   
ref|YP_009106185.1|  apocytochrome b6 of cytochrome b6/f complex        403   3e-135   
gb|AJE61752.1|  cytochrome b6                                           403   3e-135   
ref|YP_003058292.1|  cytochrome b6                                      403   3e-135   
ref|YP_006234182.1|  cytochrom b6                                       403   3e-135   
ref|YP_009056905.1|  Cytochrome b6                                      402   4e-135   
ref|YP_063557.1|  cytochrome b6                                         402   4e-135   
ref|YP_004347776.1|  cytochrome b6                                      402   5e-135   
gb|AGZ19306.1|  cytochrome b6 (chloroplast)                             402   5e-135   
ref|NP_038357.1|  cytochrome b6                                         402   5e-135   
ref|WP_010471635.1|  MULTISPECIES: cytochrome B6                        402   5e-135   
ref|YP_764425.1|  apocytochrome b6 of cytochrome b6/f complex           402   6e-135   
ref|WP_011056639.1|  MULTISPECIES: cytochrome B6                        402   6e-135   
ref|YP_009051027.1|  cytochrome b6                                      402   6e-135   
gb|ABX82611.1|  apocytochrome b6 of cytochrome b6/f complex             402   7e-135   
ref|YP_009019565.1|  cytochrome b6                                      402   7e-135   
ref|YP_009106595.1|  apocytochrome b6 of cytochrome b6/f complex        402   7e-135   
ref|YP_004581331.1|  petB gene product                                  402   9e-135   
ref|YP_009020851.1|  cytochrome b6                                      401   1e-134   
ref|YP_007878180.1|  cytochrome b6                                      401   1e-134   
ref|NP_958365.1|  cytochrome b6                                         401   1e-134   
ref|YP_009105644.1|  apocytochrome b6 of cytochrome b6/f complex        401   2e-134   
gb|AID67766.1|  apocytochrome b6 of cytochrome b6/f complex             401   2e-134   
gb|AEW12962.2|  cytochrome b6                                           400   2e-134   
ref|YP_007317185.1|  cytochrome b6                                      400   2e-134   



>emb|CCQ71650.1| cytochrome b6 (chloroplast) [Salvia miltiorrhiza]
Length=231

 Score =   446 bits (1146),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 220/230 (96%), Positives = 222/230 (97%), Gaps = 0/230 (0%)
 Frame = -1

Query  1127  DESLIYGSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFL  948
              ES IYGS+ G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFL
Sbjct  2     SESFIYGSKGGIFTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFL  61

Query  947   VQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVY  768
             VQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVY
Sbjct  62    VQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVY  121

Query  767   LTGGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPL  588
             LTGGFKKPRELTWVTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPL
Sbjct  122   LTGGFKKPRELTWVTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPL  181

Query  587   VELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             VELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  182   VELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  231



>ref|YP_007025921.1| cytochrome b6 [Vaccinium macrocarpon]
 gb|AEY84165.1| cytochrome b6 (chloroplast) [Vaccinium macrocarpon]
 gb|AFI44075.1| cytochrome b6 [Vaccinium macrocarpon]
Length=226

 Score =   446 bits (1146),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = -1

Query  1115  IYGSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVA  936
             +YGS+RG+ TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVA
Sbjct  1     MYGSRRGSLTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVA  60

Query  935   TGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  756
             TGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG
Sbjct  61    TGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  120

Query  755   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL  576
             FKKPRELTWVTGVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP IGSPLVELL
Sbjct  121   FKKPRELTWVTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPGIGSPLVELL  180

Query  575   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  226



>ref|YP_009040830.1| cytochrome b6 (chloroplast) (chloroplast) [Centaurea diffusa]
 gb|AIB03785.1| cytochrome b6 (chloroplast) (chloroplast) [Centaurea diffusa]
Length=226

 Score =   444 bits (1143),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 217/226 (96%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = -1

Query  1115  IYGSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVA  936
             +YGS+RG+ TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVA
Sbjct  1     MYGSRRGDRTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVA  60

Query  935   TGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  756
             TGFAMTFYYRPTVT+AFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG
Sbjct  61    TGFAMTFYYRPTVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  120

Query  755   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL  576
             FKKPRELTWVTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELL
Sbjct  121   FKKPRELTWVTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELL  180

Query  575   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  226



>gb|AHF71486.1| cytochrome b6 (chloroplast) [Acer buergerianum subsp. ningpoense]
Length=220

 Score =   441 bits (1135),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 215/217 (99%), Positives = 217/217 (100%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  4     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  63

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLM+ILHVFRVYLTGGFKKPRELTW
Sbjct  64    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMIILHVFRVYLTGGFKKPRELTW  123

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  124   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  183

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  184   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  220



>ref|YP_008757470.1| cytochrome b6 (chloroplast) [Oryza rufipogon]
 gb|AAA85375.1| apocytochrome b6 (alt.) [Oryza sativa]
 gb|AGY48976.1| cytochrome b6 (chloroplast) [Oryza rufipogon]
 gb|AGZ19244.1| cytochrome b6 (chloroplast) [Oryza rufipogon]
 prf||1604469A cytochrome b6
Length=232

 Score =   441 bits (1134),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 216/226 (96%), Positives = 220/226 (97%), Gaps = 0/226 (0%)
 Frame = -1

Query  1115  IYGSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVA  936
             + G   G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVA
Sbjct  7     VLGGGFGLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVA  66

Query  935   TGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  756
             TGFAMTFYYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG
Sbjct  67    TGFAMTFYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  126

Query  755   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL  576
             FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELL
Sbjct  127   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELL  186

Query  575   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  187   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  232



>ref|YP_008520169.1| cytochrome b6 (chloroplast) [Camellia taliensis]
 ref|YP_008592787.1| cytochrome b6 (chloroplast) [Camellia cuspidata]
 ref|YP_008592873.1| cytochrome b6 (chloroplast) [Camellia danzaiensis]
 ref|YP_008592963.1| cytochrome b6 (chloroplast) [Camellia impressinervis]
 ref|YP_008593141.1| cytochrome b6 (chloroplast) [Camellia yunnanensis]
 ref|YP_008593052.1| cytochrome b6 (chloroplast) [Camellia pitardii]
 ref|YP_009047962.1| cytochrome b6 (chloroplast) [Camellia crapnelliana]
 gb|AGU44235.1| cytochrome b6 (chloroplast) [Camellia cuspidata]
 gb|AGU44324.1| cytochrome b6 (chloroplast) [Camellia danzaiensis]
 gb|AGU44411.1| cytochrome b6 (chloroplast) [Camellia impressinervis]
 gb|AGU44500.1| cytochrome b6 (chloroplast) [Camellia taliensis]
 gb|AGU44589.1| cytochrome b6 (chloroplast) [Camellia pitardii]
 gb|AGU44678.1| cytochrome b6 (chloroplast) [Camellia yunnanensis]
 gb|AGU44767.1| cytochrome b6 (chloroplast) [Camellia taliensis]
 gb|AHF71576.1| cytochrome b6 (chloroplast) [Camellia crapnelliana]
Length=220

 Score =   440 bits (1131),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 215/217 (99%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  4     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  63

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  64    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  123

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  124   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  183

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  184   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  220



>ref|YP_874682.1| cytochrome b6 [Hordeum vulgare subsp. vulgare]
 gb|ABK79441.1| cytochrome b6 [Hordeum vulgare subsp. vulgare]
Length=234

 Score =   440 bits (1132),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 215/221 (97%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -1

Query  1100  RGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAM  921
             RG  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAM
Sbjct  14    RGLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAM  73

Query  920   TFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPR  741
             TFYYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPR
Sbjct  74    TFYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPR  133

Query  740   ELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSAS  561
             ELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSAS
Sbjct  134   ELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSAS  193

Query  560   VGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             VGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  194   VGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  234



>emb|CAA32267.1| petB [Hordeum vulgare subsp. vulgare]
 gb|AGP50784.1| cytochrome b6 (chloroplast) [Hordeum vulgare subsp. vulgare]
 gb|AGP50860.1| cytochrome b6 (chloroplast) [Hordeum vulgare subsp. spontaneum]
 gb|AGP50939.1| cytochrome b6 (chloroplast) [Hordeum vulgare subsp. spontaneum]
Length=232

 Score =   440 bits (1131),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 215/221 (97%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -1

Query  1100  RGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAM  921
             RG  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAM
Sbjct  12    RGLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAM  71

Query  920   TFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPR  741
             TFYYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPR
Sbjct  72    TFYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPR  131

Query  740   ELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSAS  561
             ELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSAS
Sbjct  132   ELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSAS  191

Query  560   VGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             VGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  192   VGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  232



>ref|YP_009000363.1| petB protein (chloroplast) [Arabis alpina]
 emb|CCW28210.1| petB protein (chloroplast) [Arabis alpina]
Length=232

 Score =   440 bits (1131),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  16    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  75

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  76    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  135

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQS
Sbjct  136   VTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQS  195

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  196   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  232



>ref|NP_043053.1| cytochrome b6 [Zea mays]
 ref|YP_024406.1| cytochrome b6 [Saccharum hybrid cultivar SP-80-3280]
 ref|YP_899437.1| cytochrome b6 [Sorghum bicolor]
 emb|CAA60315.1| cytochrome B6 [Zea mays]
 gb|AAT44721.1| cytochrome b6 [Saccharum hybrid cultivar SP80-3280]
 gb|ABK79525.1| cytochrome b6 [Sorghum bicolor]
 gb|AGV02684.1| cytochrome b6 (chloroplast) (chloroplast) [Zea mays subsp. mays]
 gb|AGV02768.1| cytochrome b6 (chloroplast) (chloroplast) [Zea mays subsp. mays]
Length=234

 Score =   440 bits (1131),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 216/226 (96%), Positives = 219/226 (97%), Gaps = 0/226 (0%)
 Frame = -1

Query  1115  IYGSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVA  936
             + G   G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVA
Sbjct  9     VLGGGVGLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVA  68

Query  935   TGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  756
             TGFAMTFYYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG
Sbjct  69    TGFAMTFYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  128

Query  755   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL  576
             FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL
Sbjct  129   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL  188

Query  575   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  189   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  234



>ref|YP_003097604.1| cytochrome b6 [Dendrocalamus latiflorus]
 gb|ACT99948.1| cytochrome b6 [Dendrocalamus latiflorus]
Length=232

 Score =   439 bits (1130),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 216/226 (96%), Positives = 219/226 (97%), Gaps = 0/226 (0%)
 Frame = -1

Query  1115  IYGSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVA  936
             + G   G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVA
Sbjct  7     VLGGGLGLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVA  66

Query  935   TGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  756
             TGFAMTFYYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG
Sbjct  67    TGFAMTFYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  126

Query  755   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL  576
             FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL
Sbjct  127   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL  186

Query  575   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  187   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  232



>ref|XP_010089870.1| Cytochrome b6 [Morus notabilis]
 gb|EXB38500.1| Cytochrome b6 [Morus notabilis]
Length=234

 Score =   439 bits (1130),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNK+YDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  18    TYLNKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  77

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  78    RPTVTEAFASVQYIMTETNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  137

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  138   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  197

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  198   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  234



>ref|YP_009020167.1| cytochrome b6 (chloroplast) [Sorghum timorense]
 ref|XP_002457870.1| hypothetical protein SORBIDRAFT_03g017580 [Sorghum bicolor]
 emb|CAA29000.1| unnamed protein product [Zea mays]
 gb|EES02990.1| hypothetical protein SORBIDRAFT_03g017580 [Sorghum bicolor]
 gb|AFW68359.1| cytochrome b6 [Zea mays]
 gb|AHL16854.1| cytochrome b6 (chloroplast) [Sorghum timorense]
Length=232

 Score =   439 bits (1130),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 216/226 (96%), Positives = 219/226 (97%), Gaps = 0/226 (0%)
 Frame = -1

Query  1115  IYGSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVA  936
             + G   G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVA
Sbjct  7     VLGGGVGLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVA  66

Query  935   TGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  756
             TGFAMTFYYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG
Sbjct  67    TGFAMTFYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  126

Query  755   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL  576
             FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL
Sbjct  127   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL  186

Query  575   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  187   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  232



>ref|YP_007475169.1| cytochrome b6 (chloroplast) [Arundinaria gigantea]
 ref|YP_009024284.1| cytochrome b6 (chloroplast) [Arundinaria appalachiana]
 gb|AGC38191.1| cytochrome b6 (chloroplast) [Arundinaria gigantea]
 gb|AGN72249.1| cytochrome b6 (chloroplast) [Arundinaria appalachiana]
Length=234

 Score =   439 bits (1130),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 216/233 (93%), Positives = 221/233 (95%), Gaps = 0/233 (0%)
 Frame = -1

Query  1136  AVRDESLIYGSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLT  957
             +V+    + G   G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLT
Sbjct  2     SVKFSYTVLGGGLGLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLT  61

Query  956   CFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVF  777
             CFLVQVATGFAMTFYYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVF
Sbjct  62    CFLVQVATGFAMTFYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVF  121

Query  776   RVYLTGGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIG  597
             RVYLTGGFKKPRELTWVTGVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIG
Sbjct  122   RVYLTGGFKKPRELTWVTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIG  181

Query  596   SPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             SPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  182   SPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  234



>gb|AEX65244.1| cytochrome b6, partial (chloroplast) [Didierea madagascariensis]
Length=215

 Score =   438 bits (1127),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 214/215 (99%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_005090208.1| petB gene product (chloroplast) [Ricinus communis]
 gb|AEJ82586.1| cytochrome b6 [Ricinus communis]
Length=228

 Score =   439 bits (1128),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 215/217 (99%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  12    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  71

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  72    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  131

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  132   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  191

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  192   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  228



>ref|YP_008994491.1| cytochrome b6 (chloroplast) (chloroplast) [Hypseocharis bilobata]
 gb|AGV02919.1| cytochrome b6 (chloroplast) [Hypseocharis bilobata]
Length=220

 Score =   438 bits (1127),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDI+SKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  4     TYLNKVYDWFEERLEIQAIADDISSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  63

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  64    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  123

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  124   VTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  183

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  184   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  220



>ref|YP_008815780.1| cytochrome b6 [Setaria italica]
 gb|AGZ13174.1| cytochrome b6 [Setaria italica]
Length=234

 Score =   439 bits (1128),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 215/226 (95%), Positives = 219/226 (97%), Gaps = 0/226 (0%)
 Frame = -1

Query  1115  IYGSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVA  936
             + G   G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVA
Sbjct  9     VLGGGIGLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVA  68

Query  935   TGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  756
             TGFAMTFYYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG
Sbjct  69    TGFAMTFYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGG  128

Query  755   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELL  576
             FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELL
Sbjct  129   FKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELL  188

Query  575   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  189   RGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  234



>ref|YP_008992839.1| cytochrome b6 (chloroplast) [Gossypium stocksii]
 gb|ADZ74678.1| cytochrome b6 [Gossypium stocksii]
Length=234

 Score =   438 bits (1126),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 215/217 (99%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  18    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  77

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  78    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  137

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  138   VTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  197

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  198   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  234



>ref|YP_008993550.1| cytochrome b6 (chloroplast) [Magnolia liliifera]
Length=219

 Score =   437 bits (1124),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 214/218 (98%), Positives = 216/218 (99%), Gaps = 0/218 (0%)
 Frame = -1

Query  1091  STYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFY  912
             STYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFY
Sbjct  2     STYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFY  61

Query  911   YRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELT  732
             YRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELT
Sbjct  62    YRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELT  121

Query  731   WVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQ  552
             WVTGV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQ
Sbjct  122   WVTGVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQ  181

Query  551   STLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             STLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  182   STLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  219



>ref|YP_009040435.1| cytochrome b6 (chloroplast) (chloroplast) [Neyraudia reynaudiana]
 gb|AGW46769.1| cytochrome b6 (chloroplast) (chloroplast) [Neyraudia reynaudiana]
Length=217

 Score =   437 bits (1124),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 213/215 (99%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  217



>ref|YP_740506.1| cytochrome b6 [Citrus sinensis]
 ref|YP_009059379.1| cytochrome b6 (chloroplast) [Citrus aurantiifolia]
 gb|ABI49049.1| cytochrome b6 [Citrus sinensis]
 gb|AIL50316.1| cytochrome b6 (chloroplast) [Citrus aurantiifolia]
Length=234

 Score =   438 bits (1126),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  18    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  77

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTE NFGWLIRSVHRWSASMMVLM ILHVFRVYLTGGFKKPRELTW
Sbjct  78    RPTVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMTILHVFRVYLTGGFKKPRELTW  137

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  138   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  197

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  198   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  234



>ref|YP_009048051.1| cytochrome b6 (chloroplast) [Nymphaea mexicana]
 gb|AHF71663.1| cytochrome b6 (chloroplast) [Nymphaea mexicana]
Length=220

 Score =   437 bits (1124),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+F+CLGGITLTCFLVQVATGFAMTFYY
Sbjct  4     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFHCLGGITLTCFLVQVATGFAMTFYY  63

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  64    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  123

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP++GSPLVELLRGSASVGQS
Sbjct  124   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIVGSPLVELLRGSASVGQS  183

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  184   TLTRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  220



