BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c87075_g1_i1 len=1738 path=[1716:0-1737]

Length=1738
                                                                      Score     E

ref|XP_009614669.1|  PREDICTED: uncharacterized protein LOC104107543    829   0.0      
ref|XP_011084394.1|  PREDICTED: uncharacterized protein LOC105166652    823   0.0      
ref|XP_009782107.1|  PREDICTED: uncharacterized membrane protein ...    820   0.0      
ref|XP_006361717.1|  PREDICTED: uncharacterized protein LOC102585444    808   0.0      
ref|XP_006436519.1|  hypothetical protein CICLE_v10031022mg             781   0.0      
ref|XP_007010021.1|  Major facilitator superfamily protein              764   0.0      
ref|XP_010543563.1|  PREDICTED: uncharacterized protein LOC104816431    762   0.0      
ref|XP_010068872.1|  PREDICTED: uncharacterized protein LOC104455848    759   0.0      
gb|KCW65471.1|  hypothetical protein EUGRSUZ_G02881                     759   0.0      
emb|CDO99802.1|  unnamed protein product                                751   0.0      
ref|XP_007208506.1|  hypothetical protein PRUPE_ppa026488mg             749   0.0      
ref|XP_009335989.1|  PREDICTED: uncharacterized protein LOC103928636    746   0.0      
ref|XP_008226501.1|  PREDICTED: uncharacterized protein LOC103326070    745   0.0      
gb|EYU39872.1|  hypothetical protein MIMGU_mgv1a024761mg                745   0.0      
ref|XP_009345750.1|  PREDICTED: uncharacterized protein LOC103937531    744   0.0      
ref|XP_007208449.1|  hypothetical protein PRUPE_ppa003535mg             743   0.0      
ref|XP_008227863.1|  PREDICTED: uncharacterized membrane protein ...    741   0.0      
ref|XP_008355198.1|  PREDICTED: uncharacterized protein LOC103418866    736   0.0      
ref|XP_004288935.1|  PREDICTED: uncharacterized protein LOC101295952    736   0.0      
ref|XP_011089961.1|  PREDICTED: uncharacterized protein LOC105170755    735   0.0      
ref|XP_006384953.1|  nodulin family protein                             733   0.0      
ref|XP_010111839.1|  hypothetical protein L484_020631                   734   0.0      
ref|XP_008385511.1|  PREDICTED: uncharacterized protein LOC103448054    732   0.0      
ref|XP_008385512.1|  PREDICTED: uncharacterized protein LOC103448055    732   0.0      
ref|XP_009356931.1|  PREDICTED: uncharacterized protein LOC103947712    731   0.0      
gb|KFK32342.1|  hypothetical protein AALP_AA6G229300                    732   0.0      
ref|XP_010414589.1|  PREDICTED: uncharacterized protein LOC104700...    730   0.0      
ref|XP_007016870.1|  Major facilitator superfamily protein              733   0.0      
ref|XP_010470138.1|  PREDICTED: uncharacterized protein LOC104750092    729   0.0      
emb|CDY30506.1|  BnaA04g16270D                                          729   0.0      
ref|XP_011028256.1|  PREDICTED: uncharacterized protein LOC105128342    729   0.0      
ref|XP_009356932.1|  PREDICTED: uncharacterized protein LOC103947713    729   0.0      
emb|CDX71381.1|  BnaC04g16160D                                          728   0.0      
ref|XP_006409833.1|  hypothetical protein EUTSA_v10016458mg             726   0.0      
ref|XP_011032303.1|  PREDICTED: uncharacterized protein LOC105131167    726   0.0      
ref|XP_010510684.1|  PREDICTED: uncharacterized protein LOC104786...    726   0.0      
ref|NP_180379.1|  major facilitator protein                             726   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY04538.1|  BnaA07g13640D                                          726   0.0      
ref|XP_009140846.1|  PREDICTED: uncharacterized protein LOC103864824    726   0.0      
ref|XP_010557355.1|  PREDICTED: uncharacterized protein LOC104826384    725   0.0      
emb|CDP07039.1|  unnamed protein product                                725   0.0      
ref|XP_006295838.1|  hypothetical protein CARUB_v10024965mg             724   0.0      
ref|XP_009103645.1|  PREDICTED: uncharacterized membrane protein ...    724   0.0      
ref|XP_002880951.1|  nodulin family protein                             723   0.0      
ref|XP_002313536.1|  nodulin family protein                             722   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011089957.1|  PREDICTED: uncharacterized protein LOC105170752    722   0.0      
gb|EYU36146.1|  hypothetical protein MIMGU_mgv1a018039mg                720   0.0      
ref|XP_010267225.1|  PREDICTED: uncharacterized protein LOC104604545    719   0.0      
ref|XP_010689140.1|  PREDICTED: uncharacterized protein LOC104902902    718   0.0      
ref|XP_002523712.1|  conserved hypothetical protein                     715   0.0      Ricinus communis
ref|XP_009627404.1|  PREDICTED: uncharacterized protein LOC104117959    715   0.0      
ref|XP_010321905.1|  PREDICTED: uncharacterized protein LOC101251293    713   0.0      
ref|XP_010045310.1|  PREDICTED: uncharacterized protein LOC104434056    711   0.0      
ref|XP_007206680.1|  hypothetical protein PRUPE_ppa022835mg             707   0.0      
ref|XP_004147280.1|  PREDICTED: uncharacterized protein LOC101217765    704   0.0      
ref|XP_008226513.1|  PREDICTED: uncharacterized protein LOC103326077    702   0.0      
gb|KDP43975.1|  hypothetical protein JCGZ_05442                         698   0.0      
ref|XP_004171581.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    699   0.0      
ref|XP_008465591.1|  PREDICTED: uncharacterized protein LOC103503227    698   0.0      
ref|XP_008385510.1|  PREDICTED: uncharacterized protein LOC103448053    696   0.0      
ref|XP_010651774.1|  PREDICTED: uncharacterized protein LOC100244770    700   0.0      
ref|XP_009356979.1|  PREDICTED: uncharacterized protein LOC103947752    693   0.0      
ref|XP_006488014.1|  PREDICTED: uncharacterized protein LOC102630186    693   0.0      
ref|XP_009786215.1|  PREDICTED: uncharacterized protein LOC104234332    693   0.0      
ref|XP_006424462.1|  hypothetical protein CICLE_v10028100mg             689   0.0      
ref|XP_009612261.1|  PREDICTED: uncharacterized protein LOC104105...    685   0.0      
ref|XP_009612260.1|  PREDICTED: uncharacterized protein LOC104105...    684   0.0      
ref|XP_006366091.1|  PREDICTED: uncharacterized protein LOC102598479    681   0.0      
ref|XP_004250977.1|  PREDICTED: uncharacterized membrane protein ...    678   0.0      
ref|XP_002273103.2|  PREDICTED: uncharacterized protein LOC100249900    673   0.0      Vitis vinifera
emb|CAN82898.1|  hypothetical protein VITISV_026994                     673   0.0      Vitis vinifera
emb|CDX77158.1|  BnaC04g39530D                                          670   0.0      
gb|KDO60260.1|  hypothetical protein CISIN_1g037996mg                   666   0.0      
gb|KDP43974.1|  hypothetical protein JCGZ_05441                         667   0.0      
ref|XP_002272443.3|  PREDICTED: uncharacterized protein LOC100242799    665   0.0      Vitis vinifera
ref|XP_006349027.1|  PREDICTED: uncharacterized membrane protein ...    662   0.0      
gb|EPS63290.1|  hypothetical protein M569_11492                         658   0.0      
emb|CBI17146.3|  unnamed protein product                                675   0.0      
emb|CAN72050.1|  hypothetical protein VITISV_016339                     655   0.0      Vitis vinifera
ref|XP_006491715.1|  PREDICTED: uncharacterized membrane protein ...    633   0.0      
ref|NP_181454.1|  major facilitator protein                             633   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006436518.1|  hypothetical protein CICLE_v10030988mg             633   0.0      
ref|XP_010243234.1|  PREDICTED: uncharacterized protein LOC104587357    632   0.0      
ref|XP_010103517.1|  putative transporter MCH1                          625   0.0      
gb|KDP29179.1|  hypothetical protein JCGZ_16568                         625   0.0      
ref|XP_007010014.1|  Major facilitator superfamily protein              625   0.0      
gb|KDP30491.1|  hypothetical protein JCGZ_16170                         623   0.0      
gb|KFK36814.1|  hypothetical protein AALP_AA4G174900                    622   0.0      
ref|XP_006381386.1|  hypothetical protein POPTR_0006s12430g             622   0.0      
ref|XP_011018791.1|  PREDICTED: uncharacterized protein LOC105121728    622   0.0      
emb|CDY44632.1|  BnaC04g06300D                                          619   0.0      
ref|XP_002268663.2|  PREDICTED: uncharacterized protein LOC100248651    622   0.0      Vitis vinifera
ref|XP_009780392.1|  PREDICTED: uncharacterized protein LOC104229438    619   0.0      
ref|XP_004240185.2|  PREDICTED: uncharacterized protein LOC101262315    617   0.0      
ref|XP_008362281.1|  PREDICTED: uncharacterized protein LOC103425934    619   0.0      
ref|XP_003637404.1|  Nitrate and chloride transporter                   617   0.0      
ref|XP_009143336.1|  PREDICTED: uncharacterized protein LOC103867059    617   0.0      
ref|XP_002862889.1|  nodulin family protein                             616   0.0      
ref|XP_009598854.1|  PREDICTED: uncharacterized protein LOC104094596    617   0.0      
gb|KEH44269.1|  MFS transporter                                         617   0.0      
ref|XP_010067354.1|  PREDICTED: uncharacterized protein LOC104454...    617   0.0      
ref|XP_006354409.1|  PREDICTED: uncharacterized membrane protein ...    616   0.0      
ref|XP_010067352.1|  PREDICTED: uncharacterized protein LOC104454...    617   0.0      
emb|CDX74863.1|  BnaA05g06090D                                          615   0.0      
ref|XP_009765800.1|  PREDICTED: uncharacterized membrane protein ...    615   0.0      
ref|XP_009792652.1|  PREDICTED: uncharacterized protein LOC104239662    615   0.0      
ref|XP_010534423.1|  PREDICTED: uncharacterized protein LOC104809977    615   0.0      
emb|CDY07663.1|  BnaA03g18480D                                          614   0.0      
ref|XP_010267223.1|  PREDICTED: uncharacterized protein LOC104604543    616   0.0      
ref|XP_009627853.1|  PREDICTED: uncharacterized protein LOC104118334    614   0.0      
ref|XP_003555226.2|  PREDICTED: uncharacterized protein LOC100819661    613   0.0      
ref|XP_008369817.1|  PREDICTED: uncharacterized protein LOC103433347    614   0.0      
ref|XP_007142881.1|  hypothetical protein PHAVU_007G024800g             615   0.0      
ref|XP_006428454.1|  hypothetical protein CICLE_v10013568mg             613   0.0      
ref|XP_009338584.1|  PREDICTED: uncharacterized protein LOC103930905    617   0.0      
ref|XP_002519465.1|  conserved hypothetical protein                     613   0.0      Ricinus communis
gb|KHN11442.1|  Putative transporter MCH1                               612   0.0      
emb|CDO99801.1|  unnamed protein product                                612   0.0      
ref|XP_003536696.1|  PREDICTED: uncharacterized protein LOC100776865    611   0.0      
ref|XP_009333629.1|  PREDICTED: uncharacterized protein LOC103926552    613   0.0      
ref|XP_010691115.1|  PREDICTED: uncharacterized protein LOC104904...    611   0.0      
gb|KEH44271.1|  MFS transporter                                         610   0.0      
emb|CBI30156.3|  unnamed protein product                                610   0.0      
ref|XP_007142882.1|  hypothetical protein PHAVU_007G024900g             610   0.0      
ref|XP_008233256.1|  PREDICTED: uncharacterized protein LOC103332309    610   0.0      
ref|XP_003553561.1|  PREDICTED: uncharacterized protein LOC100798313    608   0.0      
ref|XP_009141793.1|  PREDICTED: uncharacterized protein LOC103865707    607   0.0      
emb|CDY24976.1|  BnaC03g21960D                                          607   0.0      
ref|XP_004497124.1|  PREDICTED: uncharacterized protein LOC101508657    608   0.0      
emb|CDX93282.1|  BnaC04g46140D                                          606   0.0      
ref|XP_004497125.1|  PREDICTED: uncharacterized protein LOC101508976    606   0.0      
ref|XP_009133348.1|  PREDICTED: uncharacterized protein LOC103857852    605   0.0      
ref|XP_008387534.1|  PREDICTED: uncharacterized protein LOC103449994    606   0.0      
ref|XP_010325963.1|  PREDICTED: uncharacterized protein LOC101257997    606   0.0      
ref|XP_010509061.1|  PREDICTED: uncharacterized protein LOC104785527    603   0.0      
gb|KEH44270.1|  MFS transporter                                         603   0.0      
ref|XP_007220549.1|  hypothetical protein PRUPE_ppa003180mg             603   0.0      
ref|XP_010691116.1|  PREDICTED: uncharacterized protein LOC104904...    601   0.0      
ref|XP_010067353.1|  PREDICTED: uncharacterized protein LOC104454...    601   0.0      
emb|CAN63260.1|  hypothetical protein VITISV_029213                     600   0.0      Vitis vinifera
ref|XP_010068847.1|  PREDICTED: uncharacterized protein LOC104455819    600   0.0      
emb|CDP15282.1|  unnamed protein product                                599   0.0      
gb|KCW65468.1|  hypothetical protein EUGRSUZ_G02878                     600   0.0      
gb|KCW65302.1|  hypothetical protein EUGRSUZ_G02759                     600   0.0      
gb|KEH44272.1|  MFS transporter                                         599   0.0      
ref|XP_006345994.1|  PREDICTED: uncharacterized protein LOC102592436    598   0.0      
ref|XP_010068870.1|  PREDICTED: uncharacterized protein LOC104455846    599   0.0      
ref|XP_003554397.1|  PREDICTED: uncharacterized protein LOC100818752    598   0.0      
ref|XP_006293868.1|  hypothetical protein CARUB_v10022856mg             598   0.0      
ref|XP_004307342.1|  PREDICTED: uncharacterized protein LOC101306672    597   0.0      
ref|XP_008446819.1|  PREDICTED: uncharacterized protein LOC103489435    596   0.0      
ref|XP_010505589.1|  PREDICTED: uncharacterized protein LOC104782373    597   0.0      
ref|XP_009377045.1|  PREDICTED: uncharacterized protein LOC103965696    597   0.0      
ref|XP_006838710.1|  hypothetical protein AMTR_s00002p00250920          596   0.0      
ref|XP_010557206.1|  PREDICTED: uncharacterized protein LOC104826258    595   0.0      
ref|XP_009413295.1|  PREDICTED: uncharacterized protein LOC103994629    596   0.0      
ref|XP_010509060.1|  PREDICTED: uncharacterized protein LOC104785526    594   0.0      
ref|XP_007162787.1|  hypothetical protein PHAVU_001G180500g             593   0.0      
ref|XP_007027453.1|  Major facilitator superfamily protein              595   0.0      
ref|XP_002519464.1|  conserved hypothetical protein                     593   0.0      Ricinus communis
gb|KDP30493.1|  hypothetical protein JCGZ_16172                         594   0.0      
ref|XP_009630642.1|  PREDICTED: uncharacterized membrane protein ...    594   0.0      
ref|XP_004142499.1|  PREDICTED: uncharacterized membrane protein ...    593   0.0      
gb|KHN18681.1|  Putative transporter MCH1                               592   0.0      
ref|XP_008456537.1|  PREDICTED: uncharacterized protein LOC103496460    593   0.0      
ref|XP_003521414.2|  PREDICTED: uncharacterized protein LOC100797779    593   0.0      
ref|XP_008379735.1|  PREDICTED: uncharacterized protein LOC103442697    593   0.0      
ref|XP_011094505.1|  PREDICTED: uncharacterized protein LOC105174183    592   0.0      
ref|XP_007132716.1|  hypothetical protein PHAVU_011G118800g             591   0.0      
ref|XP_010517258.1|  PREDICTED: uncharacterized protein LOC104792736    590   0.0      
ref|XP_003555885.1|  PREDICTED: uncharacterized protein LOC100808975    589   0.0      
gb|KHN11444.1|  hypothetical protein glysoja_015339                     588   0.0      
ref|XP_011094591.1|  PREDICTED: uncharacterized protein LOC105174255    588   0.0      
ref|XP_004150375.1|  PREDICTED: uncharacterized protein LOC101208506    589   0.0      
ref|XP_009368999.1|  PREDICTED: uncharacterized protein LOC103958461    588   0.0      
ref|XP_002272074.2|  PREDICTED: uncharacterized protein LOC100266758    588   0.0      Vitis vinifera
gb|KHN05589.1|  Putative transporter MCH1                               588   0.0      
gb|KHN05591.1|  hypothetical protein glysoja_035791                     587   0.0      
ref|XP_011031645.1|  PREDICTED: uncharacterized protein LOC105130706    587   0.0      
ref|XP_006411146.1|  hypothetical protein EUTSA_v10016410mg             587   0.0      
gb|KDP30492.1|  hypothetical protein JCGZ_16171                         586   0.0      
ref|XP_003555225.2|  PREDICTED: uncharacterized protein LOC100819121    586   0.0      
ref|XP_006361693.1|  PREDICTED: uncharacterized protein LOC102605820    585   0.0      
ref|XP_009417128.1|  PREDICTED: uncharacterized membrane protein ...    587   0.0      
ref|XP_003535733.2|  PREDICTED: uncharacterized protein LOC100787176    586   0.0      
gb|EPS72672.1|  hypothetical protein M569_02085                         583   0.0      
ref|XP_004304474.1|  PREDICTED: uncharacterized protein LOC101301314    585   0.0      
ref|XP_009606524.1|  PREDICTED: uncharacterized protein LOC104100872    583   0.0      
gb|KHN11443.1|  Putative transporter MCH1                               583   0.0      
ref|NP_001236811.1|  nitrate and chloride transporter                   584   0.0      
ref|XP_010673913.1|  PREDICTED: uncharacterized protein LOC104890215    584   0.0      
ref|XP_007144375.1|  hypothetical protein PHAVU_007G151000g             583   0.0      
ref|XP_010435975.1|  PREDICTED: uncharacterized protein LOC104719709    582   0.0      
ref|XP_010658344.1|  PREDICTED: uncharacterized membrane protein ...    582   0.0      
emb|CAN66928.1|  hypothetical protein VITISV_011832                     582   0.0      Vitis vinifera
ref|XP_009783152.1|  PREDICTED: uncharacterized protein LOC104231797    581   0.0      
ref|XP_006379525.1|  nodulin family protein                             582   0.0      
emb|CDP14418.1|  unnamed protein product                                581   0.0      
ref|XP_003557448.1|  PREDICTED: uncharacterized protein LOC100822987    582   0.0      
ref|XP_011084395.1|  PREDICTED: uncharacterized protein LOC105166653    580   0.0      
emb|CDP15281.1|  unnamed protein product                                579   0.0      
gb|KHN02305.1|  Putative transporter MCH1                               578   0.0      
ref|XP_009397027.1|  PREDICTED: uncharacterized protein LOC103981971    580   0.0      
ref|XP_010450661.1|  PREDICTED: uncharacterized protein LOC104732777    579   0.0      
gb|KCW65466.1|  hypothetical protein EUGRSUZ_G02876                     577   0.0      
dbj|BAJ90449.1|  predicted protein                                      579   0.0      
gb|KEH24041.1|  MFS transporter                                         579   0.0      
ref|XP_010050677.1|  PREDICTED: uncharacterized protein LOC104439293    578   0.0      
ref|XP_010098800.1|  hypothetical protein L484_022565                   578   0.0      
ref|XP_003537006.1|  PREDICTED: uncharacterized protein LOC100782396    575   0.0      
ref|XP_002881636.1|  predicted protein                                  575   0.0      
ref|XP_010050695.1|  PREDICTED: uncharacterized protein LOC104439313    576   0.0      
emb|CDM84956.1|  unnamed protein product                                576   0.0      
gb|EAZ03041.1|  hypothetical protein OsI_25182                          575   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_007142880.1|  hypothetical protein PHAVU_007G024700g             574   0.0      
ref|XP_010050685.1|  PREDICTED: uncharacterized protein LOC104439301    575   0.0      
ref|XP_011094731.1|  PREDICTED: uncharacterized protein LOC105174351    572   0.0      
gb|KDO47545.1|  hypothetical protein CISIN_1g040453mg                   570   0.0      
ref|XP_009762916.1|  PREDICTED: uncharacterized protein LOC104214891    569   0.0      
dbj|BAC83908.1|  putative nodule-specific protein                       572   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004165702.1|  PREDICTED: uncharacterized LOC101216551            570   0.0      
ref|XP_006339087.1|  PREDICTED: uncharacterized protein LOC102587756    569   0.0      
ref|XP_002534014.1|  conserved hypothetical protein                     568   0.0      Ricinus communis
ref|XP_004142501.1|  PREDICTED: uncharacterized protein LOC101205029    570   0.0      
ref|XP_004147303.1|  PREDICTED: uncharacterized protein LOC101202941    570   0.0      
ref|XP_004161323.1|  PREDICTED: uncharacterized protein LOC101224401    570   0.0      
ref|XP_004494077.1|  PREDICTED: uncharacterized protein LOC101506073    569   0.0      
ref|XP_004164226.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    569   0.0      
ref|XP_004137979.1|  PREDICTED: uncharacterized protein LOC101216551    570   0.0      
ref|XP_002267992.3|  PREDICTED: uncharacterized protein LOC100256...    568   0.0      Vitis vinifera
ref|XP_010658347.1|  PREDICTED: uncharacterized protein LOC100256...    569   0.0      
gb|AAO37543.1|  putative nodule-specific protein                        569   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002464077.1|  hypothetical protein SORBIDRAFT_01g011890          570   0.0      Sorghum bicolor [broomcorn]
ref|XP_004164227.1|  PREDICTED: uncharacterized protein LOC101232127    567   0.0      
ref|XP_003541428.1|  PREDICTED: uncharacterized protein LOC100814000    567   0.0      
ref|XP_004986309.1|  PREDICTED: uncharacterized membrane protein ...    569   0.0      
ref|XP_003540770.1|  PREDICTED: uncharacterized protein LOC100799928    566   0.0      
ref|XP_004250040.1|  PREDICTED: uncharacterized protein LOC101265191    566   0.0      
dbj|BAO45884.1|  nitrate and chloride transporter                       567   0.0      
ref|XP_008464809.1|  PREDICTED: uncharacterized protein LOC103502605    566   0.0      
gb|KHN21070.1|  hypothetical protein glysoja_006549                     565   0.0      
ref|XP_006651692.1|  PREDICTED: uncharacterized protein LOC102719372    567   0.0      
ref|XP_003559578.1|  PREDICTED: uncharacterized protein LOC100828435    566   0.0      
ref|XP_010933270.1|  PREDICTED: uncharacterized membrane protein ...    566   0.0      
ref|XP_006339088.1|  PREDICTED: uncharacterized protein LOC102588077    564   0.0      
ref|XP_008241388.1|  PREDICTED: uncharacterized protein LOC103339814    566   0.0      
gb|EPS59101.1|  hypothetical protein M569_15705                         562   0.0      
ref|XP_010933280.1|  PREDICTED: uncharacterized membrane protein ...    562   0.0      
ref|XP_007204603.1|  hypothetical protein PRUPE_ppa002810mg             564   0.0      
ref|XP_004142500.1|  PREDICTED: uncharacterized protein LOC101204538    562   0.0      
ref|XP_004249479.1|  PREDICTED: uncharacterized protein LOC101244433    560   0.0      
ref|XP_004164225.1|  PREDICTED: uncharacterized protein LOC101231480    560   0.0      
ref|XP_004142503.1|  PREDICTED: uncharacterized protein LOC101205503    560   0.0      
dbj|BAJ93275.1|  predicted protein                                      560   0.0      
ref|XP_004147309.1|  PREDICTED: uncharacterized protein LOC101204389    559   0.0      
ref|XP_004249478.1|  PREDICTED: uncharacterized protein LOC101244136    559   0.0      
ref|XP_004169770.1|  PREDICTED: uncharacterized LOC101204389            559   0.0      
ref|XP_003559292.1|  PREDICTED: uncharacterized protein LOC100830563    560   0.0      
gb|EMT08425.1|  hypothetical protein F775_07944                         559   0.0      
ref|XP_008794008.1|  PREDICTED: uncharacterized membrane protein ...    560   0.0      
ref|XP_008462497.1|  PREDICTED: uncharacterized protein LOC103500834    558   0.0      
gb|KDO37221.1|  hypothetical protein CISIN_1g039263mg                   554   0.0      
ref|XP_004147308.1|  PREDICTED: uncharacterized protein LOC101204150    557   0.0      
ref|XP_004981407.1|  PREDICTED: uncharacterized protein LOC101759573    558   0.0      
dbj|BAJ86921.1|  predicted protein                                      558   0.0      
gb|EAY83124.1|  hypothetical protein OsI_38340                          557   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_008446818.1|  PREDICTED: uncharacterized protein LOC103489434    557   0.0      
gb|EMT24580.1|  hypothetical protein F775_21272                         557   0.0      
ref|NP_001066777.2|  Os12g0484600                                       556   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ28933.1|  hypothetical protein OsJ_12977                          555   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008464767.1|  PREDICTED: uncharacterized protein LOC103502570    556   0.0      
gb|KDO39314.1|  hypothetical protein CISIN_1g047229mg                   556   0.0      
ref|XP_008811023.1|  PREDICTED: uncharacterized protein LOC103722299    554   0.0      
ref|XP_003590250.1|  Nodule-specific protein Nlj70                      555   0.0      
ref|XP_010691114.1|  PREDICTED: uncharacterized protein LOC104904539    555   0.0      
gb|EYU29889.1|  hypothetical protein MIMGU_mgv1a003835mg                553   0.0      
gb|KHN48244.1|  Putative transporter MCH1                               553   0.0      
ref|XP_008665606.1|  PREDICTED: uncharacterized protein LOC103644190    555   0.0      
ref|NP_001152028.1|  nitrate and chloride transporter                   552   0.0      Zea mays [maize]
ref|XP_006664561.1|  PREDICTED: uncharacterized protein LOC102703921    551   0.0      
emb|CBI31405.3|  unnamed protein product                                550   0.0      
ref|XP_007145510.1|  hypothetical protein PHAVU_007G244600g             550   0.0      
dbj|BAJ89452.1|  predicted protein                                      550   0.0      
ref|XP_008811024.1|  PREDICTED: uncharacterized protein LOC103722300    549   0.0      
tpg|DAA50695.1|  TPA: hypothetical protein ZEAMMB73_557403              554   0.0      
gb|KHN39024.1|  Putative transporter MCH1                               547   0.0      
tpg|DAA42500.1|  TPA: nitrate and chloride transporter                  548   0.0      
ref|XP_003518996.1|  PREDICTED: uncharacterized protein LOC100789645    547   0.0      
ref|XP_004230920.1|  PREDICTED: uncharacterized protein LOC101255930    546   0.0      
gb|EPS69782.1|  hypothetical protein M569_04980                         544   0.0      
ref|XP_003590365.1|  Nodule-specific protein Nlj70                      546   0.0      
dbj|BAJ86744.1|  predicted protein                                      545   0.0      
ref|XP_003576191.1|  PREDICTED: uncharacterized protein LOC100839547    546   0.0      
ref|XP_006354407.1|  PREDICTED: uncharacterized protein LOC102589907    545   0.0      
ref|XP_008464773.1|  PREDICTED: uncharacterized protein LOC103502580    545   0.0      
ref|XP_002466277.1|  hypothetical protein SORBIDRAFT_01g004940          546   0.0      
ref|XP_010933292.1|  PREDICTED: uncharacterized protein LOC105053726    545   0.0      
ref|XP_008464784.1|  PREDICTED: uncharacterized protein LOC103502588    543   0.0      
ref|XP_006428271.1|  hypothetical protein CICLE_v10013309mg             541   0.0      
gb|KDP29178.1|  hypothetical protein JCGZ_16567                         542   0.0      
ref|XP_002519466.1|  conserved hypothetical protein                     541   0.0      
ref|XP_008665607.1|  PREDICTED: uncharacterized protein LOC103644191    544   0.0      
ref|XP_004143363.1|  PREDICTED: uncharacterized protein LOC101203981    540   0.0      
emb|CBI31406.3|  unnamed protein product                                541   0.0      
ref|XP_009621414.1|  PREDICTED: uncharacterized protein LOC104113038    540   0.0      
ref|XP_009766499.1|  PREDICTED: uncharacterized protein LOC104217867    536   0.0      
ref|XP_004142502.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    536   0.0      
ref|XP_008464760.1|  PREDICTED: uncharacterized protein LOC103502564    537   0.0      
gb|KHN23223.1|  hypothetical protein glysoja_047351                     534   1e-180   
ref|XP_008379570.1|  PREDICTED: uncharacterized protein LOC103442545    535   1e-180   
gb|AAP68384.1|  hypothetical protein                                    535   2e-180   
ref|XP_004307336.1|  PREDICTED: uncharacterized protein LOC101304914    534   2e-180   
ref|NP_001067374.2|  Os12g0637800                                       534   2e-180   
ref|XP_009368937.1|  PREDICTED: uncharacterized protein LOC103958409    535   3e-180   
gb|KHN32812.1|  hypothetical protein glysoja_024171                     534   4e-180   
gb|ABF98224.1|  nodulin family protein, putative                        535   6e-180   
ref|XP_004171580.1|  PREDICTED: uncharacterized LOC101205122            532   7e-180   
emb|CDP14419.1|  unnamed protein product                                532   8e-180   
ref|XP_004977870.1|  PREDICTED: uncharacterized protein LOC101756569    533   8e-180   
ref|XP_006599452.1|  PREDICTED: uncharacterized protein LOC102661181    533   1e-179   
ref|XP_004147312.1|  PREDICTED: uncharacterized protein LOC101205122    531   2e-179   
ref|XP_007219108.1|  hypothetical protein PRUPE_ppa015620mg             532   2e-179   
emb|CBI31408.3|  unnamed protein product                                542   4e-179   
ref|XP_004962674.1|  PREDICTED: uncharacterized protein LOC101763766    531   6e-179   
ref|XP_004963329.1|  PREDICTED: uncharacterized protein LOC101753233    530   1e-178   
gb|EAY84040.1|  hypothetical protein OsI_39270                          530   1e-178   
ref|XP_004147311.1|  PREDICTED: uncharacterized membrane protein ...    530   1e-178   
ref|XP_006664781.1|  PREDICTED: uncharacterized protein LOC102705033    530   2e-178   
ref|XP_009399380.1|  PREDICTED: uncharacterized protein LOC103983816    529   3e-178   
ref|XP_008233255.1|  PREDICTED: uncharacterized protein LOC103332307    528   4e-178   
gb|EAZ21349.1|  hypothetical protein OsJ_37006                          528   6e-178   
ref|XP_004963328.1|  PREDICTED: uncharacterized protein LOC101752820    528   7e-178   
ref|XP_007221112.1|  hypothetical protein PRUPE_ppa017904mg             526   1e-177   
ref|XP_004147304.1|  PREDICTED: uncharacterized protein LOC101203173    527   2e-177   
ref|XP_007208600.1|  hypothetical protein PRUPE_ppa022397mg             524   3e-177   
ref|XP_004307337.1|  PREDICTED: uncharacterized protein LOC101305216    525   1e-176   
gb|EEC69742.1|  hypothetical protein OsI_39271                          524   1e-176   
gb|EEE53674.1|  hypothetical protein OsJ_37007                          520   8e-176   
ref|XP_002442614.1|  hypothetical protein SORBIDRAFT_08g023010          523   1e-175   
ref|XP_008464731.1|  PREDICTED: uncharacterized protein LOC103502544    518   3e-174   
ref|XP_008442718.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    516   5e-174   
gb|AAC39500.1|  nodule-specific protein Nlj70                           515   3e-173   
ref|XP_002301218.2|  hypothetical protein POPTR_0002s13500g             512   6e-173   
ref|XP_002442137.1|  hypothetical protein SORBIDRAFT_08g014860          511   2e-171   
emb|CAN61265.1|  hypothetical protein VITISV_013572                     504   7e-170   
ref|XP_002443658.1|  hypothetical protein SORBIDRAFT_08g023020          506   3e-169   
ref|XP_010236602.1|  PREDICTED: uncharacterized protein LOC100836162    505   6e-169   
emb|CAN71485.1|  hypothetical protein VITISV_025339                     503   8e-169   
ref|XP_010670396.1|  PREDICTED: uncharacterized protein LOC104887465    501   4e-168   
ref|XP_004979965.1|  PREDICTED: uncharacterized protein LOC101755644    500   1e-166   
ref|XP_002449966.1|  hypothetical protein SORBIDRAFT_05g026300          500   3e-166   
ref|XP_004146405.1|  PREDICTED: uncharacterized protein LOC101220925    496   2e-165   
gb|EAY91415.1|  hypothetical protein OsI_13040                          494   9e-165   
ref|XP_007027450.1|  Major facilitator superfamily protein, putative    491   7e-164   
ref|XP_010677449.1|  PREDICTED: uncharacterized protein LOC104893078    490   8e-163   
ref|XP_006662218.1|  PREDICTED: uncharacterized protein LOC102719238    489   3e-162   
ref|NP_001067373.1|  Os12g0637700                                       486   1e-161   
ref|XP_008652149.1|  PREDICTED: uncharacterized protein LOC103632070    485   1e-160   
dbj|BAK06441.1|  predicted protein                                      478   1e-159   
gb|AAM01022.1|AC090488_22  Hypothetical protein                         470   3e-155   
gb|EAY77816.1|  hypothetical protein OsI_32858                          469   1e-154   
ref|XP_006369229.1|  hypothetical protein POPTR_0001s19730g             443   1e-148   
gb|KGN54809.1|  hypothetical protein Csa_4G507390                       443   3e-146   
ref|XP_008670908.1|  PREDICTED: uncharacterized protein LOC103648199    432   3e-141   
gb|KCW65298.1|  hypothetical protein EUGRSUZ_G027541                    418   1e-138   
ref|XP_008354067.1|  PREDICTED: uncharacterized protein LOC103417686    420   2e-138   
gb|KGN64768.1|  hypothetical protein Csa_1G095540                       410   2e-133   
tpg|DAA54890.1|  TPA: hypothetical protein ZEAMMB73_736019              411   3e-132   
gb|KCW65475.1|  hypothetical protein EUGRSUZ_G028862                    395   5e-131   
ref|XP_002461320.1|  hypothetical protein SORBIDRAFT_02g000890          401   2e-128   
ref|XP_008348275.1|  PREDICTED: uncharacterized protein LOC103411418    390   6e-127   
gb|KGN64769.1|  hypothetical protein Csa_1G096040                       389   3e-125   
ref|XP_007206727.1|  hypothetical protein PRUPE_ppa024782mg             375   1e-119   
ref|XP_008670991.1|  PREDICTED: uncharacterized protein LOC103648285    375   1e-118   
ref|XP_006650740.1|  PREDICTED: uncharacterized protein LOC102714717    372   6e-118   
ref|XP_010068844.1|  PREDICTED: uncharacterized protein LOC104455813    358   7e-115   
ref|XP_009621656.1|  PREDICTED: uncharacterized protein LOC104113249    356   6e-114   
gb|KGN52236.1|  hypothetical protein Csa_5G622530                       357   1e-113   
ref|XP_010068849.1|  PREDICTED: uncharacterized protein LOC104455823    355   1e-112   
gb|EYU39645.1|  hypothetical protein MIMGU_mgv1a0070051mg               349   2e-110   
ref|XP_008443577.1|  PREDICTED: uncharacterized protein LOC103487133    348   2e-110   
ref|XP_001784458.1|  predicted protein                                  349   5e-109   
ref|XP_001777486.1|  predicted protein                                  347   8e-108   
ref|XP_006838662.1|  hypothetical protein AMTR_s00002p00241480          342   4e-106   
ref|XP_001772604.1|  predicted protein                                  340   5e-106   
gb|KCW65295.1|  hypothetical protein EUGRSUZ_G02749                     330   1e-105   
ref|XP_002979925.1|  hypothetical protein SELMODRAFT_178001             338   7e-105   
ref|XP_011087196.1|  PREDICTED: uncharacterized protein LOC105168751    339   7e-105   
ref|XP_002987406.1|  hypothetical protein SELMODRAFT_235284             338   8e-105   
ref|XP_010098802.1|  putative transporter MCH1                          335   2e-104   
ref|XP_004161327.1|  PREDICTED: uncharacterized protein LOC101225305    331   4e-104   
ref|XP_008443578.1|  PREDICTED: uncharacterized protein LOC103487134    329   5e-104   
ref|XP_009400855.1|  PREDICTED: uncharacterized protein LOC103984984    336   1e-103   
ref|XP_002979921.1|  hypothetical protein SELMODRAFT_111826             333   3e-103   
ref|XP_002987402.1|  hypothetical protein SELMODRAFT_126136             332   8e-103   
ref|XP_001776979.1|  predicted protein                                  333   8e-103   
ref|XP_009783437.1|  PREDICTED: uncharacterized protein LOC104232044    331   4e-102   
ref|XP_002442621.1|  hypothetical protein SORBIDRAFT_08g023130          330   5e-102   
ref|XP_004236183.1|  PREDICTED: uncharacterized protein LOC101243876    330   7e-102   
gb|KCW65476.1|  hypothetical protein EUGRSUZ_G028861                    319   2e-101   
gb|AAV49984.1|  hypothetical protein                                    328   3e-101   
ref|XP_006285261.1|  hypothetical protein CARUB_v10006632mg             323   3e-101   
ref|XP_006367059.1|  PREDICTED: uncharacterized protein LOC102578204    327   1e-100   
emb|CAH10046.1|  Unknown similar to A.thaliana Hypothetical prote...    327   2e-100   
gb|AAP04143.1|  unknown protein                                         327   2e-100   
ref|XP_009609132.1|  PREDICTED: uncharacterized protein LOC104102978    327   2e-100   
gb|KCW65304.1|  hypothetical protein EUGRSUZ_G02762                     323   2e-100   
ref|XP_009343443.1|  PREDICTED: uncharacterized protein LOC103935402    326   4e-100   
gb|ACJ22502.1|  unknown                                                 325   5e-100   
ref|XP_002960946.1|  hypothetical protein SELMODRAFT_266544             325   7e-100   
emb|CAH10068.1|  Unknown similar to A.thaliana Hypothetical prote...    325   7e-100   
emb|CAH10054.1|  Unknown similar to A.thaliana Hypothetical prote...    325   8e-100   
ref|XP_010917688.1|  PREDICTED: uncharacterized membrane protein ...    325   1e-99    
ref|NP_177616.1|  nodulin-like and major facilitator domain-conta...    325   1e-99    
ref|XP_002887558.1|  nodulin family protein                             324   2e-99    
emb|CAH10204.1|  Unknown similar to A.thaliana Hypothetical prote...    324   2e-99    
ref|XP_001768905.1|  predicted protein                                  325   3e-99    
ref|XP_001757080.1|  predicted protein                                  325   3e-99    
emb|CDX85856.1|  BnaC06g22780D                                          323   4e-99    
ref|XP_002967061.1|  hypothetical protein SELMODRAFT_87151              322   2e-98    
ref|XP_008239662.1|  PREDICTED: probable transporter MCH1               321   3e-98    
ref|XP_010428471.1|  PREDICTED: uncharacterized protein LOC104713117    320   4e-98    
ref|XP_007209882.1|  hypothetical protein PRUPE_ppa003974mg             320   4e-98    
gb|EMT05699.1|  hypothetical protein F775_14489                         316   7e-98    
ref|XP_004157561.1|  PREDICTED: uncharacterized LOC101204293            311   8e-98    
ref|XP_010498299.1|  PREDICTED: uncharacterized protein LOC104776010    319   9e-98    
ref|XP_010539949.1|  PREDICTED: uncharacterized protein LOC104813863    319   2e-97    
ref|XP_002266530.2|  PREDICTED: uncharacterized protein LOC100244916    319   3e-97    
emb|CBI15294.3|  unnamed protein product                                321   3e-97    
ref|XP_006439674.1|  hypothetical protein CICLE_v10019543mg             319   3e-97    
ref|XP_001758479.1|  predicted protein                                  318   4e-97    
ref|XP_009788802.1|  PREDICTED: uncharacterized protein LOC104236559    318   6e-97    
gb|ACJ22518.1|  unknown                                                 317   6e-97    
gb|KDO76014.1|  hypothetical protein CISIN_1g008597mg                   318   9e-97    
gb|EYU24441.1|  hypothetical protein MIMGU_mgv1a020189mg                316   1e-96    
ref|XP_010471567.1|  PREDICTED: uncharacterized protein LOC104751346    317   1e-96    
ref|XP_010272188.1|  PREDICTED: uncharacterized protein LOC104608039    316   2e-96    
emb|CDP14900.1|  unnamed protein product                                317   3e-96    
ref|XP_006390390.1|  hypothetical protein EUTSA_v10018391mg             315   3e-96    
ref|NP_001149402.1|  nodulin-like protein                               316   3e-96    
ref|XP_003579078.1|  PREDICTED: uncharacterized protein LOC100846557    315   4e-96    
dbj|BAJ95281.1|  predicted protein                                      316   7e-96    
ref|XP_006302127.1|  hypothetical protein CARUB_v10020132mg             314   1e-95    
ref|XP_008801875.1|  PREDICTED: uncharacterized protein LOC103715...    315   1e-95    
ref|XP_009104745.1|  PREDICTED: uncharacterized protein LOC103830685    313   2e-95    
ref|XP_006307112.1|  hypothetical protein CARUB_v10008700mg             315   2e-95    
ref|XP_007037173.1|  Nodulin-like / Major Facilitator Superfamily...    313   3e-95    
gb|EYU24433.1|  hypothetical protein MIMGU_mgv1a004516mg                313   3e-95    
tpg|DAA54792.1|  TPA: nodulin-like protein                              314   3e-95    
ref|XP_010678618.1|  PREDICTED: uncharacterized protein LOC104894...    312   4e-95    
ref|XP_004138620.1|  PREDICTED: uncharacterized protein LOC101211655    313   5e-95    
ref|XP_011087194.1|  PREDICTED: uncharacterized protein LOC105168749    312   8e-95    
emb|CDY19262.1|  BnaC05g14630D                                          311   8e-95    
ref|XP_010416334.1|  PREDICTED: uncharacterized protein LOC104702206    311   9e-95    
gb|EMT08736.1|  hypothetical protein F775_20527                         313   2e-94    
ref|XP_011087197.1|  PREDICTED: uncharacterized protein LOC105168753    311   2e-94    
ref|XP_008777475.1|  PREDICTED: probable transporter mch1               311   3e-94    
ref|XP_008441326.1|  PREDICTED: uncharacterized protein LOC103485...    312   3e-94    
ref|XP_006447047.1|  hypothetical protein CICLE_v10014684mg             311   5e-94    
ref|NP_173328.1|  nodulin-like and major facilitator domain-conta...    309   6e-94    
gb|AES67885.2|  MFS transporter                                         310   6e-94    
gb|KDO63907.1|  hypothetical protein CISIN_1g007654mg                   311   7e-94    
ref|XP_004236184.1|  PREDICTED: uncharacterized protein LOC101244171    310   1e-93    
emb|CDY26708.1|  BnaA06g13140D                                          309   1e-93    
ref|XP_004513316.1|  PREDICTED: uncharacterized protein LOC101511301    310   1e-93    
gb|KHG28603.1|  putative transporter MCH1                               309   1e-93    
ref|XP_010091040.1|  hypothetical protein L484_006404                   308   2e-93    
gb|KCW49356.1|  hypothetical protein EUGRSUZ_K02900                     308   2e-93    
ref|XP_006367060.1|  PREDICTED: uncharacterized protein LOC102578528    309   2e-93    
ref|XP_010678619.1|  PREDICTED: uncharacterized protein LOC104894...    308   2e-93    
ref|XP_002890306.1|  nodulin family protein                             308   2e-93    
gb|KEH22006.1|  nodulin-like/MFS transporter                            310   3e-93    
ref|XP_010037619.1|  PREDICTED: uncharacterized protein LOC104426318    308   3e-93    
ref|XP_003574828.1|  PREDICTED: probable transporter mch1               309   4e-93    
ref|XP_006477529.1|  PREDICTED: uncharacterized protein LOC102625351    320   4e-93    
emb|CDX68165.1|  BnaA07g22050D                                          307   4e-93    
ref|XP_006338702.1|  PREDICTED: probable transporter mch1-like          309   5e-93    
ref|XP_003597634.1|  Nodulin-like protein                               309   7e-93    
ref|XP_004231775.1|  PREDICTED: probable transporter mch1               308   8e-93    
ref|NP_001051581.1|  Os03g0800000                                       302   1e-92    
ref|XP_009597102.1|  PREDICTED: probable transporter mch1 isoform X1    308   1e-92    
ref|XP_007037166.1|  Nodulin / Major Facilitator Superfamily protein    307   1e-92    
gb|EPS63811.1|  hypothetical protein M569_10970                         306   1e-92    
ref|XP_009606507.1|  PREDICTED: uncharacterized protein LOC104100862    308   1e-92    
ref|XP_009369377.1|  PREDICTED: uncharacterized protein LOC103958777    306   1e-92    
ref|XP_003523049.1|  PREDICTED: uncharacterized protein LOC100775...    306   2e-92    
ref|XP_001778186.1|  predicted protein                                  307   2e-92    
ref|XP_004486805.1|  PREDICTED: uncharacterized protein LOC101503239    306   2e-92    
gb|KGN63164.1|  hypothetical protein Csa_2G406130                       307   2e-92    
ref|XP_006416551.1|  hypothetical protein EUTSA_v10007356mg             305   3e-92    
ref|NP_001146179.1|  uncharacterized protein LOC100279749               307   3e-92    
emb|CAH66429.1|  OSIGBa0096P03.3                                        306   3e-92    
ref|XP_001762698.1|  predicted protein                                  306   4e-92    
ref|XP_009609133.1|  PREDICTED: uncharacterized protein LOC104102979    306   5e-92    
ref|XP_010420035.1|  PREDICTED: uncharacterized protein LOC104705...    306   5e-92    
ref|XP_009802951.1|  PREDICTED: uncharacterized protein LOC104248396    306   6e-92    
ref|XP_010453528.1|  PREDICTED: uncharacterized protein LOC104735432    305   1e-91    
gb|AFW61584.1|  nodulin-like protein                                    305   1e-91    
gb|KDP31187.1|  hypothetical protein JCGZ_11563                         303   2e-91    
ref|XP_003522351.2|  PREDICTED: probable transporter mch1-like          303   2e-91    