>ref|YP_008239121.1| cytochrome b6 (chloroplast) (chloroplast) [Triticum monococcum]
 ref|YP_008239199.1| cytochrome b6 (chloroplast) (chloroplast) [Secale cereale]
 ref|YP_008239263.1| cytochrome b6 (chloroplast) (chloroplast) [Triticum urartu]
 ref|YP_008474328.1| cytochrome b6 (chloroplast) [Aegilops tauschii]
 ref|YP_008474420.1| cytochrome b6 (chloroplast) [Aegilops speltoides]
 ref|YP_008963933.1| cytochrome b6 (chloroplast) (chloroplast) [Aegilops geniculata]
 ref|YP_008963856.1| cytochrome b6 (chloroplast) (chloroplast) [Aegilops cylindrica]
 ref|YP_009054865.1| cytochrome b6 (chloroplast) [Triticum timopheevii]
 ref|YP_009057957.1| cytochrome b6 (chloroplast) [Aegilops longissima]
 ref|YP_009058039.1| cytochrome b6 (chloroplast) [Aegilops bicornis]
 ref|YP_009057428.1| cytochrome b6 (chloroplast) [Aegilops sharonensis]
 ref|YP_009057346.1| cytochrome b6 (chloroplast) [Aegilops searsii]
 ref|YP_009058121.1| cytochrome b6 (chloroplast) [Aegilops kotschyi]
 ref|YP_009057264.1| cytochrome b6 (chloroplast) [Triticum turgidum]
 gb|AFH89538.1| cytochrome b6 (chloroplast) [Aegilops tauschii]
 gb|AFN42402.1| cytochrome b6 (chloroplast) [Aegilops speltoides]
 gb|AGP51019.1| cytochrome b6 (chloroplast) [Triticum monococcum]
 gb|AGP51097.1| cytochrome b6 (chloroplast) [Secale cereale]
 gb|AGP51174.1| cytochrome b6 (chloroplast) [Triticum monococcum subsp. aegilopoides]
 gb|AGP51237.1| cytochrome b6 (chloroplast) [Triticum urartu]
 gb|AGP51312.1| cytochrome b6 (chloroplast) [Triticum aestivum]
 gb|AGY92886.1| cytochrome b6 (chloroplast) [Aegilops cylindrica]
 gb|AGY92963.1| cytochrome b6 (chloroplast) [Aegilops geniculata]
 gb|AIG90457.1| cytochrome b6 (chloroplast) [Triticum aestivum]
 gb|AIG90539.1| cytochrome b6 (chloroplast) [Triticum turgidum]
 gb|AIG90621.1| cytochrome b6 (chloroplast) [Triticum turgidum]
 gb|AIG90703.1| cytochrome b6 (chloroplast) [Triticum turgidum]
 gb|AIG90785.1| cytochrome b6 (chloroplast) [Triticum turgidum]
 gb|AIG90867.1| cytochrome b6 (chloroplast) [Triticum turgidum]
 gb|AIG90949.1| cytochrome b6 (chloroplast) [Triticum turgidum]
 gb|AIG91031.1| cytochrome b6 (chloroplast) [Triticum aestivum]
 gb|AIG91113.1| cytochrome b6 (chloroplast) [Aegilops speltoides var. ligustica]
 gb|AIG91195.1| cytochrome b6 (chloroplast) [Aegilops speltoides var. ligustica]
 gb|AIG91277.1| cytochrome b6 (chloroplast) [Aegilops speltoides var. speltoides]
 gb|AIG91359.1| cytochrome b6 (chloroplast) [Triticum timopheevii]
 gb|AIG91441.1| cytochrome b6 (chloroplast) [Triticum timopheevii]
 gb|AIG91523.1| cytochrome b6 (chloroplast) [Triticum timopheevii]
 gb|AIG91604.1| cytochrome b6 (chloroplast) [Triticum timopheevii]
 gb|AIG91687.1| cytochrome b6 (chloroplast) [Triticum urartu]
 gb|AIG91769.1| cytochrome b6 (chloroplast) [Aegilops tauschii]
 gb|AIG91851.1| cytochrome b6 (chloroplast) [Aegilops searsii]
 gb|AIG91933.1| cytochrome b6 (chloroplast) [Aegilops searsii]
 gb|AIG92015.1| cytochrome b6 (chloroplast) [Aegilops searsii]
 gb|AIG92097.1| cytochrome b6 (chloroplast) [Aegilops longissima]
 gb|AIG92179.1| cytochrome b6 (chloroplast) [Aegilops sharonensis]
 gb|AIG92261.1| cytochrome b6 (chloroplast) [Aegilops bicornis]
 gb|AIG92343.1| cytochrome b6 (chloroplast) [Aegilops sharonensis]
 gb|AIG92425.1| cytochrome b6 (chloroplast) [Aegilops kotschyi]
Length=232

 Score =   438 bits (1126),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 214/220 (97%), Positives = 217/220 (99%), Gaps = 0/220 (0%)
 Frame = -1

Query  1097  GNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMT  918
             G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMT
Sbjct  13    GLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMT  72

Query  917   FYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRE  738
             FYYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRE
Sbjct  73    FYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRE  132

Query  737   LTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASV  558
             LTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASV
Sbjct  133   LTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASV  192

Query  557   GQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             GQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  193   GQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  232



>ref|YP_008758218.1| cytochrome b6 (chloroplast) [Veratrum patulum]
Length=217

 Score =   437 bits (1123),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  217



>ref|YP_002000515.1| cytochrome b6 (chloroplast) [Brachypodium distachyon]
 gb|ACF08667.1| cytochrome b6 (chloroplast) [Brachypodium distachyon]
Length=232

 Score =   437 bits (1124),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  16    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  75

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  76    RPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  135

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQS
Sbjct  136   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQS  195

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  196   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  232



>gb|AEJ10366.1| cytochrome b6 [Cyperus alternifolius]
Length=215

 Score =   436 bits (1121),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPLIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_004286034.1| cytochrome b6 [Gossypium thurberi]
 ref|YP_008992494.1| cytochrome b6 (chloroplast) [Gossypium anomalum]
 ref|YP_008992580.1| cytochrome b6 (chloroplast) [Gossypium bickii]
 ref|YP_008992925.1| cytochrome b6 (chloroplast) [Gossypium sturtianum]
 gb|ADD62318.1| cytochrome b6 [Gossypium thurberi]
 gb|ADZ74362.1| cytochrome b6 [Gossypium anomalum]
 gb|ADZ74450.1| cytochrome b6 [Gossypium bickii]
 gb|ADZ74765.1| cytochrome b6 [Gossypium sturtianum]
Length=234

 Score =   436 bits (1122),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  18    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  77

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  78    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  137

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  138   VTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  197

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  198   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  234



>gb|AIQ79230.1| cytochrome b6 [Chaetobromus involucratus subsp. dregeanus]
Length=217

 Score =   436 bits (1120),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  217



>ref|YP_636329.1| cytochrome b6 (chloroplast) [Eucalyptus globulus subsp. globulus]
 ref|YP_001671713.1| cytochrome b6 [Carica papaya]
 ref|YP_003933990.1| cytochrome b6 [Eucalyptus grandis]
 ref|YP_008575143.1| cytochrome b6 (chloroplast) [Eucalyptus obliqua]
 ref|YP_008575228.1| cytochrome b6 (chloroplast) [Eucalyptus radiata]
 ref|YP_008575313.1| cytochrome b6 (chloroplast) [Eucalyptus delegatensis]
 ref|YP_008575398.1| cytochrome b6 (chloroplast) [Eucalyptus verrucata]
 ref|YP_008575483.1| cytochrome b6 (chloroplast) [Eucalyptus baxteri]
 ref|YP_008575568.1| cytochrome b6 (chloroplast) [Eucalyptus diversifolia]
 ref|YP_008575653.1| cytochrome b6 (chloroplast) [Eucalyptus sieberi]
 ref|YP_008575738.1| cytochrome b6 (chloroplast) [Eucalyptus elata]
 ref|YP_008575823.1| cytochrome b6 (chloroplast) [Eucalyptus regnans]
 ref|YP_008575908.1| cytochrome b6 (chloroplast) [Eucalyptus umbra]
 ref|YP_008575993.1| cytochrome b6 (chloroplast) [Eucalyptus cloeziana]
 ref|YP_008576078.1| cytochrome b6 (chloroplast) [Eucalyptus patens]
 ref|YP_008576163.1| cytochrome b6 (chloroplast) [Eucalyptus marginata]
 ref|YP_008576248.1| cytochrome b6 (chloroplast) [Eucalyptus curtisii]
 ref|YP_008576333.1| cytochrome b6 (chloroplast) [Eucalyptus melliodora]
 ref|YP_008576418.1| cytochrome b6 (chloroplast) [Eucalyptus polybractea]
 ref|YP_008576503.1| cytochrome b6 (chloroplast) [Eucalyptus cladocalyx]
 ref|YP_008576588.1| cytochrome b6 (chloroplast) [Eucalyptus nitens]
 ref|YP_008576673.1| cytochrome b6 (chloroplast) [Eucalyptus aromaphloia]
 ref|YP_008576758.1| cytochrome b6 (chloroplast) [Eucalyptus saligna]
 ref|YP_008576843.1| cytochrome b6 (chloroplast) [Eucalyptus camaldulensis]
 ref|YP_008576928.1| cytochrome b6 (chloroplast) [Eucalyptus deglupta]
 ref|YP_008577013.1| cytochrome b6 (chloroplast) [Eucalyptus spathulata]
 ref|YP_008577098.1| cytochrome b6 (chloroplast) [Eucalyptus torquata]
 ref|YP_008577183.1| cytochrome b6 (chloroplast) [Eucalyptus diversicolor]
 ref|YP_008577268.1| cytochrome b6 (chloroplast) [Eucalyptus salmonophloia]
 ref|YP_008577353.1| cytochrome b6 (chloroplast) [Eucalyptus microcorys]
 ref|YP_008577438.1| cytochrome b6 (chloroplast) [Eucalyptus guilfoylei]
 ref|YP_008577523.1| cytochrome b6 (chloroplast) [Eucalyptus erythrocorys]
 ref|YP_008577608.1| cytochrome b6 (chloroplast) [Corymbia gummifera]
 ref|YP_008577693.1| cytochrome b6 (chloroplast) [Corymbia maculata]
 ref|YP_008577863.1| cytochrome b6 (chloroplast) [Corymbia tessellaris]
 ref|YP_008577948.1| cytochrome b6 (chloroplast) [Angophora floribunda]
 ref|YP_008578033.1| cytochrome b6 (chloroplast) [Angophora costata]
 ref|YP_008578203.1| cytochrome b6 (chloroplast) [Stockwellia quadrifida]
 ref|YP_008578118.1| cytochrome b6 (chloroplast) [Allosyncarpia ternata]
 sp|Q49KW8.1|CYB6_EUCGG RecName: Full=Cytochrome b6 (chloroplast) [Eucalyptus globulus 
subsp. globulus]
 gb|AAX21057.1| cytochrome b6/f complex subunit IV (chloroplast) [Eucalyptus 
globulus subsp. globulus]
 gb|ABY86813.1| cytochrome b6 [Carica papaya]
 gb|ADD31089.1| cytochrome b6 protein (chloroplast) [Cornus florida]
 gb|ADD31096.1| cytochrome b6 protein (chloroplast) [Plumbago auriculata]
 gb|ADH94374.1| cytochrome b6/f complex [Syzygium cumini]
 gb|ADO23618.1| cytochrome b6 [Eucalyptus grandis]
 gb|AGC56382.1| cytochrome b6 (chloroplast) [Eucalyptus obliqua]
 gb|AGC56467.1| cytochrome b6 (chloroplast) [Eucalyptus radiata]
 gb|AGC56552.1| cytochrome b6 (chloroplast) [Eucalyptus delegatensis]
 gb|AGC56637.1| cytochrome b6 (chloroplast) [Eucalyptus verrucata]
 gb|AGC56722.1| cytochrome b6 (chloroplast) [Eucalyptus baxteri]
 gb|AGC56807.1| cytochrome b6 (chloroplast) [Eucalyptus diversifolia]
 gb|AGC56892.1| cytochrome b6 (chloroplast) [Eucalyptus sieberi]
 gb|AGC56977.1| cytochrome b6 (chloroplast) [Eucalyptus elata]
 gb|AGC57062.1| cytochrome b6 (chloroplast) [Eucalyptus regnans]
 gb|AGC57147.1| cytochrome b6 (chloroplast) [Eucalyptus umbra]
 gb|AGC57232.1| cytochrome b6 (chloroplast) [Eucalyptus cloeziana]
 gb|AGC57317.1| cytochrome b6 (chloroplast) [Eucalyptus patens]
 gb|AGC57402.1| cytochrome b6 (chloroplast) [Eucalyptus marginata]
 gb|AGC57487.1| cytochrome b6 (chloroplast) [Eucalyptus curtisii]
 gb|AGC57572.1| cytochrome b6 (chloroplast) [Eucalyptus melliodora]
 gb|AGC57657.1| cytochrome b6 (chloroplast) [Eucalyptus melliodora]
 gb|AGC57742.1| cytochrome b6 (chloroplast) [Eucalyptus polybractea]
 gb|AGC57827.1| cytochrome b6 (chloroplast) [Eucalyptus cladocalyx]
 gb|AGC57912.1| cytochrome b6 (chloroplast) [Eucalyptus globulus]
 gb|AGC57997.1| cytochrome b6 (chloroplast) [Eucalyptus nitens]
 gb|AGC58082.1| cytochrome b6 (chloroplast) [Eucalyptus aromaphloia]
 gb|AGC58167.1| cytochrome b6 (chloroplast) [Eucalyptus saligna]
 gb|AGC58252.1| cytochrome b6 (chloroplast) [Eucalyptus camaldulensis]
 gb|AGC58337.1| cytochrome b6 (chloroplast) [Eucalyptus deglupta]
 gb|AGC58422.1| cytochrome b6 (chloroplast) [Eucalyptus spathulata]
 gb|AGC58507.1| cytochrome b6 (chloroplast) [Eucalyptus torquata]
 gb|AGC58592.1| cytochrome b6 (chloroplast) [Eucalyptus diversicolor]
 gb|AGC58677.1| cytochrome b6 (chloroplast) [Eucalyptus salmonophloia]
 gb|AGC58762.1| cytochrome b6 (chloroplast) [Eucalyptus microcorys]
 gb|AGC58847.1| cytochrome b6 (chloroplast) [Eucalyptus guilfoylei]
 gb|AGC58932.1| cytochrome b6 (chloroplast) [Eucalyptus erythrocorys]
 gb|AGC59017.1| cytochrome b6 (chloroplast) [Corymbia gummifera]
 gb|AGC59102.1| cytochrome b6 (chloroplast) [Corymbia maculata]
 gb|AGC59272.1| cytochrome b6 (chloroplast) [Corymbia tessellaris]
 gb|AGC59357.1| cytochrome b6 (chloroplast) [Angophora floribunda]
 gb|AGC59442.1| cytochrome b6 (chloroplast) [Angophora costata]
 gb|AGC59527.1| cytochrome b6 (chloroplast) [Allosyncarpia ternata]
 gb|AGC59612.1| cytochrome b6 (chloroplast) [Stockwellia quadrifida]
Length=215

 Score =   435 bits (1119),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AEX65250.1| cytochrome b6, partial (chloroplast) [Portulaca oleracea]
Length=215

 Score =   435 bits (1119),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYS PWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSXPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|ADM92677.1| cytochrome b6 [Franklinia alatamaha]
Length=215

 Score =   435 bits (1119),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 213/215 (99%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AEJ10381.1| cytochrome b6 [Mayaca fluviatilis]
Length=214

 Score =   435 bits (1119),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 211/214 (99%), Positives = 214/214 (100%), Gaps = 0/214 (0%)
 Frame = -1

Query  1079  NKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPT  900
             NKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPT
Sbjct  1     NKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPT  60

Query  899   VTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTG  720
             VTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTG
Sbjct  61    VTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTG  120

Query  719   VVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLT  540
             V+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLT
Sbjct  121   VILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLT  180

Query  539   RFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             RFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   RFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  214



>emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [Staphylococcus 
aureus subsp. aureus]
Length=267

 Score =   437 bits (1124),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  51    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  110

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  111   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  170

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  171   VTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  230

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  231   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  267



>ref|YP_538966.1| cytochrome b6 [Gossypium hirsutum]
 ref|YP_005087819.1| cytochrome b6 (chloroplast) [Gossypium darwinii]
 gb|ABC73657.1| cytochrome b6 [Gossypium hirsutum]
 gb|ADV38876.1| cytochrome b6 (chloroplast) [Gossypium darwinii]
Length=235

 Score =   436 bits (1121),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  19    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  78

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  79    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  138

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  139   VTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  198

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  199   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  235



>ref|YP_004769658.1| cytochrome b6 (chloroplast) [Spirodela polyrhiza]
 gb|AEK94370.1| cytochrome b6 (chloroplast) [Spirodela polyrhiza]
Length=217

 Score =   435 bits (1119),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  217



>ref|YP_009073373.1| cytochrome b6 [Monachather paradoxus]
 gb|AIQ79983.1| cytochrome b6 [Monachather paradoxus]
Length=217

 Score =   435 bits (1119),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  217



>ref|YP_004841813.1| cytochrome b6 [Cucumis melo subsp. melo]
 gb|AEM76922.1| cytochrome b6 [Cucumis melo subsp. melo]
 gb|AHM88691.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM88750.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM88808.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM88923.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM88981.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89040.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89099.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89158.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89217.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89276.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89336.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89395.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89454.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89513.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89573.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89632.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89691.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89750.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89809.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89868.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89927.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM89986.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90045.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90104.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90163.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90222.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90281.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90340.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90399.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90458.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90517.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90576.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90635.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90694.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90753.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90812.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90871.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90930.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM90989.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM91048.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM91106.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM91166.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
 gb|AHM91281.1| cytochrome b6 (chloroplast) [Lagenaria siceraria]
Length=233

 Score =   436 bits (1120),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 218/228 (96%), Positives = 219/228 (96%), Gaps = 3/228 (1%)
 Frame = -1

Query  1112  YGSQRGNS---TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQ  942
             Y   RG S   TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQ
Sbjct  6     YTVLRGGSPWFTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQ  65

Query  941   VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT  762
             VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT
Sbjct  66    VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT  125

Query  761   GGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVE  582
             GGFKKPRELTWVTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVE
Sbjct  126   GGFKKPRELTWVTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVE  185

Query  581   LLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             LLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  186   LLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  233



>gb|ABI97446.1| cytochrome b6 [Cucumis sativus]
 gb|AHM91224.1| cytochrome b6, partial (chloroplast) [Lagenaria siceraria]
Length=231

 Score =   435 bits (1119),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 218/228 (96%), Positives = 219/228 (96%), Gaps = 3/228 (1%)
 Frame = -1

Query  1112  YGSQRGNS---TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQ  942
             Y   RG S   TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQ
Sbjct  4     YTVLRGGSPWFTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQ  63

Query  941   VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT  762
             VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT
Sbjct  64    VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT  123

Query  761   GGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVE  582
             GGFKKPRELTWVTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVE
Sbjct  124   GGFKKPRELTWVTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVE  183

Query  581   LLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             LLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  184   LLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  231



>gb|ADD31090.1| cytochrome b6 protein (chloroplast) [Euonymus americanus]
Length=215

 Score =   435 bits (1118),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+T
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWIT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AHG24566.1| cytochrome b6 [Erodium reichardii]
Length=220

 Score =   435 bits (1118),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  4     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  63

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  64    RPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  123

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQS
Sbjct  124   VTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQS  183

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFML+HFLMIRKQGISGPL
Sbjct  184   TLTRFYSLHTFVLPLLTAVFMLIHFLMIRKQGISGPL  220