>ref|XP_009614669.1| PREDICTED: uncharacterized protein LOC104107543 [Nicotiana tomentosiformis]
Length=577

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/561 (74%), Positives = 473/561 (84%), Gaps = 24/561 (4%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             NF  Q  RGRWFMMFASFLIMAGAGATYLFGVYSK IK+TLGYDQSTLNLLG+ KD+GAN
Sbjct  11    NFTLQFLRGRWFMMFASFLIMAGAGATYLFGVYSKVIKSTLGYDQSTLNLLGTCKDLGAN  70

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AE+TPTWFVLLVGS MNFAGYFLIWL+VTK+IA PKVWQMC+YIC+GANSQN
Sbjct  71    VGVLSGLLAEITPTWFVLLVGSVMNFAGYFLIWLAVTKKIATPKVWQMCIYICIGANSQN  130

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG+LVTCVKNFP SRGMMLGLMKGFVGLSGA+FTQLYLAIYGNDS++LILLIGWLPA
Sbjct  131   FANTGSLVTCVKNFPESRGMMLGLMKGFVGLSGAIFTQLYLAIYGNDSKSLILLIGWLPA  190

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             +LSI+FI +IR MK S HPNE +VF++ L ISI+LAL LMGLTI+QKY++FSH AY+ACA
Sbjct  191   LLSILFIFNIREMKSSRHPNEVRVFYQNLAISISLALLLMGLTISQKYLKFSHNAYVACA  250

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLS--------------SENVEDppppaenie  824
              IVC +LFLP +IA+ EE  T K K+K+++               SE VE      EN  
Sbjct  251   IIVCVVLFLPCIIAIREEFYTWKLKRKEIMQPPTRIIVEKPHLPVSEIVE-----LENFS  305

Query  823   kaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
              A+ ++  +  CF NI  KPKRGEDY+ILQALLSVDML+LF+  FCG GCSL A+DNLGQ
Sbjct  306   MAKTQEKNEVGCFSNICNKPKRGEDYTILQALLSVDMLILFVATFCGLGCSLTAVDNLGQ  365

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IGESLGYP  TI TFVSLVSIWNYFGRVFSGFVSE I+ +WK+PRTLMMTF+LLLP  GD
Sbjct  366   IGESLGYPSHTISTFVSLVSIWNYFGRVFSGFVSEKILLKWKVPRTLMMTFALLLPSIGD  425

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             LL+AFPFPGSVY ASL++GFS+G+QLTLLFIIISELFGLKYYSTLFNCGQLASP+GSY+L
Sbjct  426   LLIAFPFPGSVYVASLLIGFSFGIQLTLLFIIISELFGLKYYSTLFNCGQLASPIGSYVL  485

Query  283   NVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
             NVKIVG+LYD EA+KQ+A++G     V EL C+G QCY  SFI+LA VN FGALVSL+LV
Sbjct  486   NVKIVGKLYDKEALKQLASKGLTRSMVKELVCIGKQCYMNSFIILACVNAFGALVSLILV  545

Query  118   ARTAAYYKTDIYKRFRDEMGA  56
              RT  YYKTDIYKRFRDEM A
Sbjct  546   WRTKDYYKTDIYKRFRDEMEA  566



>ref|XP_011084394.1| PREDICTED: uncharacterized protein LOC105166652 [Sesamum indicum]
Length=603

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/562 (74%), Positives = 466/562 (83%), Gaps = 20/562 (4%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+ Q+  GRWFMMFASFLIMAGAGATYLFGVYSK IK+TLGYDQSTLNLLGSFKD+GAN
Sbjct  21    RFIKQVLVGRWFMMFASFLIMAGAGATYLFGVYSKVIKSTLGYDQSTLNLLGSFKDLGAN  80

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTPTWFVLLVGSAMNFAGYF+IWL+VTK+I+KP VWQMC+YIC+GANSQN
Sbjct  81    VGVLSGLMAEVTPTWFVLLVGSAMNFAGYFMIWLAVTKKISKPSVWQMCIYICMGANSQN  140

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG+LVTCVKNFP SRGM++GLMKGF+GLSGAVFTQLYLAIYGND+++LILLIGWLPA
Sbjct  141   FANTGSLVTCVKNFPESRGMLIGLMKGFIGLSGAVFTQLYLAIYGNDAESLILLIGWLPA  200

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++SI+F+ +I+ MKIS HPNE KVF+EYL IS+ LALCLMGLTIAQKYV FSH  +I  A
Sbjct  201   VISILFVFNIKTMKISRHPNEVKVFYEYLIISVGLALCLMGLTIAQKYVDFSHVGHIVSA  260

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL---------------LSSENVEDppppaeni  827
             T VC LLFLP LIA  EE  T + K++                 L S   E         
Sbjct  261   TAVCFLLFLPCLIAFREEFTTLRLKEQAARAGRSRVVVVEEEPPLVSSKPEPEIVEVTGG  320

Query  826   ekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLG  647
              K E+    D  C  NI  KPKRGEDYSILQALLS+DML+LF+  FCG GCSL A+DNLG
Sbjct  321   LKGEDHGKKDACCCTNICNKPKRGEDYSILQALLSIDMLILFVATFCGLGCSLTAVDNLG  380

Query  646   QIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAG  467
             QIGESLGYP RTI TFVSLVSIWNYFGRVFSGFVSE ++ +WKIPRTLMMTF+LLLP  G
Sbjct  381   QIGESLGYPQRTISTFVSLVSIWNYFGRVFSGFVSEKLLLKWKIPRTLMMTFALLLPSIG  440

Query  466   DLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI  287
             DLL+A PFPGSVY ASL++GFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI
Sbjct  441   DLLIAIPFPGSVYIASLLIGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI  500

Query  286   LNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             LNV+IVG+LYD EA+KQ++ RG     V ELTC+G  CY+ SF++LAGVNLFGALVSL+L
Sbjct  501   LNVRIVGKLYDREALKQLSRRGMTRSMVRELTCIGKDCYRRSFLILAGVNLFGALVSLIL  560

Query  121   VARTAAYYKTDIYKRFRDEMGA  56
             V RT  YYKTDIYKRFRDEM A
Sbjct  561   VVRTRQYYKTDIYKRFRDEMEA  582



>ref|XP_009782107.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Nicotiana 
sylvestris]
Length=565

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/547 (75%), Positives = 470/547 (86%), Gaps = 7/547 (1%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             NF  Q  RGRWFMMFASFLIMAGAGATYLFGVYSK IK+TLGYDQSTLNLLG+ KD+GAN
Sbjct  15    NFTLQFLRGRWFMMFASFLIMAGAGATYLFGVYSKVIKSTLGYDQSTLNLLGTCKDLGAN  74

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTPTWFVLLVGS MNFAGYFLIWL+VTK+IA PKVWQMC+YIC+GANSQN
Sbjct  75    VGVLSGLLAEVTPTWFVLLVGSVMNFAGYFLIWLAVTKKIATPKVWQMCIYICIGANSQN  134

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG+LVTCVKNFP SRGMMLGLMKGFVGLSGA+FTQLYLAIYGNDS++LILLIGWLPA
Sbjct  135   FANTGSLVTCVKNFPESRGMMLGLMKGFVGLSGAIFTQLYLAIYGNDSKSLILLIGWLPA  194

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             +LSI+FI +IR MK S HPNE +VF++ L ISI+LAL LMGLTI+QKY++FSH AY+AC 
Sbjct  195   LLSILFIFNIREMKSSRHPNEVRVFYQNLVISISLALLLMGLTISQKYLKFSHNAYVACT  254

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSCFG  782
             TIVC +LFLP +IA+ EE  T K +    +  EN   P P +E +E  ++++  +  CF 
Sbjct  255   TIVCVVLFLPCIIAIREEFYTWKLQTPCRIIVEN--PPLPMSEIVELDKKQEKNEVGCFS  312

Query  781   NIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGT  602
             NI  KPKRGEDY+ILQALLSVDML+LF+  FCG GCSL A+DNLGQIGESLGYP  TI T
Sbjct  313   NICNKPKRGEDYTILQALLSVDMLILFVATFCGLGCSLTAVDNLGQIGESLGYPSHTIST  372

Query  601   FVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGA  422
             FVSLVSIWNYFGRVFSGFVSE ++ +WK+PRTLMMTF+L+LP  GDLL+AFPFP SVY A
Sbjct  373   FVSLVSIWNYFGRVFSGFVSEKLLLKWKVPRTLMMTFALILPSIGDLLIAFPFPASVYVA  432

Query  421   SLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAV  242
             SL++GFS+G+QLTLLFIIISELFGLKYYSTLFNCGQLASP+GSY+LNVKIVG+LYD EA+
Sbjct  433   SLLIGFSFGIQLTLLFIIISELFGLKYYSTLFNCGQLASPIGSYVLNVKIVGKLYDKEAL  492

Query  241   KQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKR  77
             KQ+A++G     V EL C+G QCY+ SFI+LA VN FGALVSL+LV RT  YY TDIYKR
Sbjct  493   KQLASKGMTRSMVKELVCIGKQCYRNSFIILACVNAFGALVSLILVWRTKDYYNTDIYKR  552

Query  76    FRDEMGA  56
             FRDEM A
Sbjct  553   FRDEMEA  559



>ref|XP_006361717.1| PREDICTED: uncharacterized protein LOC102585444 [Solanum tuberosum]
Length=582

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/561 (71%), Positives = 464/561 (83%), Gaps = 19/561 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             NF  Q  RGRWFMMFAS+LIMAGAGATYLFGVYSK IK+TLGYDQ+TLNLL +FKD+GAN
Sbjct  9     NFTLQFLRGRWFMMFASYLIMAGAGATYLFGVYSKTIKSTLGYDQTTLNLLSTFKDLGAN  68

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTPTWFVLL+GS MN +GY LIWL+VTK+IA PK+W MC+YIC+GANSQN
Sbjct  69    VGVLSGLLAEVTPTWFVLLIGSLMNISGYLLIWLAVTKKIATPKIWHMCVYICIGANSQN  128

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG+LVTCVKNFP SRGMMLGLMKGFVGLSGA+FTQLYLAIYGNDS++LILLI WLPA
Sbjct  129   FANTGSLVTCVKNFPHSRGMMLGLMKGFVGLSGAIFTQLYLAIYGNDSKSLILLIAWLPA  188

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             +LS++FI SIR  K S HPNE KVF   L ISI LAL LMG+TIAQKY+ FSH  Y+ACA
Sbjct  189   LLSMIFIFSIREKKFSRHPNEVKVFNVTLVISIVLALLLMGMTIAQKYIDFSHIGYVACA  248

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLS--SENVEDppppaeniekaeeekAGDYS-  791
             TIVC +LF PF +A+ EE  + K KKK+L S  S  + + PP  E+     E +  +YS 
Sbjct  249   TIVCVVLFCPFFVAIREEYTSWKLKKKELESVPSRVIVEEPPLPESKAPMLEIELPEYSS  308