>ref|YP_004286132.1| cytochrome b6 [Fragaria vesca subsp. vesca]
 ref|YP_006883293.1| cytochrome b6 (chloroplast) [Fragaria vesca subsp. bracteata]
 ref|YP_006883366.1| cytochrome b6 [Fragaria mandshurica]
 ref|YP_007025413.1| cytochrome b6 (chloroplast) [Fragaria chiloensis]
 ref|YP_009040237.1| cytochrome b6 [Fragaria iinumae]
 gb|ADY15381.1| cytochrome b6 [Fragaria vesca subsp. vesca]
 gb|AET62685.1| cytochrome b6 (chloroplast) [Fragaria chiloensis]
 gb|AFC17672.1| cytochrome b6 (chloroplast) [Fragaria vesca subsp. bracteata]
 gb|AFC17745.1| cytochrome b6 [Fragaria mandshurica]
 gb|AGN71740.1| cytochrome b6 [Fragaria vesca subsp. bracteata]
 gb|AGN71825.1| cytochrome b6 [Fragaria vesca subsp. bracteata]
 gb|AGN71910.1| cytochrome b6 [Fragaria vesca subsp. bracteata]
 gb|AGN72080.1| cytochrome b6 [Fragaria iinumae]
 gb|AGN72165.1| cytochrome b6 [Fragaria mandshurica]
Length=217

 Score =   435 bits (1118),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNK+YDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  217



>gb|ABU85419.1| cytochrome b6 [Musa acuminata]
Length=236

 Score =   436 bits (1120),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 215/224 (96%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -1

Query  1109  GSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATG  930
             GS     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATG
Sbjct  13    GSPLALVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATG  72

Query  929   FAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFK  750
             FAMTFYYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFK
Sbjct  73    FAMTFYYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFK  132

Query  749   KPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRG  570
             KPRELTWVTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRG
Sbjct  133   KPRELTWVTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRG  192

Query  569   SASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             SASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  193   SASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  236



>gb|AHG24641.1| cytochrome b6 [Erodium foetidum subsp. foetidum]
Length=220

 Score =   435 bits (1118),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 212/219 (97%), Positives = 216/219 (99%), Gaps = 0/219 (0%)
 Frame = -1

Query  1094  NSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTF  915
             + TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTF
Sbjct  2     DVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTF  61

Query  914   YYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPREL  735
             YYRPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPREL
Sbjct  62    YYRPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPREL  121

Query  734   TWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVG  555
             TWVTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVG
Sbjct  122   TWVTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVG  181

Query  554   QSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             QSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  182   QSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  220



>ref|YP_009054459.1| cytochrome b6 (chloroplast) [Populus euphratica]
 gb|AIJ19624.1| cytochrome b6 (chloroplast) [Populus euphratica]
Length=228

 Score =   435 bits (1118),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQ IADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  12    TYLNKVYDWFEERLEIQTIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  71

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  72    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  131

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  132   VTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  191

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  192   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  228



>ref|YP_004841978.1| cytochrome b6 [Panicum virgatum]
 ref|YP_008855120.1| cytochrome b6 (chloroplast) [Phragmites australis]
 ref|YP_008854455.1| cytochrome b6 [Musa textilis]
 ref|YP_009033999.1| cytochrome b6 [Cenchrus americanus]
 ref|YP_009034209.1| cytochrome b6 [Digitaria exilis]
 ref|YP_009029900.1| cytochrome b6 (chloroplast) [Lecomtella madagascariensis]
 ref|YP_009072618.1| cytochrome b6 [Aristida purpurea]
 ref|YP_009072703.1| cytochrome b6 [Centotheca lappacea]
 ref|YP_009072788.1| cytochrome b6 [Chionochloa macra]
 ref|YP_009072873.1| cytochrome b6 [Coleataenia prionitis]
 ref|YP_009073043.1| cytochrome b6 [Elytrophorus spicatus]
 ref|YP_009073126.1| cytochrome b6 [Eriachne stipacea]
 ref|YP_009073209.1| cytochrome b6 [Hakonechloa macra]
 ref|YP_009073456.1| cytochrome b6 [Thysanolaena latifolia]
 gb|ADV41885.1| cytochrome b6 (chloroplast) [Panicum virgatum]
 gb|ADV41970.1| cytochrome b6 (chloroplast) [Panicum virgatum]
 gb|AHA12544.1| cytochrome b6 [Musa textilis]
 gb|AHA12785.1| cytochrome b6 [Canna indica]
 gb|AHA82329.1| cytochrome b6 (chloroplast) [Phragmites australis]
 emb|CCO06459.1| cytochrome b6 (chloroplast) (chloroplast) [Lecomtella madagascariensis]
 gb|AHZ18245.1| cytochrome b6 [Cenchrus americanus]
 gb|AHZ60822.1| cytochrome b6 [Digitaria exilis]
 gb|AIQ79060.1| cytochrome b6 [Aristida purpurea]
 gb|AIQ79145.1| cytochrome b6 [Centotheca lappacea]
 gb|AIQ79315.1| cytochrome b6 [Chionochloa macra]
 gb|AIQ79400.1| cytochrome b6 [Coleataenia prionitis]
 gb|AIQ79570.1| cytochrome b6 [Elytrophorus spicatus]
 gb|AIQ79653.1| cytochrome b6 [Eriachne stipacea]
 gb|AIQ79736.1| cytochrome b6 [Hakonechloa macra]
 gb|AIQ79900.1| cytochrome b6 [Micraira sp. JLC-2014]
 gb|AIQ80066.1| cytochrome b6 [Thysanolaena latifolia]
Length=217

 Score =   434 bits (1117),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_009048140.1| cytochrome b6 (chloroplast) [Primula poissonii]
 gb|AHF71752.1| cytochrome b6 (chloroplast) [Primula poissonii]
Length=220

 Score =   434 bits (1117),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  4     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  63

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTV+EAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  64    RPTVSEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  123

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIG+PLVELLRGSASVGQS
Sbjct  124   VTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGAPLVELLRGSASVGQS  183

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  184   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  220



>gb|ACT67274.1| cytochrome b6, partial (chloroplast) [Joinvillea plicata]
 gb|AEJ10355.1| cytochrome b6 [Abolboda macrostachya]
 gb|AEJ10369.1| cytochrome b6 [Eleusine coracana]
 gb|AEJ10370.1| cytochrome b6 [Flagellaria indica]
 gb|AEJ10394.1| cytochrome b6 [Streptochaeta angustifolia]
Length=215

 Score =   434 bits (1116),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|NP_084723.2| cytochrome b6 [Oenothera elata subsp. hookeri]
 ref|YP_001687167.1| cytochrome b6 (chloroplast) [Oenothera argillicola]
 ref|YP_001687313.1| cytochrome b6 (chloroplast) [Oenothera glazioviana]
 ref|YP_001687397.1| cytochrome b6 (chloroplast) [Oenothera biennis]
 ref|YP_001687481.1| cytochrome b6 (chloroplast) [Oenothera parviflora]
 sp|Q9MTJ5.2|CYB6_OENEH RecName: Full=Cytochrome b6 (chloroplast) [Oenothera elata subsp. 
hookeri]
 gb|ABW98734.1| cytochrome b6 (chloroplast) [Oenothera argillicola]
 gb|ABW98902.1| cytochrome b6 (chloroplast) [Oenothera biennis]
 gb|ABX10067.1| cytochrome b6 (chloroplast) [Oenothera glazioviana]
 gb|ABX10151.1| cytochrome b6 (chloroplast) [Oenothera parviflora]
 emb|CAB67189.2| cytochrome b6 (chloroplast) [Oenothera elata subsp. hookeri]
Length=215

 Score =   434 bits (1116),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_009033472.1| cytochrome b6 [Olyra latifolia]
 sp|P05642.2|CYB6_MAIZE RecName: Full=Cytochrome b6 (chloroplast) [Zea mays]
 gb|AAB29194.1| PetB (chloroplast) [Zea mays subsp. mays]
 gb|AGC38274.1| cytochrome b6 (chloroplast) [Cryptochloa strictiflora]
 gb|AGZ13269.1| cytochrome b6 [Olyra latifolia]
Length=215

 Score =   434 bits (1116),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_007476380.1| PetB (chloroplast) [Trithuria inconspicua]
 emb|CCJ32547.1| PetB (chloroplast) [Trithuria inconspicua]
 gb|AHB38684.1| cytochrome b6 (chloroplast) [Trithuria filamentosa]
 gb|AHB38737.1| cytochrome b6 (chloroplast) [Trithuria filamentosa]
Length=215

 Score =   434 bits (1116),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP++GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIVGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_009024367.1| cytochrome b6 (chloroplast) [Arundinaria tecta]
 gb|AGN72332.1| cytochrome b6 (chloroplast) [Arundinaria tecta]
Length=235

 Score =   435 bits (1118),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 216/234 (92%), Positives = 221/234 (94%), Gaps = 1/234 (0%)
 Frame = -1

Query  1136  AVRDESLIYGSQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLT  957
             +V+    + G   G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLT
Sbjct  2     SVKFSYTVLGGGLGLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLT  61

Query  956   CFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEANF-GWLIRSVHRWSASMMVLMMILHV  780
             CFLVQVATGFAMTFYYRPTVTEAF+SVQYIMTEANF GWLIRSVHRWSASMMVLMMILHV
Sbjct  62    CFLVQVATGFAMTFYYRPTVTEAFSSVQYIMTEANFFGWLIRSVHRWSASMMVLMMILHV  121

Query  779   FRVYLTGGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVI  600
             FRVYLTGGFKKPRELTWVTGVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVI
Sbjct  122   FRVYLTGGFKKPRELTWVTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVI  181

Query  599   GSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             GSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  182   GSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  235



>gb|AEJ10395.1| cytochrome b6 [Syngonanthus chrysanthus]
Length=215

 Score =   434 bits (1116),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGS LVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|XP_011018713.1| PREDICTED: cytochrome b6 [Populus euphratica]
Length=269

 Score =   436 bits (1121),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQ IADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  53    TYLNKVYDWFEERLEIQTIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  112

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  113   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  172

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  173   VTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  232

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  233   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  269



>gb|AGM14978.1| cytochrome b6, partial (chloroplast) [Panax ginseng]
 gb|AGM15064.1| cytochrome b6, partial (chloroplast) [Panax ginseng]
 gb|AGM15150.1| cytochrome b6, partial (chloroplast) [Panax ginseng]
 gb|AII17921.1| cytochrome b6, partial (chloroplast) [Viburnum acerifolium]
 gb|AII17922.1| cytochrome b6, partial (chloroplast) [Viburnum amplificatum]
 gb|AII17923.1| cytochrome b6, partial (chloroplast) [Viburnum carlesii]
 gb|AII17924.1| cytochrome b6, partial (chloroplast) [Viburnum cassinoides]
 gb|AII17925.1| cytochrome b6, partial (chloroplast) [Viburnum clemensae]
 gb|AII17926.1| cytochrome b6, partial (chloroplast) [Viburnum cylindricum]
 gb|AII17927.1| cytochrome b6, partial (chloroplast) [Viburnum dentatum]
 gb|AII17928.1| cytochrome b6, partial (chloroplast) [Viburnum dilatatum]
 gb|AII17929.1| cytochrome b6, partial (chloroplast) [Viburnum erubescens]
 gb|AII17930.1| cytochrome b6, partial (chloroplast) [Viburnum grandiflorum]
 gb|AII17931.1| cytochrome b6, partial (chloroplast) [Viburnum lantanoides]
 gb|AII17932.1| cytochrome b6, partial (chloroplast) [Viburnum lentago]
 gb|AII17933.1| cytochrome b6, partial (chloroplast) [Viburnum lutescens]
 gb|AII17934.1| cytochrome b6, partial (chloroplast) [Viburnum molle]
 gb|AII17935.1| cytochrome b6, partial (chloroplast) [Viburnum opulus]
 gb|AII17936.1| cytochrome b6, partial (chloroplast) [Viburnum plicatum]
 gb|AII17937.1| cytochrome b6, partial (chloroplast) [Viburnum punctatum]
 gb|AII17938.1| cytochrome b6, partial (chloroplast) [Viburnum sieboldii]
 gb|AII17939.1| cytochrome b6, partial (chloroplast) [Viburnum taiwanianum]
 gb|AII17941.1| cytochrome b6, partial (chloroplast) [Viburnum triphyllum]
 gb|AII17942.1| cytochrome b6, partial (chloroplast) [Viburnum vernicosum]
Length=217

 Score =   434 bits (1116),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  1     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  60

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVT+AFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  61    RPTVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  120

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  121   VTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  180

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_009073290.1| cytochrome b6 [Isachne distichophylla]
 gb|AIQ79817.1| cytochrome b6 [Isachne distichophylla]
Length=217

 Score =   434 bits (1116),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+T
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWIT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_009027809.1| cytochrome b6 (chloroplast) [Cercis canadensis]
Length=217

 Score =   434 bits (1115),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGS LVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  217



>ref|YP_008577778.1| cytochrome b6 (chloroplast) [Corymbia eximia]
 gb|AGC59187.1| cytochrome b6 (chloroplast) [Corymbia eximia]
Length=215

 Score =   434 bits (1115),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFK+PRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKEPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|ADM92676.1| cytochrome b6 [Davidia involucrata]
 gb|AEX65242.1| cytochrome b6, partial (chloroplast) [Anredera baselloides]
 gb|AEX65243.1| cytochrome b6, partial (chloroplast) [Blossfeldia liliputana]
Length=215

 Score =   434 bits (1115),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/215 (99%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>sp|P06247.2|CYB6_TOBAC RecName: Full=Cytochrome b6 (chloroplast) [Nicotiana tabacum]
Length=215

 Score =   434 bits (1115),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQ+GYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|ADD31091.1| cytochrome b6 protein (chloroplast) [Ficus sp. Moore 315]
Length=215

 Score =   434 bits (1115),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++K+YDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPLIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_001123060.1| cytochrome B6 [Aethionema grandiflorum]
 dbj|BAF49884.1| cytochrome B6 [Aethionema grandiflorum]
Length=215

 Score =   434 bits (1115),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AHF72016.1| cytochrome b6 (chloroplast) [Rosa odorata var. gigantea]
Length=220

 Score =   434 bits (1115),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNK+YDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  4     TYLNKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  63

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  64    RPTVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  123

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQS
Sbjct  124   VTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQS  183

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  184   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  220



>gb|AGX28873.2| cytochrome b6 (chloroplast) [Veratrum patulum]
Length=215

 Score =   434 bits (1115),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AAZ04013.1| cytochrome b6 [Typha latifolia]
Length=232

 Score =   434 bits (1117),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  16    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  75

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  76    RPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  135

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  136   VTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  195

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  196   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  232



>gb|AEX65247.1| cytochrome b6, partial (chloroplast) [Opuntia decumbens]
 gb|AEX65249.1| cytochrome b6, partial (chloroplast) [Pereskiopsis diguetii]
Length=215

 Score =   434 bits (1115),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_007025498.1| cytochrome b6 (chloroplast) [Fragaria virginiana]
 gb|AET62770.1| cytochrome b6 (chloroplast) [Fragaria virginiana]
Length=217

 Score =   434 bits (1115),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNK+YDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLT+VFMLMHFLMIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTSVFMLMHFLMIRKQGISGPL  217



>gb|ABU85327.1| cytochrome b6 [Elaeis oleifera]
Length=232

 Score =   434 bits (1116),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  16    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  75

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  76    RPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  135

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  136   VTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  195

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  196   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  232



>gb|AFU96002.1| PetB, partial (chloroplast) [Phyllanthus urinaria]
 gb|AFU96004.1| PetB, partial (chloroplast) [Podocalyx loranthoides]
Length=213

 Score =   433 bits (1114),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 212/213 (99%), Positives = 213/213 (100%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  213



>gb|AGQ50366.1| cytochrome b6 (chloroplast) [Rumex acetosa]
Length=215

 Score =   433 bits (1114),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             +NKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIP++GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPIVGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_008992753.1| cytochrome b6 (chloroplast) [Gossypium longicalyx]
 gb|ADZ74591.1| cytochrome b6 [Gossypium longicalyx]
Length=234

 Score =   434 bits (1116),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  18    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  77

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAF SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  78    RPTVTEAFDSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  137

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  138   VTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  197

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  198   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  234



>ref|YP_008080525.1| cytochrome b6/f complex subunit IV (chloroplast) [Pharus latifolius]
 ref|YP_008994003.1| cytochrome b6 (chloroplast) [Pharus lappulaceus]
 ref|YP_009002022.1| cytochrome b6 (chloroplast) [Puelia olyriformis]
 gb|AEI29112.1| cytochrome b6/f complex subunit IV (chloroplast) [Pharus latifolius]
 gb|AGE65782.1| cytochrome b6 (chloroplast) [Pharus lappulaceus]
 gb|AGH33802.1| cytochrome b6 (chloroplast) [Puelia olyriformis]
Length=215

 Score =   433 bits (1114),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             +NKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|XP_010421234.1| PREDICTED: cytochrome b6, partial [Camelina sativa]
Length=219

 Score =   433 bits (1114),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  3     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  62

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  63    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  122

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VT VVL VLTAS GVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQS
Sbjct  123   VTDVVLGVLTASIGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQS  182

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  183   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  219



>gb|AHM88865.1| cytochrome b6, partial (chloroplast) [Lagenaria siceraria]
Length=232

 Score =   434 bits (1115),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 217/227 (96%), Positives = 218/227 (96%), Gaps = 3/227 (1%)
 Frame = -1

Query  1112  YGSQRGNS---TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQ  942
             Y   RG S   TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQ
Sbjct  6     YTVLRGGSPWFTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQ  65

Query  941   VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT  762
             VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT
Sbjct  66    VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT  125

Query  761   GGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVE  582
             GGFKKPRELTWVTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVE
Sbjct  126   GGFKKPRELTWVTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVE  185

Query  581   LLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGP  441
             LLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGP
Sbjct  186   LLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGP  232



>gb|AHV90354.1| cytochrome b6 (chloroplast) [Setaria italica]
Length=217

 Score =   433 bits (1114),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_001936547.1| cytochrome b6 [Fagopyrum esculentum subsp. ancestrale]
 gb|ABY79762.1| cytochrome b6 [Fagopyrum esculentum subsp. ancestrale]
Length=215

 Score =   433 bits (1114),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVT+AFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQ+GYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQVGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AEJ10368.1| cytochrome b6 [Ecdeiocolea monostachya]
Length=215