Query  790   -----------CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
                        CF +IFKKPKRGEDY+ILQALLS+DML+LF+  FCG GCSL +IDNLGQ
Sbjct  309   MVKLQEKKEVGCFRDIFKKPKRGEDYTILQALLSIDMLILFVATFCGLGCSLTSIDNLGQ  368

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IGESLGYP  TI TFVSL+SIWNYFGRV SGF+SE ++ +WK+PRTLMMT +L+LP  GD
Sbjct  369   IGESLGYPQHTISTFVSLMSIWNYFGRVCSGFISEKLLLKWKVPRTLMMTLALILPAIGD  428

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             L++AFPF GSVY ASL++GFS+GVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL
Sbjct  429   LIIAFPFSGSVYVASLLIGFSFGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  488

Query  283   NVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
             NV++VGRLYD EA+KQ+  +G     V ELTC+G QCY+ SFI+LA VNLFGALVSL+LV
Sbjct  489   NVQVVGRLYDNEALKQLENKGLTRLMVKELTCIGKQCYRNSFIILACVNLFGALVSLILV  548

Query  118   ARTAAYYKTDIYKRFRDEMGA  56
              RT  YYK+DIYKRFRD+M A
Sbjct  549   KRTMEYYKSDIYKRFRDQMEA  569



>ref|XP_006436519.1| hypothetical protein CICLE_v10031022mg [Citrus clementina]
 ref|XP_006485348.1| PREDICTED: uncharacterized protein LOC102612195 [Citrus sinensis]
 gb|ESR49759.1| hypothetical protein CICLE_v10031022mg [Citrus clementina]
 gb|KDO47546.1| hypothetical protein CISIN_1g007665mg [Citrus sinensis]
Length=594

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/564 (68%), Positives = 458/564 (81%), Gaps = 22/564 (4%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             +F+ Q+ RGRWFMMFASFLIMAGAGATYLFG YSKEIK+TLGYDQ+TLNLL + KD+GAN
Sbjct  15    SFLLQVLRGRWFMMFASFLIMAGAGATYLFGTYSKEIKSTLGYDQTTLNLLSTCKDLGAN  74

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTP W VLLVGSAMNF GYF+IWL+V K+IAKPKVWQMCLYIC+GANSQN
Sbjct  75    VGVLSGLLAEVTPPWLVLLVGSAMNFGGYFMIWLAVMKKIAKPKVWQMCLYICIGANSQN  134

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG+LVTCVKNFP SRGMMLGLMKGFVGLSGAVFTQ+YLAIYGND++++ILLI WLPA
Sbjct  135   FANTGSLVTCVKNFPESRGMMLGLMKGFVGLSGAVFTQIYLAIYGNDAKSMILLIAWLPA  194

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++S+VF+ +IRP+K+SSHPNE KVF+EYL I+I+LALCLMGLTIAQK   F H  YI  A
Sbjct  195   LVSLVFVYTIRPLKVSSHPNELKVFYEYLYITISLALCLMGLTIAQKQAHFPHVGYIGSA  254

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL----------------LSSENVEDppppaen  830
               VC  +FLP  IA  EE A  +++K+                    SE +E     ++ 
Sbjct  255   IAVCIFVFLPLFIAFREEFAAWQQRKQPTPASAVVIVFEQTTLVATKSEILEIESDHSQT  314

Query  829   iekaeeekAGDYS-CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
             ++   +++  D + C GNIFK PKRGEDY ILQALLS+DML+LF+  FCG GCSL AIDN
Sbjct  315   LQTENKKQEPDQTPCCGNIFKPPKRGEDYGILQALLSIDMLILFLATFCGLGCSLTAIDN  374

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIGESLGYP  TI TFVSLVSIWNYFGRVF+GFVSE I+ ++K+PR L+M  SL+L  
Sbjct  375   LGQIGESLGYPQHTINTFVSLVSIWNYFGRVFAGFVSEIILLKYKVPRPLIMAISLILSA  434

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              GD+L+AFP PGSVY ASL++GFSYG QLTLLFIIISELFGLKYYSTLFNCGQLASPLGS
Sbjct  435   VGDVLIAFPKPGSVYVASLLVGFSYGAQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  494

Query  292   YILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             Y+LNV +VGRLYD EA+KQ+A +G     V +LTC+G QCY++SF +LAGVN+FGAL++ 
Sbjct  495   YVLNVIVVGRLYDREAMKQLAEKGMTRAMVKDLTCIGRQCYRLSFTILAGVNIFGALITF  554

Query  127   VLVARTAAYYKTDIYKRFRDEMGA  56
             +LV RT  YY  DIYK+F++++ A
Sbjct  555   ILVMRTRRYYSGDIYKKFKEQIAA  578



>ref|XP_007010021.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY18831.1| Major facilitator superfamily protein [Theobroma cacao]
Length=591

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/557 (68%), Positives = 442/557 (79%), Gaps = 15/557 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+ Q+  GRWFMMFASFLIMAGAGATYLFGVYSK+IKATLGYDQSTLNL+ +FKD+GAN
Sbjct  17    RFLCQVINGRWFMMFASFLIMAGAGATYLFGVYSKDIKATLGYDQSTLNLMSTFKDLGAN  76

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTPTWFVLLVG+ MNFAGYF+IW +VTK+I  P+VW MC YIC+GANSQN
Sbjct  77    VGVLSGLLAEVTPTWFVLLVGAVMNFAGYFMIWCAVTKKIPTPQVWHMCAYICIGANSQN  136

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG+LVTCVKNFP SRG+MLGLMKGFVGLSGA+FTQLY AIYGNDS++LILLIGWLPA
Sbjct  137   FANTGSLVTCVKNFPESRGIMLGLMKGFVGLSGALFTQLYYAIYGNDSKSLILLIGWLPA  196

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+ +IR MKIS HPNE KVF EYL IS+ LAL LMGLTIAQK V F    Y+  A
Sbjct  197   AISLVFVYNIRIMKISRHPNEHKVFHEYLTISVILALLLMGLTIAQKKVTFPRIGYVLSA  256

Query  961   TIVCALLFLPFLIAVMEELATRKEKKK----------QLLSSENVEDppppaeniekaee  812
              +VC +LF P  IA+ EE  T K +K+              +E V       E  E    
Sbjct  257   VVVCVMLFSPLAIAIREEYYTWKHRKQITTPTSIIVEATPPTETVSKSEIEPECTETEIV  316

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
              K  + SC  NI K+PKRG+DY+ILQAL S DMLLLF+  FCG GCSL A+DNLGQIGES
Sbjct  317   MKNQEDSCCTNICKRPKRGQDYTILQALTSADMLLLFVATFCGLGCSLTAVDNLGQIGES  376

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             LGYP  TI TFVSL+SIWNYFGRVF+GFVSE I+ ++K+PR  +M F+LLL   GDLL+A
Sbjct  377   LGYPQLTISTFVSLLSIWNYFGRVFAGFVSEKILLKYKVPRPSIMAFALLLSAVGDLLIA  436

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             FP+PGSVY ASL+LGFSYG QLTLLF I+SELFGLKYYSTLFNC QLASPLGSY+LNV++
Sbjct  437   FPWPGSVYPASLVLGFSYGAQLTLLFTIVSELFGLKYYSTLFNCSQLASPLGSYVLNVRV  496

Query  271   VGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
             VG+LYD EA+KQ+AA+G     V ELTC+G QCY++SF++LA  N     V+L+LVART 
Sbjct  497   VGKLYDREALKQLAAKGLTRSMVKELTCMGKQCYRLSFLILAAANFCAFFVTLILVARTR  556

Query  106   AYYKTDIYKRFRDEMGA  56
              YY+ DIYKRFRDEM A
Sbjct  557   KYYRGDIYKRFRDEMEA  573



>ref|XP_010543563.1| PREDICTED: uncharacterized protein LOC104816431 [Tarenaya hassleriana]
Length=601

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/572 (66%), Positives = 446/572 (78%), Gaps = 31/572 (5%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F+ Q+ RGRWFMMFASFLIMAGAGATYLFGVYSK+IKATLGYDQSTLNLL +FKD+GANV
Sbjct  17    FLLQVLRGRWFMMFASFLIMAGAGATYLFGVYSKDIKATLGYDQSTLNLLSTFKDLGANV  76

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGL+AEVTPTWFVLLVGSAMNF GYFLI+LSVT +I  PK+WQMC++IC+GANSQNF
Sbjct  77    GVLSGLLAEVTPTWFVLLVGSAMNFGGYFLIYLSVTGKIPNPKIWQMCMFICIGANSQNF  136

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRGMMLGLMKGFVGLSGAVF QLY +IY +DS++LILLI WLPA 
Sbjct  137   ANTGALVTCVKNFPESRGMMLGLMKGFVGLSGAVFNQLYFSIYRDDSKSLILLIAWLPAA  196

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S+VF+ +IR MKISSHPNE KVF++YL ISI LAL LM LT+AQK  +FSH  Y+A   
Sbjct  197   ISVVFVYTIRAMKISSHPNELKVFYQYLWISIVLALTLMALTVAQKLCKFSHIGYVASTI  256

Query  958   IVCALLFLPFLIAVMEELATRKEKK-------------------KQLLS-------SENV  857
              VC LLF P +IA  EE AT K KK                   K ++S       +E V
Sbjct  257   AVCVLLFTPLIIAFREEYATWKAKKHDATAVAVTVGKVDVVVEDKNVISHNKDGNETEIV  316

Query  856   EDppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQG  677
             ED    ++     ++    D  C GNI + PKRGEDY ILQALLSVDM++LFI  FCG G
Sbjct  317   EDKTVISDTTATEDKIVNKDVPCCGNICRPPKRGEDYGILQALLSVDMIILFIGTFCGLG  376

Query  676   CSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMM  497
             CSL A+DNLGQIGESLGYP   I TFVSL SIWNYFGRVF+GF+SE I+ R+KIPR L+M
Sbjct  377   CSLTAMDNLGQIGESLGYPQLAISTFVSLTSIWNYFGRVFAGFISEIILVRYKIPRPLIM  436

Query  496   TFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCG  317
               +L L    D++VA+PFPGSVY AS+++GF+YG QLTLLF IISELFGLKY+STLFNCG
Sbjct  437   ALALALSAVSDIIVAYPFPGSVYLASVLIGFTYGAQLTLLFTIISELFGLKYFSTLFNCG  496

Query  316   QLASPLGSYILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVN  152
             QLASP+GSY+ NVK+VG+LYD  A+KQ+AARG     V ELTC+G  CYK+SF +LA  N
Sbjct  497   QLASPIGSYVFNVKVVGKLYDVAAMKQLAARGMRREMVKELTCVGNDCYKLSFSILAATN  556

Query  151   LFGALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             + GA+V +VLV RT  +Y+ DIYK+FRDEM A
Sbjct  557   VVGAIVLMVLVLRTRKFYRGDIYKKFRDEMAA  588



>ref|XP_010068872.1| PREDICTED: uncharacterized protein LOC104455848 [Eucalyptus grandis]
Length=596

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/559 (68%), Positives = 446/559 (80%), Gaps = 19/559 (3%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q+ RGRWFMMFASFLIMAGAGATYLFGVYSK+IK+TLGYDQSTLNLL S KD+GANV
Sbjct  15    FALQVLRGRWFMMFASFLIMAGAGATYLFGVYSKDIKSTLGYDQSTLNLLSSCKDLGANV  74

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGLIAEV PTW VLLVGSAMNFAGYFLIWL+VT+RI +P VWQMC+YICVGANSQNF
Sbjct  75    GVLSGLIAEVAPTWLVLLVGSAMNFAGYFLIWLAVTRRIPRPAVWQMCVYICVGANSQNF  134

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTG+LVTCVKNFP SRG+MLGLMKGFVGLSGA+ TQLY AIYG+DS++LILLIGWLPA+
Sbjct  135   ANTGSLVTCVKNFPESRGIMLGLMKGFVGLSGAMMTQLYYAIYGDDSKSLILLIGWLPAV  194

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +SIVF+ +IR MK+S+HPNE KVF+E L I++ LAL +M LTIAQK V FSH AY+  A 
Sbjct  195   ISIVFVYTIRTMKLSTHPNELKVFYECLAITVVLALVIMALTIAQKQVSFSHGAYVVSAV  254

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQLLSS--------------ENVEDppppaeniek  821
              VC L FLP  IAV EE AT K++K Q  ++               ++E         E+
Sbjct  255   AVCVLTFLPLGIAVREEWATWKQRKAQKPTTATVGVAGDDASSPARDLEIHATDQRRQEE  314

Query  820   aeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQI  641
              E     D SC  ++FK P+RG DY+I+QALLS+DM+ LF+  FCG GCSL A+DNLGQI
Sbjct  315   QEAANPNDTSCCADVFKPPERGADYTIMQALLSLDMITLFVATFCGLGCSLTAVDNLGQI  374

Query  640   GESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDL  461
             GESLGYP  TIGTFVSLVS+WNYFGRV +GF+SE I  +WK+PR ++M  SL++   GDL
Sbjct  375   GESLGYPQHTIGTFVSLVSVWNYFGRVLAGFISEIIYDKWKVPRPVIMMLSLVVSGVGDL  434

Query  460   LVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILN  281
             L+AFP PGSVY ASL++GFS+G QLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL+
Sbjct  435   LIAFPAPGSVYVASLLIGFSFGAQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILS  494

Query  280   VKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVA  116
             V +VGRLYD EA +Q+AARG+      ELTC+G +CY+  F +LAGVN  GALV LVLV 
Sbjct  495   VLVVGRLYDVEATRQLAARGLTRSAAKELTCIGRRCYRTLFSILAGVNALGALVLLVLVV  554

Query  115   RTAAYYKTDIYKRFRDEMG  59
             RT  YY+ DIYKR+RD+M 
Sbjct  555   RTREYYQGDIYKRYRDQMA  573



>gb|KCW65471.1| hypothetical protein EUGRSUZ_G02881 [Eucalyptus grandis]
Length=602

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/559 (68%), Positives = 446/559 (80%), Gaps = 19/559 (3%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q+ RGRWFMMFASFLIMAGAGATYLFGVYSK+IK+TLGYDQSTLNLL S KD+GANV
Sbjct  17    FALQVLRGRWFMMFASFLIMAGAGATYLFGVYSKDIKSTLGYDQSTLNLLSSCKDLGANV  76

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGLIAEV PTW VLLVGSAMNFAGYFLIWL+VT+RI +P VWQMC+YICVGANSQNF
Sbjct  77    GVLSGLIAEVAPTWLVLLVGSAMNFAGYFLIWLAVTRRIPRPAVWQMCVYICVGANSQNF  136

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTG+LVTCVKNFP SRG+MLGLMKGFVGLSGA+ TQLY AIYG+DS++LILLIGWLPA+
Sbjct  137   ANTGSLVTCVKNFPESRGIMLGLMKGFVGLSGAMMTQLYYAIYGDDSKSLILLIGWLPAV  196

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +SIVF+ +IR MK+S+HPNE KVF+E L I++ LAL +M LTIAQK V FSH AY+  A 
Sbjct  197   ISIVFVYTIRTMKLSTHPNELKVFYECLAITVVLALVIMALTIAQKQVSFSHGAYVVSAV  256

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQLLSS--------------ENVEDppppaeniek  821
              VC L FLP  IAV EE AT K++K Q  ++               ++E         E+
Sbjct  257   AVCVLTFLPLGIAVREEWATWKQRKAQKPTTATVGVAGDDASSPARDLEIHATDQRRQEE  316

Query  820   aeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQI  641
              E     D SC  ++FK P+RG DY+I+QALLS+DM+ LF+  FCG GCSL A+DNLGQI
Sbjct  317   QEAANPNDTSCCADVFKPPERGADYTIMQALLSLDMITLFVATFCGLGCSLTAVDNLGQI  376

Query  640   GESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDL  461
             GESLGYP  TIGTFVSLVS+WNYFGRV +GF+SE I  +WK+PR ++M  SL++   GDL
Sbjct  377   GESLGYPQHTIGTFVSLVSVWNYFGRVLAGFISEIIYDKWKVPRPVIMMLSLVVSGVGDL  436

Query  460   LVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILN  281
             L+AFP PGSVY ASL++GFS+G QLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL+
Sbjct  437   LIAFPAPGSVYVASLLIGFSFGAQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILS  496

Query  280   VKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVA  116
             V +VGRLYD EA +Q+AARG+      ELTC+G +CY+  F +LAGVN  GALV LVLV 
Sbjct  497   VLVVGRLYDVEATRQLAARGLTRSAAKELTCIGRRCYRTLFSILAGVNALGALVLLVLVV  556

Query  115   RTAAYYKTDIYKRFRDEMG  59
             RT  YY+ DIYKR+RD+M 
Sbjct  557   RTREYYQGDIYKRYRDQMA  575



>emb|CDO99802.1| unnamed protein product [Coffea canephora]
Length=596

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/565 (65%), Positives = 448/565 (79%), Gaps = 24/565 (4%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F+ Q  RGRWFMMFA+FLIM+G+GATY+FG YSK IK++LGYDQSTLN+LGS KD+GA +
Sbjct  18    FMVQFLRGRWFMMFATFLIMSGSGATYIFGAYSKAIKSSLGYDQSTLNILGSCKDLGATI  77

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGL+AEVTP+WFVLLVG+ MNF+GYFL+WL+VTKRI KP VWQMC+YIC+GANSQNF
Sbjct  78    GVLSGLLAEVTPSWFVLLVGALMNFSGYFLVWLAVTKRIPKPPVWQMCVYICIGANSQNF  137

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTG+LV CVKNFP  RGMMLGLMKGFVGLSGA+FTQLYLAIY ND++++ILLIGWLPA+
Sbjct  138   ANTGSLVPCVKNFPERRGMMLGLMKGFVGLSGAIFTQLYLAIYHNDAKDMILLIGWLPAV  197

Query  1138  LSIVFIPSIRPM-KISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             +S+VF+  I+ M KIS HP+E KV ++ L I++ LAL LM LTIAQ Y  FSH  Y+A A
Sbjct  198   ISLVFLFCIKEMKKISGHPHEVKVMYQNLIITVGLALTLMALTIAQNYFNFSHADYVASA  257

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLS------------SENVEDppppaenieka  818
             T VC LLFLPFL+AV EEL T ++KK+  L              E+              
Sbjct  258   TGVCVLLFLPFLVAVKEELETWQQKKEDALKPPNRVVTEEPPLPESSNPRKQEIVPAHCT  317

Query  817   eeekAGDYS------CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAID  656
              ++  GD        C G+I  KPKRGEDY+I QALLS DM++LFI  FCG GCS AA+D
Sbjct  318   IDKGGGDDEFRQEGCCCGDICNKPKRGEDYTICQALLSADMIILFIVTFCGLGCSQAAVD  377

Query  655   NLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLP  476
             NLGQIGESLGYP +T+ TFVSL+SIWNYFGR  SGF SE ++++WK+PRTLMMT SL++P
Sbjct  378   NLGQIGESLGYPTKTVNTFVSLLSIWNYFGRALSGFGSEQLLRKWKVPRTLMMTISLVVP  437

Query  475   CAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLG  296
               GDL++A PFPGSVY AS+++GF+YGVQLT++F+IISELFGLKYYSTL NCGQLASP+G
Sbjct  438   AIGDLIIALPFPGSVYIASVLVGFAYGVQLTMVFVIISELFGLKYYSTLLNCGQLASPIG  497

Query  295   SYILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVS  131
             SY LNV+IVG+LYD EA+KQ+A  G     V +LTC+GTQCY+ SF++LAGVN  GAL+S
Sbjct  498   SYFLNVRIVGKLYDKEALKQLARAGLTRSMVPDLTCIGTQCYRTSFLILAGVNTLGALIS  557

Query  130   LVLVARTAAYYKTDIYKRFRDEMGA  56
             L+LV RT  YYK++IY +FRDEM A
Sbjct  558   LILVMRTREYYKSNIYMKFRDEMEA  582



>ref|XP_007208506.1| hypothetical protein PRUPE_ppa026488mg [Prunus persica]
 gb|EMJ09705.1| hypothetical protein PRUPE_ppa026488mg [Prunus persica]
Length=577

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/563 (66%), Positives = 443/563 (79%), Gaps = 16/563 (3%)
 Frame = -1

Query  1705  N*EEQNME--NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNL  1532
             N   +N E   F   + +GRWF +FASFLIMAGAGATYLFGVYSK+IK++LGYDQ+TLNL
Sbjct  11    NGSRKNSELLPFAVHVVQGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNL  70

Query  1531  LGSFKDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCL  1352
             LG FKD+GANVGVLSGLI EVTPTWFVLL+GSAMNFAGYF+IWL+VT +I KPKVW MCL
Sbjct  71    LGFFKDLGANVGVLSGLIGEVTPTWFVLLIGSAMNFAGYFMIWLAVTAKIPKPKVWHMCL  130

Query  1351  YICVGANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQN  1172
             YIC+GANSQNFANTGALVTCVKNFPASRG+MLGL+KGF GLSGA+FTQ+YLA+YGN+S++
Sbjct  131   YICIGANSQNFANTGALVTCVKNFPASRGVMLGLLKGFTGLSGAIFTQIYLAVYGNNSKS  190

Query  1171  LILLIGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVR  992
             +ILLI WLPA LS+VF+ +IRPMK+   PNE +VF+ +L +SI LAL LM + I QK V 
Sbjct  191   MILLIAWLPAALSVVFVYTIRPMKLVRQPNELRVFYHFLYVSIALALFLMAMIIVQKQVS  250

Query  991   FSHFAYIACATIVCALLFLPFLIAVMEELATRKEKKKQ---------LLSSENVEDpppp  839
             FS  AY    T+VC  LF+P  IA+ EEL     KK+            + + +E     
Sbjct  251   FSQAAYAGSVTVVCVFLFVPLGIAIREELLLWNLKKQPGDPPTELTIEKAPQTIEAKEDA  310

Query  838   aeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAI  659
                    E+++    SCF +IF KP+RGEDY+ILQALLSVDML+LFI   CG G SL A+
Sbjct  311   LPLNSSKEQKQDTKISCFADIFNKPERGEDYTILQALLSVDMLILFIATLCGLGSSLTAV  370

Query  658   DNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLL  479
             DNLGQIGESLGYP +TI +FVSLVSIWNYFGRVFSGFVSE+++ +WK+PR LMMTF LLL
Sbjct  371   DNLGQIGESLGYPTKTISSFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTFVLLL  430

Query  478   PCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPL  299
              CAG LL+AFP PGSVY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPL
Sbjct  431   SCAGHLLIAFPAPGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPL  490

Query  298   GSYILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALV  134
             GSYILNVK+ G LYD EA+K++A +G     V EL CLG+QCY+++F +LA +  FGALV
Sbjct  491   GSYILNVKVTGMLYDREALKELAKKGMARSSVKELICLGSQCYRLAFTILASITFFGALV  550

Query  133   SLVLVARTAAYYKTDIYKRFRDE  65
             SLVLV RT  +YK DIYK+F +E
Sbjct  551   SLVLVIRTREFYKGDIYKKFTEE  573



>ref|XP_009335989.1| PREDICTED: uncharacterized protein LOC103928636 [Pyrus x bretschneideri]
Length=559

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/545 (68%), Positives = 439/545 (81%), Gaps = 6/545 (1%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   L +GRWF +FASFLIMAGAGATYLFGVYSK+IK++LGYDQ+TLNLLGSFKD+GAN
Sbjct  11    RFAIHLLQGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNLLGSFKDLGAN  70

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTPTWFVLL+GSAMNF GYF+IWL+VT +I KPKVW MCLYIC+GANSQN
Sbjct  71    VGVLSGLIGEVTPTWFVLLIGSAMNFTGYFMIWLAVTAKIPKPKVWHMCLYICIGANSQN  130

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFPASRG+MLGL+KGF GLSGA+FTQ+YLA+YGN+S+++ILLI WLPA
Sbjct  131   FANTGALVTCVKNFPASRGVMLGLLKGFTGLSGAMFTQIYLAVYGNNSKSMILLIAWLPA  190

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS+VF+ +IRPMK+   PNE +VF+ +L +SI LA+ LM + I QK + FS  AY    
Sbjct  191   ALSVVFVYTIRPMKLVRQPNELRVFYHFLYVSIGLAVFLMAMIILQKQINFSQAAYAGSV  250

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL-LSSENVEDppppaeniekaeeekAGDYSCF  785
             T+VC  LF+P  IA+ EEL      K+ +   +E   +  P      K E+EK  + SCF
Sbjct  251   TVVCFFLFVPLGIAIREELILWNLMKQPVDPPTELTVEKLPAQAIEAKDEQEKKTNISCF  310

Query  784   GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIG  605
              ++F KPKRGEDY+ILQALLSVDML+LFI   CG G SL A+DNLGQIGESLGYP +TI 
Sbjct  311   ADVFNKPKRGEDYTILQALLSVDMLILFIATLCGLGSSLTAVDNLGQIGESLGYPTKTIS  370

Query  604   TFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYG  425
             +FVSLVSIWNYFGRVFSGFVSE+++ +WK+PR LMMT  LLL C G LL+AFP PGSVY 
Sbjct  371   SFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTLVLLLSCVGHLLIAFPAPGSVYV  430

Query  424   ASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEA  245
             AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LYD EA
Sbjct  431   ASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGMLYDREA  490

Query  244   VKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYK  80
             +K++A  G     V EL CLG+QCY+++F +LA V  FGA+VSL+LV RT  +YK DIYK
Sbjct  491   LKELAKSGRDRSSVKELICLGSQCYRLAFSILAAVTFFGAVVSLILVVRTREFYKGDIYK  550

Query  79    RFRDE  65
             +FRDE
Sbjct  551   KFRDE  555



>ref|XP_008226501.1| PREDICTED: uncharacterized protein LOC103326070 [Prunus mume]
Length=577

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/563 (66%), Positives = 444/563 (79%), Gaps = 16/563 (3%)
 Frame = -1

Query  1705  N*EEQNME--NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNL  1532
             N   +N E   F   + RGRWF +FASFLIMAGAGATYLFGVYSK+IK++LGYDQ+TLNL
Sbjct  11    NGSRKNSELLPFAVHVVRGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNL  70

Query  1531  LGSFKDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCL  1352
             LG FKD+GANVGVLSGLI EVTPTWFVLL+GSAMNFAGYF+IWL+VT +I KPKVW MCL
Sbjct  71    LGFFKDLGANVGVLSGLIGEVTPTWFVLLIGSAMNFAGYFMIWLAVTAKIPKPKVWHMCL  130

Query  1351  YICVGANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQN  1172
             YIC+GANSQNFANTGALVTCVKNFPASRG+MLGL+KGF GLSGA+FTQ+YLA+YGN+S++
Sbjct  131   YICIGANSQNFANTGALVTCVKNFPASRGVMLGLLKGFTGLSGAIFTQIYLAVYGNNSKS  190

Query  1171  LILLIGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVR  992
             +ILLI WLPA LS+VF+ +IRPMK+   PNE +VF+ +L +SI LAL LM + + QK V 
Sbjct  191   MILLIAWLPAALSVVFVYTIRPMKLVRQPNELRVFYHFLYVSIALALFLMAMIVVQKQVS  250

Query  991   FSHFAYIACATIVCALLFLPFLIAVMEELATRKEKKK-----QLLSSENV----EDpppp  839
             FS  AY    T+VC  LF+P  IA+ EEL     KK+       L+ E V    E     
Sbjct  251   FSQAAYAGSVTVVCVFLFVPLGIAIREELLLWNLKKQPGDPPTELTIEKVPQTIEAKEDA  310

Query  838   aeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAI  659
             + +    E+++    SCF +IF KP+RGEDY+ILQALLS+DML+LFI   CG G SL A+
Sbjct  311   SPSNSSKEQKQDTKISCFADIFNKPERGEDYTILQALLSIDMLILFIATLCGLGSSLTAV  370

Query  658   DNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLL  479
             DNLGQIGESLGYP +TI +FVSLVSIWNYFGRVFSGFVSE+++ +WK+PR LMMT  LLL
Sbjct  371   DNLGQIGESLGYPTKTISSFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTLVLLL  430

Query  478   PCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPL  299
              C G LL+AFP PGSVY AS+I+GFS+G QL LLF IISE+FGLKYYSTLFNCGQLASPL
Sbjct  431   SCVGHLLIAFPAPGSVYVASVIIGFSFGAQLPLLFAIISEIFGLKYYSTLFNCGQLASPL  490

Query  298   GSYILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALV  134
             GSYILNVK+ G LYD EA+K++A +G     V EL CLG+QCY+++F +LA +  FGALV
Sbjct  491   GSYILNVKVTGMLYDREALKELAKKGMARSSVKELICLGSQCYRLAFTILASITFFGALV  550