 Score =   433 bits (1114),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLT VFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTTVFMLMHFLMIRKQGISGPL  215



>gb|AHY80570.1| cytochrome b6 [Beta vulgaris subsp. vulgaris]
Length=231

 Score =   434 bits (1115),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  15    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  74

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  75    RPTVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  134

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQS
Sbjct  135   VTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQS  194

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  195   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  231



>ref|NP_039415.1| cytochrome b6 [Oryza sativa Japonica Group]
 ref|YP_052779.1| cytochrome b6 [Oryza nivara]
 ref|YP_005088039.1| petB gene product [Leersia tisserantii]
 ref|YP_005089176.1| petB gene product [Rhynchoryza subulata]
 ref|YP_009034126.1| cytochrome b6 [Oryza glaberrima]
 ref|YP_009049298.1| cytochrome b6 (chloroplast) [Oryza australiensis]
 sp|P12123.1|CYB6_ORYSJ RecName: Full=Cytochrome b6 (chloroplast) [Oryza sativa Japonica 
Group]
 sp|P60161.1|CYB6_HORVU RecName: Full=Cytochrome b6 (chloroplast) [Hordeum vulgare]
 sp|P60162.1|CYB6_WHEAT RecName: Full=Cytochrome b6 (chloroplast) [Triticum aestivum]
 sp|Q6ENE4.1|CYB6_ORYNI RecName: Full=Cytochrome b6 (chloroplast) [Oryza nivara]
 sp|P0C316.1|CYB6_ORYSI RecName: Full=Cytochrome b6 (chloroplast) [Oryza sativa Indica 
Group]
 sp|P0C315.1|CYB6_ORYSA RecName: Full=Cytochrome b6 (chloroplast) [Oryza sativa]
 gb|AAA85374.1| apocytochrome b6 [Oryza sativa]
 emb|CAA33977.1| cytochrome B6 [Oryza sativa Japonica Group]
 dbj|BAD26808.1| cytochrome b6 [Oryza nivara]
 gb|AEO21207.1| cytochrome b6 [Leersia tisserantii]
 gb|AEO21373.1| cytochrome b6 [Rhynchoryza subulata]
 gb|AER12848.1| cytochrome b6 (chloroplast) [Oryza sativa Indica Group]
 gb|AER12935.1| cytochrome b6 (chloroplast) [Oryza sativa Indica Group]
 gb|AHZ60739.1| cytochrome b6 [Oryza glaberrima]
 gb|AIE44604.1| cytochrome b6 (chloroplast) [Oryza australiensis]
 prf||1603356BM cytochrome b6
Length=215

 Score =   433 bits (1113),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 215/215 (100%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_008592670.1| cytochrome b6 (chloroplast) [Berberis bealei]
 ref|YP_008592718.1| cytochrome b6 (chloroplast) [Berberis bealei]
 gb|AGU37076.1| cytochrome b6 (chloroplast) [Berberis bealei]
 gb|AGU37124.1| cytochrome b6 (chloroplast) [Berberis bealei]
Length=228

 Score =   434 bits (1115),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  12    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  71

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAF SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  72    RPTVTEAFTSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  131

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQS
Sbjct  132   VTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQS  191

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  192   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  228



>ref|YP_762291.1| cytochrome b6 [Morus indica]
 ref|YP_009110366.1| cytochrome b6 (chloroplast) [Morus mongolica]
 sp|Q09WY7.1|CYB6_MORIN RecName: Full=Cytochrome b6 (chloroplast) [Morus indica]
 gb|ABB20987.1| cytochrome b6 [Morus indica]
 gb|AIX11691.1| cytochrome b6 (chloroplast) [Morus mongolica]
Length=215

 Score =   433 bits (1113),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++K+YDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTETNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AEJ10357.1| cytochrome b6 [Albuca kirkii]
 gb|AEJ10380.1| cytochrome b6 [Lomandra longifolia]
 gb|AEJ10383.1| cytochrome b6 [Neoastelia spectabilis]
Length=215

 Score =   433 bits (1113),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>dbj|BAP59064.1| cytochrome b6, partial (chloroplast) [Triticum timopheevii]
Length=215

 Score =   433 bits (1113),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AIA76986.1| cytochrome b6 (chloroplast) (chloroplast) [Capsicum annuum var. 
glabriusculum]
Length=218

 Score =   433 bits (1113),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             +YLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  2     SYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  61

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  62    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  121

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQS
Sbjct  122   VTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQS  181

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  182   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  218



>ref|YP_002720142.1| petB [Jatropha curcas]
 ref|YP_004327692.1| cytochrome b6 [Hevea brasiliensis]
 ref|YP_008081295.1| cytochrome b6 (chloroplast) (chloroplast) [Catharanthus roseus]
 gb|ACN72721.1| petB [Jatropha curcas]
 gb|ADO33586.1| cytochrome b6 [Hevea brasiliensis]
 gb|AGI51174.1| cytochrome b6 (chloroplast) (chloroplast) [Catharanthus roseus]
Length=215

 Score =   433 bits (1113),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  215



>ref|YP_009111685.1| cytochrome b6 (chloroplast) [Apios americana]
 gb|AHI95814.1| cytochrome b6 (chloroplast) [Apios americana]
Length=217

 Score =   433 bits (1113),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGS LVELLRGS+SVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSLVELLRGSSSVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  217



>ref|YP_003587697.1| cytochrome b6 [Anomochloa marantoidea]
 gb|ACT15435.1| cytochrome b6 [Anomochloa marantoidea]
Length=217

 Score =   433 bits (1113),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVY+WFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYNWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>gb|AAZ04009.1| cytochrome b6 [Acorus americanus]
Length=217

 Score =   433 bits (1113),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  1     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  60

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVT+AFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  61    RPTVTDAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  120

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQS
Sbjct  121   VTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQS  180

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>gb|AEJ10358.1| cytochrome b6 [Apostasia wallichii]
Length=215

 Score =   432 bits (1112),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIG PLVELLRG+ASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGLPLVELLRGNASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_009072958.1| cytochrome b6 [Danthonia californica]
 gb|AIQ79485.1| cytochrome b6 [Danthonia californica]
Length=217

 Score =   432 bits (1112),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_009114478.1| cytochrome b6 (chloroplast) [Paeonia obovata]
 gb|AHV83423.1| cytochrome b6 (chloroplast) [Paeonia obovata]
Length=218

 Score =   432 bits (1112),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             +YLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  2     SYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  61

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  62    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  121

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  122   VTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  181

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  182   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  218



>ref|YP_001718467.1| cytochrome b6 [Manihot esculenta]
 ref|YP_007317278.1| cytochrome b6 (chloroplast) [Camellia sinensis]
 ref|YP_008578569.1| cytochrome b6 (chloroplast) (chloroplast) [Asclepias nivea]
 ref|YP_008578652.1| cytochrome b6 (chloroplast) (chloroplast) [Asclepias syriaca]
 ref|YP_008963335.1| cytochrome b6 [Camellia oleifera]
 ref|YP_009050618.1| cytochrome b6 (chloroplast) [Camellia grandibracteata]
 ref|YP_009050705.1| cytochrome b6 (chloroplast) [Camellia leptophylla]
 ref|YP_009050792.1| cytochrome b6 (chloroplast) [Camellia petelotii]
 ref|YP_009050879.1| cytochrome b6 (chloroplast) [Camellia pubicosta]
 ref|YP_009050966.1| cytochrome b6 (chloroplast) [Camellia reticulata]
 ref|YP_009108789.1| cytochrome b6 [Oncinotis tenuiloba]
 ref|YP_009108619.1| cytochrome b6 [Echites umbellatus]
 ref|YP_009108873.1| cytochrome b6 [Pentalinon luteum]
 ref|YP_009108704.1| cytochrome b6 [Nerium oleander]
 ref|YP_009115712.1| cytochrome b6 [Lysimachia coreana]
 gb|ABV66184.1| cytochrome b6 [Manihot esculenta]
 gb|ADD31077.1| cytochrome b6 protein (chloroplast) [Dillenia indica]
 gb|ADD31083.1| cytochrome b6 protein (chloroplast) [Nerium oleander]
 gb|ADZ52348.1| cytochrome b6 (chloroplast) [Asclepias syriaca]
 gb|AER52442.1| cytochrome b6 [Asclepias albicans]
 gb|AER52524.1| cytochrome b6 [Asclepias albicans]
 gb|AER52606.1| cytochrome b6 [Asclepias coulteri]
 gb|AER52688.1| cytochrome b6 [Asclepias cutleri]
 gb|AER52770.1| cytochrome b6 [Asclepias cutleri]
 gb|AER52933.1| cytochrome b6 [Asclepias macrotis]
 gb|AER53013.1| cytochrome b6 [Asclepias macrotis]
 gb|AER53091.1| cytochrome b6 [Asclepias masonii]
 gb|AER53173.1| cytochrome b6 [Asclepias subaphylla]
 gb|AER53253.1| cytochrome b6 [Asclepias subaphylla]
 gb|AER53333.1| cytochrome b6 [Asclepias subulata]
 gb|AER53415.1| cytochrome b6 [Asclepias subulata]
 gb|AER53497.1| cytochrome b6 [Asclepias albicans x Asclepias subulata]
 gb|AFK81328.1| cytochrome b6 [Camellia sinensis var. assamica]
 gb|AFK81415.1| cytochrome b6 [Camellia oleifera]
 gb|AFK81502.1| cytochrome b6 [Camellia taliensis]
 gb|AGA55626.1| cytochrome b6 (chloroplast) [Camellia sinensis]
 gb|AGW04315.1| cytochrome b6 [Secamone afzelii]
 gb|AGW04392.1| cytochrome b6 [Araujia sericifera]
 gb|AGW04469.1| cytochrome b6 [Astephanus triflorus]
 gb|AGW04545.1| cytochrome b6 [Eustegia minuta]
 gb|AGW04618.1| cytochrome b6 [Marsdenia astephanoides]
 gb|AGW04772.1| cytochrome b6 [Orthosia scoparia]
 gb|AGW04849.1| cytochrome b6 [Sisyranthus trichostomus]
 gb|AGW04926.1| cytochrome b6 [Telosma cordata]
 gb|AGW05003.1| cytochrome b6 [Vincetoxicum rossicum]
 gb|AGW05056.1| cytochrome b6 (chloroplast) (chloroplast) [Asclepias nivea]
 gb|AGW05166.1| cytochrome b6 (chloroplast) (chloroplast) [Asclepias syriaca]
 gb|AIG61282.1| cytochrome b6 (chloroplast) [Camellia grandibracteata]
 gb|AIG61369.1| cytochrome b6 (chloroplast) [Camellia leptophylla]
 gb|AIG61456.1| cytochrome b6 (chloroplast) [Camellia petelotii]
 gb|AIG61543.1| cytochrome b6 (chloroplast) [Camellia pubicosta]
 gb|AIG61630.1| cytochrome b6 (chloroplast) [Camellia reticulata]
 gb|AIG61718.1| cytochrome b6 (chloroplast) [Camellia sinensis var. dehungensis]
 gb|AIG61805.1| cytochrome b6 (chloroplast) [Camellia sinensis var. pubilimba]
 gb|AIG61892.1| cytochrome b6 (chloroplast) [Camellia sinensis var. sinensis]
 gb|AIW05209.1| cytochrome b6 [Aganosma cymosa]
 gb|AIW05294.1| cytochrome b6 [Echites umbellatus]
 gb|AIW05379.1| cytochrome b6 [Epigynum auritum]
 gb|AIW05463.1| cytochrome b6 [Neobracea bahamensis]
 gb|AIW05548.1| cytochrome b6 [Nerium oleander]
 gb|AIW05633.1| cytochrome b6 [Oncinotis tenuiloba]
 gb|AIW05717.1| cytochrome b6 [Pentalinon luteum]
 gb|AIW05802.1| cytochrome b6 [Periploca sepium]
 gb|AIW05887.1| cytochrome b6 [Rhabdadenia biflora]
 gb|AIW05972.1| cytochrome b6 [Wrightia natalensis]
 gb|AJC00300.1| cytochrome b6 [Lysimachia coreana]
Length=215

 Score =   432 bits (1112),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AEJ10359.1| cytochrome b6 [Asparagus officinalis]
Length=215

 Score =   432 bits (1111),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_004563897.1| cytochrome b6 [Nelumbo lutea]
 ref|YP_009093980.1| cytochrome b6 (chloroplast) [Nelumbo nucifera]
 gb|ACN49354.1| cytochrome b6 [Nelumbo lutea]
 gb|ACN49439.1| cytochrome b6 (chloroplast) [Nelumbo nucifera]
 gb|ADD31082.1| cytochrome b6 protein (chloroplast) [Nelumbo nucifera]
 gb|AFH01477.1| cytochrome b6 (chloroplast) [Nelumbo nucifera]
 gb|AFH01520.1| cytochrome b6 (chloroplast) [Nelumbo lutea]
 gb|AGO98554.1| cytochrome b6 (chloroplast) [Nelumbo nucifera]
 gb|AIY33853.1| cytochrome b6 (chloroplast) [Nelumbo nucifera]
Length=215

 Score =   432 bits (1111),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|NP_051088.1| cytochrome b6 [Arabidopsis thaliana]
 ref|YP_001123403.1| cytochrome b6 [Capsella bursa-pastoris]
 ref|YP_001123316.1| cytochrome B6 [Barbarea verna]
 ref|YP_001123667.1| cytochrome b6 [Lepidium virginicum]
 ref|YP_001123844.1| cytochrome b6 [Nasturtium officinale]
 ref|YP_001123145.1| cytochrome b6 [Olimarabidopsis pumila]
 ref|YP_001123229.1| cytochrome B6 [Arabis hirsuta]
 ref|YP_001123580.1| cytochrome B6 [Draba nemorosa]
 ref|YP_001123755.1| cytochrome b6 [Lobularia maritima]
 ref|YP_006666322.1| cytochrome b6 (chloroplast) [Pachycladon enysii]
 ref|YP_007889972.1| cytochrome b6 (chloroplast) [Pachycladon cheesemanii]
 ref|YP_009046944.1| cytochrome b6 (chloroplast) [Raphanus sativus]
 sp|P56773.1|CYB6_ARATH RecName: Full=Cytochrome b6 (chloroplast) [Arabidopsis thaliana]
 dbj|BAA84415.1| cytochrome B6 [Arabidopsis thaliana]
 dbj|BAF49969.1| cytochrome B6 [Olimarabidopsis pumila]
 dbj|BAF50053.1| cytochrome B6 [Arabis hirsuta]
 dbj|BAF50140.1| cytochrome B6 [Barbarea verna]
 dbj|BAF50227.1| cytochrome B6 [Capsella bursa-pastoris]
 dbj|BAF50404.1| cytochrome B6 [Draba nemorosa]
 dbj|BAF50491.1| cytochrome B6 [Lepidium virginicum]
 dbj|BAF50579.1| cytochrome B6 [Lobularia maritima]
 dbj|BAF50668.1| cytochrome B6 [Nasturtium officinale]
 gb|AFM92310.1| cytochrome b6 (chloroplast) [Pachycladon cheesemanii]
 gb|AFQ07822.1| cytochrome b6 (chloroplast) [Pachycladon enysii]
 gb|AHN07200.1| cytochrome b6 [Cardamine impatiens]
 gb|AHN07285.1| cytochrome b6 [Cardamine resedifolia]
 gb|AIE42497.1| cytochrome b6 (chloroplast) [Raphanus sativus]
Length=215

 Score =   432 bits (1111),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AEX65246.1| cytochrome b6, partial (chloroplast) [Mollugo verticillata]
Length=215

 Score =   432 bits (1111),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQ+GYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_003540961.1| cytochrome b6 [Phoenix dactylifera]
 gb|ADF28176.1| cytochrome b6 (chloroplast) [Phoenix dactylifera]
Length=218

 Score =   432 bits (1111),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  2     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  61

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  62    RPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  121

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  122   VTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  181

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  182   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  218



>gb|AII17940.1| cytochrome b6, partial (chloroplast) [Viburnum tinus]
Length=217

 Score =   432 bits (1111),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  1     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  60

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVT+AFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  61    RPTVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  120

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  121   VTGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  180

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_008992667.1| cytochrome b6 (chloroplast) [Gossypium herbaceum]
 gb|ADZ74507.1| cytochrome b6 [Gossypium herbaceum]
Length=234

 Score =   433 bits (1113),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  18    TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  77

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  78    RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  137

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVL VLTASFGVTGYSLP DQ+GYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQ+
Sbjct  138   VTGVVLGVLTASFGVTGYSLPRDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQA  197

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  198   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  234



>gb|AEX65248.1| cytochrome b6, partial (chloroplast) [Portulacaria afra]
Length=215

 Score =   432 bits (1110),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_009019918.1| cytochrome b6 (chloroplast) [Azadirachta indica]
 gb|AHJ91348.1| cytochrome b6 (chloroplast) [Azadirachta indica]
Length=215

 Score =   432 bits (1110),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF SVQYIMTEANFGWLIRSVHRWSASMMVLM+ILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFTSVQYIMTEANFGWLIRSVHRWSASMMVLMIILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|XP_002888340.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64599.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=242

 Score =   433 bits (1113),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 209/219 (95%), Positives = 215/219 (98%), Gaps = 0/219 (0%)
 Frame = -1

Query  1094  NSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTF  915
             N +  +++YDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTF
Sbjct  24    NRSNRSQIYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTF  83

Query  914   YYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPREL  735
             YYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPREL
Sbjct  84    YYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPREL  143

Query  734   TWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVG  555
             TWVTGVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVG
Sbjct  144   TWVTGVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVG  203

Query  554   QSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             QSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  204   QSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  242



>ref|YP_001122976.1| cytochrome B6 [Aethionema cordifolium]
 dbj|BAF49800.1| cytochrome B6 [Aethionema cordifolium]
Length=215

 Score =   432 bits (1110),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+L VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AHF71930.1| cytochrome b6 (chloroplast) [Paeonia sp. Sd0052]
Length=220

 Score =   432 bits (1110),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = -1

Query  1085  YLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYR  906
             YLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYR
Sbjct  5     YLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYR  64

Query  905   PTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWV  726
             PTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWV
Sbjct  65    PTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWV  124

Query  725   TGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQST  546
             TGVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQST
Sbjct  125   TGVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQST  184

Query  545   LTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             LTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  185   LTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  220



>gb|ADD31092.1| cytochrome b6 protein (chloroplast) [Gunnera manicata]
Length=215