Query  133   SLVLVARTAAYYKTDIYKRFRDE  65
             SLVLV RT  +YK DIYK+F +E
Sbjct  551   SLVLVIRTREFYKGDIYKKFTEE  573



>gb|EYU39872.1| hypothetical protein MIMGU_mgv1a024761mg [Erythranthe guttata]
Length=595

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/560 (65%), Positives = 445/560 (79%), Gaps = 18/560 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+ Q+  GRW M   SF+IMA AGATYLFGVYSKEIK+TLGYDQSTLN LGS KD+GAN
Sbjct  19    RFILQVINGRWLMQSGSFMIMANAGATYLFGVYSKEIKSTLGYDQSTLNTLGSVKDLGAN  78

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTP WFVL VG+AMNF GYF++WL+VTK+I +P  WQM +YIC GANSQN
Sbjct  79    VGVLSGLLAEVTPPWFVLTVGAAMNFGGYFMVWLAVTKKIPRPADWQMYVYICAGANSQN  138

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG+LV CVKNFP +RG ++GLMKG+VGLSGA+FTQLYLAIYG+D++++IL IGWLPA
Sbjct  139   FANTGSLVPCVKNFPENRGRLIGLMKGYVGLSGAIFTQLYLAIYGDDAKSMILFIGWLPA  198

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF P +R MK S+H NE KV + YL  ++  A  +MG+ IAQK V FSH  Y+A A
Sbjct  199   AVSLVFAPVMRIMKPSTHKNEVKVLWYYLIAAVVTAFVIMGVIIAQKCVHFSHSEYVASA  258

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSEN----------VED---ppppaeniek  821
             T+VC L+  PF I + +E+AT + +KK+ L SE+          ++D     P +E  + 
Sbjct  259   TVVCLLVSAPFFIGLRQEIATWQSRKKEYLESESESGSTPSSIVIQDPPKRDPESEMADD  318

Query  820   aeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQI  641
               +  + +   + +IFKKP+RGEDY+ILQALLSVDML++F+  FC  GCSL AIDNLGQI
Sbjct  319   ERKNTSNNTPWYKDIFKKPERGEDYTILQALLSVDMLIIFVSTFCALGCSLTAIDNLGQI  378

Query  640   GESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDL  461
             GESLGYP  T+ TFVSLVSI+N+FGRVFSGFVSE +V  WK+PRTLMMTFSLLLPC GDL
Sbjct  379   GESLGYPSHTVSTFVSLVSIFNFFGRVFSGFVSEKLVLEWKVPRTLMMTFSLLLPCVGDL  438

Query  460   LVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILN  281
             +VAFPF GSVY A+LI+GFS+G+QLT+LFII+SELFGLKYYST+FNCGQLA P+GSY LN
Sbjct  439   IVAFPFKGSVYAATLIIGFSFGIQLTILFIILSELFGLKYYSTIFNCGQLAGPIGSYTLN  498

Query  280   VKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVA  116
             VK VGRLYD EA++Q+A RG     V ELTC+GT+CY+VSF++LA VN FGAL SLVLV 
Sbjct  499   VKTVGRLYDREALRQLADRGMTRSMVRELTCIGTECYRVSFLILACVNFFGALASLVLVM  558

Query  115   RTAAYYKTDIYKRFRDEMGA  56
             RT  YYK+DIYK+FR EM A
Sbjct  559   RTRKYYKSDIYKKFRHEMEA  578



>ref|XP_009345750.1| PREDICTED: uncharacterized protein LOC103937531 [Pyrus x bretschneideri]
Length=559

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/545 (68%), Positives = 438/545 (80%), Gaps = 6/545 (1%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   L +GRWF +FASFLIMAGAGATYLFGVYSK+IK++LGYDQ+TLNLLGSFKD+GAN
Sbjct  11    RFAIHLLQGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNLLGSFKDLGAN  70

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTPTWFVLL+GSAMNF GYF+IWL+VT +I KPKVW MCLYIC+GANSQN
Sbjct  71    VGVLSGLIGEVTPTWFVLLIGSAMNFTGYFMIWLAVTAKIPKPKVWHMCLYICIGANSQN  130

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFPASRG+MLGL+KGF GLSGA+FTQ+YLA+YGN+S+++ILLI WLPA
Sbjct  131   FANTGALVTCVKNFPASRGVMLGLLKGFTGLSGAMFTQIYLAVYGNNSKSMILLIAWLPA  190

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS+VF+ +IRPMK+   PNE +VF+ +L +SI LA+ LM + I Q  + FS  AY    
Sbjct  191   ALSVVFVYTIRPMKLVRQPNELRVFYHFLYVSIGLAVFLMAMIILQNQINFSQAAYAGSV  250

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL-LSSENVEDppppaeniekaeeekAGDYSCF  785
             T+VC  LF+P  IA+ EEL      K+ +   +E   +  P      K E+EK  + SCF
Sbjct  251   TVVCFFLFVPLGIAIREELILWNLMKQPVDPPTELTVEKLPAQAIEAKDEQEKKTNISCF  310

Query  784   GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIG  605
              ++F KPKRGEDY+ILQALLSVDML+LFI   CG G SL A+DNLGQIGESLGYP +TI 
Sbjct  311   ADVFNKPKRGEDYTILQALLSVDMLILFIATLCGLGSSLTAVDNLGQIGESLGYPTKTIS  370

Query  604   TFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYG  425
             +FVSLVSIWNYFGRVFSGFVSE+++ +WK+PR LMMT  LLL C G LL+AFP PGSVY 
Sbjct  371   SFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTLVLLLSCVGHLLIAFPAPGSVYV  430

Query  424   ASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEA  245
             AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LYD EA
Sbjct  431   ASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGMLYDREA  490

Query  244   VKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYK  80
             +K++A  G     V EL CLG+QCY+++F +LA V  FGA+VSL+LV RT  +YK DIYK
Sbjct  491   LKELAKSGRDRSSVKELICLGSQCYRLAFSILAAVTFFGAVVSLILVVRTREFYKGDIYK  550

Query  79    RFRDE  65
             +FRDE
Sbjct  551   KFRDE  555



>ref|XP_007208449.1| hypothetical protein PRUPE_ppa003535mg [Prunus persica]
 gb|EMJ09648.1| hypothetical protein PRUPE_ppa003535mg [Prunus persica]
Length=567

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/547 (68%), Positives = 441/547 (81%), Gaps = 11/547 (2%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q+ +GRWF +FASFLIMAGAGATYLFGVYSK+IK+TLGYDQ+TLNLLG FKD+GANV
Sbjct  20    FAVQVIKGRWFTVFASFLIMAGAGATYLFGVYSKDIKSTLGYDQTTLNLLGFFKDLGANV  79

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGLI EVTP WFVLLVGSAMNFAGYF+IWLSVT++IAKPKVWQMCLYIC+GANSQNF
Sbjct  80    GVLSGLIGEVTPAWFVLLVGSAMNFAGYFMIWLSVTEKIAKPKVWQMCLYICLGANSQNF  139

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRG+MLGL+KGF GLSGA+FTQLYLAIY NDS++LILLIGWLPA 
Sbjct  140   ANTGALVTCVKNFPESRGVMLGLLKGFTGLSGAIFTQLYLAIYPNDSKSLILLIGWLPAA  199

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             LS+VF+ +IRPMK     NE +VF+ +L IS++LAL ++ +++ QK V FS  AY   + 
Sbjct  200   LSVVFVYTIRPMKAVKQQNELRVFYHFLYISVSLALFILAMSLIQKQVAFSQAAYAGTSA  259

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQL-----LSSENVEDppppaeniekaeeekAGDY  794
             +VC  LFLP  IA+ EEL     KKK +     +S E  ++     ++ +   +      
Sbjct  260   VVCLFLFLPLAIAIREELVLWNLKKKPVDPPTEVSIEKPQEIQEIKDDSDLQVQNTKST-  318

Query  793   SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPR  614
             +CFG+I  KP+RGEDY+ILQALLS+DM++LFI  FCG G SL A+DNLGQIGESLGYP +
Sbjct  319   TCFGDICNKPERGEDYTILQALLSMDMMILFIATFCGLGSSLTAVDNLGQIGESLGYPTK  378

Query  613   TIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGS  434
             TI TFVSLVSIWNYFGRVFSGFVSE ++ +WK+PRTLMMTF L+L     L +AFPFPGS
Sbjct  379   TIKTFVSLVSIWNYFGRVFSGFVSENLIVKWKVPRTLMMTFMLVLSSLAYLSIAFPFPGS  438

Query  433   VYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYD  254
             VY AS+I+G S+G QLTLLF IISELFGLKY++TLFNCGQLASPLGSYILNVK+ G LYD
Sbjct  439   VYVASVIIGVSFGAQLTLLFTIISELFGLKYFATLFNCGQLASPLGSYILNVKVTGMLYD  498

Query  253   GEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
              EA+KQ+A +G     V ELTCLG QCY++SF +LA V  FGALVSLVLV RT  +YK D
Sbjct  499   REALKQLAEKGLTRSSVKELTCLGGQCYRLSFSILAAVTFFGALVSLVLVMRTTKFYKGD  558

Query  88    IYKRFRD  68
             IYK++R+
Sbjct  559   IYKKYRE  565



>ref|XP_008227863.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Prunus 
mume]
Length=567

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/547 (68%), Positives = 441/547 (81%), Gaps = 11/547 (2%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q+ +GRWF +FASFLIMAGAGATYLFGVYSK+IK+TLGYDQ+TLNLLG FKD+GANV
Sbjct  20    FAVQVIKGRWFTVFASFLIMAGAGATYLFGVYSKDIKSTLGYDQTTLNLLGFFKDLGANV  79

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGLI EVTP WFVLLVGSAMNFAGYF+IWLSVT++IAKPKVWQMCLYIC+GANSQNF
Sbjct  80    GVLSGLIGEVTPAWFVLLVGSAMNFAGYFMIWLSVTEKIAKPKVWQMCLYICLGANSQNF  139

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRG+MLGL+KGF GLSGA+FTQ+YLAIY NDS++LILLIGWLPA 
Sbjct  140   ANTGALVTCVKNFPESRGVMLGLLKGFTGLSGAIFTQIYLAIYPNDSKSLILLIGWLPAA  199

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             LS+VF+ +IRPMK     N+ +VF+ +L IS++LAL ++ + + QK V FS  AY   + 
Sbjct  200   LSVVFVYTIRPMKAVKQQNDLRVFYHFLYISVSLALFILAMNLIQKQVAFSQAAYAGTSA  259

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQL-----LSSENVEDppppaeniekaeeekAGDY  794
             +VC  LFLP  IA+ EEL     KKK +     +S E  ++     ++++   +      
Sbjct  260   VVCLFLFLPLAIAIREELVLWNLKKKPVDPPTEVSIEKPQEIQEIKDDLDLQVQNTKST-  318

Query  793   SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPR  614
             +CFG+I  KP+RGEDY+ILQALLS+DM++LFI  FCG G SL A+DNLGQIGESLGYP +
Sbjct  319   TCFGDICNKPERGEDYTILQALLSMDMMILFIATFCGLGSSLTAVDNLGQIGESLGYPTK  378

Query  613   TIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGS  434
             TI TFVSLVSIWNYFGRVFSGFVSET++ +WK+PRTLMMTF L+L     L +AFPFPGS
Sbjct  379   TIKTFVSLVSIWNYFGRVFSGFVSETLMVKWKVPRTLMMTFMLVLSSLAYLSIAFPFPGS  438

Query  433   VYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYD  254
             VY AS+I+G S+G QLTLLF IISELFGLKYY+TLFNCGQLASPLGSYILNVK+ G LYD
Sbjct  439   VYVASVIIGVSFGAQLTLLFTIISELFGLKYYATLFNCGQLASPLGSYILNVKVTGMLYD  498

Query  253   GEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
              EA+KQ+A +G     V ELTCLG QCY++SF +LA V  FGALVSLVLV RT  +YK D
Sbjct  499   REALKQLAEKGLTRSSVKELTCLGGQCYRLSFSILAAVAFFGALVSLVLVMRTRKFYKGD  558

Query  88    IYKRFRD  68
             IYK+ R+
Sbjct  559   IYKKHRE  565



>ref|XP_008355198.1| PREDICTED: uncharacterized protein LOC103418866 [Malus domestica]
Length=559

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/545 (67%), Positives = 435/545 (80%), Gaps = 6/545 (1%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + +GRWF +FASFLIMAGAGATYLFGVYSK+IK++LGYDQ+TLN LGSFKD+GAN
Sbjct  11    RFAIHVLQGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNXLGSFKDLGAN  70

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTPTWFVLL+GSAMNF GYF+IWL++T +I KPKVW MCLYIC+GANSQN
Sbjct  71    VGVLSGLIGEVTPTWFVLLIGSAMNFTGYFMIWLAITAKIPKPKVWHMCLYICIGANSQN  130

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFPASRG+MLGL+KGF GLSGA+FTQ+YLAIYGN+S+++ILLI WLPA
Sbjct  131   FANTGALVTCVKNFPASRGVMLGLLKGFTGLSGAMFTQIYLAIYGNNSKSMILLIAWLPA  190

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS+VF+ +IRPMK+   PNE +VF+ +L +SI LA+ LM + I QK + FS  AY    
Sbjct  191   ALSVVFVYTIRPMKLVRQPNELRVFYHFLYVSIGLAVFLMAMIILQKQINFSQAAYAGSV  250

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL-LSSENVEDppppaeniekaeeekAGDYSCF  785
             ++VC  LF+P  I + EEL      K+ +   +E   +  P      K EEEK    SCF
Sbjct  251   SVVCFFLFVPLGIVIREELILWNLMKQPVDPPTEXTVEKLPAQAIEAKEEEEKKXKISCF  310

Query  784   GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIG  605
              ++F KPKRGEDY+ILQALLSVDML+LFI   CG G SL A+DNLGQIGESLGYP +TI 
Sbjct  311   XDVFNKPKRGEDYTILQALLSVDMLILFIATLCGLGSSLTAVDNLGQIGESLGYPTKTIS  370

Query  604   TFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYG  425
             +FVSLVSIWNYFGRVFSGFVSE+++  WKIPR LMMT  LLL C G LL+AFP PGSVY 
Sbjct  371   SFVSLVSIWNYFGRVFSGFVSESLLVXWKIPRPLMMTXVLLLSCVGHLLIAFPAPGSVYV  430

Query  424   ASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEA  245
             AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LYD EA
Sbjct  431   ASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGMLYDREA  490

Query  244   VKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYK  80
             +K++A  G     V EL CLG+QCY+++F +LA V  FGA+VSL+LV RT   YK+DIYK
Sbjct  491   LKELAKSGRDRSSVKELICLGSQCYRLAFSILAAVTFFGAVVSLILVVRTREXYKSDIYK  550

Query  79    RFRDE  65
             +FRDE
Sbjct  551   KFRDE  555



>ref|XP_004288935.1| PREDICTED: uncharacterized protein LOC101295952 [Fragaria vesca 
subsp. vesca]
Length=561

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/544 (68%), Positives = 434/544 (80%), Gaps = 5/544 (1%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F  Q+ +GRWF +FASFLIMAGAGATYLFGVYSK+IK+TLGYDQSTLNLLG FKD+GAN
Sbjct  14    QFAVQVVQGRWFTVFASFLIMAGAGATYLFGVYSKQIKSTLGYDQSTLNLLGFFKDLGAN  73

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTPTWFVLLVGSAMNF GYF+I+L+VT +IAKPKVWQMC+YIC+GANSQN
Sbjct  74    VGVLSGLIGEVTPTWFVLLVGSAMNFTGYFMIFLAVTGKIAKPKVWQMCMYICIGANSQN  133

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KGF GLSGA+F Q+YLA+YGNDS++L+LLI WLPA
Sbjct  134   FANTGALVTCVKNFPESRGVMLGLLKGFTGLSGAMFNQIYLALYGNDSKSLVLLIAWLPA  193

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS+VF+ +IRPMK+   PNE +VF+ +L ISI LAL LM + I QK + FS  AY    
Sbjct  194   ALSVVFVYTIRPMKVVRQPNELRVFYHFLYISIALALFLMVMNIMQKQIAFSQAAYAGSV  253

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSCFG  782
              +VC  LFLP  IA+ EEL     KK+ +     V    P A    K E+ +  +  CF 
Sbjct  254   AVVCVFLFLPLGIAIREELLLWNLKKQPVDPPMEVAVQKPEANEQPKTEKAEKIETPCFA  313

Query  781   NIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGT  602
              +  KP RGEDY+ILQALLSVDML+LFI   CG G SL A+DNLGQIGESLGYP +TI +
Sbjct  314   GMCNKPPRGEDYTILQALLSVDMLILFIATLCGLGSSLTAVDNLGQIGESLGYPTKTISS  373

Query  601   FVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGA  422
             FVSLVSIWN+FGRVFSGFVSE+++ RWK+PR LMMT  L+L   G LL+AFP PGSVY A
Sbjct  374   FVSLVSIWNFFGRVFSGFVSESLLVRWKMPRPLMMTLVLMLSSIGHLLIAFPAPGSVYVA  433

Query  421   SLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAV  242
             S+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LYD EA+
Sbjct  434   SVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGMLYDREAL  493

Query  241   KQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKR  77
             K +A++G     V EL C+G+QCY++SF +LA V  FGALVSLVLV RT  +YK+DIYK+
Sbjct  494   KVLASKGMTRSSVKELICIGSQCYRLSFSILAAVTFFGALVSLVLVIRTREFYKSDIYKK  553

Query  76    FRDE  65
             FR+E
Sbjct  554   FREE  557



>ref|XP_011089961.1| PREDICTED: uncharacterized protein LOC105170755 [Sesamum indicum]
Length=573

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/556 (65%), Positives = 441/556 (79%), Gaps = 11/556 (2%)
 Frame = -1

Query  1699  EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSF  1520
                 + +F   + RGRWF +FASFLIMAGAGATYLFGVYS EIKATLGYDQ+TLNLLGSF
Sbjct  9     RRSQLMSFAVHVIRGRWFSLFASFLIMAGAGATYLFGVYSNEIKATLGYDQTTLNLLGSF  68

Query  1519  KDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICV  1340
             KD+GANVGVLSGLIAEVTPTWF+LL+G+AMNFAGYF+IWL+VT +I++P VWQMC+YIC+
Sbjct  69    KDLGANVGVLSGLIAEVTPTWFLLLIGAAMNFAGYFMIWLAVTGKISRPAVWQMCIYICI  128

Query  1339  GANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILL  1160
             GANSQNFANTGALVT VKNFP SRG+MLGL+KGF GLSGA+ TQ+YLA+YGNDS+ LILL
Sbjct  129   GANSQNFANTGALVTSVKNFPVSRGIMLGLLKGFTGLSGAILTQIYLAVYGNDSKALILL  188

Query  1159  IGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHF  980
             I WLPA LS+VF+ +IR MK+    NE K+F+++L +SI LAL +M +T+ QK V FS  
Sbjct  189   IAWLPAALSVVFVYTIREMKVVRQTNELKIFYQFLYVSIVLALFIMVMTVVQKLVAFSQA  248

Query  979   AYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV---EDppppaeniekaeee  809
             AY   AT+VCALLFLP  IA+ EE     + K+ LL+   +   +       + +   E+
Sbjct  249   AYAGSATVVCALLFLPLFIAIREEFTLWSQNKQPLLNPARITIDKPTGLLPGDSKPEREK  308

Query  808   kAGD---YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIG  638
               G     SCF NIFKKP+RGEDY+ILQALLS DML+LF+  FCG G SL A+DNLGQIG
Sbjct  309   PVGGSKMKSCFANIFKKPERGEDYTILQALLSTDMLILFLATFCGLGSSLTAVDNLGQIG  368

Query  637   ESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLL  458
             ESLGYP +TI +FVSL+SIWNYFGRVFSGFVSET++ ++K PR LMMT  LLL C G +L
Sbjct  369   ESLGYPTKTIKSFVSLLSIWNYFGRVFSGFVSETLLAKYKFPRPLMMTIVLLLSCIGLIL  428

Query  457   VAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNV  278
             +AFPF GSVY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV
Sbjct  429   IAFPFQGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNV  488

Query  277   KIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVAR  113
             K+ G LYD EA++++A +G     V +LTC+G +CY+++F++LA +  FGA+ SL+LV R
Sbjct  489   KVTGPLYDREALRELAKKGMTRSSVKQLTCIGARCYRLAFLILASITFFGAISSLILVVR  548

Query  112   TAAYYKTDIYKRFRDE  65
             T  +Y+ DIYK+F DE
Sbjct  549   TQEFYRGDIYKKFGDE  564



>ref|XP_006384953.1| nodulin family protein [Populus trichocarpa]
 gb|ABK95139.1| unknown [Populus trichocarpa]
 gb|ERP62750.1| nodulin family protein [Populus trichocarpa]
Length=559

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/552 (66%), Positives = 436/552 (79%), Gaps = 11/552 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F      GRWF +FASFLIMAGAGATYLFG YSK+IKATLGYDQ+TLNLLG FKD+GAN
Sbjct  6     EFAVHAINGRWFSVFASFLIMAGAGATYLFGTYSKDIKATLGYDQTTLNLLGFFKDLGAN  65

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV SGL+AEVTPTWFVLLVGSAMNFAGYF+IWL+VT++IA+P VWQMCLYIC+GANSQN
Sbjct  66    VGVFSGLLAEVTPTWFVLLVGSAMNFAGYFMIWLAVTQKIARPAVWQMCLYICIGANSQN  125

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KGFVGLSGA+ TQ YLAIYG DS++LILLIGWLPA
Sbjct  126   FANTGALVTCVKNFPESRGVMLGLLKGFVGLSGAILTQFYLAIYGTDSKSLILLIGWLPA  185

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS++F+ ++R  K    PNE +VF+ +L +SI LAL LM + I +K V FS  AY   A
Sbjct  186   ALSVIFVYTVRERKPERQPNELRVFYHFLYVSIVLALFLMAMNIVEKQVDFSKAAYAGSA  245

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSS------ENVEDppppaeniekaeeekAG  800
              +VCA+LF+P +IA+ E+      K +  +        +   D  P  ++    ++E+  
Sbjct  246   AVVCAMLFVPLIIAIREDWVQWNLKNQDGMKPATETTVDRALDIAPEVKSEVSKDKEEKA  305

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF +I  KP+RGEDY+ILQALLS+DML+LF   FCG G SL A+DNLGQIGESLGYP
Sbjct  306   KESCFVSICHKPERGEDYTILQALLSMDMLILFAATFCGLGGSLTAVDNLGQIGESLGYP  365

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
              +TI +FVSLVSIWNYFGRVFSGFVSE+++ ++K+PR LMMTF LLL C G LL+AFPFP
Sbjct  366   TKTIKSFVSLVSIWNYFGRVFSGFVSESLLVKYKMPRPLMMTFVLLLACVGHLLIAFPFP  425

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+I+GF++G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVKI G L
Sbjct  426   GSVYVASVIMGFAFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKITGHL  485

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA+K++A +G     V EL C+G QCY+V FI+L+ V LFGAL+SLVLV RT  +Y 
Sbjct  486   YDHEALKELAKKGMNRSSVKELICMGVQCYRVPFIILSSVTLFGALISLVLVMRTRKFYS  545

Query  94    TDIYKRFRDEMG  59
             +DIYK+FR+  G
Sbjct  546   SDIYKKFREIHG  557



>ref|XP_010111839.1| hypothetical protein L484_020631 [Morus notabilis]
 gb|EXC31804.1| hypothetical protein L484_020631 [Morus notabilis]
Length=573

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/556 (66%), Positives = 435/556 (78%), Gaps = 15/556 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + +GRWF +FASFLIM GAGATYLFGVYSK+IK++LGYDQ TLNL+G FKD+GAN
Sbjct  6     RFAVHVIKGRWFSVFASFLIMFGAGATYLFGVYSKQIKSSLGYDQKTLNLIGFFKDLGAN  65

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEVTPTWFVLL+GSAMNFAGYF+IWL+VT +IAKPKVWQMCLYIC+GANSQN
Sbjct  66    VGVLSGLIAEVTPTWFVLLIGSAMNFAGYFMIWLAVTGKIAKPKVWQMCLYICIGANSQN  125

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG++LGL+KGFVGLSGAV TQLYLAIYG+DS++LILLI WLPA
Sbjct  126   FANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAVMTQLYLAIYGDDSKSLILLIAWLPA  185

Query  1141  ILSIVFIPSIRPMKISSHP----NETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
              LS+VF+ +IR MK   HP    NE KVF+ +L +SI LAL LM + I QK V FS  AY
Sbjct  186   ALSVVFVYTIRTMK-PDHPSKQKNELKVFYHFLYVSIFLALFLMVMNIVQKKVVFSRAAY  244

Query  973   IACATIVCALLFLPFLIAVMEELA-----TRKEKKKQLLSSENVEDppppaeniekaeee  809
               CAT+VC L+F+P LIA+ EEL        +   +   S E  +            +++
Sbjct  245   AGCATVVCVLIFVPLLIAIKEELVIWNNLNNQHSVEDPPSHEVTQKQEEIVTKKVDIDDQ  304

Query  808   kAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
             K    SCF   F  P RGEDY+ILQALLS+DM++LF+   CG G SL A+DNLGQIGESL
Sbjct  305   KEKQKSCFLTAFDPPPRGEDYTILQALLSLDMMILFLATLCGLGSSLTAVDNLGQIGESL  364

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
             GYP RT+ +FVSLVSIWNYFGRVFSGFVSE ++ +WK+PR LMMTF LLL CAG LL+AF
Sbjct  365   GYPARTVSSFVSLVSIWNYFGRVFSGFVSEGLMVKWKVPRPLMMTFVLLLSCAGHLLIAF  424

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
             P PGSVY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV++ 
Sbjct  425   PIPGSVYIASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVA  484

Query  268   GRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAA  104
             G LYD EA+K++A +G     V EL C+G  CY+VSF +LA V  FGALVSL+LV RT  
Sbjct  485   GMLYDREALKELAQKGLDRKSVKELICIGKNCYRVSFTILACVTFFGALVSLILVVRTRE  544

Query  103   YYKTDIYKRFRDEMGA  56
             +Y+ DIYK+FR+E  A
Sbjct  545   FYRGDIYKKFREEREA  560



>ref|XP_008385511.1| PREDICTED: uncharacterized protein LOC103448054 [Malus domestica]
Length=572

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/554 (65%), Positives = 441/554 (80%), Gaps = 16/554 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F  Q+ +GRWF +FASFLIMAGAGATYLFGVYSK+IK+TLGYDQ+TLN+LG FKD+GAN
Sbjct  17    EFALQVVKGRWFTVFASFLIMAGAGATYLFGVYSKDIKSTLGYDQTTLNMLGFFKDLGAN  76

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI E+TPTWFVLL+GS +NF GYF+I+L++T++IAKPKVWQMCLYICVGANSQN
Sbjct  77    VGVLSGLIGEITPTWFVLLLGSGLNFVGYFMIYLAITEKIAKPKVWQMCLYICVGANSQN  136

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             F NTGALVTCVKNFP SRG+MLGL+KGF GLSGA+FTQLYLAIY NDS++LILLIGWLPA
Sbjct  137   FVNTGALVTCVKNFPESRGVMLGLLKGFTGLSGAIFTQLYLAIYPNDSKSLILLIGWLPA  196

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS+VF+ +IRPM++    NE +VF+ +L ISI+LAL +M +++ Q+ V FS  AY   A
Sbjct  197   ALSVVFVYTIRPMQVVRQKNEIRVFYHFLYISISLALFIMAISLIQRKVAFSQAAYAGTA  256

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSS-----------ENVEDppppaeniekae  815
             T+VC  +F+P  +A+ EEL     KKK +              + V+D   PA +    +
Sbjct  257   TVVCLFMFIPLGVAIREELVLWNLKKKTVDPRTEIAVEKPSEIQEVKDDLDPASSSSAVQ  316

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
             ++     SC G+I KKP RGEDY+ILQALLS DM++LFI  FCG G SL AIDNLGQIGE
Sbjct  317   DQNKKSTSCCGDICKKPTRGEDYTILQALLSTDMIILFIATFCGLGSSLTAIDNLGQIGE  376

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             +LGYP +TI TFVSLVSIWNYFGRVFSGFVSET++ +WK+PRTLMMT  L+L     L +
Sbjct  377   ALGYPTKTISTFVSLVSIWNYFGRVFSGFVSETLMGKWKVPRTLMMTIMLVLSSISYLSI  436

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AFPF GSVY AS+++G S+G QLTLLF IISELFGLKYY+TLFNCGQLASPLGSYILNVK
Sbjct  437   AFPFRGSVYVASVVIGVSFGAQLTLLFTIISELFGLKYYATLFNCGQLASPLGSYILNVK  496