 Score =   432 bits (1110),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSP+VELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPVVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  215



>gb|ABU85495.1| cytochrome b6 [Passiflora biflora]
Length=216

 Score =   432 bits (1110),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 1/216 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+T
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWLT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTL  180

Query  542   TR-FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TR FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  216



>gb|AEX10215.1| cytochrome b6 [California macrophylla]
Length=215

 Score =   431 bits (1109),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MDKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AFU95984.1| PetB, partial (chloroplast) [Flueggea suffruticosa]
Length=213

 Score =   431 bits (1109),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 210/213 (99%), Positives = 213/213 (100%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             +LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTLTR
Sbjct  121   ILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPLIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  213



>gb|AHA13212.1| cytochrome b6 [Thaumatococcus daniellii]
Length=217

 Score =   432 bits (1110),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  217



>ref|YP_009027917.1| cytochrome b6 (chloroplast) (chloroplast) [Hirtella racemosa]
 ref|YP_009028000.1| cytochrome b6 (chloroplast) (chloroplast) [Chrysobalanus icaco]
 ref|YP_009028083.1| cytochrome b6 (chloroplast) (chloroplast) [Licania heteromorpha]
 ref|YP_009028249.1| cytochrome b6 (chloroplast) (chloroplast) [Licania alba]
 ref|YP_009028332.1| cytochrome b6 (chloroplast) (chloroplast) [Licania sprucei]
 ref|YP_009028415.1| cytochrome b6 (chloroplast) [Hirtella physophora]
 ref|YP_009028166.1| cytochrome b6 (chloroplast) [Couepia guianensis]
 ref|YP_009028498.1| cytochrome b6 (chloroplast) [Parinari campestris]
 gb|AHX80630.1| cytochrome b6 (chloroplast) [Hirtella racemosa]
 gb|AHX80712.1| cytochrome b6 (chloroplast) [Chrysobalanus icaco]
 gb|AHX80796.1| cytochrome b6 (chloroplast) [Licania heteromorpha]
 gb|AHX80876.1| cytochrome b6 (chloroplast) [Couepia guianensis]
 gb|AHX80962.1| cytochrome b6 (chloroplast) [Licania alba]
 gb|AHX81044.1| cytochrome b6 (chloroplast) [Licania sprucei]
 gb|AHX81128.1| cytochrome b6 (chloroplast) [Hirtella physophora]
 gb|AHX81211.1| cytochrome b6 (chloroplast) [Parinari campestris]
Length=215

 Score =   431 bits (1109),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+T
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWLT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AEJ10377.1| cytochrome b6 [Juncus effusus]
Length=215

 Score =   431 bits (1109),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVY+WFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYNWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_005097904.1| cytochrome b6 (chloroplast) [Colocasia esculenta]
 gb|AEK48437.1| cytochrome b6 (chloroplast) [Colocasia esculenta]
 gb|AEK48523.1| cytochrome b6 (chloroplast) [Colocasia esculenta]
Length=215

 Score =   431 bits (1109),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             + KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MKKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  215



>ref|XP_008467004.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b6, partial [Cucumis 
melo]
Length=260

 Score =   433 bits (1113),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/228 (95%), Positives = 218/228 (96%), Gaps = 3/228 (1%)
 Frame = -1

Query  1112  YGSQRGNS---TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQ  942
             Y   RG S   TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQ
Sbjct  33    YTVLRGGSPWFTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQ  92

Query  941   VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT  762
             VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT
Sbjct  93    VATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLT  152

Query  761   GGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVE  582
             GGFKKPRELTWVTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVE
Sbjct  153   GGFKKPRELTWVTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVE  212

Query  581   LLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             LLRGSASVGQSTLT FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  213   LLRGSASVGQSTLTXFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  260



>gb|AGN71995.1| cytochrome b6 [Dasiphora fruticosa subsp. floribunda]
Length=217

 Score =   431 bits (1109),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNK+YDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRS+HRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFASVQYIMTEANFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_009107006.1| cytochrome b6 (chloroplast) [Sapindus mukorossi]
 gb|AIT96752.1| cytochrome b6 (chloroplast) [Sapindus mukorossi]
Length=215

 Score =   431 bits (1109),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             +++VYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSEVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLM ILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMTILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>sp|Q09ME7.2|CYB6_CITSI RecName: Full=Cytochrome b6 (chloroplast) [Citrus sinensis]
Length=215

 Score =   431 bits (1109),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTE NFGWLIRSVHRWSASMMVLM ILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMTILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_004021346.1| cytochrome b6 [Theobroma cacao]
 ref|YP_006503307.1| cytochrome b6 (chloroplast) [Gossypium incanum]
 ref|YP_006503390.1| cytochrome b6 (chloroplast) [Gossypium somalense]
 ref|YP_006503556.1| cytochrome b6 (chloroplast) [Gossypium areysianum]
 gb|ADD31078.1| cytochrome b6 protein (chloroplast) [Ehretia acuminata]
 gb|ADO64839.1| cytochrome b6 [Theobroma cacao]
 gb|ADO64920.2| cytochrome b6 [Theobroma cacao]
 gb|AEH42953.1| cytochrome b6 [Gossypium incanum]
 gb|AEH43036.1| cytochrome b6 [Gossypium somalense]
 gb|AEH43202.1| cytochrome b6 (chloroplast) [Gossypium areysianum]
 gb|AEX57756.1| cytochrome b6 (chloroplast) [Theobroma cacao]
 gb|AEX57837.1| cytochrome b6 (chloroplast) [Theobroma cacao]
 gb|AEX57918.1| cytochrome b6 (chloroplast) [Theobroma cacao]
 gb|AEX57999.1| cytochrome b6 (chloroplast) [Theobroma cacao]
 gb|AEX58080.1| cytochrome b6 (chloroplast) [Theobroma cacao]
 gb|AEX58161.1| cytochrome b6 (chloroplast) [Theobroma cacao]
 gb|AEX58242.1| cytochrome b6 (chloroplast) [Theobroma cacao]
 gb|AEX58323.1| cytochrome b6 (chloroplast) [Theobroma cacao]
 gb|AEX58404.1| cytochrome b6 (chloroplast) [Theobroma cacao]
 gb|AEX58566.1| cytochrome b6 (chloroplast) [Theobroma cacao]
 gb|AHH30468.1| cytochrome b6 (chloroplast) [Bartsia inaequalis]
Length=215

 Score =   431 bits (1108),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AEJ10376.1| cytochrome b6 [Joinvillea ascendens]
Length=215

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             L KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LXKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AFU95992.1| PetB, partial (chloroplast) [Irvingia malayana]
Length=213

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 210/213 (99%), Positives = 213/213 (100%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASV+YIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVEYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPV+GSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVVGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  213



>ref|YP_054659.1| cytochrome b6 [Saccharum hybrid cultivar NCo 310]
 ref|YP_003029768.1| cytochrome b6 [Bambusa oldhamii]
 ref|YP_003208216.1| cytochrome b6 [Coix lacryma-jobi]
 ref|YP_004734130.1| cytochrome b6 [Bambusa emeiensis]
 ref|YP_004734214.1| cytochrome b6 [Ferrocalamus rimosivaginus]
 ref|YP_007890403.1| cytochrome b6 (chloroplast) [Ardisia polysticta]
 ref|YP_009051280.1| cytochrome b6 (chloroplast) [Bambusa multiplex]
 ref|YP_009053194.1| cytochrome b6 (chloroplast) [Gelidocalamus tessellatus]
 ref|YP_009053908.1| cytochrome b6 [Ampelocalamus calcareus]
 sp|Q6ENT4.1|CYB6_SACOF RecName: Full=Cytochrome b6 (chloroplast) [Saccharum officinarum]
 sp|A1E9V4.2|CYB6_SORBI RecName: Full=Cytochrome b6 (chloroplast) [Sorghum bicolor]
 sp|Q6L372.2|CYB6_SACHY RecName: Full=Cytochrome b6 (chloroplast) [Saccharum sp.]
 emb|CAA28999.1| petB [Zea mays]
 dbj|BAD27322.1| cytochrome b6 [Saccharum hybrid cultivar NCo 310]
 gb|ACI43301.1| cytochrome b6 [Coix lacryma-jobi]
 gb|ACS94737.1| cytochrome b6 [Bambusa oldhamii]
 gb|ADO65254.1| cytochrome b6 [Ferrocalamus rimosivaginus]
 gb|ADO65503.1| cytochrome b6 [Bambusa emeiensis]
 gb|AEI70775.1| cytochrome b6 [Puelia olyriformis]
 gb|AFS67675.1| cytochrome b6 (chloroplast) [Gelidocalamus tessellatus]
 gb|AGG36914.1| cytochrome b6 (chloroplast) [Ardisia polysticta]
 gb|AHY86210.1| cytochrome b6 [Ampelocalamus calcareus]
 gb|AIH00266.1| cytochrome b6 (chloroplast) [Bambusa multiplex]
Length=215

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|ACH47639.1| cytochrome b6 [Erodium chrysanthum]
Length=215

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPV+GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVLGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLT VFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTTVFMLMHFLMIRKQGISGPL  215



>gb|ABI98775.1| cytochrome b6 [Cucumis sativus]
Length=215

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AEX65252.1| cytochrome b6, partial (chloroplast) [Weingartia kargliana]
Length=215

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVY+TGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYITGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPV+GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVMGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF+MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFIMIRKQGISGPL  215



>ref|YP_358611.1| cytochrome b6 [Phalaenopsis aphrodite subsp. formosana]
 ref|YP_006073295.1| cytochrome b6 (chloroplast) [Phalaenopsis equestris]
 ref|YP_009107589.1| cytochrome b6 (chloroplast) [Phalaenopsis hybrid cultivar]
 sp|Q3BAK7.1|CYB6_PHAAO RecName: Full=Cytochrome b6 (chloroplast) [Phalaenopsis aphrodite 
subsp. formosana]
 gb|AAW82529.1| cytochrome b6 [Phalaenopsis aphrodite subsp. formosana]
 gb|AEB96273.1| cytochrome b6 (chloroplast) [Phalaenopsis equestris]
 gb|AIU44799.1| cytochrome b6 (chloroplast) [Phalaenopsis hybrid cultivar]
Length=215

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|NP_783261.1| cytochrome b6 [Atropa belladonna]
 ref|YP_538879.1| cytochrome b6 [Solanum bulbocastanum]
 ref|YP_635669.1| cytochrome b6 [Solanum tuberosum]
 ref|YP_008563118.1| cytochrome b6 (chloroplast) [Solanum lycopersicum]
 ref|YP_009040350.1| cytochrome b6 [Hyoscyamus niger]
 ref|YP_009114899.1| cytochrome b6 [Thalictrum coreanum]
 ref|AP_004958.1| cytochrome b6 (chloroplast) [Solanum lycopersicum]
 sp|Q8S8W0.1|CYB6_ATRBE RecName: Full=Cytochrome b6 (chloroplast) [Atropa belladonna]
 sp|Q2MI71.1|CYB6_SOLLC RecName: Full=Cytochrome b6 (chloroplast) [Solanum lycopersicum]
 sp|Q2MIF8.1|CYB6_SOLBU RecName: Full=Cytochrome b6 (chloroplast) [Solanum bulbocastanum]
 sp|Q2VEF0.1|CYB6_SOLTU RecName: Full=Cytochrome b6 (chloroplast) [Solanum tuberosum]
 emb|CAC88074.1| cytochrome b6 [Atropa belladonna]
 gb|ABB90069.1| cytochrome b6 [Solanum tuberosum]
 gb|ABC56242.1| cytochrome b6 [Solanum bulbocastanum]
 gb|ABC56329.1| cytochrome b6 (chloroplast) [Solanum lycopersicum]
 gb|ABD47086.1| cytochrome b6 [Solanum tuberosum]
 emb|CAJ32424.1| cytochrome b6 [Solanum lycopersicum]
 gb|AEB72169.1| cytochrome b6 (chloroplast) [Solanum tuberosum]
 gb|AEB72255.1| cytochrome b6 (chloroplast) [Solanum tuberosum]
 gb|AGU46498.1| cytochrome b6 [Hyoscyamus niger]
 gb|AIX03547.1| cytochrome b6 [Thalictrum coreanum]
Length=215

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AEX58485.1| cytochrome b6 (chloroplast) [Theobroma grandiflorum]
Length=215

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+T
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWIT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_001001564.1| cytochrome b6 [Nuphar advena]
 gb|ABC60488.1| cytochrome b6 [Nuphar advena]
Length=215

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+F+CLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFHCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPV+GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVVGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  215



>ref|YP_784503.1| cytochrome b6 [Piper cenocladum]
 sp|Q06GN0.1|CYB6_PIPCE RecName: Full=Cytochrome b6 (chloroplast) [Piper cenocladum]
 gb|ABI14501.1| cytochrome b6 [Piper cenocladum]
Length=215

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGS SVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSTSVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  215



>gb|ADD31088.1| cytochrome b6 protein (chloroplast) [Bulnesia arborea]
Length=215

 Score =   431 bits (1107),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVT+AFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AGW04695.1| cytochrome b6 [Matelea biflora]
Length=215

 Score =   431 bits (1107),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPREL+WVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELSWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQ+GYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQVGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_004769841.1| cytochrome b6 (chloroplast) [Wolffiella lingulata]
 gb|AEK94454.1| cytochrome b6 [Wolffiella lingulata]
Length=215

 Score =   431 bits (1107),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             + KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MKKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AAZ04014.1| cytochrome b6 [Yucca schidigera]
Length=224

 Score =   431 bits (1108),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  8     TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  67

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAF+SVQYIM EANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  68    RPTVTEAFSSVQYIMIEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  127

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS
Sbjct  128   VTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  187

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  188   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  224



>ref|YP_001123492.1| cytochrome b6 [Crucihimalaya wallichii]
 dbj|BAF50316.1| cytochrome B6 [Crucihimalaya wallichii]
Length=215

 Score =   431 bits (1107),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSP VELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPFVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AER52851.1| cytochrome b6 [Asclepias leptopus]
Length=215

 Score =   431 bits (1107),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRE TWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPREFTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AEX93422.1| cytochrome b/b6 (mitochondrion) [Wolffia arrhiza]
Length=215

 Score =   431 bits (1107),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AFU95973.1| PetB, partial (chloroplast) [Caloncoba echinata]
 gb|AFU95981.1| PetB, partial (chloroplast) [Erythroxylum areolatum]
 gb|AFU95982.1| PetB, partial (chloroplast) [Euphorbia maculata]
 gb|AFU95996.1| PetB, partial (chloroplast) [Mammea americana]
 gb|AFU96003.1| PetB, partial (chloroplast) [Ploiarium sp. CCD-2012]
Length=213

 Score =   430 bits (1106),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/213 (99%), Positives = 212/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  213



>ref|YP_008963425.1| cytochrome b6 (chloroplast) [Sedum sarmentosum]
 gb|AFQ99092.1| cytochrome b6 (chloroplast) [Sedum sarmentosum]
Length=217

 Score =   431 bits (1107),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SV+YIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFK+PRELTWVT
Sbjct  63    TVTEAFSSVEYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKRPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_008378812.1| cytochrome b6 (chloroplast) [Najas flexilis]
 gb|AFY64142.1| cytochrome b6 (chloroplast) [Najas flexilis]
Length=215

 Score =   430 bits (1106),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             + KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MKKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLT+VFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTSVFMLMHFLMIRKQGISGPL  215



>ref|YP_006073134.1| cytochrome b6 (chloroplast) [Elaeis guineensis]
 ref|YP_007475819.1| cytochrome b6 [Pseudophoenix vinifera]
 ref|YP_007475991.1| cytochrome b6 [Bismarckia nobilis]
 ref|YP_008854540.1| cytochrome b6 [Ravenala madagascariensis]
 gb|ADZ10898.1| cytochrome b6 (chloroplast) [Elaeis guineensis]
 gb|AGE92883.1| cytochrome b6 [Pseudophoenix vinifera]
 gb|AGE93055.1| cytochrome b6 [Bismarckia nobilis]
 gb|AGE93313.1| cytochrome b6 [Chamaedorea seifrizii]
 gb|AGE93485.1| cytochrome b6 [Xiphidium caeruleum]
 emb|CCW72406.1| petB (chloroplast) [Musa acuminata subsp. malaccensis]
 gb|AHA12629.1| cytochrome b6 [Ravenala madagascariensis]
Length=217

 Score =   431 bits (1107),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_009041117.1| cytochrome b6 [Rhazya stricta]
 gb|AIB08764.1| cytochrome b6 [Rhazya stricta]
Length=215

 Score =   430 bits (1106),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AEX65245.1| cytochrome b6, partial (chloroplast) [Maihuenia poeppigii]
Length=215

 Score =   430 bits (1106),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 212/215 (99%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEE LEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEECLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|NP_054530.1| cytochrome b6 [Nicotiana tabacum]
 ref|YP_358708.1| cytochrome b6 [Nicotiana sylvestris]
 ref|YP_398894.1| cytochrome b6 [Nicotiana tomentosiformis]
 ref|YP_004891637.1| petB gene product (chloroplast) [Nicotiana undulata]
 sp|Q33C02.1|CYB6_NICTO RecName: Full=Cytochrome b6 (chloroplast) [Nicotiana tomentosiformis]
 sp|Q3C1M5.1|CYB6_NICSY RecName: Full=Cytochrome b6 (chloroplast) [Nicotiana sylvestris]
 emb|CAA77375.1| cytochrome b6 [Nicotiana tabacum]
 dbj|BAE46684.1| cytochrome b6 [Nicotiana sylvestris]
 dbj|BAE48033.1| cytochrome b6 [Nicotiana tomentosiformis]
 gb|AEO95599.1| cytochrome b6 (chloroplast) [Nicotiana undulata]
 gb|AEO95709.1| cytochrome b6 [synthetic construct]
 prf||1211235BH cytochrome b6
Length=215

 Score =   430 bits (1106),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQ+GYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|ADD31095.1| cytochrome b6 protein (chloroplast) [Oxalis latifolia]
Length=215

 Score =   430 bits (1106),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGS SVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSTSVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYS HTFVLPLLTAVF+LMHFLMIRKQGISGPL
Sbjct  181   TRFYSFHTFVLPLLTAVFLLMHFLMIRKQGISGPL  215