Query  274   IVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             + G LYD EA+KQ+A +G     V ELTCLG+QCY++SF +LAG+  FGALVSL+LV RT
Sbjct  497   VTGMLYDREALKQLAKKGLTKASVKELTCLGSQCYRLSFCILAGITFFGALVSLILVVRT  556

Query  109   AAYYKTDIYKRFRD  68
               +YK DIYK++R+
Sbjct  557   REFYKGDIYKKYRE  570



>ref|XP_008385512.1| PREDICTED: uncharacterized protein LOC103448055 [Malus domestica]
Length=559

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/545 (67%), Positives = 437/545 (80%), Gaps = 6/545 (1%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + +GRWF +FASFLIMAGAGATYLFGVYSK+IK++LGYDQ+TLNLLG FKD+GAN
Sbjct  11    QFAIHVVKGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNLLGFFKDLGAN  70

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTPTWFVLL+GSAMNFAGYF+IWL+VT +I KPKVW MCLYIC+GANSQN
Sbjct  71    VGVLSGLIGEVTPTWFVLLIGSAMNFAGYFMIWLAVTAKIPKPKVWHMCLYICIGANSQN  130

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFPASRG+MLGL+KGF GLSGA+FTQ+YLA+YG++S+++ILLI WLPA
Sbjct  131   FANTGALVTCVKNFPASRGVMLGLLKGFTGLSGAMFTQIYLAVYGDNSKSMILLIAWLPA  190

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS++F+ +IRPMK+   PNE +VF+ +L +SI LA+ LM + + QK V FS  AY    
Sbjct  191   ALSVIFVYTIRPMKLVRQPNELRVFYHFLYVSIGLAVFLMVMIVLQKQVDFSQAAYAGSV  250

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL-LSSENVEDppppaeniekaeeekAGDYSCF  785
             ++VC  LF+P  IA+ EEL      K+ +   +E      P  E+  K E+EK    SCF
Sbjct  251   SVVCFFLFVPLGIAIREELILWNLMKQPVDPPTELTVKKLPAQESEAKEEQEKKTKISCF  310

Query  784   GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIG  605
              ++F KPKRGEDYSILQALLSVDML+LFI   CG G SL A+DNLGQIGESLGYP +TI 
Sbjct  311   VDVFNKPKRGEDYSILQALLSVDMLILFIATLCGLGSSLTAVDNLGQIGESLGYPTKTIS  370

Query  604   TFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYG  425
             +FVSLVSIWNYFGRVFSGFVSE+++ +WK+PR LMMT  LLL C G LL+AFP PGSVY 
Sbjct  371   SFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTLVLLLSCVGHLLIAFPAPGSVYV  430

Query  424   ASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEA  245
             AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LYD EA
Sbjct  431   ASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGMLYDREA  490

Query  244   VKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYK  80
             +K++A  G     V EL CLG QCY+++F +L  +  FGA+VSL+LV RT  +YK DIYK
Sbjct  491   LKELAKSGMARSSVKELICLGNQCYRLAFSILTAITFFGAVVSLILVVRTREFYKGDIYK  550

Query  79    RFRDE  65
             +FR+E
Sbjct  551   KFREE  555



>ref|XP_009356931.1| PREDICTED: uncharacterized protein LOC103947712 [Pyrus x bretschneideri]
Length=559

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/545 (67%), Positives = 436/545 (80%), Gaps = 6/545 (1%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + +GRWF +FASFLIMAGAGATYLFGVYSK+IK++LGYDQ+TLNLLG FKD+GAN
Sbjct  11    QFAVHVVKGRWFSVFASFLIMAGAGATYLFGVYSKQIKSSLGYDQTTLNLLGFFKDLGAN  70

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTPTWFVLL+GSAMNFAGYF+IWL+VT +I KPKVW MCLYIC+GANSQN
Sbjct  71    VGVLSGLIGEVTPTWFVLLIGSAMNFAGYFMIWLAVTAKIPKPKVWHMCLYICIGANSQN  130

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFPASRG+MLGL+KGF GLSGA+FTQ+YLA+YGN+S+++ILLI WLPA
Sbjct  131   FANTGALVTCVKNFPASRGVMLGLLKGFTGLSGAMFTQIYLAVYGNNSKSMILLIAWLPA  190

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS++F+ +IRPMK+   PNE +VF+ +L +SI LA+ LM + + QK V FS  AY    
Sbjct  191   ALSVIFVYTIRPMKLVRQPNELRVFYHFLYVSIGLAVFLMAMIVLQKQVDFSQAAYAGSV  250

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL-LSSENVEDppppaeniekaeeekAGDYSCF  785
             ++VC  LF P  IA+ EEL      K+ +   +E      P  E+  K E+EK    SCF
Sbjct  251   SVVCFFLFAPLGIAIREELILWNLMKQPVDPPTELTVTKLPAQESEVKEEQEKKTKISCF  310

Query  784   GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIG  605
              ++F KPKRGEDY+ILQALLS+DML+LFI   CG G SL A+DNLGQIGESLGYP +TI 
Sbjct  311   VDVFNKPKRGEDYTILQALLSIDMLILFIATLCGLGSSLTAVDNLGQIGESLGYPTKTIS  370

Query  604   TFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYG  425
             +FVSLVSIWNYFGRVFSGFVSE+++ +WK+PR LMMT  LLL C G LL+AFP PGSVY 
Sbjct  371   SFVSLVSIWNYFGRVFSGFVSESLLVKWKVPRPLMMTLVLLLSCVGHLLIAFPAPGSVYV  430

Query  424   ASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEA  245
             AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LYD EA
Sbjct  431   ASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGMLYDREA  490

Query  244   VKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYK  80
             +K++A  G     V EL CLG QCY+++F +LA +  FGA+VSL+LV RT  +Y  DIYK
Sbjct  491   LKELAKSGMARSSVKELICLGNQCYRLAFSILAAITFFGAVVSLILVVRTREFYNGDIYK  550

Query  79    RFRDE  65
             +FR+E
Sbjct  551   KFREE  555



>gb|KFK32342.1| hypothetical protein AALP_AA6G229300 [Arabis alpina]
Length=578

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/566 (64%), Positives = 440/566 (78%), Gaps = 25/566 (4%)
 Frame = -1

Query  1705  N*EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLG  1526
             N +      F+  +F GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNL+G
Sbjct  5     NHQSNETVRFLIHIFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLMG  64

Query  1525  SFKDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYI  1346
              FKD+GANVGV+SGLIAEVTPTWFVL +GSAMNF GYF+IWLSVT ++AKPKVWQMCLYI
Sbjct  65    FFKDLGANVGVMSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLSVTGKVAKPKVWQMCLYI  124

Query  1345  CVGANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLI  1166
             C+GANSQNFANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLYLAIYG+DS++LI
Sbjct  125   CIGANSQNFANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYLAIYGHDSKSLI  184

Query  1165  LLIGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFS  986
             LLI WLPA++S+VF+ SIR  K+    NE  VF+++L ISI LAL LM + IA+K V +S
Sbjct  185   LLIAWLPAVVSLVFVYSIREKKVVRQRNELNVFYQFLYISIFLALFLMAMNIAEKQVHYS  244

Query  985   HFAYIACATIVCALLFLPFLIAVMEEL--------------ATRKEKKKQLLSSENVEDp  848
               A +A A I C LLF+P  +AV +E+                + EK KQ++  ++V+D 
Sbjct  245   KAALVASAAICCVLLFVPLTVAVKQEIEVWNMTNLPVEEPSEVKVEKPKQVVDLDHVQDK  304

Query  847   pppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSL  668
                 +  EK ++      SCF  +F  P RGEDY+ILQAL S+DM++LF+  FCG G SL
Sbjct  305   TAKEDQEEKEKK------SCFSTVFDPPSRGEDYTILQALFSIDMIILFVATFCGLGSSL  358

Query  667   AAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFS  488
              A+DNLGQIGESLGYP  T+ +FVSLVSIWNYFGRVFSGFVSE ++ ++K+PR LMMT  
Sbjct  359   TAVDNLGQIGESLGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLV  418

Query  487   LLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLA  308
             LLL CAG LL+AFP PGSVY AS+++GFS+G QL LLF IISELFGLKYYSTLFNCGQLA
Sbjct  419   LLLSCAGHLLIAFPIPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLA  478

Query  307   SPLGSYILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFG  143
             SPLGSYILNV++ G LYD EA+KQ+ ARG     V +LTC+G+QCYK+ F++LA V  FG
Sbjct  479   SPLGSYILNVRVTGMLYDREALKQLKARGLTREDVKDLTCIGSQCYKLPFVILAAVTFFG  538

Query  142   ALVSLVLVARTAAYYKTDIYKRFRDE  65
             ALV+L L  RT  +YK DIYK+FRD 
Sbjct  539   ALVALGLAIRTREFYKGDIYKKFRDS  564



>ref|XP_010414589.1| PREDICTED: uncharacterized protein LOC104700725 isoform X1 [Camelina 
sativa]
 ref|XP_010414590.1| PREDICTED: uncharacterized protein LOC104700725 isoform X2 [Camelina 
sativa]
Length=572

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/549 (66%), Positives = 430/549 (78%), Gaps = 11/549 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+  LF GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  8     RFLIHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  67

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEVTPTWFVL +GSAMNF GYF+IWL+VT ++AKPKVWQMCLYIC+GANSQN
Sbjct  68    VGVLSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQN  127

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLY AIYGNDS++LILLI WLPA
Sbjct  128   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGNDSKSLILLIAWLPA  187

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+  IR  K+    NE  VF+++L ISI LAL LM + IA+K V FS  AY A A
Sbjct  188   AVSLVFVYLIREKKVVRQRNELSVFYQFLYISIFLALFLMAMNIAEKQVHFSKAAYAASA  247

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDY----  794
             TI C LLF+P  ++V +E+     KK  +     V+      E     ++    D     
Sbjct  248   TICCVLLFVPLTVSVKQEIEVWNMKKLPIEEPSEVKVEKHKKEVDLDQDKTAKVDLEEKE  307

Query  793   --SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF  +F  P RGEDY+ILQALLS DM++LF+  FCG G SL A+DNLGQIGESLGYP
Sbjct  308   TKSCFLTVFSPPPRGEDYTILQALLSTDMIILFVATFCGLGSSLTAVDNLGQIGESLGYP  367

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
               T+ +FVSLVSIWNYFGRVFSGFVSE ++ ++K+PR LMMT  LLL CAG LL+AFP P
Sbjct  368   NHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIAFPVP  427

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+++GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV++ G L
Sbjct  428   GSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVTGML  487

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA+KQ+AA+G     V +LTCLG+QCYK+ F++LA V  FGALVSLVL  RT  +YK
Sbjct  488   YDREALKQLAAQGLTRKDVKDLTCLGSQCYKLPFVILAAVTFFGALVSLVLAMRTREFYK  547

Query  94    TDIYKRFRD  68
              DIYK+FR+
Sbjct  548   GDIYKKFRE  556



>ref|XP_007016870.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY34489.1| Major facilitator superfamily protein [Theobroma cacao]
Length=646

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/553 (65%), Positives = 432/553 (78%), Gaps = 15/553 (3%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q  RGRWF +FASFLIMAGAGATYLFG YSKEIKATLGYDQ+TLNLLG FKD+GANV
Sbjct  90    FTVQFLRGRWFALFASFLIMAGAGATYLFGTYSKEIKATLGYDQTTLNLLGFFKDLGANV  149

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGL+AEVTPTWFVLL+G+ +NF GYF+IWL+VT +IAKPKVWQMC+YICVGANSQNF
Sbjct  150   GVLSGLVAEVTPTWFVLLLGAVLNFGGYFMIWLAVTGKIAKPKVWQMCIYICVGANSQNF  209

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVT VKNFP SRG MLGL+KGF GLSGAV TQLYLAIYGNDS++LILLIGWLPA 
Sbjct  210   ANTGALVTSVKNFPESRGAMLGLLKGFTGLSGAVMTQLYLAIYGNDSKSLILLIGWLPAA  269

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S++F+ +IR M+   HPNE +VF+ +L  SI LA+ LM LT+A+K + FS   Y    T
Sbjct  270   ISVIFVYTIRTMRPVRHPNELRVFYHFLYASIVLAVFLMALTLAEKLLTFSKAEYAGATT  329

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQL----------LSSENVEDppppaeniekaeee  809
             +VC LLF+P  I++ EEL     KK+ +            +E VE     +      + +
Sbjct  330   VVCFLLFVPLFISIREELVVWNIKKQPINPPNEIAVEKPKAEAVESKQEASNLSSPKQAD  389

Query  808   kAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
             +  + SCF  IF +P RGEDY+ILQA+ S+DML LF+  FCG G SL A+DNLGQIGESL
Sbjct  390   EKAEKSCFLTIFDRPDRGEDYTILQAMTSIDMLTLFLATFCGLGSSLTAVDNLGQIGESL  449

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
             GYP +T+ +FVSLVSIWNYFGRVFSGFVSET++ ++K+PR LMMT  LLL C G LLVAF
Sbjct  450   GYPNKTVTSFVSLVSIWNYFGRVFSGFVSETLLAKYKLPRPLMMTAVLLLACIGYLLVAF  509

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
             P PGS+Y AS+I+GFS+G QL LLF IISELFGLK+YSTLFNCGQLASPLGSYI NVKI 
Sbjct  510   PAPGSLYIASIIIGFSFGAQLPLLFAIISELFGLKHYSTLFNCGQLASPLGSYIFNVKIT  569

Query  268   GRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAA  104
             G LYD EA+K +A +G     V ELTC+GT CY+V FI+LA V  FGAL SL+LV RT +
Sbjct  570   GWLYDREALKDLAEKGLTRSSVKELTCIGTHCYRVPFIILAAVTFFGALTSLILVVRTRS  629

Query  103   YYKTDIYKRFRDE  65
             +YK+DIYK+FR+ 
Sbjct  630   FYKSDIYKKFREN  642



>ref|XP_010470138.1| PREDICTED: uncharacterized protein LOC104750092 [Camelina sativa]
Length=570

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/548 (66%), Positives = 432/548 (79%), Gaps = 9/548 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+  LF GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  8     RFLIHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  67

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEVTPTWFVL +GSAMNF GYF+IWL+VT ++AKPK+WQMCLYIC+GANSQN
Sbjct  68    VGVLSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKIWQMCLYICIGANSQN  127

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLY AIYGNDS++LILLI WLPA
Sbjct  128   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGNDSKSLILLIAWLPA  187

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+  IR  K+    NE  VF+++L ISI LAL LM + IA+K V FS  AY A A
Sbjct  188   AVSLVFVYLIREKKVVRQRNELSVFYQFLYISIFLALFLMAMNIAEKQVHFSKAAYAASA  247

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE----DppppaeniekaeeekAGDY  794
             TI C LLF+P  ++V +E+     KK  +     V+          +  + A+ E+    
Sbjct  248   TICCVLLFVPLTVSVKQEIEVWNMKKLPIEEPSEVKVEKPKKEVDLDQDKTAKVEEKETK  307

Query  793   SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPR  614
             SCF  +F  P RGEDY+ILQALLS DM++LF+  FCG G SL A+DNLGQIGESLGYP  
Sbjct  308   SCFLTVFSPPPRGEDYTILQALLSTDMIILFVATFCGLGSSLTAVDNLGQIGESLGYPNH  367

Query  613   TIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGS  434
             T+ +FVSLVSIWNYFGRVFSGFVSE +V ++K+PR LMMT  LLL CAG LL+AFP PGS
Sbjct  368   TVSSFVSLVSIWNYFGRVFSGFVSEYLVAKYKLPRPLMMTLVLLLSCAGHLLIAFPVPGS  427

Query  433   VYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYD  254
             VY AS+++GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV++ G LYD
Sbjct  428   VYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVTGMLYD  487

Query  253   GEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
              EA+KQ+AA+G     V +LTCLG+QCYK+ F++LA V  FGALVSLVL  RT  +YK D
Sbjct  488   REALKQLAAQGLTRKDVKDLTCLGSQCYKLPFVILAAVTFFGALVSLVLAMRTREFYKGD  547

Query  88    IYKRFRDE  65
             IYK+FR+ 
Sbjct  548   IYKKFREN  555



>emb|CDY30506.1| BnaA04g16270D [Brassica napus]
Length=566

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/547 (66%), Positives = 430/547 (79%), Gaps = 7/547 (1%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+  LF GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  9     RFLIHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  68

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV+SGLIAEVTPTWFVL VGSAMNF GYF+IWL+VT +++KPKVWQMCLYIC+GANSQN
Sbjct  69    VGVMSGLIAEVTPTWFVLTVGSAMNFVGYFMIWLTVTGKVSKPKVWQMCLYICIGANSQN  128

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLY AIYGNDS++LILLI WLPA
Sbjct  129   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGNDSKSLILLIAWLPA  188

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++S+VF+ SIR  K+    NE  VF+ +L +SI LAL LM + IA+K V F+  AY A A
Sbjct  189   VVSLVFVYSIREKKVVRQRNELNVFYNFLYLSIFLALFLMAMNIAEKQVHFTKAAYAASA  248

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSCFG  782
             TI C LLF+P  +AV +E+          L    +E      +       E+    SCF 
Sbjct  249   TICCVLLFVPLTVAVKQEIENLSRMSD--LPGSPLEKKVEAPKKEIDLVHEEKEMKSCFL  306

Query  781   NIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGT  602
              +F  P RGEDY+ILQALLS+DM++LF+  FCG G SL A+DNLGQIGESLGYP  T+ +
Sbjct  307   TVFDPPPRGEDYTILQALLSLDMIILFVATFCGLGSSLTAVDNLGQIGESLGYPNHTVSS  366

Query  601   FVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGA  422
             FVSLVSIWNYFGRVFSGFVSE ++ ++K+PR LMMTF LLL CAG LL+AFP PGSVY A
Sbjct  367   FVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTFVLLLSCAGHLLIAFPVPGSVYIA  426

Query  421   SLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAV  242
             S+++GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV++ G LYD EA+
Sbjct  427   SILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVTGMLYDREAL  486

Query  241   KQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKR  77
             KQ+ ARG     V +LTCLG+QCYK+ F++LA V  FGALVSL L  RT  +YK DIYK+
Sbjct  487   KQLKARGLTRKDVKDLTCLGSQCYKLPFVILASVTFFGALVSLGLAIRTRKFYKGDIYKK  546

Query  76    FRDEMGA  56
             FR+  G+
Sbjct  547   FRETPGS  553



>ref|XP_011028256.1| PREDICTED: uncharacterized protein LOC105128342 [Populus euphratica]
 ref|XP_011012690.1| PREDICTED: uncharacterized protein LOC105116886 [Populus euphratica]
Length=559

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/555 (66%), Positives = 439/555 (79%), Gaps = 11/555 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             ++  F      GRWF +FASFLIMAGAGATYLFG YSK+IKATLGYDQ+TLNLLG FKD+
Sbjct  3     DLWEFAVHAINGRWFSVFASFLIMAGAGATYLFGTYSKDIKATLGYDQTTLNLLGFFKDL  62

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGV SGL+AEVTPTWFVLLVGSAMNFAGYF+IWL+VT++IA+P VWQMCLYIC+GAN
Sbjct  63    GANVGVFSGLLAEVTPTWFVLLVGSAMNFAGYFMIWLAVTQKIARPAVWQMCLYICMGAN  122

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQNFANTGALVTCVKNFP SRG+MLGL+KGFVGLSGA+ TQ YLAIYG DS++LILLIGW
Sbjct  123   SQNFANTGALVTCVKNFPESRGVMLGLLKGFVGLSGAILTQFYLAIYGTDSKSLILLIGW  182

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA LS++F+ ++R  K    PNE +VF+ +L +SI LAL LM + I +K V FS  AY 
Sbjct  183   LPAALSVIFVYTVRERKPERQPNELRVFYHFLYVSIVLALFLMAMNIVEKQVDFSKAAYA  242

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLL------SSENVEDppppaeniekaeee  809
                 +VCALLF+P +IA+ E+      K +  +      + +   D  P  ++    E+E
Sbjct  243   GSVAVVCALLFIPLIIAIREDWVQWNLKNQDGMKPATETTVDRALDIAPEVKSEVSKEKE  302

Query  808   kAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
             +    SCF +I  KP+RGEDY+ILQALLS+DML+LF   FCG G SL A+DNLGQIGESL
Sbjct  303   EKAKESCFASICHKPERGEDYTILQALLSMDMLILFAATFCGLGGSLTAVDNLGQIGESL  362

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
             GYP +TI +FVSLVSIWNYFGRVFSGFVSE+++ ++K+PR LMMTF LLL C G LL+AF
Sbjct  363   GYPTKTIKSFVSLVSIWNYFGRVFSGFVSESLLVKYKMPRPLMMTFVLLLACVGHLLIAF  422

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
             PFPGSVY AS+I+GF++G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVKI 
Sbjct  423   PFPGSVYVASVIMGFAFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKIT  482

Query  268   GRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAA  104
             G LYD EA+K++A +G     V EL C+G+QCY+V FI+L+ V LFGAL+SLVLV RT  
Sbjct  483   GHLYDHEALKELAKKGMNRSSVKELICMGSQCYRVPFIILSSVTLFGALISLVLVMRTRK  542

Query  103   YYKTDIYKRFRDEMG  59
             +Y +DIYK+FR+  G
Sbjct  543   FYGSDIYKKFREIHG  557



>ref|XP_009356932.1| PREDICTED: uncharacterized protein LOC103947713 [Pyrus x bretschneideri]
Length=575

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/554 (65%), Positives = 438/554 (79%), Gaps = 16/554 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F  Q+ +GRWF +FASFLIMAGAGATYLFGVYSK+IK+TLGYDQ+TLN+LG FKD+GAN
Sbjct  20    EFALQVVKGRWFTVFASFLIMAGAGATYLFGVYSKDIKSTLGYDQTTLNMLGFFKDLGAN  79

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTPTWFVLL+GS +NF GYF+I+L+VT++IAKPKVWQMCLYICVGANSQN
Sbjct  80    VGVLSGLIGEVTPTWFVLLLGSGLNFVGYFMIYLAVTEKIAKPKVWQMCLYICVGANSQN  139

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             F NTGALVTCVKNFP SRG+MLGL+KGF GLSGA+FTQLYLAIY NDS++LILLIGWLPA
Sbjct  140   FVNTGALVTCVKNFPESRGVMLGLLKGFTGLSGAIFTQLYLAIYPNDSKSLILLIGWLPA  199

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS+VF+ +IRPM++    NE +VF+ +L ISI+LAL +M +++ Q+ V FS  AY   A
Sbjct  200   ALSVVFVYTIRPMQVVRQKNEIRVFYHFLYISISLALFIMAMSLIQRKVAFSQAAYAGTA  259

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSS-----------ENVEDppppaeniekae  815
             T+VC  +F+P  +A+ EEL     KKK +              +  +D   P  +    +
Sbjct  260   TVVCLFMFIPLGVAIREELVLWNLKKKTVDPPTEIAVEKPSEIQEAKDDLDPESSSSAVQ  319

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
             ++     SC G+I  KP RGEDY+ILQALLS DM++LFI  FCG G SL AIDNLGQIGE
Sbjct  320   DQNKRSTSCCGDICNKPTRGEDYTILQALLSTDMIILFIATFCGLGSSLTAIDNLGQIGE  379

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             +LGYP +TI TFVSLVSIWNYFGRVFSGFVSET++ +WK+PRTLMMT  L+L     L +
Sbjct  380   ALGYPTKTISTFVSLVSIWNYFGRVFSGFVSETLMGKWKVPRTLMMTIMLVLSSISYLSI  439

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AFPF GSVY AS+++G S+G QLTLLF IISELFGLKYY+TLFNCGQLASPLGSYILNVK
Sbjct  440   AFPFRGSVYVASVVIGVSFGAQLTLLFTIISELFGLKYYATLFNCGQLASPLGSYILNVK  499

Query  274   IVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             + G LYD EA+KQ+A +G     V ELTCLG+QCY++SF +LAG+  FGALVSL+LV RT
Sbjct  500   VTGMLYDREALKQLAKKGLTRASVKELTCLGSQCYRLSFSILAGITFFGALVSLILVVRT  559

Query  109   AAYYKTDIYKRFRD  68
               +YK DIYK++R+
Sbjct  560   REFYKGDIYKKYRE  573



>emb|CDX71381.1| BnaC04g16160D [Brassica napus]
Length=572

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/566 (64%), Positives = 436/566 (77%), Gaps = 23/566 (4%)
 Frame = -1

Query  1738  IHSKGQLN*LIN*EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATL  1559
             IHS G+              F+   F GRWFM+FASFLIMA AGATYLFG YSK+IK+TL
Sbjct  5     IHSSGE-----------TVRFLIHFFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTL  53

Query  1558  GYDQSTLNLLGSFKDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIA  1379
             GYDQ+TLNLLG FKD+GANVGV+SGLIAEVTPTWFVL++GSAMNF GYF+IWL+VT ++A
Sbjct  54    GYDQTTLNLLGFFKDLGANVGVMSGLIAEVTPTWFVLVIGSAMNFVGYFMIWLTVTGKVA  113

Query  1378  KPKVWQMCLYICVGANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYL  1199
             KP+VWQMCLYIC+GANSQNFANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+FTQLY 
Sbjct  114   KPRVWQMCLYICIGANSQNFANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIFTQLYF  173

Query  1198  AIYGNDSQNLILLIGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMG  1019
             AIYGNDS++LILLI WLPA++S+VF+ SIR  K+    NE  VF+ +L ISI LAL LM 
Sbjct  174   AIYGNDSKSLILLIAWLPAVVSLVFVYSIREKKVVRQRNEINVFYNFLYISIFLALFLMA  233

Query  1018  LTIAQKYVRFSHFAYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDpppp  839
             + IA+K V F+  AYIA ATI C LLF+P  +AV +E+     KK   L+ E   +    
Sbjct  234   MNIAEKQVHFTKAAYIASATICCVLLFVPLTVAVKQEIEVWNMKK---LAEEEPSEVKIE  290

Query  838   aeniekaeeekAGD----YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCS  671
                 +    ++ G+     SC   +F  P RGEDY+ILQALLS+DM++LF+  FCG G S
Sbjct  291   KPEKDIDHLKEDGEKKEMKSCLLTVFDPPPRGEDYTILQALLSLDMIILFLATFCGLGSS  350

Query  670   LAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTF  491
             L A+DNLGQIGESLGYP   + +FVSLVSIWNYFGRVFSGFVSE ++ + K+PR LMMT 
Sbjct  351   LTALDNLGQIGESLGYPNHAVSSFVSLVSIWNYFGRVFSGFVSEYLLAKHKLPRPLMMTL  410

Query  490   SLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQL  311
              LLL CAG LL+AFP PGSVY AS+++GFS+G QL LLF IISELFGLKY+STLFNCGQL
Sbjct  411   VLLLSCAGHLLIAFPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYFSTLFNCGQL  470

Query  310   ASPLGSYILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLF  146
             ASPLGSYILNV++ G LYD EA+KQ+ ARG     V +LTCLG+QCYK+ F++LA V  F
Sbjct  471   ASPLGSYILNVRVTGMLYDREAMKQLTARGLTRKDVKDLTCLGSQCYKLPFVILAAVTFF  530

Query  145   GALVSLVLVARTAAYYKTDIYKRFRD  68
             GALVSL L  RT  +YK DIYK+FRD
Sbjct  531   GALVSLGLAIRTRKFYKGDIYKKFRD  556



>ref|XP_006409833.1| hypothetical protein EUTSA_v10016458mg [Eutrema salsugineum]
 gb|ESQ51286.1| hypothetical protein EUTSA_v10016458mg [Eutrema salsugineum]
Length=560

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/543 (67%), Positives = 429/543 (79%), Gaps = 13/543 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+  LF GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  13    RFLIHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  72

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV+SGLIAEVTPTWFVL +GSAMNF GYF+IWL+VT ++A+PKVWQMCLYIC+GANSQN
Sbjct  73    VGVMSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVARPKVWQMCLYICIGANSQN  132

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLY AIYGNDS +LILLI WLPA
Sbjct  133   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGNDSMSLILLIAWLPA  192

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++S+VF+ SIR  K+    NE  VF+ +L +SI LAL LM + IA+K V F+  AY A A
Sbjct  193   VVSLVFVYSIREKKVVRQRNELNVFYNFLYLSIFLALFLMAMNIAEKQVHFTKAAYTASA  252

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSCFG  782
             TI C LLF+P  +AV +E+   + KK  L   E  ED     +  EK  +      SCF 
Sbjct  253   TICCVLLFVPLTVAVKQEIEVWEMKK--LPVEEPSEDKTTKLDQEEKERK------SCFL  304

Query  781   NIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGT  602
              IF  P RGEDY+ILQAL S+DM++LF+  FCG G SL A+DNLGQIGESLGYP  T+ +
Sbjct  305   TIFAPPSRGEDYTILQALFSIDMIILFVATFCGLGSSLTAVDNLGQIGESLGYPNHTVSS  364

Query  601   FVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGA  422
             FVSLVSIWNYFGRVFSGFVSE ++ ++K+PR LMMT  LLL CAG LL+AFP PGSVY A
Sbjct  365   FVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIAFPIPGSVYIA  424

Query  421   SLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAV  242
             S+++GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV++ G LYD EA+
Sbjct  425   SILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVTGMLYDREAL  484

Query  241   KQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKR  77
             KQ+AARG     V +LTCLG QCYK+ F++LA V  FGALVSL L  RT  +YK DIY +
Sbjct  485   KQLAARGLTRKDVKDLTCLGRQCYKLPFVILATVTFFGALVSLGLAIRTREFYKGDIYNK  544

Query  76    FRD  68
             FR+
Sbjct  545   FRE  547



>ref|XP_011032303.1| PREDICTED: uncharacterized protein LOC105131167 [Populus euphratica]
 ref|XP_011032304.1| PREDICTED: uncharacterized protein LOC105131167 [Populus euphratica]
Length=559

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/552 (66%), Positives = 436/552 (79%), Gaps = 11/552 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F      GRWF +FASFLIMAGAGATYLFG YSK+IKATLGYDQ+TLNLLG FKD+GAN
Sbjct  6     KFALHAVDGRWFSVFASFLIMAGAGATYLFGTYSKDIKATLGYDQTTLNLLGFFKDLGAN  65

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTPTWFVL+VGSAMNFAGYF+IW+SVT+RIAKP VWQMCLYIC+GANSQN
Sbjct  66    VGVLSGLLAEVTPTWFVLVVGSAMNFAGYFMIWMSVTQRIAKPAVWQMCLYICIGANSQN  125

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLG++KGFVGLSGA+FTQ YLAIYG DS++LILLIGWLPA
Sbjct  126   FANTGALVTCVKNFPESRGVMLGMLKGFVGLSGAIFTQFYLAIYGTDSKSLILLIGWLPA  185

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS++F  ++R  K    PNE KVF+++L +SI LAL LM + I +K V FS  AY   A
Sbjct  186   ALSVIFAYTVRERKPERQPNELKVFYQFLIVSIVLALFLMAMNIVEKLVDFSKAAYAGSA  245

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLL------SSENVEDppppaeniekaeeekAG  800
             T+VC +LF+P +IA+ E+      K ++ +      ++E   D  P  ++    E+E+  
Sbjct  246   TVVCVMLFIPLVIAIKEDWIHWNLKHQEGMKPATEATAEKKLDIAPEVKSEISKEQEEKV  305

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF  I  KP RG+DY+ILQALLS+DML+LF   FCG G SL A+DNLGQIGESLGYP
Sbjct  306   RKSCFLTICNKPPRGQDYTILQALLSIDMLILFAATFCGLGASLTAVDNLGQIGESLGYP  365

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
              RTI +FVSLVSIWN+FGRVF+GFVSE+++ ++K+PR LMMTF LLL C G LL+AFPF 
Sbjct  366   TRTIKSFVSLVSIWNFFGRVFAGFVSESLLVKYKMPRPLMMTFVLLLACVGYLLIAFPFS  425

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+I GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G L
Sbjct  426   GSVYVASVITGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGLL  485

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EAVK++A +G     V EL C+G QC+++ FIVL+ V  FGAL+SL+LV RT  +Y 
Sbjct  486   YDNEAVKELAKKGLDRSAVKELVCIGVQCFRLPFIVLSAVTFFGALISLILVMRTRKFYG  545

Query  94    TDIYKRFRDEMG  59
             +DIYK+FR+  G
Sbjct  546   SDIYKKFREIHG  557



>ref|XP_010510684.1| PREDICTED: uncharacterized protein LOC104786910 isoform X1 [Camelina 
sativa]
 ref|XP_010510685.1| PREDICTED: uncharacterized protein LOC104786910 isoform X2 [Camelina 
sativa]
 ref|XP_010510687.1| PREDICTED: uncharacterized protein LOC104786910 isoform X3 [Camelina 
sativa]
Length=572

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/549 (66%), Positives = 431/549 (79%), Gaps = 11/549 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+  LF GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  8     RFLIHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  67

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEVTPTWFVL +GSAMNF GYF+IWL+VT ++AKPKVWQMCLYIC+GANSQN
Sbjct  68    VGVLSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQN  127

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLY AIYGNDS++LILLI WLPA
Sbjct  128   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGNDSKSLILLIAWLPA  187

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+  IR  K+    NE  VF+++L ISI LAL LM + IA+K V FS  AY A A
Sbjct  188   AVSLVFVYLIREKKVVRQRNELSVFYQFLYISIFLALFLMAMNIAEKQVHFSKAAYAASA  247

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDY----  794
             TI C LLF+P  ++V +E+     KK  +     V+   P  E     ++    D     
Sbjct  248   TICCVLLFVPLTVSVKQEIEVWNMKKLPIEEPSEVKVEKPKKEVDLDQDKTAKVDLEEKE  307

Query  793   --SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF  +F  P RGEDY+ILQALLS DM++LF+  FCG G SL A+DNLGQIGESLGYP
Sbjct  308   TKSCFLTVFSPPPRGEDYTILQALLSTDMIILFVATFCGLGSSLTAVDNLGQIGESLGYP  367

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
               T+ +FVSLVSIWNYFGRVFSGFVSE ++ ++K+PR LMMT  LLL CAG LL+AFP P
Sbjct  368   NHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIAFPVP  427

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+++GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV++ G L
Sbjct  428   GSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVTGML  487

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA+KQ+AA+G     V +LTCLG+QC+K+ F++LA V  FGALV+LVL  RT  +YK
Sbjct  488   YDREALKQLAAQGLTRKDVKDLTCLGSQCFKLPFVILAAVTFFGALVALVLAMRTREFYK  547

Query  94    TDIYKRFRD  68
              DIYK+FR+
Sbjct  548   GDIYKKFRE  556



>ref|NP_180379.1| major facilitator protein [Arabidopsis thaliana]
 gb|AAC98454.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAL14413.1| At2g28120/F24D13.9 [Arabidopsis thaliana]
 gb|AAL32615.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAM13326.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC08082.1| major facilitator protein [Arabidopsis thaliana]
Length=577

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/549 (66%), Positives = 431/549 (79%), Gaps = 11/549 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+   F GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  8     RFLIHFFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  67

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEVTPTWFVL +GSAMNF GYF+IWL+VT ++AKPKVWQMCLYIC+GANSQN
Sbjct  68    VGVLSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQN  127

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+FTQLY AIYG+DS++LILLI WLPA
Sbjct  128   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIFTQLYFAIYGHDSKSLILLIAWLPA  187

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+  IR  K+    NE  VF+++L ISI LAL LM + IA+K V FS  AY A A
Sbjct  188   AVSLVFVYLIREKKVVRQRNELSVFYQFLYISIFLALFLMAMNIAEKQVHFSKAAYAASA  247

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLL--SSENVEDppppaeniekaeeekAGDY--  794
             TI CALLF+P  ++V +EL      K  +   S   VE P    +  +    +  G+   
Sbjct  248   TICCALLFVPLTVSVKQELEVWNMMKLPIEEPSEVKVEKPKKELDLDQDKAAKVNGEEKE  307

Query  793   --SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF  +F  P RGEDY+ILQALLS DM++LF+  FCG G SL A+DNLGQIGESLGYP
Sbjct  308   TKSCFSTVFSPPPRGEDYTILQALLSTDMIILFVATFCGLGSSLTAVDNLGQIGESLGYP  367

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
               T+ +FVSLVSIWNYFGRVFSGFVSE ++ ++K+PR LMMT  LLL CAG LL+AFP P
Sbjct  368   NHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIAFPVP  427

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+++GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV++ G L
Sbjct  428   GSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVTGML  487

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA+KQ+ ARG     V +LTCLG+QCYK+ F++LA V  FGALVSL L  RT  +YK
Sbjct  488   YDKEALKQLTARGLTRKDVKDLTCLGSQCYKLPFLILAAVTFFGALVSLGLAIRTREFYK  547

Query  94    TDIYKRFRD  68
              DIYK+FR+
Sbjct  548   GDIYKKFRE  556



>emb|CDY04538.1| BnaA07g13640D [Brassica napus]
Length=572

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/564 (65%), Positives = 437/564 (77%), Gaps = 18/564 (3%)
 Frame = -1

Query  1738  IHSKGQLN*LIN*EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATL  1559
             IHS G+              F+   F GRWFM+FASFLIMA AGATYLFG YSK+IK+TL
Sbjct  5     IHSSGE-----------TVRFLIHFFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTL  53

Query  1558  GYDQSTLNLLGSFKDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIA  1379
             GYDQ+TLNLLG FKD+GANVGV+SGLIAEVTPTWFVL++GSAMNF GYF+IWL+VT ++A
Sbjct  54    GYDQTTLNLLGFFKDLGANVGVMSGLIAEVTPTWFVLVIGSAMNFVGYFMIWLTVTGKVA  113

Query  1378  KPKVWQMCLYICVGANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYL  1199
             KP+VWQMCLYIC+GANSQNFANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+FTQLY 
Sbjct  114   KPRVWQMCLYICIGANSQNFANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIFTQLYF  173

Query  1198  AIYGNDSQNLILLIGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMG  1019
             AIYGNDS++LILLI WLPA++S+VF+ SIR  K+    NE  VF+ +L ISI LAL LM 
Sbjct  174   AIYGNDSKSLILLIAWLPAVVSLVFVYSIREKKVVRQRNEINVFYNFLYISIFLALFLMA  233

Query  1018  LTIAQKYVRFSHFAYIACATIVCALLFLPFLIAVMEELATRKEKK--KQLLSSENVEDpp  845
             + IA+K V F+  AYIA ATI C LLF+P  +AV +E+     KK  ++  S   +E P 
Sbjct  234   MNIAEKQVHFTRAAYIASATICCVLLFVPLTVAVKQEIEVWNMKKLAEEEPSEVKIEKPQ  293

Query  844   ppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLA  665
                 +  K + EK    SC   +F  P RGEDY+ILQALLS+DM++LF+  FCG G SL 
Sbjct  294   KEDIDHLKEDGEKKEMKSCLLTVFDPPPRGEDYTILQALLSLDMIILFLATFCGLGSSLT  353

Query  664   AIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSL  485
             A+DNLGQIGESLGYP   + +FVSLVSIWNYFGRVFSGFVSE ++ + K+PR LMMT  L
Sbjct  354   ALDNLGQIGESLGYPNHAVSSFVSLVSIWNYFGRVFSGFVSEYLLAKHKLPRPLMMTLVL  413

Query  484   LLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLAS  305
             LL CAG LL+AFP PGSVY AS+++GFS+G QL LLF IISELFGLKY+STLFNCGQLAS
Sbjct  414   LLSCAGHLLIAFPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYFSTLFNCGQLAS  473

Query  304   PLGSYILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGA  140
             PLGSYILNV++ G LYD EA+KQ+ ARG     V +LTCLG QCYK+ F++LA V  FGA
Sbjct  474   PLGSYILNVRVTGMLYDREAMKQLTARGLTRKDVKDLTCLGRQCYKLPFVILAAVTFFGA  533

Query  139   LVSLVLVARTAAYYKTDIYKRFRD  68
             LVSL L  RT  +YK DIYK+FR+
Sbjct  534   LVSLGLAIRTRKFYKGDIYKKFRE  557



>ref|XP_009140846.1| PREDICTED: uncharacterized protein LOC103864824 [Brassica rapa]
Length=581

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/560 (65%), Positives = 434/560 (78%), Gaps = 18/560 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+  LF GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  9     RFLIHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  68

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV+SGLIAEVTPTWFVL VGSAMNF GYF+IWL+VT +++KPKVWQMCLYIC+GANSQN
Sbjct  69    VGVMSGLIAEVTPTWFVLTVGSAMNFVGYFMIWLTVTGKVSKPKVWQMCLYICIGANSQN  128

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLY AIYGNDS++LILLI WLPA
Sbjct  129   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGNDSKSLILLIAWLPA  188

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++S+VF+ SIR  K+    NE  VF+ +L +SI LAL LM + IA+K V F+  AY A A
Sbjct  189   VVSLVFVYSIREKKVVRQRNELNVFYNFLYLSIFLALFLMAMNIAEKQVHFTKAAYAASA  248

Query  961   TIVCALLFLPFLIAVMEELATRKEKK--KQLLSSENV-----------EDppppaeniek  821
             TI C LLF+P  +AV +E+     KK     +  EN+           E      +    
Sbjct  249   TICCVLLFVPLTVAVKQEIEVWNMKKLPPSEVKVENLSRMSDLPGSPLEKKVEAPKKEID  308

Query  820   aeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQI  641
                E+    SCF  +F  P RGEDY+ILQALLS+DM++LF+  FCG G SL A+DNLGQI
Sbjct  309   LVHEEKEMKSCFLTVFDPPPRGEDYTILQALLSLDMIILFMATFCGLGSSLTAVDNLGQI  368

Query  640   GESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDL  461
             GESLGYP  T+ +FVSLVSIWNYFGRVFSGFVSE ++ ++K+PR LMMTF LLL CAG L
Sbjct  369   GESLGYPNHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTFVLLLSCAGHL  428

Query  460   LVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILN  281
             L+AFP PGSVY AS+++GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILN
Sbjct  429   LIAFPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILN  488

Query  280   VKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVA  116
             V++ G LYD EA+KQ+ ARG     V +LTCLG+QCYK+ F++LA V  FGALVSL L  
Sbjct  489   VRVTGMLYDREALKQLKARGLTRKDVKDLTCLGSQCYKLPFVILASVTFFGALVSLGLAI  548

Query  115   RTAAYYKTDIYKRFRDEMGA  56
             RT  +YK DIYK+FR+  G+
Sbjct  549   RTRKFYKGDIYKKFRETPGS  568



>ref|XP_010557355.1| PREDICTED: uncharacterized protein LOC104826384 [Tarenaya hassleriana]
Length=578

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/563 (65%), Positives = 440/563 (78%), Gaps = 23/563 (4%)
 Frame = -1

Query  1699  EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSF  1520
             E   +  FV  LF GRWFM+FASFLIMA AGATYLFG YSKEIKATLGYDQ+TLNLLG F
Sbjct  6     ESGEIPRFVVHLFNGRWFMVFASFLIMACAGATYLFGTYSKEIKATLGYDQTTLNLLGFF  65

Query  1519  KDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICV  1340
             KD+GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYF+IWL+VT +IAKPKVWQMCLYIC+
Sbjct  66    KDLGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFMIWLAVTGKIAKPKVWQMCLYICI  125

Query  1339  GANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILL  1160
             GANSQNFANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLYLAIYG DS++LILL
Sbjct  126   GANSQNFANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYLAIYGTDSKSLILL  185

Query  1159  IGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHF  980
             IGWLPA +S++F+ SIR  K+    NE  VF+++L +SI LAL LM + IAQK   FS  
Sbjct  186   IGWLPAAISVLFVYSIREKKVVRQKNELNVFYQFLYLSIFLALFLMAMNIAQKQTHFSKA  245

Query  979   AYIACATIVCALLFLPFLIAVMEELAT--------------RKEKKKQLLSSENVEDppp  842
             AY A AT+ C LLF+P  +AV +E+                + EK KQ+ S  ++ +   
Sbjct  246   AYTASATVCCVLLFVPLFVAVKQEIDVWNMKKLPVEPPSELKVEKSKQIESRTDLPEDRT  305

Query  841   paeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAA  662
              A+   +  +      SCF  +F  P RGEDY+ILQAL S+DM++LF+  FCG G SL A
Sbjct  306   AAKGYLENSK----KRSCFLTVFDPPPRGEDYTILQALFSIDMIILFLATFCGLGSSLTA  361

Query  661   IDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLL  482
             +DNLGQIGESLGYPP T+ +FVSLVSIWNYFGRVFSG+VSE ++ ++K+PR LMMT  LL
Sbjct  362   VDNLGQIGESLGYPPHTVSSFVSLVSIWNYFGRVFSGYVSEHLLAKYKLPRPLMMTLVLL  421

Query  481   LPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASP  302
             L C G LL+AFPFPGSVY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASP
Sbjct  422   LSCLGHLLIAFPFPGSVYIASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASP  481

Query  301   LGSYILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGAL  137
             LGSYILNV++ G LYD EA+K++AA+G     V +LTC+G QCY++ F+VLA V  FG+L
Sbjct  482   LGSYILNVRVTGMLYDSEAMKELAAKGLRREDVKDLTCIGRQCYRLPFVVLAAVTFFGSL  541

Query  136   VSLVLVARTAAYYKTDIYKRFRD  68
             V+LVL  RT  +YK DIYK+F+D
Sbjct  542   VALVLTVRTREFYKGDIYKKFKD  564



>emb|CDP07039.1| unnamed protein product [Coffea canephora]
Length=593

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/549 (65%), Positives = 433/549 (79%), Gaps = 13/549 (2%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F   + RGRWF +FASFLIMAGAGATYLFG YSKEIK++LGYDQ+TLNLLG FKD GANV
Sbjct  23    FAVHVVRGRWFSLFASFLIMAGAGATYLFGTYSKEIKSSLGYDQTTLNLLGFFKDFGANV  82

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGLI EV PTW VLL+G+ MNFAGYF+IWL+VT RIAKPKVW MC+YICVGANSQNF
Sbjct  83    GVLSGLIDEVVPTWLVLLIGAGMNFAGYFMIWLAVTGRIAKPKVWMMCIYICVGANSQNF  142

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVT VKNFP SRG+M+GL+KGF GLSGA+ TQ+YLA+YGNDS++LILLI WLPA 
Sbjct  143   ANTGALVTSVKNFPESRGIMIGLLKGFTGLSGAILTQVYLAVYGNDSKSLILLIAWLPAA  202

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             LS+VF+ +IR MK+   PN+  +F+ +L +SI LAL LM +TI QK V FS  AY   AT
Sbjct  203   LSVVFVYTIREMKVVRQPNQLSIFYYFLFVSIALALFLMVMTILQKAVAFSQAAYAGSAT  262

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQLLSSENV--------EDppppaeniekaeeekA  803
             + CALLF P LIA+ +E    K++ +  +SS  V        E     A      + ++ 
Sbjct  263   VACALLFFPLLIAIKQEWLIWKQRNRPDISSPTVSIEIPLEIEPKQTSAAQSSSKKIDEN  322

Query  802   GDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGY  623
                  + NIFKKPKRG+DY+ILQAL S DML+LF+  FCG G SL A+DNLGQIGESLGY
Sbjct  323   QTALWYQNIFKKPKRGDDYTILQALSSTDMLVLFLATFCGLGSSLTAVDNLGQIGESLGY  382

Query  622   PPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPF  443
             P +TI +FVSL+SIWN+FGR+FSGFVSET++ ++K PRTLMMTF+LLL C G LL+AFPF
Sbjct  383   PTKTIKSFVSLLSIWNFFGRIFSGFVSETLLVKYKFPRTLMMTFALLLACTGYLLIAFPF  442

Query  442   PGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGR  263
              GSVY AS+I+GFS+G QL L+F IISELFGLK+Y+TLFNCGQLASPLGSYILNVK+ G 
Sbjct  443   NGSVYIASIIIGFSFGAQLPLIFTIISELFGLKHYATLFNCGQLASPLGSYILNVKVTGP  502

Query  262   LYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYY  98
             LYD EA+K +A RG     V +LTC+GTQCY++ FIVLA + LFGAL SL+LVART  +Y
Sbjct  503   LYDREALKDLARRGMTRSSVKDLTCIGTQCYRLPFIVLASITLFGALASLILVARTREFY  562

Query  97    KTDIYKRFR  71
             ++DIYK+FR
Sbjct  563   RSDIYKKFR  571



>ref|XP_006295838.1| hypothetical protein CARUB_v10024965mg [Capsella rubella]
 gb|EOA28736.1| hypothetical protein CARUB_v10024965mg [Capsella rubella]
Length=583

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/544 (67%), Positives = 430/544 (79%), Gaps = 12/544 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+  L  GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  8     RFLIHLLNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  67

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEVTPTWFVL +GSAMNF GYF+IWL+VT ++AKPKVWQMCLYIC+GANSQN
Sbjct  68    VGVLSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQN  127

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLY AIYGNDS++LILLI WLPA
Sbjct  128   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGNDSKSLILLIAWLPA  187

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+  IR  K+    NE  VF+++L +SI LAL LM + IA+K V FS  AY A A
Sbjct  188   AVSLVFVYLIREKKVVRQRNELSVFYQFLYLSIFLALFLMAMNIAEKQVHFSKAAYAASA  247

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSCFG  782
             T+ C LLF+P  ++V +E+     KK  L   E  ED      + E+ E +     SCF 
Sbjct  248   TVCCVLLFVPLTVSVKQEIEVWNMKK--LPVEEPSEDKTAKKVDQEEKETK-----SCFL  300

Query  781   NIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGT  602
              +F  P RGEDY+ILQALLS DM++LF+  FCG G SL A+DNLGQIGESLGYP  T+ +
Sbjct  301   TVFSPPPRGEDYTILQALLSTDMIILFVATFCGLGSSLTAVDNLGQIGESLGYPNHTVSS  360

Query  601   FVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGA  422
             FVSLVSIWNYFGRVFSGFVSE ++ ++K+PR LMMT  LLL CAG LL+AFP PGSVY A
Sbjct  361   FVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIAFPIPGSVYIA  420

Query  421   SLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAV  242
             S+++GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV++ G LYD EA+
Sbjct  421   SILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVTGMLYDREAL  480

Query  241   KQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKR  77
             KQ+AARG     V +LTC+G+QCYK+ F++LA V  FGALVSL L  RT  +YK DIYK+
Sbjct  481   KQLAARGLTRKDVKDLTCIGSQCYKLPFVILAAVTFFGALVSLGLAMRTREFYKGDIYKK  540

Query  76    FRDE  65
             FR+ 
Sbjct  541   FRES  544



>ref|XP_009103645.1| PREDICTED: uncharacterized membrane protein YMR155W [Brassica 
rapa]
Length=572

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/564 (65%), Positives = 437/564 (77%), Gaps = 18/564 (3%)
 Frame = -1

Query  1738  IHSKGQLN*LIN*EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATL  1559
             IHS G+              F+   F GRWFM+FASFLIMA AGATYLFG YSK+IK+TL
Sbjct  5     IHSSGE-----------TVRFLIHFFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTL  53

Query  1558  GYDQSTLNLLGSFKDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIA  1379
             GYDQ+TLNLLG FKD+GANVGV+SGLIAEVTPTWFVL++GSAMNF GYF+IWL+VT ++A
Sbjct  54    GYDQTTLNLLGFFKDLGANVGVMSGLIAEVTPTWFVLVIGSAMNFVGYFMIWLTVTGKVA  113

Query  1378  KPKVWQMCLYICVGANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYL  1199
             KP+VWQMCLYIC+GANSQNFANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+FTQLY 
Sbjct  114   KPRVWQMCLYICIGANSQNFANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIFTQLYF  173

Query  1198  AIYGNDSQNLILLIGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMG  1019
             AIYGNDS++LILLI WLPA++S+VF+ SIR  K+    NE  VF+ +L ISI LAL LM 
Sbjct  174   AIYGNDSKSLILLIAWLPAVVSLVFVYSIREKKVVRQRNEINVFYNFLYISIFLALFLMA  233

Query  1018  LTIAQKYVRFSHFAYIACATIVCALLFLPFLIAVMEELATRKEKK--KQLLSSENVEDpp  845
             + IA+K V F+  AYIA ATI C LLF+P  +AV +E+     KK  ++  S   +E P 
Sbjct  234   MNIAEKQVHFTRAAYIASATICCVLLFVPLTVAVKQEIEVWNMKKLAEEEPSEVKIEKPQ  293

Query  844   ppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLA  665
                 +  K + EK    SC   +   P RGEDY+ILQALLS+DM++LF+  FCG G SL 
Sbjct  294   KEDIDHLKEDGEKKEMKSCLLTVLDPPPRGEDYTILQALLSLDMIILFLATFCGLGSSLT  353

Query  664   AIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSL  485
             A+DNLGQIGESLGYP   + +FVSLVSIWNYFGRVFSGFVSE ++ + K+PR LMMT  L
Sbjct  354   ALDNLGQIGESLGYPNHAVSSFVSLVSIWNYFGRVFSGFVSEYLLAKHKLPRPLMMTLVL  413

Query  484   LLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLAS  305
             LL CAG LL+AFP PGSVY AS+++GFS+G QL LLF IISELFGLKY+STLFNCGQLAS
Sbjct  414   LLSCAGHLLIAFPVPGSVYIASILMGFSFGAQLPLLFAIISELFGLKYFSTLFNCGQLAS  473

Query  304   PLGSYILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGA  140
             PLGSYILNV++ G LYD EA+KQ+ ARG     V +LTCLG+QCYK+ F++LA V  FGA
Sbjct  474   PLGSYILNVRVTGMLYDREAMKQLTARGLTRKDVKDLTCLGSQCYKLPFVILAAVTFFGA  533

Query  139   LVSLVLVARTAAYYKTDIYKRFRD  68
             LVSL L  RT  +Y+ DIYK+FR+
Sbjct  534   LVSLGLAIRTRKFYRGDIYKKFRE  557



>ref|XP_002880951.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57210.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=573

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/549 (66%), Positives = 431/549 (79%), Gaps = 11/549 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+   F GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  8     RFLIHFFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  67

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEVTPTWFVL +GSAMNF GYF+IWL+VT ++AKPKVWQMCLYIC+GANSQN
Sbjct  68    VGVLSGLIAEVTPTWFVLTIGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQN  127

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLY AIYG+DS++LILLI WLPA
Sbjct  128   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAILTQLYFAIYGHDSKSLILLIAWLPA  187

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+  IR  K+    NE  VF+++L ISI LAL LM + IA+K V FS  AY A A
Sbjct  188   AVSLVFVYLIREKKVVRQRNELSVFYQFLYISIFLALFLMAMNIAEKQVHFSKAAYAASA  247

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLL--SSENVEDppppaeniekaeeekAGDY--  794
             TI C LLF+P  ++V +E+     KK  +   S   VE P    + ++    +  G+   
Sbjct  248   TICCVLLFVPLTVSVKQEIEVWNMKKLPIEEPSEVKVEKPKKELDLVQDKTAKVDGEEKE  307

Query  793   --SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF  +F  P RGEDY+ILQALLS DM++LF+  FCG G SL A+DNLGQIGESLGYP
Sbjct  308   TKSCFLTVFSPPPRGEDYTILQALLSTDMIILFVATFCGLGSSLTAVDNLGQIGESLGYP  367

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
               T+ +FVSLVSIWNYFGRVFSGFVSE ++ ++K+PR LMMT  LLL CAG LL+AFP P
Sbjct  368   NHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTLVLLLSCAGHLLIAFPVP  427

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+++GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV++ G L
Sbjct  428   GSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVTGML  487

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA+KQ+ ARG     V +LTCLG+QCYK+ F++LA V  FGALVSL L  RT  +YK
Sbjct  488   YDREALKQLTARGLTRKDVKDLTCLGSQCYKLPFVILAAVTFFGALVSLGLAIRTREFYK  547

Query  94    TDIYKRFRD  68
              DIYK+FR+
Sbjct  548   GDIYKKFRE  556



>ref|XP_002313536.1| nodulin family protein [Populus trichocarpa]
 gb|EEE87491.1| nodulin family protein [Populus trichocarpa]
Length=559

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/552 (65%), Positives = 435/552 (79%), Gaps = 11/552 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F      GRWF +FASFLIMAGAGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  6     KFALHAVDGRWFSVFASFLIMAGAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  65

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTPTWFVL+VGSAMNFAGYF+IW+SVT+RIAKP VWQMCLYIC+GANSQN
Sbjct  66    VGVLSGLLAEVTPTWFVLVVGSAMNFAGYFMIWMSVTQRIAKPAVWQMCLYICIGANSQN  125

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLG++KGFVGLSGA+FTQ YLAIYG DS++LILLIGWLPA
Sbjct  126   FANTGALVTCVKNFPESRGVMLGMLKGFVGLSGAIFTQFYLAIYGTDSKSLILLIGWLPA  185

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS++F  ++R  K    PNE KVF+++L +SI LAL LM + I +K V FS  AY   A
Sbjct  186   ALSVIFAYTVRERKPERQPNELKVFYQFLIVSIILALFLMAMNIVEKLVDFSKAAYAGSA  245

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLL------SSENVEDppppaeniekaeeekAG  800
             T+VC +LF+P +I++ E+      K ++ +      ++E   D  P  ++    E+E+  
Sbjct  246   TVVCVMLFIPLIISIKEDWIQWNLKHQEGMKPATEATAEKKLDITPEVKSEISKEQEEKV  305