>ref|NP_862783.1| cytochrome b6 [Calycanthus floridus var. glaucus]
 sp|Q7YJU8.1|CYB6_CALFG RecName: Full=Cytochrome b6 (chloroplast) [Calycanthus floridus 
var. glaucus]
 emb|CAD28750.1| cytochrome B6 [Calycanthus floridus var. glaucus]
Length=215

 Score =   430 bits (1106),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+F+CLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFHCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AEP94890.1| cytochrome b6 [Vigna unguiculata]
Length=216

 Score =   430 bits (1106),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 212/214 (99%), Gaps = 0/214 (0%)
 Frame = -1

Query  1079  NKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPT  900
             NKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPT
Sbjct  3     NKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPT  62

Query  899   VTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTG  720
             VTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTG
Sbjct  63    VTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTG  122

Query  719   VVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLT  540
             VVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGS LVELLRGS+SVGQSTLT
Sbjct  123   VVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSLVELLRGSSSVGQSTLT  182

Query  539   RFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             RFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   RFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  216



>ref|YP_001294382.1| cytochrome b6 [Dioscorea elephantipes]
 gb|ABR01459.1| cytochrome b6 [Dioscorea elephantipes]
Length=215

 Score =   430 bits (1106),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_007475649.1| cytochrome b6 [Heliconia collinsiana]
 gb|AGE92713.1| cytochrome b6 [Heliconia collinsiana]
Length=218

 Score =   430 bits (1106),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  4     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  63

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  64    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  123

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  124   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  183

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  184   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  218



>gb|AFU95980.1| PetB, partial (chloroplast) [Elaeodendron orientale]
Length=213

 Score =   430 bits (1106),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 209/213 (98%), Positives = 212/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+TGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWITGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLT SFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTTSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLT+VFMLMHFLMIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTSVFMLMHFLMIRKQGISGPL  213



>gb|ADD31098.1| cytochrome b6 protein (chloroplast) [Staphylea colchica]
Length=215

 Score =   430 bits (1106),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPV+GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVLGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AEJ10356.1| cytochrome b6 [Agapanthus praecox]
 gb|AEJ10360.1| cytochrome b6 [Belosynapsis ciliata]
 gb|AEJ10361.1| cytochrome b6 [Brocchinia micrantha]
 gb|AEJ10363.1| cytochrome b6 [Chamaedorea seifrizii]
 gb|AEJ10364.1| cytochrome b6 [Chlorophytum rhizopendulum]
 gb|AEJ10373.1| cytochrome b6 [Hesperaloe parviflora]
 gb|AEJ10374.1| cytochrome b6 [Hosta ventricosa]
 gb|AEJ10382.1| cytochrome b6 [Navia saxicola]
 gb|AEJ10385.1| cytochrome b6 [Nolina atopocarpa]
 gb|AEJ10387.1| cytochrome b6 [Phormium tenax]
 gb|AEJ10391.1| cytochrome b6 [Ravenea hildebrandtii]
 gb|AEJ10393.1| cytochrome b6 [Sparganium eurycarpum]
Length=215

 Score =   430 bits (1106),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_009057181.1| cytochrome b6 (chloroplast) [Allium cepa]
 gb|AHC94617.1| cytochrome b6 (chloroplast) [Allium cepa]
 gb|AHC94698.1| cytochrome b6 (chloroplast) [Allium cepa]
Length=218

 Score =   430 bits (1106),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = -1

Query  1085  YLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYR  906
             YLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYR
Sbjct  3     YLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYR  62

Query  905   PTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWV  726
             PTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWV
Sbjct  63    PTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWV  122

Query  725   TGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQST  546
             TGVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIP+IGSPLVELLRGSASVGQST
Sbjct  123   TGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPIIGSPLVELLRGSASVGQST  182

Query  545   LTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             LTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   LTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  218



>ref|YP_005352737.1| petB gene product (chloroplast) [Ginkgo biloba]
 gb|AEQ37143.1| cytochrome b6 (chloroplast) [Ginkgo biloba]
 gb|AEX98450.1| cytochrome b6 (chloroplast) [Ginkgo biloba]
 gb|AEX98867.1| cytochrome b6 (chloroplast) [Ginkgo biloba]
 gb|AEX99035.1| cytochrome b6 (chloroplast) [Ginkgo biloba]
Length=218

 Score =   430 bits (1106),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 212/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TYL+KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGG+TLTCFLVQVATGFAMTFYY
Sbjct  2     TYLDKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGVTLTCFLVQVATGFAMTFYY  61

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAFASVQYIM E NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  62    RPTVTEAFASVQYIMIEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  121

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGV+LAVLT SFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGS SVGQS
Sbjct  122   VTGVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSISVGQS  181

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGI GPL
Sbjct  182   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGIPGPL  218



>ref|YP_053184.1| cytochrome b6 [Nymphaea alba]
 sp|Q6EW22.1|CYB6_NYMAL RecName: Full=Cytochrome b6 (chloroplast) [Nymphaea alba]
 emb|CAF28624.1| cytochrome B6 [Nymphaea alba]
Length=215

 Score =   430 bits (1105),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+F+CLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFHCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP++GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIVGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  215



>sp|A7M993.2|CYB6_CUSRE RecName: Full=Cytochrome b6 [Cuscuta reflexa]
Length=215

 Score =   430 bits (1105),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDW EERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWLEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASV+YIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVKYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPLIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPL+TAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLITAVFMLMHFLMIRKQGISGPL  215



>gb|AFU95977.1| PetB, partial (chloroplast) [Clusia rosea]
 gb|AFU95985.1| PetB, partial (chloroplast) [Galearia maingayi]
 gb|AFU95986.1| PetB, partial (chloroplast) [Garcinia mangostana]
Length=213

 Score =   430 bits (1105),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 210/213 (99%), Positives = 212/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             +LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   ILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  213



>ref|YP_002836120.1| cytochrome b6 [Megaleranthis saniculifolia]
 gb|ACO92045.1| cytochrome b6 [Megaleranthis saniculifolia]
Length=215

 Score =   430 bits (1105),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSP+VELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPVVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|NP_114287.1| cytochrome b6 [Triticum aestivum]
 ref|YP_874766.1| cytochrome b6 [Agrostis stolonifera]
 ref|YP_001531311.1| petB gene product (chloroplast) [Lolium perenne]
 ref|YP_007026496.1| cytochrome b6 [Festuca altissima]
 ref|YP_007026668.1| cytochrome b6 [Festuca pratensis]
 ref|YP_007026754.1| cytochrome b6 [Lolium multiflorum]
 ref|YP_009003858.1| cytochrome b6 [Deschampsia antarctica]
 sp|A1EA38.1|CYB6_AGRST RecName: Full=Cytochrome b6 (chloroplast) [Agrostis stolonifera]
 emb|CAA38551.1| apocytochrome b-563 [Triticum aestivum]
 emb|CAA32266.1| petB [Hordeum vulgare subsp. vulgare]
 dbj|BAB47063.1| cytochrome B6 [Triticum aestivum]
 gb|ABK79609.1| cytochrome b6 [Agrostis stolonifera]
 emb|CAO86005.1| cytochrome b6 (chloroplast) [Lolium perenne]
 gb|AFV62676.1| cytochrome b6 [Festuca altissima]
 gb|AFV62848.1| cytochrome b6 [Festuca pratensis]
 gb|AFV62934.1| cytochrome b6 [Lolium multiflorum]
 gb|AHI43073.1| cytochrome b6 [Deschampsia antarctica]
 gb|AIG61198.1| cytochrome b6 (chloroplast) [Triticum aestivum]
 gb|AIU45488.1| cytochrome b6 (chloroplast) [Triticum turgidum subsp. durum]
Length=215

 Score =   430 bits (1105),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_007476077.1| cytochrome b6 [Dasypogon bromeliifolius]
 gb|AGE93141.1| cytochrome b6 [Dasypogon bromeliifolius]
Length=217

 Score =   430 bits (1105),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_588147.1| cytochrome b6 (chloroplast) [Helianthus annuus]
 ref|YP_004564402.1| cytochrome b6 (chloroplast) [Ageratina adenophora]
 ref|YP_008964387.1| cytochrome b6 [Helianthus divaricatus]
 ref|YP_008964472.1| cytochrome b6 [Helianthus decapetalus]
 ref|YP_008964727.1| cytochrome b6 [Helianthus strumosus]
 ref|YP_008964812.1| cytochrome b6 [Helianthus maximiliani]
 ref|YP_008964217.1| cytochrome b6 [Helianthus giganteus]
 ref|YP_008964302.1| cytochrome b6 [Helianthus grosseserratus]
 ref|YP_008964557.1| cytochrome b6 [Helianthus hirsutus]
 ref|YP_008964642.1| cytochrome b6 [Helianthus tuberosus]
 sp|Q1KXS9.1|CYB6_HELAN RecName: Full=Cytochrome b6 (chloroplast) [Helianthus annuus]
 gb|ABD47175.1| cytochrome b6 (chloroplast) [Helianthus annuus]
 gb|AEG64586.1| cytochrome b6 (chloroplast) [Ageratina adenophora]
 gb|AHB14487.1| cytochrome b6 [Helianthus giganteus]
 gb|AHB14572.1| cytochrome b6 [Helianthus giganteus]
 gb|AHB14657.1| cytochrome b6 [Helianthus giganteus]
 gb|AHB14742.1| cytochrome b6 [Helianthus giganteus]
 gb|AHB14827.1| cytochrome b6 [Helianthus grosseserratus]
 gb|AHB14912.1| cytochrome b6 [Helianthus grosseserratus]
 gb|AHB14997.1| cytochrome b6 [Helianthus divaricatus]
 gb|AHB15082.1| cytochrome b6 [Helianthus divaricatus]
 gb|AHB15167.1| cytochrome b6 [Helianthus divaricatus]
 gb|AHB15252.1| cytochrome b6 [Helianthus divaricatus]
 gb|AHB15337.1| cytochrome b6 [Helianthus decapetalus]
 gb|AHB15422.1| cytochrome b6 [Helianthus decapetalus]
 gb|AHB15507.1| cytochrome b6 [Helianthus decapetalus]
 gb|AHB15592.1| cytochrome b6 [Helianthus hirsutus]
 gb|AHB15677.1| cytochrome b6 [Helianthus hirsutus]
 gb|AHB15762.1| cytochrome b6 [Helianthus tuberosus]
 gb|AHB15847.1| cytochrome b6 [Helianthus tuberosus]
 gb|AHB15932.1| cytochrome b6 [Helianthus tuberosus]
 gb|AHB16017.1| cytochrome b6 [Helianthus divaricatus]
 gb|AHB16102.1| cytochrome b6 [Helianthus giganteus]
 gb|AHB16187.1| cytochrome b6 [Helianthus giganteus]
 gb|AHB16272.1| cytochrome b6 [Helianthus grosseserratus]
 gb|AHB16357.1| cytochrome b6 [Helianthus grosseserratus]
 gb|AHB16442.1| cytochrome b6 [Helianthus grosseserratus]
 gb|AHB16527.1| cytochrome b6 [Helianthus grosseserratus]
 gb|AHB16612.1| cytochrome b6 [Helianthus decapetalus]
 gb|AHB16697.1| cytochrome b6 [Helianthus decapetalus]
 gb|AHB16782.1| cytochrome b6 [Helianthus decapetalus]
 gb|AHB16867.1| cytochrome b6 [Helianthus hirsutus]
 gb|AHB16952.1| cytochrome b6 [Helianthus hirsutus]
 gb|AHB17037.1| cytochrome b6 [Helianthus strumosus]
 gb|AHB17122.1| cytochrome b6 [Helianthus tuberosus]
 gb|AHB17207.1| cytochrome b6 [Helianthus tuberosus]
 gb|AHB17292.1| cytochrome b6 [Helianthus tuberosus]
 gb|AHB17377.1| cytochrome b6 [Helianthus maximiliani]
 gb|AHB17462.1| cytochrome b6 [Helianthus maximiliani]
 gb|AHB17547.1| cytochrome b6 [Helianthus maximiliani]
 gb|AHB17632.1| cytochrome b6 [Helianthus maximiliani]
Length=215

 Score =   430 bits (1105),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVT+AFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AIZ57558.1| cytochrome b6 (chloroplast) [Clematis fusca var. coreana]
Length=216

 Score =   430 bits (1105),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 210/213 (99%), Positives = 212/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  4     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  63

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  64    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  123

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  124   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTLTR  183

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  184   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  216



>gb|AEJ10367.1| cytochrome b6 [Dasypogon bromeliifolius]
Length=215

 Score =   430 bits (1105),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_009020774.1| cytochrome b6 (chloroplast) [Praxelis clematidea]
 gb|AHM02434.1| cytochrome b6 (chloroplast) [Praxelis clematidea]
Length=226

 Score =   430 bits (1106),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 211/223 (95%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -1

Query  1106  SQRGNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGF  927
             S+ G+     KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGF
Sbjct  4     SEGGSHLSQYKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGF  63

Query  926   AMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKK  747
             AMTFYYRPTVT+AFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKK
Sbjct  64    AMTFYYRPTVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKK  123

Query  746   PRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGS  567
             PRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGS
Sbjct  124   PRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGS  183

Query  566   ASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             ASVGQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  184   ASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  226



>ref|YP_001294128.1| cytochrome b6 [Chloranthus spicatus]
 gb|ABQ43289.1| cytochrome b6 [Chloranthus spicatus]
Length=217

 Score =   430 bits (1105),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+F+CLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFHCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>gb|AEJ10365.1| cytochrome b6 [Molineria capitulata]
Length=215

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL +LTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGLLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AFU96012.1| PetB, partial (chloroplast) [Turnera ulmifolia]
Length=213

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/213 (98%), Positives = 212/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKI TGVPEAIP+IGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIXTGVPEAIPIIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTA+FMLMHFLMIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAIFMLMHFLMIRKQGISGPL  213



>ref|YP_009108527.1| cytochrome b6 (chloroplast) [Utricularia macrorhiza]
 emb|CDL78765.1| cytochrome b6 (chloroplast) [Utricularia macrorhiza]
Length=215

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AJE71246.1| cytochrome b6 [Acorus gramineus]
Length=217

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVT+AFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTDAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>gb|AFK36715.1| unknown [Lotus japonicus]
Length=215

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGS +VELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSVVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_009109920.1| cytochrome b6 (chloroplast) [Trifolium strictum]
 gb|AIJ28387.1| cytochrome b6 (chloroplast) [Trifolium strictum]
Length=217

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGS +VELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSSVVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  217



>gb|AEJ10396.1| cytochrome b6 [Thamnochortus insignis]
Length=215

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMT+ NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTDVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLT+SFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTSSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_001122836.2| cytochrome b6 [Phaseolus vulgaris]
 ref|YP_003434374.1| cytochrome b6 [Vigna radiata]
 ref|YP_006460372.1| cytochrome b6 (chloroplast) [Vigna unguiculata]
 ref|YP_007889754.1| cytochrome b6 (chloroplast) [Vigna angularis]
 gb|ABH88115.2| cytochrome b6 [Phaseolus vulgaris]
 gb|ABW22754.1| cytochrome b6 [Phaseolus vulgaris]
 gb|ACV90241.1| cytochrome b6 [Vigna radiata]
 gb|AFJ91888.1| cytochrome b6 (chloroplast) [Vigna unguiculata]
 dbj|BAN14958.1| cytochrome b6 (chloroplast) [Vigna angularis]
Length=215

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGS LVELLRGS+SVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSLVELLRGSSSVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  215



>ref|YP_005089525.1| petB gene product (chloroplast) [Silene conica]
 ref|YP_009000044.1| cytochrome b6 (chloroplast) (chloroplast) [Silene conoidea]
 ref|YP_008999964.1| cytochrome b6 (chloroplast) (chloroplast) [Agrostemma githago]
 gb|AEC04033.1| cytochrome b6 (chloroplast) [Silene conica]
 gb|AGZ17955.1| cytochrome b6 (chloroplast) [Agrostemma githago]
 gb|AGZ18035.1| cytochrome b6 (chloroplast) [Silene conoidea]
Length=215

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPV+GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVVGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AFU95974.1| PetB, partial (chloroplast) [Casearia nitida]
Length=213

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 210/213 (99%), Positives = 211/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQ IADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQTIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  213



>ref|YP_006665810.1| cytochrome b6 (chloroplast) [Elodea canadensis]
 gb|AEY84683.1| cytochrome b6 (chloroplast) [Elodea canadensis]
Length=215

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLT+VFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTSVFMLMHFLMIRKQGISGPL  215



>gb|AFU95997.1| PetB, partial (chloroplast) [Medusagyne oppositifolia]
Length=213

 Score =   429 bits (1103),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/213 (98%), Positives = 212/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+TGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWITGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLT+VFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTSVFMLMHFSMIRKQGISGPL  213



>gb|AEJ10389.1| cytochrome b6 [Potarophytum riparium]
Length=215

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCF+VQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFIVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_009115445.1| PetB; cytochrome b6 (chloroplast) [Acacia ligulata]
 emb|CED95192.1| PetB; cytochrome b6 (chloroplast) [Acacia ligulata]
Length=215

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGS LVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_009109234.1| cytochrome b6 [Corallorhiza wisteriana]
 ref|YP_009108955.1| cytochrome b6 [Corallorhiza bulbosa]
 gb|AIW51234.1| cytochrome b6 [Corallorhiza bulbosa]
 gb|AIW51363.1| cytochrome b6 [Corallorhiza maculata var. mexicana]
 gb|AIW51702.1| cytochrome b6 [Corallorhiza wisteriana]
Length=217

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGG+TLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGVTLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>gb|AFU95969.1| PetB, partial (chloroplast) [Balanops pachyphylla]
Length=213

 Score =   429 bits (1103),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 210/213 (99%), Positives = 212/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  213



>ref|NP_054964.1| cytochrome b6 [Spinacia oleracea]
 sp|P00165.1|CYB6_SPIOL RecName: Full=Cytochrome b6 (chloroplast) [Spinacia oleracea]
 emb|CAA30128.1| petB [Spinacia oleracea]
 emb|CAB88757.1| cytochrome b6 (chloroplast) [Spinacia oleracea]
Length=215

 Score =   429 bits (1103),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVT+AFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTDAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_004733273.1| cytochrome b6 [Indocalamus longiauritus]
 ref|YP_004733607.1| cytochrome b6 [Phyllostachys edulis]
 ref|YP_004733789.1| cytochrome b6 [Acidosasa purpurea]
 ref|YP_004734007.1| cytochrome b6 [Phyllostachys nigra var. henonis]
 ref|YP_005088562.1| petB gene product (chloroplast) [Phyllostachys propinqua]
 ref|YP_009051365.1| cytochrome b6 (chloroplast) [Phyllostachys sulphurea]
 ref|YP_009052613.1| cytochrome b6 (chloroplast) [Arundinaria fargesii]
 ref|YP_009052696.1| cytochrome b6 (chloroplast) [Sarocalamus faberi]
 ref|YP_009052780.1| cytochrome b6 (chloroplast) [Chimonocalamus longiusculus]
 ref|YP_009052862.1| cytochrome b6 (chloroplast) [Fargesia nitida]
 ref|YP_009052945.1| cytochrome b6 (chloroplast) [Fargesia spathacea]
 ref|YP_009053028.1| cytochrome b6 (chloroplast) [Fargesia yunnanensis]
 ref|YP_009053111.1| cytochrome b6 (chloroplast) [Gaoligongshania megalothyrsa]
 ref|YP_009053360.1| cytochrome b6 (chloroplast) [Indosasa sinica]
 ref|YP_009053442.1| cytochrome b6 (chloroplast) [Oligostachyum shiuyingianum]
 ref|YP_009053689.1| cytochrome b6 (chloroplast) [Yushania levigata]
 ref|YP_009053524.1| cytochrome b6 (chloroplast) [Pleioblastus maculatus]
 ref|YP_009053606.1| cytochrome b6 (chloroplast) [Thamnocalamus spathiflorus]
 gb|ADN32920.1| cytochrome b6 [Phyllostachys nigra var. henonis]
 gb|ADO65171.1| cytochrome b6 [Acidosasa purpurea]
 gb|ADO65337.1| cytochrome b6 [Indocalamus longiauritus]
 gb|ADO65419.1| cytochrome b6 [Phyllostachys edulis]
 gb|AEO21290.1| cytochrome b6 (chloroplast) [Phyllostachys propinqua]
 gb|AFS67094.1| cytochrome b6 (chloroplast) [Arundinaria fargesii]
 gb|AFS67176.1| cytochrome b6 (chloroplast) [Sarocalamus faberi]
 gb|AFS67261.1| cytochrome b6 (chloroplast) [Chimonocalamus longiusculus]
 gb|AFS67343.1| cytochrome b6 (chloroplast) [Fargesia nitida]
 gb|AFS67426.1| cytochrome b6 (chloroplast) [Fargesia spathacea]
 gb|AFS67509.1| cytochrome b6 (chloroplast) [Fargesia yunnanensis]
 gb|AFS67592.1| cytochrome b6 (chloroplast) [Gaoligongshania megalothyrsa]
 gb|AFS67841.1| cytochrome b6 (chloroplast) [Indosasa sinica]
 gb|AFS67923.1| cytochrome b6 (chloroplast) [Oligostachyum shiuyingianum]
 gb|AFS68005.1| cytochrome b6 (chloroplast) [Pleioblastus maculatus]
 gb|AFS68087.1| cytochrome b6 (chloroplast) [Thamnocalamus spathiflorus]
 gb|AFS68170.1| cytochrome b6 (chloroplast) [Yushania levigata]
 gb|AHZ61406.1| cytochrome b6 [Bergbambos tessellata]
 gb|AIH00351.1| cytochrome b6 (chloroplast) [Phyllostachys sulphurea]
Length=215

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AHA12868.1| cytochrome b6 [Maranta leuconeura]
Length=217

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  123   GVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_001468338.1| cytochrome b6 [Ipomoea purpurea]
 gb|ABV02378.1| cytochrome b6 [Ipomoea purpurea]
 gb|AGW96367.1| cytochrome b6 (chloroplast) [Ipomoea batatas]
 gb|AGW96450.1| cytochrome b6 (chloroplast) [Ipomoea batatas]
 gb|AGW96537.1| cytochrome b6 (chloroplast) [Ipomoea batatas]
 gb|AGW96621.1| cytochrome b6 (chloroplast) [Ipomoea trifida]
 gb|AGW96704.1| cytochrome b6 (chloroplast) [Argyreia nervosa]
 gb|AGW96791.1| cytochrome b6 (chloroplast) [Ipomoea amnicola]
 gb|AGW96876.1| cytochrome b6 (chloroplast) [Ipomoea argillicola]
 gb|AGW96961.1| cytochrome b6 (chloroplast) [Ipomoea cairica]
 gb|AGW97046.1| cytochrome b6 (chloroplast) [Ipomoea diamantinensis]
 gb|AGW97131.1| cytochrome b6 (chloroplast) [Ipomoea dumetorum]
 gb|AGW97301.1| cytochrome b6 (chloroplast) [Ipomoea hederifolia]
 gb|AGW97471.1| cytochrome b6 (chloroplast) [Ipomoea murucoides]
 gb|AGW97556.1| cytochrome b6 (chloroplast) [Ipomoea nil]
 gb|AGW97641.1| cytochrome b6 (chloroplast) [Ipomoea orizabensis]
 gb|AGW97724.1| cytochrome b6 (chloroplast) [Ipomoea pedicellaris]
 gb|AGW97809.1| cytochrome b6 (chloroplast) [Ipomoea pes-caprae]
 gb|AGW97895.1| cytochrome b6 (chloroplast) [Ipomoea polpha]
 gb|AGW97980.1| cytochrome b6 (chloroplast) [Ipomoea setosa]
 gb|AGW98064.1| cytochrome b6 (chloroplast) [Ipomoea splendor-sylvae]
 gb|AGW98149.1| cytochrome b6 (chloroplast) [Ipomoea ternifolia]
 gb|AGW98234.1| cytochrome b6 (chloroplast) [Ipomoea tricolor]
 gb|AGW98319.1| cytochrome b6 (chloroplast) [Ipomoea trifida]
 gb|AGW98404.1| cytochrome b6 (chloroplast) [Ipomoea cordatotriloba]
 gb|AGW98489.1| cytochrome b6 (chloroplast) [Ipomoea minutiflora]
 gb|AGW98575.1| cytochrome b6 (chloroplast) [Ipomoea obscura]
 gb|AGW98660.1| cytochrome b6 (chloroplast) [Ipomoea pes-tigridis]
 gb|AGW98745.1| cytochrome b6 (chloroplast) [Merremia quinquefolia]
 gb|AGW98829.1| cytochrome b6 (chloroplast) [Operculina macrocarpa]
 gb|AGW98915.1| cytochrome b6 (chloroplast) [Stictocardia macalusoi]
 gb|AGW98999.1| cytochrome b6 (chloroplast) [Turbina corymbosa]
Length=215

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|ACH47645.1| cytochrome b6 [Sarcocaulon vanderietiae]
Length=215

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLL+AVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLSAVFMLMHFLMIRKQGISGPL  215



>ref|YP_001004216.1| cytochrome b6 [Ranunculus macranthus]
 gb|ABC70786.1| cytochrome b6 [Ranunculus macranthus]
 gb|ADD31093.1| cytochrome b6 protein (chloroplast) [Heuchera sanguinea]
Length=215

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_009053277.1| cytochrome b6 (chloroplast) [Indocalamus wilsonii]
 ref|YP_009093830.1| cytochrome b6 (chloroplast) [Luzuriaga radicans]
 gb|AFS67758.1| cytochrome b6 (chloroplast) [Indocalamus wilsonii]
 gb|AIT16053.1| cytochrome b6 (chloroplast) [Luzuriaga radicans]
Length=215

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+L VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AFU95976.1| PetB, partial (chloroplast) [Chrysobalanus icaco]
Length=213

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 210/213 (99%), Positives = 212/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+TGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWLTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  213



>ref|YP_913217.1| cytochrome b6 [Gossypium barbadense]
 ref|YP_005088310.1| cytochrome b6 (chloroplast) [Gossypium tomentosum]
 ref|YP_005088406.1| cytochrome b6 (chloroplast) [Gossypium herbaceum subsp. africanum]
 ref|YP_005088946.1| cytochrome b6 (chloroplast) [Gossypium mustelinum]
 ref|YP_005089029.1| cytochrome b6 (chloroplast) [Gossypium arboreum]
 ref|YP_006503473.1| cytochrome b6 (chloroplast) [Gossypium capitis-viridis]
 ref|YP_006503639.1| cytochrome b6 (chloroplast) [Gossypium robinsonii]
 ref|YP_008994424.1| cytochrome b6 (chloroplast) (chloroplast) [Viviania marifolia]
 sp|A0ZZ65.1|CYB6_GOSBA RecName: Full=Cytochrome b6 (chloroplast) [Gossypium barbadense]
 sp|Q2L933.2|CYB6_GOSHI RecName: Full=Cytochrome b6 (chloroplast) [Gossypium hirsutum]
 dbj|BAF41277.1| Cytochrome b6 [Gossypium barbadense]
 gb|ADV38794.1| cytochrome b6 (chloroplast) [Gossypium arboreum]
 gb|ADV38960.1| cytochrome b6 (chloroplast) [Gossypium herbaceum subsp. africanum]
 gb|ADV39043.1| cytochrome b6 (chloroplast) [Gossypium mustelinum]
 gb|ADV39209.1| cytochrome b6 (chloroplast) [Gossypium tomentosum]
 gb|AEB90515.1| cytochrome b6 (chloroplast) [Gossypium hirsutum]
 gb|AEB90598.1| cytochrome b6 (chloroplast) [Gossypium hirsutum]
 gb|AEB90681.1| cytochrome b6 (chloroplast) [Gossypium barbadense]
 gb|AEB90764.1| cytochrome b6 (chloroplast) [Gossypium barbadense]
 gb|AEB90847.1| cytochrome b6 (chloroplast) [Gossypium barbadense]
 gb|AEH43119.1| cytochrome b6 (chloroplast) [Gossypium capitis-viridis]
 gb|AEH43285.1| cytochrome b6 [Gossypium robinsonii]
 gb|AGV02852.1| cytochrome b6 (chloroplast) [Viviania marifolia]
Length=215

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_001023731.1| cytochrome b6 (chloroplast) [Angiopteris evecta]
 gb|ABG79630.1| cytochrome b6 (chloroplast) [Angiopteris evecta]
 gb|AJE71330.1| cytochrome b6 [Angiopteris angustifolia]
Length=215

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 207/215 (96%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLT SFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGS SVGQSTL
Sbjct  121   GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSVSVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_004221951.1| cytochrome b6 [Erodium carvifolium]
 gb|ADU58176.1| cytochrome b6 [Erodium carvifolium]
 gb|AHF21180.1| cytochrome b6 [Erodium manescavi]
Length=215

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MDKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AFU96006.1| PetB, partial (chloroplast) [Drypetes roxburghii]
Length=213

 Score =   429 bits (1102),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 210/213 (99%), Positives = 211/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPL TAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLFTAVFMLMHFPMIRKQGISGPL  213



>gb|ADD31080.1| cytochrome b6 protein (chloroplast) [Lonicera japonica]
Length=215

 Score =   429 bits (1102),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVT+AFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIG PLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGPPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_003934064.1| cytochrome b6/f complex subunit II [Geranium palmatum]
 gb|ACH47641.1| cytochrome b6 [Geranium carolinianum]
 gb|ACH47643.1| cytochrome b6 [Geranium palmatum]
 gb|ADJ66363.1| cytochrome b6/f complex subunit II [Geranium palmatum]
Length=215

 Score =   429 bits (1102),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AFW65461.1| hypothetical protein ZEAMMB73_679753 [Zea mays]
Length=232

 Score =   429 bits (1104),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 210/220 (95%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  1097  GNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMT  918
             G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMT
Sbjct  13    GLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMT  72

Query  917   FYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRE  738
             FYYRPTVTEAF+S+QYIMTEA FGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRE
Sbjct  73    FYYRPTVTEAFSSIQYIMTEAKFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRE  132

Query  737   LTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASV  558
             LTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVT VPEAIPVI SPLVELLRGSASV
Sbjct  133   LTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTCVPEAIPVIRSPLVELLRGSASV  192

Query  557   GQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             GQSTLTRFYSLHTFVLPLLTA+FMLMHF MIRKQGISGPL
Sbjct  193   GQSTLTRFYSLHTFVLPLLTAIFMLMHFPMIRKQGISGPL  232



>gb|AAZ04011.1| cytochrome b6 [Nuphar advena]
Length=213

 Score =   429 bits (1102),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/213 (98%), Positives = 212/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+F+CLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFHCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPV+GSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVVGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  213



>gb|AEJ10362.1| cytochrome b6 [Centrolepis monogyna]
Length=215

 Score =   429 bits (1102),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 207/215 (96%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SV+YIMT+ NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVEYIMTDVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLT VFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTTVFMLMHFLMIRKQGISGPL  215



>ref|YP_005089982.1| petB gene product (chloroplast) [Brassica napus]
 gb|ACY66235.1| cytochrome b6 [Brassica napus]
 gb|AIK29034.1| cytochrome b6 (chloroplast) [Brassica napus]
Length=214

 Score =   429 bits (1102),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/213 (98%), Positives = 211/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
              VYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  2     SVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  61

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  62    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  121

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  122   VLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTLTR  181

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  182   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  214



>gb|AFM83323.1| cytochrome b6 (chloroplast) [Kingia australis]
Length=217

 Score =   429 bits (1102),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLT+VFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTSVFMLMHFPMIRKQGISGPL  217



>ref|YP_009114264.1| cytochrome b6 (chloroplast) [Sedum takesimense]
 gb|AHJ61261.1| cytochrome b6 (chloroplast) [Sedum takesimense]
Length=215

 Score =   429 bits (1102),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFK+PRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKRPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AHA12954.1| cytochrome b6 [Monocostus uniflorus]
 gb|AHA13040.1| cytochrome b6 [Costus pulverulentus]
Length=217

 Score =   429 bits (1102),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  123   GVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPLIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_665588.1| cytochrome b6 [Populus alba]
 ref|YP_001109532.1| cytochrome b6 [Populus trichocarpa]
 ref|YP_009054165.1| cytochrome b6 (chloroplast) [Populus balsamifera]
 ref|YP_009054084.1| cytochrome b6 (chloroplast) [Populus fremontii]
 sp|Q14FC7.1|CYB6_POPAL RecName: Full=Cytochrome b6 (chloroplast) [Populus alba]
 dbj|BAE97235.1| cytochrome b6 (chloroplast) [Populus alba]
 gb|ABO36736.1| cytochrome b6 [Populus trichocarpa]
 gb|AID60418.1| cytochrome b6 (chloroplast) [Populus fremontii]
 gb|AID60499.1| cytochrome b6 (chloroplast) [Populus balsamifera]
Length=215

 Score =   429 bits (1102),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQ IADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQTIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_009113540.1| cytochrome b6 (chloroplast) [Bowenia serrulata]
 dbj|BAE94558.1| cytochrome b6 complex subunit (chloroplast) [Takakia lepidozioides]
 dbj|BAE94565.1| cytochrome b6 complex subunit [Takakia lepidozioides]
 dbj|BAL03656.1| cytochrome b6 (chloroplast) [Bowenia serrulata]
 gb|AFR13716.1| cytochrome b6 (chloroplast) [Bowenia serrulata]
 gb|AFS64379.1| cytochrome b6 (chloroplast) [Macrozamia mountperriensis]
Length=215

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 211/215 (98%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             + KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLT SFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGS SVGQSTL
Sbjct  121   GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSVSVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AFU95971.1| PetB, partial (chloroplast) [Bhesa sp. CCD-2012]
Length=213

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/213 (98%), Positives = 212/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+TGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWITGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLT+VFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTSVFMLMHFPMIRKQGISGPL  213



>ref|YP_008994598.1| cytochrome b6 (chloroplast) (chloroplast) [Pelargonium alternans]
 gb|AGV03026.1| cytochrome b6 (chloroplast) [Pelargonium alternans]
Length=215

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLL+AVFML+HFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLSAVFMLIHFLMIRKQGISGPL  215



>gb|AEJ10378.1| cytochrome b6 [Kingia australis]
Length=215

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLT+VFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTSVFMLMHFPMIRKQGISGPL  215



>gb|AHH29757.1| cytochrome b6 (chloroplast) [Fritillaria unibracteata var. wabuensis]
Length=221

 Score =   429 bits (1102),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  1088  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYY  909
             TY NKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYY
Sbjct  5     TYPNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYY  64

Query  908   RPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  729
             RPTVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW
Sbjct  65    RPTVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW  124

Query  728   VTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQS  549
             VTGV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIG PLVELLRGSASVGQS
Sbjct  125   VTGVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGLPLVELLRGSASVGQS  184

Query  548   TLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  185   TLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  221



>gb|AFU95990.1| PetB, partial (chloroplast) [Hypericum kalmianum]
Length=213

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 211/213 (99%), Positives = 211/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP IGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPGIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  213



>gb|AEZ01454.1| cytochrome b6, partial (chloroplast) [Japonolirion osense]
Length=215

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+T
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWIT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_009033915.1| cytochrome b6 [Dioscorea rotundata]
 gb|AHZ18160.1| cytochrome b6 [Dioscorea rotundata]
Length=215

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGS SVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSTSVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_001595538.1| cytochrome b6/f complex PetB protein [Lemna minor]
 gb|ABD48525.1| cytochrome b6/f complex PetB protein [Lemna minor]
Length=215

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 207/215 (96%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             + KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MKKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+L VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|EMS62069.1| Cytochrome b6 [Triticum urartu]
Length=232

 Score =   429 bits (1103),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/220 (95%), Positives = 214/220 (97%), Gaps = 0/220 (0%)
 Frame = -1

Query  1097  GNSTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMT  918
             G  TYLNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMT
Sbjct  13    GLVTYLNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMT  72

Query  917   FYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRE  738
             FYYRPT+TEAF+SVQYIM+EANFGWLIRSVHRWSASMMVLMMILHVFRVYL GGFKK RE
Sbjct  73    FYYRPTITEAFSSVQYIMSEANFGWLIRSVHRWSASMMVLMMILHVFRVYLIGGFKKSRE  132

Query  737   LTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASV  558
             LTWVTGV LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASV
Sbjct  133   LTWVTGVFLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASV  192

Query  557   GQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             GQSTLTRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  193   GQSTLTRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  232



>ref|YP_003778188.1| cytochrome b6 [Phoenix dactylifera]
 gb|ADD63200.2| cytochrome b6 (chloroplast) [Phoenix dactylifera]
Length=217

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_003934304.1| cytochrome b6 [Monsonia speciosa]
 gb|ACH47644.1| cytochrome b6 [Monsonia speciosa]
 gb|ADJ66439.1| cytochrome b6 [Monsonia speciosa]
Length=215