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF  I  KP RGEDY+ILQALLS+DML+LF   FCG G SL A+DNLGQIGESLGYP
Sbjct  306   QKSCFLTICNKPPRGEDYTILQALLSIDMLILFAATFCGLGASLTAVDNLGQIGESLGYP  365

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
              +TI +FVSLVSIWN+FGRVF+GFVSE+++ ++K+PR LMMTF LLL C G LL+AFPF 
Sbjct  366   TKTIKSFVSLVSIWNFFGRVFAGFVSESLLVKYKMPRPLMMTFVLLLACVGYLLIAFPFS  425

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+I GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G L
Sbjct  426   GSVYVASVITGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGLL  485

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EAVK++A +G     V EL C+G QC+++ FIVL+ V   GAL+SL+LV RT  +Y 
Sbjct  486   YDREAVKELAKKGLDRSAVKELVCIGVQCFRLPFIVLSAVTFSGALISLILVMRTRKFYS  545

Query  94    TDIYKRFRDEMG  59
             +DIYK+FR+  G
Sbjct  546   SDIYKKFREIHG  557



>ref|XP_011089957.1| PREDICTED: uncharacterized protein LOC105170752 [Sesamum indicum]
Length=579

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/549 (66%), Positives = 440/549 (80%), Gaps = 11/549 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             NF   + RGRWF +F+SFLIMAGAGATYLFG+YSKEIKATLGYDQ+TLNLLG FKD+GAN
Sbjct  15    NFTVHVIRGRWFSLFSSFLIMAGAGATYLFGIYSKEIKATLGYDQTTLNLLGFFKDLGAN  74

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEVTPTWFVLL+GSAMNF GYF+IWL+VT +I++P VWQMC+YIC+GANSQN
Sbjct  75    VGVLSGLIAEVTPTWFVLLIGSAMNFTGYFMIWLAVTGQISRPAVWQMCIYICIGANSQN  134

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVT VKNFP SRG+MLGL+KGF GLSGA+ TQ+YLA+YGNDS+ LILLI WLPA
Sbjct  135   FANTGALVTSVKNFPESRGIMLGLLKGFTGLSGAILTQIYLAVYGNDSKALILLIAWLPA  194

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS+VF+ +IR MK+    NE K+F+E+L +SI LAL +M +TI QK V FS  AY   A
Sbjct  195   ALSVVFVYTIREMKVVRQSNELKIFYEFLYVSIVLALFIMVMTIVQKIVAFSQAAYAGSA  254

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV------EDppppaeniekaeeekAG  800
             T+VCALLF+P  IA+ E+     + K  +++   +      E  P   +   +  EE + 
Sbjct  255   TVVCALLFVPLFIAIREDFTLWGQNKHPVINPSQITIDKPAEIEPEDLKPEPEKPEEGSK  314

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SC  NIFKKP+RGEDY+ILQALLS DML+LF+  FCG G SL A+DNLGQIGESLGYP
Sbjct  315   TKSCLANIFKKPERGEDYTILQALLSTDMLILFLATFCGLGSSLTAVDNLGQIGESLGYP  374

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
              +TI +FVSL+SIWNYFGR+FSGFVSET++ ++K PR LMMT  LLL C G LL+AFPF 
Sbjct  375   TKTIKSFVSLLSIWNYFGRIFSGFVSETLLAKYKFPRPLMMTIVLLLSCIGLLLIAFPFQ  434

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+I+GFS+G QL L+F IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G L
Sbjct  435   GSVYVASVIIGFSFGAQLPLIFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGPL  494

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA++++A +G     V ELTC+GT+CY+++F++LA +  FGA+ S++LVART  +YK
Sbjct  495   YDREALRELAKKGMTRSSVKELTCIGTRCYRLAFVILASITFFGAVSSMILVARTREFYK  554

Query  94    TDIYKRFRD  68
              DIYK+FRD
Sbjct  555   GDIYKKFRD  563



>gb|EYU36146.1| hypothetical protein MIMGU_mgv1a018039mg [Erythranthe guttata]
Length=583

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/548 (65%), Positives = 432/548 (79%), Gaps = 10/548 (2%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F   + RGRWF +FASFL+MAGAGATYLFGVYSK+IK++LGYDQ+TLNLLG FKD+GANV
Sbjct  21    FAAHVLRGRWFSLFASFLVMAGAGATYLFGVYSKDIKSSLGYDQTTLNLLGFFKDLGANV  80

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGLIAEVTPTWFVLL+GSAMNFAGYF+IWLSVT +++KP+VWQMCLYIC+GANSQNF
Sbjct  81    GVLSGLIAEVTPTWFVLLIGSAMNFAGYFMIWLSVTGKVSKPRVWQMCLYICIGANSQNF  140

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVT V+NFP SRG+MLGL+KGF GLSGA+ TQ+YLA+YGNDS+ LILLI WLPA 
Sbjct  141   ANTGALVTSVRNFPESRGVMLGLLKGFTGLSGAILTQIYLAVYGNDSKALILLIAWLPAA  200

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             LS+VF+ +IR MK+    NE K+F+++L +SI LAL +M +T+ +K   FS  AY A AT
Sbjct  201   LSVVFVYTIRAMKVVRQGNELKIFYQFLYVSILLALFIMAMTVLEKVTAFSPAAYAASAT  260

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQLLSSEN---VEDppppaeniekaeeekAGDYSC  788
             +V ALLF P  IAV EE +    KK+QL +      ++D           E+ +    + 
Sbjct  261   VVSALLFFPLFIAVREESSIWSIKKQQLTNPPQIITIDDNNNNNNPAPMEEKSRTATTTT  320

Query  787   --FGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPR  614
               +  IF +P+RGEDY+ILQAL S DML+LF+  FCG G SL A+DNLGQIGESL YP R
Sbjct  321   RWYAKIFDRPERGEDYTILQALSSTDMLILFLATFCGLGSSLTAVDNLGQIGESLEYPVR  380

Query  613   TIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGS  434
             TI TFVSL+SIWNYFGR+FSGFVSE ++ ++K PR LMMT  L L C G LL+AFPF GS
Sbjct  381   TIKTFVSLLSIWNYFGRIFSGFVSEKLLSKYKFPRPLMMTIVLFLSCIGLLLIAFPFRGS  440

Query  433   VYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYD  254
             VY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNV++ G LYD
Sbjct  441   VYIASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVRVTGPLYD  500

Query  253   GEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
              EA+K +A +G     V ELTC+G QCY+++F++LA V  FGA+ SL+LVART  +Y+ D
Sbjct  501   REALKNLAKKGLTRDSVKELTCVGPQCYRLAFVILASVTFFGAVSSLILVARTREFYRGD  560

Query  88    IYKRFRDE  65
             IYK+FRDE
Sbjct  561   IYKKFRDE  568



>ref|XP_010267225.1| PREDICTED: uncharacterized protein LOC104604545 [Nelumbo nucifera]
Length=589

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/549 (68%), Positives = 438/549 (80%), Gaps = 12/549 (2%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F+  L RGRWFM+FASF IMAGAGATYLFG+YSK+IKA+LGYDQSTLNLLG  KD+GANV
Sbjct  16    FLLHLIRGRWFMVFASFWIMAGAGATYLFGIYSKDIKASLGYDQSTLNLLGFCKDLGANV  75

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGLIAEVTPTWFVLLVGSAMNFAGYF+IWL+VT RIAKP+VWQMCLYIC+GANSQNF
Sbjct  76    GVLSGLIAEVTPTWFVLLVGSAMNFAGYFMIWLAVTGRIAKPQVWQMCLYICIGANSQNF  135

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTG+LVTCVKNFP SRG+MLGLMKGFVGLSGAV TQLYLAIYGNDS++LILLIGWLPA+
Sbjct  136   ANTGSLVTCVKNFPESRGIMLGLMKGFVGLSGAVMTQLYLAIYGNDSKSLILLIGWLPAL  195

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S +F+ SIR +K+   PNE KVF+ +L +SI LAL LM +TI QK   FSH  Y   AT
Sbjct  196   ISFIFVYSIRVIKVVRQPNEVKVFYHFLYVSIALALFLMVMTILQKQFVFSHALYCVSAT  255

Query  958   IVCALLFLPFLIAVMEELATRKEKKK-----QLLSSENVEDppppaeniekaeeekAGDY  794
             IVC LLF+P  IA  EE A RK K +      +     VE+  P A     + + +    
Sbjct  256   IVCVLLFVPLAIAAREEFALRKLKNQPPTEVTVEKPPVVEESKPAALPSNSSTQLEEKPK  315

Query  793   SCF-GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPP  617
               F  +IFK+P+RGEDY+ILQALLS+DML+LF+   CG GCSL A+DNLGQIGESLGYP 
Sbjct  316   GSFLSSIFKRPERGEDYTILQALLSIDMLILFMATLCGLGCSLTAVDNLGQIGESLGYPT  375

Query  616   RTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPG  437
             R I +FVSLVSIWNY GRVF+GF+SE ++ R + PRTLM+T  LLL   G L++A PFPG
Sbjct  376   RVISSFVSLVSIWNYSGRVFAGFLSEYLI-RLRFPRTLMLTLVLLLSAVGYLIIALPFPG  434

Query  436   SVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLY  257
             SVY AS+I+GF +G QLTLLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LY
Sbjct  435   SVYIASVIIGFCFGAQLTLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVAGLLY  494

Query  256   DGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
             D EA+KQ+AA+G     V ELTC+G QCY+ +F+VL G +L GAL+S +LV RT  +YK 
Sbjct  495   DREALKQLAAKGLTRSSVKELTCIGNQCYRSTFLVLTGASLVGALISFILVLRTREFYKG  554

Query  91    DIYKRFRDE  65
             DIYK++R+E
Sbjct  555   DIYKKYREE  563



>ref|XP_010689140.1| PREDICTED: uncharacterized protein LOC104902902 [Beta vulgaris 
subsp. vulgaris]
Length=599

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/568 (64%), Positives = 442/568 (78%), Gaps = 26/568 (5%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             +F  Q+ +GRWF +FASFLIMAGAGATYLF +YSKEIK++LGY+QSTLNLLG FKD+GAN
Sbjct  11    DFAVQVIKGRWFTVFASFLIMAGAGATYLFAIYSKEIKSSLGYNQSTLNLLGFFKDLGAN  70

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV SGLIAEV PTW VLL+GSAMNFAGYF+IWL+VT +I++PKVW MCLYI +GANSQN
Sbjct  71    VGVFSGLIAEVIPTWAVLLIGSAMNFAGYFMIWLAVTYKISRPKVWHMCLYIMMGANSQN  130

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGAV TQ+YLAIYGNDS++LILLIGWLPA
Sbjct  131   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAVMTQIYLAIYGNDSKSLILLIGWLPA  190

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+ +IR +K+    NE KVF+ +L +SI LAL LM +TI ++ + FS  AY A A
Sbjct  191   AISVVFVYTIRTLKVCRQENEIKVFYHFLYVSIGLALFLMMMTILERTMVFSRGAYAASA  250

Query  961   TIVCALLFLPFLIAVMEELATR-KEKKKQLLSSENVED--------------------pp  845
             ++VCA+LFLP LIA+ EE     + +   + ++ +V+D                      
Sbjct  251   SVVCAMLFLPLLIAIKEEYYLLIRSRGAGIETAVDVDDDSPRPLPCPSSNGDKFVDSEKE  310

Query  844   ppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLA  665
                     + E+K  D SCF  I  KP+RG+DY+ILQA+ S+DM +LF+   CG G SL 
Sbjct  311   LLDFIDGGSNEKKKKDKSCFLTICNKPERGDDYTILQAIFSIDMGILFLATLCGLGASLT  370

Query  664   AIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSL  485
             A+DNLGQIGESLGYP +TI +FVSLVSIWNYFGRVF+GFVSET++ +WK PR LMMT  L
Sbjct  371   AVDNLGQIGESLGYPTKTISSFVSLVSIWNYFGRVFAGFVSETLLAKWKFPRPLMMTLIL  430

Query  484   LLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLAS  305
             LL C G LL+AFP PGSVY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLAS
Sbjct  431   LLACVGHLLIAFPIPGSVYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLAS  490

Query  304   PLGSYILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGA  140
             PLGSYILNVK+ G LYD EA+K++A RG     V ELTCLGT+CY++SFI+LAGV +FGA
Sbjct  491   PLGSYILNVKVTGMLYDKEALKELAKRGLKRSDVKELTCLGTRCYRLSFIILAGVTIFGA  550

Query  139   LVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             L+S +LV RT  +YK DIYK+FR++  A
Sbjct  551   LISFILVIRTREFYKGDIYKKFREQAEA  578



>ref|XP_002523712.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38652.1| conserved hypothetical protein [Ricinus communis]
Length=558

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/561 (65%), Positives = 427/561 (76%), Gaps = 31/561 (6%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   +  GRWF +FASFLIMAGAGATYLFG YSK+IKATLGYDQ TLNLLG FKD+GAN
Sbjct  6     RFAVHVINGRWFSVFASFLIMAGAGATYLFGTYSKDIKATLGYDQQTLNLLGFFKDLGAN  65

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEVTPTWFVLL+GSAMNF GYF+IWL+VT RIAKP VWQMCLYIC+GANSQN
Sbjct  66    VGVLSGLIAEVTPTWFVLLMGSAMNFTGYFMIWLTVTGRIAKPAVWQMCLYICIGANSQN  125

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCV NFP SRG+MLGL+KGFVGLSGA+FTQLYLAIYG DS++LILLI WLPA
Sbjct  126   FANTGALVTCVINFPESRGVMLGLLKGFVGLSGAIFTQLYLAIYGTDSKSLILLIAWLPA  185

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS+VF+ +IR MK    PNE KVF+ +L +SI LAL L+ ++I +K + FS  AY A A
Sbjct  186   ALSVVFVYTIRVMKPERQPNELKVFYNFLYVSIVLALFLLLISILEKQINFSREAYAASA  245

Query  961   TIVCALLFLPFLIAVME-----------------ELATRKEKKKQLLSSENVEDppppae  833
             T+ C  LF+P LIAV E                 ELA +K K+   L  + V        
Sbjct  246   TVACLFLFVPLLIAVKEEWIQWNLKKEEAMKPPTELAIQKPKEVTALEQDEV--------  297

Query  832   niekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
              ++    ++  + SCF  IF KP+RGEDY+ILQALLS+DML+LF    CG G SL A+DN
Sbjct  298   -VKPEVSKEKAERSCFLTIFDKPERGEDYTILQALLSIDMLILFAATLCGLGASLTAVDN  356

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIGESLGYP +TI TFVSLVSIWNYFGRVF+GFVSE ++ ++K PR LMMTF LLL C
Sbjct  357   LGQIGESLGYPTKTINTFVSLVSIWNYFGRVFAGFVSEGLLVKYKTPRPLMMTFVLLLAC  416

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              G L++AFPF  SVY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASP+GS
Sbjct  417   IGHLIIAFPFTNSVYLASVIMGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPIGS  476

Query  292   YILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             YILNVK+ G LYD EA+K++  +G     V EL CLG +CY+  FI+L+    FGA+VSL
Sbjct  477   YILNVKVTGLLYDNEALKELHKKGLNRSSVKELVCLGVECYRKPFIILSCATFFGAIVSL  536

Query  127   VLVARTAAYYKTDIYKRFRDE  65
             +LV RT  +Y  DIYK+FR+ 
Sbjct  537   ILVIRTRKFYSGDIYKKFRER  557



>ref|XP_009627404.1| PREDICTED: uncharacterized protein LOC104117959 [Nicotiana tomentosiformis]
 ref|XP_009627405.1| PREDICTED: uncharacterized protein LOC104117959 [Nicotiana tomentosiformis]
 ref|XP_009627406.1| PREDICTED: uncharacterized protein LOC104117959 [Nicotiana tomentosiformis]
Length=594

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/564 (64%), Positives = 435/564 (77%), Gaps = 17/564 (3%)
 Frame = -1

Query  1696  EQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFK  1517
                +  F   + RGRWF +FASFLIMAGAGATYLFG YSKEIK +LGYDQ+TLNLLG FK
Sbjct  17    RHEVLQFALHVVRGRWFSLFASFLIMAGAGATYLFGTYSKEIKGSLGYDQTTLNLLGFFK  76

Query  1516  DVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVG  1337
             D+GANVGVLSGLIAEVTPTWFVLLVG+AMNF GY +IWL+V  +I+KPKVW+MC+YIC+G
Sbjct  77    DLGANVGVLSGLIAEVTPTWFVLLVGAAMNFTGYLMIWLAVVGKISKPKVWKMCIYICLG  136

Query  1336  ANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLI  1157
             ANSQNFANTGALVT ++NFP SRG M+GL+KGF GLSGA+ TQLYLA+YGNDSQ+LILLI
Sbjct  137   ANSQNFANTGALVTSIRNFPESRGNMIGLLKGFTGLSGAIMTQLYLAVYGNDSQSLILLI  196

Query  1156  GWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFA  977
              WLPA LS+VF+ +IR MK+   PN+  VFF  L ISI LA+ LM +T+ +K + FSH A
Sbjct  197   AWLPAALSVVFVYTIREMKVVRQPNQQTVFFYCLIISIVLAVFLMVMTLVEKAIAFSHAA  256

Query  976   YIACATIVCALLFLPFLIAVMEELATRKEKKKQL----LSSEN----VEDppppaeniek  821
             Y+  AT+ CALLFLP L+ + EEL   ++KK  L    + +EN    VE        + +
Sbjct  257   YVGTATVACALLFLPLLVFIREELILWRQKKLLLGPPKMVAENPPASVESELKAIPELPQ  316

Query  820   aeeekA---GDYSCFGNIF-KKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
               E K       S   +IF  KP RGEDY+ILQALLS DML+LF+  FCG G SL A+DN
Sbjct  317   ISETKKEFNSKSSWLTDIFLNKPARGEDYTILQALLSTDMLILFLATFCGLGSSLTAVDN  376

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIGESLGYP  TI +FVSL+SIWN+FGR+F+GFVSE+++ R+K PR LMMT  LLL C
Sbjct  377   LGQIGESLGYPTTTIKSFVSLLSIWNFFGRIFAGFVSESLLVRFKFPRPLMMTLVLLLSC  436

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              G L +AFPFPGSVY ASLI+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGS
Sbjct  437   IGLLFIAFPFPGSVYVASLIIGFSFGAQLPLLFTIISELFGLKYYSTLFNCGQLASPLGS  496

Query  292   YILNVKIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             YILNV++ G LYD EA++ +  +G     V ELTC+G QCY+++FI+LAGV  FGAL SL
Sbjct  497   YILNVRVTGPLYDREALRDLEKKGLTRASVKELTCMGNQCYRLAFIILAGVTFFGALASL  556

Query  127   VLVARTAAYYKTDIYKRFRDEMGA  56
             +LVART  +YK DIYK+FR++  A
Sbjct  557   ILVARTRQFYKGDIYKKFREQAEA  580



>ref|XP_010321905.1| PREDICTED: uncharacterized protein LOC101251293 [Solanum lycopersicum]
Length=583

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/552 (64%), Positives = 428/552 (78%), Gaps = 13/552 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              FV  + RGRWF +FASFLIM+GAGATYLFG+YS+EIK TLGYDQ+TL LLG FKD+GAN
Sbjct  14    QFVLHVLRGRWFSLFASFLIMSGAGATYLFGIYSQEIKNTLGYDQTTLVLLGFFKDLGAN  73

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEV+PTWFVLLVG+AMNF GYF+IWLSV  +I+KPKVWQMC+YIC+GANSQN
Sbjct  74    VGVLSGLLAEVSPTWFVLLVGAAMNFTGYFMIWLSVIGKISKPKVWQMCIYICLGANSQN  133

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVT V+NFP SRG M+GL+KGF GLSGA+ TQLYLA+YGND+Q+LILLI W+PA
Sbjct  134   FANTGALVTSVRNFPESRGNMIGLLKGFTGLSGAILTQLYLAVYGNDAQSLILLIAWMPA  193

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS+VF+ +IR MK+   PN+  VFF  L ISI LAL LM +T+ +K + FSH AY+  A
Sbjct  194   ALSVVFVYTIREMKVVRQPNQQTVFFHCLLISIVLALFLMVMTLLEKAIAFSHAAYVVAA  253

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSEN-------VEDppppaeniekaeeekA  803
             T+ CALLF P L+ + EELA  ++ K+    + N       VE          +    K 
Sbjct  254   TVSCALLFSPLLVFIREELAIWRQMKQTSSLNHNGGVANTIVEPTEIQQPQKNQVNNSKI  313

Query  802   GDYSCFGNI-FKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
                S F  I F+KP RGEDYSILQALLS DML+LF+   CG G SL A+DN+GQIG SLG
Sbjct  314   STSSWFSKIFFEKPARGEDYSILQALLSTDMLILFVATLCGLGSSLTAVDNMGQIGGSLG  373

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP  T+ +F+SL+SIWN+FGR+FSGFVSE+++ R+K PRTLMMT  L L C G LL+AFP
Sbjct  374   YPKTTVKSFLSLLSIWNFFGRIFSGFVSESLLVRYKFPRTLMMTLVLFLSCIGLLLIAFP  433

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
             FPGS+Y AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G
Sbjct  434   FPGSLYVASIIIGFSFGAQLPLLFTIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTG  493

Query  265   RLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              LYD EA+K +  RG     V ELTC+G QCY++ FI+LA V  FGA+ SL+LVART  +
Sbjct  494   PLYDREALKDLEKRGLTRASVKELTCIGNQCYQLPFIILACVTFFGAMASLILVARTRQF  553

Query  100   YKTDIYKRFRDE  65
             YK DIYK+F+++
Sbjct  554   YKGDIYKKFKEQ  565



>ref|XP_010045310.1| PREDICTED: uncharacterized protein LOC104434056 [Eucalyptus grandis]
 gb|KCW87472.1| hypothetical protein EUGRSUZ_B03936 [Eucalyptus grandis]
Length=599

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/548 (66%), Positives = 430/548 (78%), Gaps = 10/548 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              FV  L +GRWF +FASFL+M GAGATYLFG+YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  14    RFVAHLLQGRWFTVFASFLVMFGAGATYLFGIYSKQIKSTLGYDQTTLNLLGFFKDLGAN  73

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEVTPTWFVLL GSAMNFAGYFLIWL VT +IA+P VWQMC+YIC+GANSQN
Sbjct  74    VGVLSGLIAEVTPTWFVLLTGSAMNFAGYFLIWLVVTGKIARPAVWQMCIYICIGANSQN  133

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP  RG+MLGL+KGFVGLSGAV TQ+YLAIYGNDS++LILLI WLPA
Sbjct  134   FANTGALVTCVKNFPEGRGVMLGLLKGFVGLSGAVMTQMYLAIYGNDSKSLILLIAWLPA  193

Query  1141  ILSIVFIPSIRPMK-ISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
              +S++F+ +IR M+ +    +E +VF+++L +SI LAL LM +TI QK   F   AY A 
Sbjct  194   AISVLFVYTIRTMEGVPRQRDEQRVFYKFLYLSIALALFLMVMTILQKQFAFPKAAYAAS  253

Query  964   ATIVCALLFLPFLIAVMEELATRKEKKKQLLSSEN----VEDppppaeniekaeeekAGD  797
             AT+VCALLF+P LI + EELA  +++  +  S  N    V+     A   +  E      
Sbjct  254   ATVVCALLFVPLLIIIGEELALWRKQNLKNGSPPNPGLAVKIQSLEASESKSIELVAPAH  313

Query  796   YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPP  617
                  +IFK P RGEDY+ILQALLSVDML+LF+   CG G SL A+DNLGQIGESLGY  
Sbjct  314   VPWHSSIFKPPARGEDYTILQALLSVDMLILFLATLCGLGSSLTAVDNLGQIGESLGYEA  373

Query  616   RTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPG  437
             R   TFVSLVSIWNYFGRVFSGFVSE+++ R+K PR LMMT  LLL C G LL+AFP  G
Sbjct  374   RITSTFVSLVSIWNYFGRVFSGFVSESLLVRYKFPRPLMMTLVLLLSCVGHLLIAFPSSG  433

Query  436   SVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLY  257
             S+Y AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LY
Sbjct  434   SLYVASVIIGFSFGAQLPLLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGMLY  493

Query  256   DGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
             D EA+K++A +G     V ELTC+G  CY++SFI+LA V LFGALVSL+LV RT  +Y+ 
Sbjct  494   DREALKELARKGLSRDSVKELTCIGRHCYRLSFIILALVTLFGALVSLILVVRTREFYRG  553

Query  91    DIYKRFRD  68
             DIY++FRD
Sbjct  554   DIYEKFRD  561



>ref|XP_007206680.1| hypothetical protein PRUPE_ppa022835mg [Prunus persica]
 gb|EMJ07879.1| hypothetical protein PRUPE_ppa022835mg [Prunus persica]
Length=554

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/541 (65%), Positives = 425/541 (79%), Gaps = 9/541 (2%)
 Frame = -1

Query  1666  LFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLS  1487
             +  GRWF +FASFLIMAGAGATYL+G YSKEIK+TLGYDQ+ +N+LG  KD GANVGVLS
Sbjct  13    MLTGRWFSVFASFLIMAGAGATYLYGTYSKEIKSTLGYDQTEINMLGFSKDFGANVGVLS  72

Query  1486  GLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTG  1307
             GLI EVTP WFVL++G+ MNF GYF+IWL+VT RI KPKVWQMC+YIC+GANSQNFANTG
Sbjct  73    GLIGEVTPVWFVLIIGAVMNFVGYFMIWLAVTGRIPKPKVWQMCVYICIGANSQNFANTG  132

Query  1306  ALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIV  1127
             ALVTCVKNFP SRG+MLGL+KGF GLSGA+ TQ+YLA+YGNDS++LILLIGWLPA +SIV
Sbjct  133   ALVTCVKNFPESRGVMLGLLKGFTGLSGAILTQIYLAVYGNDSKSLILLIGWLPAAVSIV  192

Query  1126  FIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCA  947
             F+ +IRPMK+   PNE KVF+ +L ISI LA+ LM + + QKY+ FSH AY   AT+   
Sbjct  193   FVYTIRPMKVIRQPNELKVFYHFLYISIILAVFLMVMNLLQKYINFSHAAYAGSATVAVL  252

Query  946   LLFLPFLIAVMEELATRKEKKKQLLSSENVE----DppppaeniekaeeekAGDYSCFGN  779
             LLFLP  I++ EEL     +K+ +     V+          +N  K +E +  +  CF +
Sbjct  253   LLFLPLGISIREELVLWNLQKQPVDPPTEVKVEKPQEIEEKKNEPKEKELETPEPGCFSD  312

Query  778   IFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTF  599
             I+ KP RGEDY+ILQALLS DML+LFI   CG G SL A+DNLGQIGESLGYP +TI TF
Sbjct  313   IWNKPTRGEDYTILQALLSTDMLILFISTLCGLGSSLTAVDNLGQIGESLGYPTKTIKTF  372

Query  598   VSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGAS  419
             VSL SIWNYFGRVFSGF+SE+++ RWKIPR L+MTF+L+L C G LL+AFP PGSVY AS
Sbjct  373   VSLTSIWNYFGRVFSGFISESLLIRWKIPRPLVMTFALVLSCVGLLLIAFPVPGSVYVAS  432

Query  418   LILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVK  239
             +I+GFS+G QL LLF IISELFGLK+++TLFNCGQ+ASPLGSY+ NVK+ G LYD EA+K
Sbjct  433   VIIGFSFGAQLPLLFAIISELFGLKHFATLFNCGQIASPLGSYLFNVKLTGALYDKEAMK  492

Query  238   QVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRF  74
             ++  RG     V +LTCLG  CY++SF +LA    FGALVSL+LV RT  +YK DIYK++
Sbjct  493   ELTKRGLTRSQVKDLTCLGNHCYRLSFTILAAATFFGALVSLILVFRTRKFYKGDIYKKY  552

Query  73    R  71
             R
Sbjct  553   R  553



>ref|XP_004147280.1| PREDICTED: uncharacterized protein LOC101217765 [Cucumis sativus]
 gb|KGN64786.1| hypothetical protein Csa_1G097655 [Cucumis sativus]
Length=594

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/553 (62%), Positives = 425/553 (77%), Gaps = 16/553 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F  Q+  GRWF +FA+FLIMAGAGATYLFGVYSK+IK+ LGYDQ+TLNL+G FKD+GAN
Sbjct  19    QFPLQVITGRWFTVFATFLIMAGAGATYLFGVYSKQIKSALGYDQTTLNLMGFFKDLGAN  78

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTPTWFVLL+GSA+NF GYF+IWL+V+ RIAKPKVWQMCLYICVGANSQN
Sbjct  79    VGVLSGLVAEVTPTWFVLLLGSALNFTGYFMIWLAVSGRIAKPKVWQMCLYICVGANSQN  138