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFK+PRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKRPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQ+GYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQVGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|EPS74506.1| hypothetical protein M569_00223, partial [Genlisea aurea]
Length=215

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQ IADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQTIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AEJ10371.1| cytochrome b6 [Fosterella caulescens]
 gb|AEJ10384.1| cytochrome b6 [Neoregelia carolinae]
 gb|AEJ10388.1| cytochrome b6 [Pitcairnia feliciana]
 gb|AEJ10390.1| cytochrome b6 [Puya laxa]
Length=215

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFYSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_001381699.1| cytochrome b6 [Medicago truncatula]
 ref|YP_009027152.1| cytochrome b6 [Trifolium aureum]
 ref|YP_009027076.1| cytochrome b6 [Trifolium grandiflorum]
 gb|AGO63730.1| cytochrome b6 [Trifolium grandiflorum]
 gb|AGO63806.1| cytochrome b6 [Trifolium aureum]
Length=217

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGS +VELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSSVVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_005089363.1| petB gene product (chloroplast) [Silene vulgaris]
 gb|AEC04277.1| cytochrome b6 (chloroplast) [Silene vulgaris]
Length=215

 Score =   428 bits (1101),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQ+IADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQSIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPV+GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVVGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_008963631.1| cytochrome b6 (chloroplast) [Lupinus luteus]
 gb|AGK82944.1| cytochrome b6 (chloroplast) [Lupinus luteus]
Length=215

 Score =   428 bits (1101),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGS +VELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSVVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AFU96000.1| PetB, partial (chloroplast) [Passiflora ciliata]
Length=213

 Score =   428 bits (1100),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 209/213 (98%), Positives = 211/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVL LLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   FYSLHTFVLTLLTAVFMLMHFLMIRKQGISGPL  213



>ref|YP_009109307.1| cytochrome b6 [Corallorhiza odontorhiza]
 gb|AIW51775.1| cytochrome b6 [Corallorhiza odontorhiza]
Length=217

 Score =   428 bits (1101),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGG+TLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGVTLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSA+VGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSANVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_247630.1| cytochrome b6 [Cucumis sativus]
 ref|YP_740595.1| cytochrome b6 [Platanus occidentalis]
 ref|YP_817512.1| cytochrome b6 [Coffea arabica]
 ref|YP_004021180.1| cytochrome b6 [Castanea mollissima]
 ref|YP_004072492.1| cytochrome b6 [Corynocarpus laevigata]
 ref|YP_004935696.1| petB gene product (chloroplast) [Sesamum indicum]
 ref|YP_007353944.1| cytochrome b6 (chloroplast) [Tectona grandis]
 ref|YP_007375073.1| cytochrome b6 [Quercus rubra]
 ref|YP_008081395.1| cytochrome b6 (chloroplast) [Tetracentron sinense]
 ref|YP_008815967.1| cytochrome b6 (chloroplast) [Lindenbergia philippensis]
 ref|YP_008963721.1| cytochrome b6 (chloroplast) [Liquidambar formosana]
 ref|YP_008964896.1| cytochrome b6 (chloroplast) [Schwalbea americana]
 ref|YP_009004073.1| cytochrome b6 [Cucumis hystrix]
 ref|YP_009019821.1| cytochrome b6 (chloroplast) [Vitis rotundifolia]
 ref|YP_009020249.1| cytochrome b6 (chloroplast) [Castanopsis echinocarpa]
 sp|Q4VZI6.1|CYB6_CUCSA RecName: Full=Cytochrome b6 (chloroplast) [Cucumis sativus]
 sp|A0A365.1|CYB6_COFAR RecName: Full=Cytochrome b6 (chloroplast) [Coffea arabica]
 emb|CAJ00789.1| cytochrome b6 [Cucumis sativus]
 gb|AAZ94680.1| cytochrome b6 [Cucumis sativus]
 gb|ABI49809.1| cytochrome b6 [Platanus occidentalis]
 gb|ABJ89708.1| cytochrome b6 [Coffea arabica]
 gb|ADD31081.1| cytochrome b6 protein (chloroplast) [Meliosma aff. cuneifolia 
Moore 333]
 gb|ADD31087.1| cytochrome b6 protein (chloroplast) [Berberidopsis corallina]
 gb|ADD31094.1| cytochrome b6 protein (chloroplast) [Liquidambar styraciflua]
 gb|ADD31097.1| cytochrome b6 protein (chloroplast) [Quercus nigra]
 gb|ADO60340.1| cytochrome b6 [Corynocarpus laevigata]
 gb|ADO65090.1| cytochrome b6 [Castanea mollissima]
 gb|AEO92736.1| cytochrome b6 (chloroplast) [Sesamum indicum]
 emb|CCP47160.1| cytochrome b6 (chloroplast) [Tectona grandis]
 emb|CCP47249.1| cytochrome b6 (chloroplast) [Tectona grandis]
 emb|CCP47338.1| cytochrome b6 (chloroplast) [Tectona grandis]
 gb|AGC31276.1| cytochrome b6 [Quercus rubra]
 gb|AGJ72087.1| cytochrome b6 (chloroplast) [Tetracentron sinense]
 gb|AGL13460.1| cytochrome b6 (chloroplast) [Liquidambar formosana]
 gb|AGL45366.1| PetB (chloroplast) [Sesamum indicum]
 emb|CDI43948.1| cytochrome b6 (chloroplast) [Lindenbergia philippensis]
 emb|CDJ38658.1| cytochrome b6 (chloroplast) [Schwalbea americana]
 gb|AHJ61415.1| cytochrome b6 [Cucumis hystrix]
 gb|AHJ91240.1| cytochrome b6 (chloroplast) [Vitis rotundifolia]
 gb|AHL16936.1| cytochrome b6 (chloroplast) [Castanopsis echinocarpa]
 gb|AJE28405.1| cytochrome b6 (chloroplast) [Premna microphylla]
Length=215

 Score =   428 bits (1100),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_007026582.1| cytochrome b6 [Festuca ovina]
 gb|AFV62762.1| cytochrome b6 [Festuca ovina]
Length=215

 Score =   428 bits (1100),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|ACH47646.1| cytochrome b6 [Pelargonium cotyledonis]
Length=215

 Score =   428 bits (1100),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLL+AVFML+HFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLSAVFMLIHFLMIRKQGISGPL  215



>ref|YP_538795.1| cytochrome b6 [Glycine max]
 ref|YP_008145740.1| cytochrome b6 (chloroplast) [Glycine cyrtoloba]
 ref|YP_008816276.1| cytochrome b6 (chloroplast) [Glycine soja]
 sp|Q2PMQ5.1|CYB6_SOYBN RecName: Full=Cytochrome b6 (chloroplast) [Glycine max]
 gb|ABC25153.1| cytochrome b6 [Glycine max]
 gb|AGO44189.1| cytochrome b6 (chloroplast) [Glycine cyrtoloba]
 gb|AHA04011.1| cytochrome b6 (chloroplast) [Glycine soja]
Length=215

 Score =   428 bits (1100),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGS LVELLRGS+SVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSSLVELLRGSSSVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  215



>gb|AGW97216.1| cytochrome b6 (chloroplast) [Ipomoea eriocarpa]
 gb|AGW97386.1| cytochrome b6 (chloroplast) [Ipomoea involucrata]
Length=215

 Score =   428 bits (1100),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AHA12710.1| cytochrome b6 [Orchidantha fimbriata]
Length=217

 Score =   428 bits (1100),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTA+FMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAIFMLMHFPMIRKQGISGPL  217



>ref|YP_007889891.1| cytochrome b6 [Francoa sonchifolia]
 ref|YP_008994319.1| cytochrome b6 [Melianthus villosus]
 gb|AFJ00501.1| cytochrome b6 [Francoa sonchifolia]
 gb|AGS13037.1| cytochrome b6 [Melianthus villosus]
Length=215

 Score =   428 bits (1100),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|ACH47642.1| cytochrome b6 [Geranium macrorrhizum]
Length=215

 Score =   428 bits (1100),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFK+PRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKRPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AFU96008.1| PetB, partial (chloroplast) [Rhizophora mangle]
Length=213

 Score =   427 bits (1099),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 209/213 (98%), Positives = 211/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             +LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   ILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  213



>ref|YP_009024711.1| cytochrome b6 (chloroplast) [Prunus kansuensis]
 gb|AHN13567.1| cytochrome b6 (chloroplast) [Prunus kansuensis]
Length=217

 Score =   428 bits (1100),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNK+YDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKIYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>gb|AFU95993.1| PetB, partial (chloroplast) [Ixonanthes sp. CCD-2012]
Length=213

 Score =   427 bits (1099),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 210/213 (99%), Positives = 211/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIP IGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPGIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  213



>gb|AGE93227.1| cytochrome b6 [Calectasia narragara]
Length=217

 Score =   427 bits (1099),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASV QSTL
Sbjct  123   GVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVSQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>ref|YP_740232.1| cytochrome b6 [Liriodendron tulipifera]
 ref|YP_004769744.1| cytochrome b6 [Magnolia kwangsiensis]
 ref|YP_006576144.1| PetB (chloroplast) [Magnolia denudata]
 ref|YP_007474482.1| cytochrome b6 (chloroplast) [Magnolia officinalis subsp. biloba]
 ref|YP_007474566.1| cytochrome b6 (chloroplast) [Magnolia grandiflora]
 ref|YP_008993206.1| cytochrome b6 (chloroplast) [Magnolia cathcartii]
 ref|YP_008993292.1| cytochrome b6 (chloroplast) [Magnolia dealbata]
 ref|YP_008993378.1| cytochrome b6 (chloroplast) [Magnolia pyramidata]
 ref|YP_008993464.1| cytochrome b6 (chloroplast) [Magnolia kobus]
 ref|YP_008993636.1| cytochrome b6 (chloroplast) [Magnolia odora]
 ref|YP_008993808.1| cytochrome b6 (chloroplast) [Magnolia sinica]
 ref|YP_008993894.1| cytochrome b6 (chloroplast) [Magnolia sprengeri]
 ref|YP_008993722.1| cytochrome b6 (chloroplast) [Magnolia salicifolia]
 ref|YP_009026911.1| cytochrome b6 [Magnolia tripetala]
 ref|YP_009048317.1| cytochrome b6 (chloroplast) [Magnolia yunnanensis]
 sp|Q0G9I9.1|CYB6_LIRTU RecName: Full=Cytochrome b6 (chloroplast) [Liriodendron tulipifera]
 gb|ABI32539.1| cytochrome b6 [Liriodendron tulipifera]
 gb|ADL39086.1| cytochrome b6 [Magnolia kwangsiensis]
 gb|AEM65247.1| PetB [Magnolia denudata]
 gb|AEX98281.1| cytochrome b6 (chloroplast) [Magnolia liliiflora]
 gb|AEX98364.1| cytochrome b6 (chloroplast) [Magnolia denudata]
 gb|AEX98614.1| cytochrome b6 (chloroplast) [Magnolia officinalis subsp. biloba]
 gb|AEX98698.1| cytochrome b6 (chloroplast) [Magnolia officinalis subsp. biloba]
 gb|AEX98782.1| cytochrome b6 (chloroplast) [Magnolia officinalis subsp. biloba]
 gb|AEX98949.1| cytochrome b6 (chloroplast) [Magnolia grandiflora]
 gb|AEX99117.1| cytochrome b6 (chloroplast) [Magnolia grandiflora]
 gb|AHF72102.1| cytochrome b6 (chloroplast) [Magnolia yunnanensis]
 gb|AHW51987.1| cytochrome b6 [Magnolia tripetala]
Length=215

 Score =   427 bits (1099),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_008082611.1| cytochrome b6 (chloroplast) [Utricularia gibba]
 gb|AGL61105.1| cytochrome b6 (chloroplast) [Utricularia gibba]
Length=215

 Score =   427 bits (1099),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_007475734.1| cytochrome b6 [Zingiber spectabile]
 ref|YP_008854624.1| cytochrome b6 [Curcuma roscoeana]
 gb|AGE92798.1| cytochrome b6 [Zingiber spectabile]
 gb|AGE93399.1| cytochrome b6 [Alpinia zerumbet]
 gb|AHA13126.1| cytochrome b6 [Curcuma roscoeana]
Length=217

 Score =   427 bits (1099),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 210/215 (98%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIP IGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPGIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>gb|AEJ10372.1| cytochrome b6 [Georgeantha hexandra]
Length=215

 Score =   427 bits (1099),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 207/215 (96%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             T+TEAF+SVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTW+T
Sbjct  61    TITEAFSSVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWIT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGS LVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPQAIPVIGSSLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_009026467.1| cytochrome b6 (chloroplast) [Dendrobium catenatum]
 gb|AGM48225.1| cytochrome b6 (chloroplast) [Dendrobium catenatum]
 gb|AIR76417.1| cytochrome b6 (chloroplast) [Dendrobium catenatum]
Length=215

 Score =   427 bits (1099),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIP+IGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPIIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL  215



>gb|AHI87558.1| cytochrome b6 (chloroplast) [Chionographis japonica]
Length=215

 Score =   427 bits (1099),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFFSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGS SVGQSTL
Sbjct  121   GVILAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSTSVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>ref|YP_005089606.1| petB gene product (chloroplast) [Silene latifolia]
 gb|AEC04114.1| cytochrome b6 (chloroplast) [Silene latifolia]
Length=215

 Score =   427 bits (1099),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPV+GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVVGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>gb|AAZ04012.1| cytochrome b6 [Ranunculus macranthus]
 gb|AFU96013.1| PetB, partial (chloroplast) [Viola pubescens]
Length=213

 Score =   427 bits (1098),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 209/213 (98%), Positives = 211/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  213



>ref|YP_001837390.1| cytochrome b6 [Guizotia abyssinica]
 gb|ACB86556.1| cytochrome b6 [Guizotia abyssinica]
Length=215

 Score =   427 bits (1098),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVT+AFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTDAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFY LHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYILHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|ADN86073.1| cytochrome b6 [Chasmanthium latifolium]
Length=213

 Score =   427 bits (1098),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 209/213 (98%), Positives = 211/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV
Sbjct  61    TEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR
Sbjct  121   VLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  213



>gb|AFM54180.1| PetB (chloroplast) [Ceratozamia hildae]
 gb|AFM54181.1| PetB (chloroplast) [Zamia furfuracea]
 gb|AFR13803.1| cytochrome b6 (chloroplast) [Ceratozamia hildae]
 gb|AFR45403.1| cytochrome b6 (chloroplast) [Zamia furfuracea]
Length=215

 Score =   427 bits (1098),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 207/215 (96%), Positives = 211/215 (98%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             + KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GV+LAVLT SFGVTGYSLPWDQIGYWAVKIVTGVPEAIP+IGSPLVELLRGS SVGQSTL
Sbjct  121   GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPLIGSPLVELLRGSVSVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_009051591.1| cytochrome b6 (chloroplast) [Salix interior]
 gb|AII01938.1| cytochrome b6 (chloroplast) [Salix interior]
Length=215

 Score =   427 bits (1098),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQ IADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQTIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AFU95975.1| PetB, partial (chloroplast) [Centroplacus glaucinus]
Length=213

 Score =   427 bits (1098),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 208/213 (98%), Positives = 211/213 (99%), Gaps = 0/213 (0%)
 Frame = -1

Query  1076  KVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRPTV  897
             KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRPTV
Sbjct  1     KVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTV  60

Query  896   TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGV  717
             TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILH+FRVYLTGGFKKPRELTW+TGV
Sbjct  61    TEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWITGV  120

Query  716   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTR  537
             VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIG PLVELLRGSASVGQSTLTR
Sbjct  121   VLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGXPLVELLRGSASVGQSTLTR  180

Query  536   FYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             FYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   FYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  213



>ref|YP_003434005.1| cytochrome b6 [Typha latifolia]
 ref|YP_008578315.1| cytochrome b6 (chloroplast) [Cocos nucifera]
 ref|YP_009045596.1| cytochrome b6 (chloroplast) [Cypripedium macranthos]
 ref|YP_009108464.1| cytochrome b6 (chloroplast) [Genlisea margaretae]
 gb|ADA63729.1| cytochrome b6 [Typha latifolia]
 gb|AGS43495.1| cytochrome b6 (chloroplast) [Cocos nucifera]
 gb|AHI16779.1| cytochrome b6 (chloroplast) (chloroplast) [Cypripedium macranthos]
 emb|CDI44024.1| cytochrome b6 (chloroplast) [Genlisea margaretae]
Length=215

 Score =   427 bits (1098),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  215



>gb|AHF21105.1| cytochrome b6 [Erodium rupestre]
Length=215

 Score =   427 bits (1098),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MDKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_009000126.1| cytochrome b6 (chloroplast) (chloroplast) [Silene chalcedonica]
 gb|AGZ18117.1| cytochrome b6 (chloroplast) [Silene chalcedonica]
Length=215

 Score =   427 bits (1098),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTE NFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVLAVLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPV+GSPLVELLRGSASVGQSTL
Sbjct  121   GVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVVGSPLVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  215



>ref|YP_009059549.1| cytochrome b6 [Iris gatesii]
 gb|AIN79018.1| cytochrome b6 [Iris gatesii]
Length=217

 Score =   427 bits (1098),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 209/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             LNKVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  3     LNKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  62

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAF+SVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  63    TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  122

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLP DQIGYWAVKIVTGVP+AIPVIGSPLVELLRGSASVGQSTL
Sbjct  123   GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL  182

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLHTFVLPLLTAVFMLMHF MIRKQGISGPL
Sbjct  183   TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL  217



>gb|AFK41288.1| unknown [Lotus japonicus]
Length=215

 Score =   427 bits (1098),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 208/215 (97%), Positives = 212/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  1082  LNKVYDWFEERLEIQAIADDITSKYVPPHVNLFYCLGGITLTCFLVQVATGFAMTFYYRP  903
             ++KVYDWFEERLEIQAIADDITSKYVPPHVN+FYCLGGITLTCFLVQVATGFAMTFYYRP
Sbjct  1     MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP  60

Query  902   TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  723
             TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT
Sbjct  61    TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT  120

Query  722   GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL  543
             GVVL VLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGS +VELLRGSASVGQSTL
Sbjct  121   GVVLGVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSVVELLRGSASVGQSTL  180

Query  542   TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL  438
             TRFYSLH FVLPLLTAVFMLMHFLMIRKQGISGPL
Sbjct  181   TRFYSLHIFVLPLLTAVFMLMHFLMIRKQGISGPL  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4516508690724