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTC++NFP SRG M+GL+KGF GLSGA+ T++Y A+Y +D+  LILLIGWLPA
Sbjct  139   FANTGALVTCIQNFPESRGAMMGLLKGFTGLSGAILTEIYRAVYADDATALILLIGWLPA  198

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+ +IR ++    PNE +VF+ +L ISI LA+ +M + I QK V+F+H AY + A
Sbjct  199   AISVVFVFTIRRLRSERQPNEKRVFYHFLYISIGLAVFIMIMNIVQKKVQFNHTAYASSA  258

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSEN-----------VEDppppaeniekae  815
             T++C  LFLP L+ + EEL     KK   +  E+           + +       I+K  
Sbjct  259   TVICVFLFLPLLVVIREELRIWNTKKSTSVPIESPQPKPIDEPKIITEESKQITEIQKQN  318

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
                    SCF NI +KP RG+DY+ILQALLS+DM +LF+  FCG G SL A+DNLGQIGE
Sbjct  319   LATPPPESCFSNICQKPPRGDDYTILQALLSIDMFVLFVATFCGLGTSLTAVDNLGQIGE  378

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             SLGYP +T+ +FVSLVSIWNYFGR+F+GFVSE+++ R+K PR LMMT  LLL C G LL+
Sbjct  379   SLGYPLKTVSSFVSLVSIWNYFGRIFAGFVSESLLARFKFPRPLMMTLVLLLSCVGQLLI  438

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AFP PGSVY AS+I+GFS+G QL LLF IISELFGLKY+STLFNCGQ+ASPLGSYILNVK
Sbjct  439   AFPVPGSVYIASVIIGFSFGAQLPLLFAIISELFGLKYFSTLFNCGQIASPLGSYILNVK  498

Query  274   IVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             + G LYD EA+KQ+  +G     V EL C+G QCY+ SF + A V   GA+VSLVLV RT
Sbjct  499   VAGMLYDMEALKQLKEKGLDRSAVKELICMGKQCYRKSFSITAIVTFVGAMVSLVLVMRT  558

Query  109   AAYYKTDIYKRFR  71
               +YK DIYK+FR
Sbjct  559   REFYKGDIYKKFR  571



>ref|XP_008226513.1| PREDICTED: uncharacterized protein LOC103326077 [Prunus mume]
Length=554

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/546 (63%), Positives = 423/546 (77%), Gaps = 9/546 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F + +  GRWF +FASFLIMAGAGATYL+G YSKEIK+TLGYDQ+ +N+LG  KD GAN
Sbjct  8     RFSWHMLTGRWFSVFASFLIMAGAGATYLYGTYSKEIKSTLGYDQTEINMLGFSKDFGAN  67

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTP WFVL++G+ MNF GYF+IWL+VT RI KPKVWQMC+YIC+GANSQN
Sbjct  68    VGVLSGLIGEVTPVWFVLIIGAVMNFVGYFMIWLAVTGRIPKPKVWQMCIYICIGANSQN  127

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KGF GLSGA+ TQ+YLA+YGNDS++LILLI WLPA
Sbjct  128   FANTGALVTCVKNFPESRGVMLGLLKGFTGLSGAILTQIYLAVYGNDSKSLILLIAWLPA  187

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +SI F+ +IRPMK+   PNE KVF+ +L ISI LA+ LM + + QKY+ FSH AY   A
Sbjct  188   AVSIFFVYTIRPMKVIRQPNELKVFYHFLYISIILAVFLMVMNLLQKYINFSHAAYAGSA  247

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE----DppppaeniekaeeekAGDY  794
             T    LLFLP  I++ EEL     +K+ +     V+          +   K +E +  + 
Sbjct  248   TGAVLLLFLPLGISIREELVLWNLQKQPVDPPTEVKVEKPQEIEEKKAEPKEKELETPEP  307

Query  793   SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPR  614
              CF +I+ KP RGEDY+ILQALLS DML+LFI   CG G SL A+DNLGQIGESLGYP +
Sbjct  308   GCFSDIWNKPPRGEDYTILQALLSTDMLILFISTLCGLGSSLTAVDNLGQIGESLGYPTK  367

Query  613   TIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGS  434
             TI TFVSL SIWNYFGRVFSGF+SE+++ RWKIPR L+MTF+L+L C G LL+AFP PGS
Sbjct  368   TIKTFVSLTSIWNYFGRVFSGFISESLLIRWKIPRPLVMTFALVLSCVGLLLIAFPVPGS  427

Query  433   VYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYD  254
             VY AS+I+GFS+G QL LLF IISELFGLK+++TLFNCGQ+ASP+GSY+ NVK+ G LYD
Sbjct  428   VYVASVIIGFSFGAQLPLLFAIISELFGLKHFATLFNCGQIASPIGSYLFNVKLTGALYD  487

Query  253   GEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
              EA+K++  RG     V +LTCLG  CY++SF +LA    FGALVSL+LV RT  +YK D
Sbjct  488   KEAMKELTKRGLTRSQVKDLTCLGNHCYRLSFTILAAATFFGALVSLILVFRTRKFYKGD  547

Query  88    IYKRFR  71
             IYK++R
Sbjct  548   IYKKYR  553



>gb|KDP43975.1| hypothetical protein JCGZ_05442 [Jatropha curcas]
Length=536

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/532 (66%), Positives = 416/532 (78%), Gaps = 12/532 (2%)
 Frame = -1

Query  1621  MAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLIAEVTPTWFVLLV  1442
             MAGAGATYLFG YSK+IK TLGYDQSTLNL+G FKD+GAN+GVLSGLIAEVTPTWFVLL+
Sbjct  1     MAGAGATYLFGTYSKDIKETLGYDQSTLNLIGFFKDLGANIGVLSGLIAEVTPTWFVLLI  60

Query  1441  GSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALVTCVKNFPASRGM  1262
             GSAMNF GYF+IWL VT++IAKP++WQMCLYIC+GANSQNFANTGALVTCV NFP SRG+
Sbjct  61    GSAMNFIGYFMIWLVVTRKIAKPEIWQMCLYICIGANSQNFANTGALVTCVLNFPESRGV  120

Query  1261  MLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIPSIRPMKISSHPN  1082
             MLGL+KGFVGLSGA+ TQLYLAIYGNDS++LILLI WLPA LS++F+ +IR MK    PN
Sbjct  121   MLGLLKGFVGLSGAIMTQLYLAIYGNDSKSLILLIAWLPAALSVIFVFTIRKMKAERQPN  180

Query  1081  ETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLFLPFLIAVMEELA  902
             E KVF+ +L +SI LAL LM + I +K V FS  AY   AT+VC LLF+P LIA+ EE  
Sbjct  181   ELKVFYHFLYVSIVLALFLMVMNILEKQVNFSKGAYATIATLVCLLLFVPLLIAIREEWG  240

Query  901   TRKEKKKQLLS-------SENVEDppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYS  743
                 KK++ +        ++  E+     E     EE+     SCF  +F KP+RGEDY+
Sbjct  241   QWNIKKQEAMKPSCEVTINKPSEEKDESVETKISKEEKNQISRSCFLTVFDKPERGEDYT  300

Query  742   ILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGR  563
             ILQALLS+DML+LF   FCG G SL A+DNLGQIGESLGYP +TI +FVSLVSIWNYFGR
Sbjct  301   ILQALLSIDMLILFAATFCGLGSSLTAVDNLGQIGESLGYPTKTIKSFVSLVSIWNYFGR  360

Query  562   VFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLT  383
             VF+GFVSET++ ++K PR LMMT  LLL   G L++AFPFP SVY AS+I+GFS+G QL 
Sbjct  361   VFAGFVSETLIVKYKTPRPLMMTGVLLLSSIGFLIIAFPFPNSVYIASVIIGFSFGAQLP  420

Query  382   LLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARG-----V  218
             LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LYD EA++Q+  +G     V
Sbjct  421   LLFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGTLYDNEALRQLKKKGLERSAV  480

Query  217   GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDEM  62
              EL C+G +CY+  FIVL    LFGAL+SL+LV RT  +Y  DIYK+FRD +
Sbjct  481   KELICIGVECYRKPFIVLCSAALFGALISLILVVRTRKFYSGDIYKKFRDRV  532



>ref|XP_004171581.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101217765 
[Cucumis sativus]
Length=594

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/553 (62%), Positives = 424/553 (77%), Gaps = 16/553 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F  Q+  GRWF +FA+FLIMAGAGATYLFGVYSK+IK+ LGYDQ+TLNL+G FKD+GAN
Sbjct  19    QFPLQVITGRWFTVFATFLIMAGAGATYLFGVYSKQIKSALGYDQTTLNLMGFFKDLGAN  78

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTPTWFVLL+GSA+NF GYF+IWL+V+ RIAKPKVWQMCLYICVGANSQN
Sbjct  79    VGVLSGLVAEVTPTWFVLLLGSALNFTGYFMIWLAVSGRIAKPKVWQMCLYICVGANSQN  138

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTC++NFP SRG M+GL+KGF GLSGA+ T+++ A+Y +D+  LILLIGWLPA
Sbjct  139   FANTGALVTCIQNFPESRGAMMGLLKGFTGLSGAILTEIFRAVYADDATALILLIGWLPA  198

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+ +IR ++    PNE + F+ +L ISI LA+ +M + I QK V+F+H AY + A
Sbjct  199   AISVVFVFTIRRLRSERQPNEXEGFYHFLYISIGLAVFIMIMNIVQKKVQFNHTAYASSA  258

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSEN-----------VEDppppaeniekae  815
             T++C  LFLP L+ + EEL     KK   +  E+           + +       I+K  
Sbjct  259   TVICVFLFLPLLVVIREELRIWNTKKSTSVPIESPQPKPIDEPKIITEESKQITEIQKQN  318

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
                    SCF NI +KP RG+DY+ILQALLS+DM +LF+  FCG G SL A+DNLGQIGE
Sbjct  319   LATPPPESCFSNICQKPPRGDDYTILQALLSIDMFVLFVATFCGLGTSLTAVDNLGQIGE  378

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             SLGYP +T+ +FVSLVSIWNYFGR+F+GFVSE+++ R+K PR LMMT  LLL C G LL+
Sbjct  379   SLGYPLKTVSSFVSLVSIWNYFGRIFAGFVSESLLARFKFPRPLMMTLVLLLSCVGQLLI  438

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AFP PGSVY AS+I+GFS+G QL LLF IISELFGLKY+STLFNCGQ+ASPLGSYILNVK
Sbjct  439   AFPVPGSVYIASVIIGFSFGAQLPLLFAIISELFGLKYFSTLFNCGQIASPLGSYILNVK  498

Query  274   IVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             + G LYD EA+KQ+  +G     V EL C+G QCY+ SF + A V   GA+VSLVLV RT
Sbjct  499   VAGMLYDMEALKQLKEKGLDRSAVKELICMGKQCYRKSFSITAIVTFVGAMVSLVLVMRT  558

Query  109   AAYYKTDIYKRFR  71
               +YK DIYK+FR
Sbjct  559   REFYKGDIYKKFR  571



>ref|XP_008465591.1| PREDICTED: uncharacterized protein LOC103503227 [Cucumis melo]
Length=592

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/550 (62%), Positives = 419/550 (76%), Gaps = 17/550 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F  Q+  GRWF +FA+FLIMAGAGATYLFGVYSK+IK+ LGYDQ+TLNL+G FKD+GAN
Sbjct  19    QFPLQVITGRWFTVFATFLIMAGAGATYLFGVYSKQIKSALGYDQTTLNLMGFFKDLGAN  78

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGL+AEVTPTWFVLL+GSA+NF GYF+IWL+VT RIAKPKVWQMCLYICVGANSQN
Sbjct  79    VGVLSGLVAEVTPTWFVLLLGSALNFTGYFMIWLAVTGRIAKPKVWQMCLYICVGANSQN  138

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTC++NFP SRG M+GL+KGF GLSGA+ T++Y A+Y +D+  LILLIGWLPA
Sbjct  139   FANTGALVTCIQNFPESRGAMMGLLKGFTGLSGAILTEIYRAVYADDATALILLIGWLPA  198

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+ +IR +K    PNE +VF+ +L ISI LA+ +M + I QK V F+H AY   A
Sbjct  199   AISVVFVFTIRRLKAERQPNEKRVFYHFLYISIGLAVFIMIMNIVQKKVEFNHTAYTLSA  258

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSEN------------VEDppppaenieka  818
             T++C  LFLP LI + EEL      K   +  EN             E+     +   ++
Sbjct  259   TVICIFLFLPLLIVIREELRLWNANKSPPIPIENPQPKPIDEPKIITEESNQITKIQNQS  318

Query  817   eeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIG  638
                   + +CF NI +KP RG+DY+ILQALLS+DM +LFI  FCG G SL A+DNLGQIG
Sbjct  319   PPAPPPEVACFSNICRKPPRGDDYTILQALLSIDMFVLFIATFCGLGTSLTAVDNLGQIG  378

Query  637   ESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLL  458
             ESLGYP +T+ +FVSLVSIWNYFGR+F+GFVSE+++ R+K PR LMMT  LLL C G LL
Sbjct  379   ESLGYPLKTVSSFVSLVSIWNYFGRIFAGFVSESLLARYKFPRPLMMTLVLLLSCIGQLL  438

Query  457   VAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNV  278
             +AFP PGSVY AS+I+GFS+G QL LLF IISELFGLKY+STLFNCGQ+ASPLGSYILNV
Sbjct  439   IAFPVPGSVYIASVIIGFSFGAQLPLLFAIISELFGLKYFSTLFNCGQIASPLGSYILNV  498

Query  277   KIVGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVAR  113
             K+ G LYD EA+KQ+  +G     V ELTC+G +CY+ SF +   V   GA+VSL+LV R
Sbjct  499   KVAGMLYDIEALKQLKEKGLDRSAVKELTCIGKECYRKSFTITTIVTFAGAMVSLILVMR  558

Query  112   TAAYYKTDIY  83
             T  +YK DIY
Sbjct  559   TREFYKGDIY  568



>ref|XP_008385510.1| PREDICTED: uncharacterized protein LOC103448053 [Malus domestica]
Length=560

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/546 (64%), Positives = 431/546 (79%), Gaps = 9/546 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F + +  GRWF +FASFLIMAGAGATYL+G YSKEIKATLGYDQ+ +N+LG  KD+GAN
Sbjct  14    QFSWHMLNGRWFSVFASFLIMAGAGATYLYGTYSKEIKATLGYDQTEINMLGFSKDLGAN  73

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTP WFVL+VG+ MNFAGYF+IWL+VT+RI KPKVWQMC+YIC+GANSQN
Sbjct  74    VGVLSGLIGEVTPVWFVLIVGAVMNFAGYFMIWLAVTQRIPKPKVWQMCVYICIGANSQN  133

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KGF GLSGA+ TQ+YLA+YGNDS++LILLIGWLPA
Sbjct  134   FANTGALVTCVKNFPESRGVMLGLLKGFTGLSGAILTQIYLAVYGNDSKSLILLIGWLPA  193

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +SI+F+ SIRPMK+   PNE +VF+ +L IS+ LAL LM +++ QK + FSH AY A A
Sbjct  194   AVSIIFVYSIRPMKVVRQPNELQVFYHFLYISVVLALFLMVMSLLQKTINFSHAAYAATA  253

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE----DppppaeniekaeeekAGDY  794
             T    LLFLP  IA+ EEL    + K+ +     V+          ++  K +E +  + 
Sbjct  254   TGAILLLFLPLGIAIREELVIWNQLKQPVDPPTEVKVEKPGETEFKKDESKDKELERPEP  313

Query  793   SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPR  614
              CF +I  KP RGEDY+ILQALLSVDML+LFI   CG G SL A+DNLGQIGESLGYP +
Sbjct  314   GCFSDICNKPPRGEDYTILQALLSVDMLILFIATLCGLGSSLTAVDNLGQIGESLGYPTK  373

Query  613   TIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGS  434
             T+  FVSL SIWNYFGRVFSGF+SE+++ R++IPR L+MT +L+L C G LL+AFP PGS
Sbjct  374   TVRAFVSLTSIWNYFGRVFSGFISESLLIRYRIPRPLVMTGALVLSCVGLLLIAFPGPGS  433

Query  433   VYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYD  254
             VY AS+I+GF++G QL LLF IISELFGLK+++TLFNCGQ+ASPLGSY+LNVK+ G LYD
Sbjct  434   VYVASVIIGFAFGAQLPLLFAIISELFGLKHFATLFNCGQIASPLGSYLLNVKLTGALYD  493

Query  253   GEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
              EA K++A RG     V +LTC+G  CY++SF +LA V  FGALVSL+LV RT A+YK D
Sbjct  494   KEARKELAKRGLTRSQVKDLTCIGNHCYQLSFTILAAVTFFGALVSLILVYRTRAFYKGD  553

Query  88    IYKRFR  71
             IYK++R
Sbjct  554   IYKKYR  559



>ref|XP_010651774.1| PREDICTED: uncharacterized protein LOC100244770 [Vitis vinifera]
Length=670

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/553 (64%), Positives = 431/553 (78%), Gaps = 14/553 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + RGRWF ++ASFLIM GAGATYLFG+YSKEIK+++GYDQSTLNL+G FKD+GAN
Sbjct  101   RFAVHVIRGRWFSVYASFLIMVGAGATYLFGIYSKEIKSSMGYDQSTLNLIGFFKDLGAN  160

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV +GLIAEVTPTWFVLLVGSA+NF+G+F+IWL+VT +IAKPKVWQ+C YICVGANSQN
Sbjct  161   VGVPAGLIAEVTPTWFVLLVGSALNFSGFFMIWLAVTGQIAKPKVWQICAYICVGANSQN  220

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVT VKNFP SRG+MLGL+KGFVGLSGA+ TQ+Y A+YGNDS++LILLIGW PA
Sbjct  221   FANTGALVTSVKNFPESRGVMLGLLKGFVGLSGAIMTQIYFAVYGNDSKSLILLIGWFPA  280

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S+VF+ +IR MK+   PNE +VF+ +L +S+ LA+ LM +TI +K + F   AY    
Sbjct  281   AISVVFVFTIRTMKVVRQPNELRVFYHFLYVSVALAVFLMVMTILEKQLAFPRAAYAGSV  340

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQ--------LLSSENVEDppppaeniekaeeek  806
             T+VCALLFLP +IA+ +E A   ++K+Q        +   + VE              E 
Sbjct  341   TVVCALLFLPLVIAIRQEFAPWNQQKQQDDSPSEITIEKPQAVESKLVALPPTSSPNREG  400

Query  805   AGDY-SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
               +  SCF  IF+KP RGEDY+ILQALLS+DM +LF+    G G SL AIDNLGQIGESL
Sbjct  401   KSNSPSCFTTIFQKPPRGEDYTILQALLSIDMSILFLATLFGLGSSLTAIDNLGQIGESL  460

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
             GYP +TI +FVSLVSIWN+FGRVF+GF+SE +V +WK PRTLM+T  LLL C G L++AF
Sbjct  461   GYPTKTISSFVSLVSIWNFFGRVFAGFLSEALVAKWKFPRTLMLTLVLLLLCVGHLMIAF  520

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
             P  GSVY AS+ILGFS+G QLTLLF IISELFGLKYYSTLFNCGQLASPLG+Y+LNVKI 
Sbjct  521   PISGSVYVASVILGFSFGAQLTLLFTIISELFGLKYYSTLFNCGQLASPLGTYVLNVKIT  580

Query  268   GRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAA  104
             G  YD EA+K++A +G     V ELTCLG +CY+ SFI+LA    FGALVSL+LV RT  
Sbjct  581   GMFYDNEALKELAKKGMTRLSVNELTCLGVRCYRKSFIILAAGTFFGALVSLILVIRTRQ  640

Query  103   YYKTDIYKRFRDE  65
             +YK DIYK+F++E
Sbjct  641   FYKGDIYKKFKEE  653



>ref|XP_009356979.1| PREDICTED: uncharacterized protein LOC103947752 [Pyrus x bretschneideri]
Length=554

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/547 (64%), Positives = 429/547 (78%), Gaps = 9/547 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F + +  GRWF +FASFLIMAGAGATYL+G YSKEIKATLGYDQ+ +N+LG  KD+GAN
Sbjct  8     QFSWHILNGRWFSVFASFLIMAGAGATYLYGTYSKEIKATLGYDQTEINMLGFSKDLGAN  67

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTP WFVL+VG+ MNFAGYF+IWL+VT+RI KPKVWQMC+YIC+GANSQN
Sbjct  68    VGVLSGLIGEVTPVWFVLIVGAVMNFAGYFMIWLAVTQRIPKPKVWQMCVYICIGANSQN  127

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KGF GLSGA+ TQ+YLA+YGNDS++LILLIGWLPA
Sbjct  128   FANTGALVTCVKNFPESRGVMLGLLKGFTGLSGAILTQIYLAVYGNDSKSLILLIGWLPA  187

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +SI+F+ SIRPMK+   PNE +VF+ +L IS+ LAL LM +++ QK + FSH AY A A
Sbjct  188   AVSIIFVYSIRPMKVVRQPNELQVFYHFLYISVVLALFLMVMSLLQKTINFSHAAYAATA  247

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE----DppppaeniekaeeekAGDY  794
             T    LLFLP  IA+ EEL    + K+ +     V+          +   K +E +  + 
Sbjct  248   TGAIFLLFLPLGIAIREELVIWNQLKQPVDPPTEVKVEKPGETEFKKEESKDKELERPEP  307

Query  793   SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPR  614
              CF +I  KP RGEDY+ILQALLSVDML+LFI   CG G SL A+DNLGQIGESLGYP +
Sbjct  308   GCFSDICNKPPRGEDYTILQALLSVDMLILFIATLCGLGSSLTAVDNLGQIGESLGYPTK  367

Query  613   TIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGS  434
             T+  FVSL SIWNYFGRVFSGF+SE+++ R++IPR L+MT +L+L C G LL+AFP PGS
Sbjct  368   TVRAFVSLTSIWNYFGRVFSGFISESLLIRYRIPRPLVMTGALVLSCVGLLLIAFPGPGS  427

Query  433   VYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYD  254
             VY AS+I+GF++G QL LLF IISELFGLK+++TLFNCGQ+ASPLGSY+LNVK+ G LYD
Sbjct  428   VYVASVIIGFAFGAQLPLLFAIISELFGLKHFATLFNCGQIASPLGSYLLNVKLTGALYD  487

Query  253   GEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
              EA K++A RG     V +LTC+G  CY++SF +LA V   GALVSL+LV RT A+YK D
Sbjct  488   KEARKELAKRGLTRSQVKDLTCIGNHCYQLSFTILAAVTFLGALVSLILVYRTRAFYKGD  547

Query  88    IYKRFRD  68
             IYK++R 
Sbjct  548   IYKKYRQ  554



>ref|XP_006488014.1| PREDICTED: uncharacterized protein LOC102630186 [Citrus sinensis]
Length=568

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/550 (64%), Positives = 429/550 (78%), Gaps = 8/550 (1%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             N  +F+  + RGRWF +FASFLIMAGAGATYLFG YSK+IKA+LGYDQSTLNLLG FKD+
Sbjct  11    NWFHFMLHVIRGRWFSVFASFLIMAGAGATYLFGTYSKDIKASLGYDQSTLNLLGFFKDL  70

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGV SGL+ E+TPTWFVLLVGS MNFAGY +IWL+VT +IAKP VW MC YIC+GAN
Sbjct  71    GANVGVPSGLLGEITPTWFVLLVGSGMNFAGYLMIWLAVTGKIAKPAVWHMCAYICIGAN  130

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQNFANTGALVTCVKNFP SRG M+GL+KGF GLSGA+ TQ+YLA+YGNDS++LILLIGW
Sbjct  131   SQNFANTGALVTCVKNFPESRGNMIGLLKGFTGLSGAILTQVYLAVYGNDSKSLILLIGW  190

Query  1150  LPAILSIVFIPSIRPMKISSH-PNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             LPA +S++F+ +IR + +  H  +E KVF+ +L  SI LAL LM +TI +K + F   AY
Sbjct  191   LPAAISVIFVYTIRIIPVVQHTSHEAKVFYHFLYASIVLALFLMVMTILEKVMSFPREAY  250

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKK--QLLSSENVEDppppaeniekaeeekAG  800
              A AT    LLF+P  IA+ EELA    KK+    ++ E   +  P  E +   +E K  
Sbjct  251   AASATGCIVLLFVPLAIAIREELAIWNLKKQPPSEVTVEKPAEIEPKKEPLPPPDEPKGS  310

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF  I  KP RGEDY+ILQALLS+DML+LF+  F G G SL AIDNLGQIGESLGYP
Sbjct  311   TKSCFLTICDKPPRGEDYTILQALLSIDMLILFVATFGGLGSSLTAIDNLGQIGESLGYP  370

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
              +TI +FVSLVSIWNYFGRVF+GFVSE ++ ++K+PR LM+T  L+L C G LL+AFPFP
Sbjct  371   TKTIKSFVSLVSIWNYFGRVFAGFVSEGLLAKYKMPRPLMLTLVLVLSCIGLLLIAFPFP  430

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+I+GFS+G QL L+F IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G L
Sbjct  431   GSVYVASVIIGFSFGAQLPLIFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGSL  490

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD +AVK++A +G     V EL C+G +CY++ FI+LA V  FGALVS +LV RT  +Y+
Sbjct  491   YDHQAVKELAKKGMNRSDVKELICIGVKCYRLPFIILACVTCFGALVSFILVIRTREFYR  550

Query  94    TDIYKRFRDE  65
             +DIYK+FR+ 
Sbjct  551   SDIYKKFREN  560



>ref|XP_009786215.1| PREDICTED: uncharacterized protein LOC104234332 [Nicotiana sylvestris]
Length=596

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/555 (64%), Positives = 434/555 (78%), Gaps = 13/555 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + RGRWF +FASFLIMAGAGATYLFG YSKEIKA+LGYDQ+TLNLLG FKD+GAN
Sbjct  28    QFANHVARGRWFSLFASFLIMAGAGATYLFGTYSKEIKASLGYDQTTLNLLGFFKDLGAN  87

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV SGLIAEVTPTWFVLLVG+AMNF GYF+IWLSV  +I KPKVW MC+ IC+GANSQN
Sbjct  88    VGVFSGLIAEVTPTWFVLLVGAAMNFTGYFMIWLSVVGKIPKPKVWHMCICICLGANSQN  147

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVT V+NFP SRG M+GL+KGF GLSGA+ TQLYLA+YGNDS++LILLI WLPA
Sbjct  148   FANTGALVTSVRNFPESRGNMIGLLKGFTGLSGAIMTQLYLAVYGNDSKSLILLIAWLPA  207

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S++F+ +IR M++   PN+ +VF+  L I+I LAL LM +T+  K V FSH AY+  A
Sbjct  208   AVSVIFVYTIREMRVVKQPNQLRVFYYCLAIAIVLALFLMVMTLVDKAVAFSHAAYVGTA  267

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL----LSSEN---VEDppppaeniekaeeekA  803
             T+ CALLFLP L+ + EEL   + K   +    +++E+   V +    +  +E  +++  
Sbjct  268   TVACALLFLPLLVFIREELDVFRRKNLPIDPPRIATEDPKVVLEKEDNSTTLEIKKDDTN  327

Query  802   GDYSCFGNI-FKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
                  F +I F KP+RGEDYSILQALLS DML+LF+  FCG G SL A+DNLGQIGESLG
Sbjct  328   SKCVWFTDIFFNKPERGEDYSILQALLSTDMLILFLATFCGLGTSLTAVDNLGQIGESLG  387

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP  TI +FVSL+SIWN+FGR+FSGFVSET++ ++K PR LMMT  LLL C G LL+AFP
Sbjct  388   YPTTTIKSFVSLLSIWNFFGRIFSGFVSETLLVKYKFPRPLMMTLVLLLSCIGLLLIAFP  447

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
             FPGSVY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G
Sbjct  448   FPGSVYVASVIIGFSFGAQLPLLFSIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTG  507

Query  265   RLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              LYD +A+K++A +G     V ELTC+G QCY+ +F++LA V  FGAL S+ LVART  +
Sbjct  508   PLYDRQALKELAKKGLTRSSVKELTCIGNQCYRQAFVILASVAFFGALASMTLVARTRNF  567

Query  100   YKTDIYKRFRDEMGA  56
             YK DIYK+FR++  A
Sbjct  568   YKGDIYKKFREQAEA  582



>ref|XP_006424462.1| hypothetical protein CICLE_v10028100mg [Citrus clementina]
 gb|ESR37702.1| hypothetical protein CICLE_v10028100mg [Citrus clementina]
Length=568

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/550 (64%), Positives = 427/550 (78%), Gaps = 8/550 (1%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             N  + +  + RGRWF +FASFLIMAGAGATYLFG YSK+IKA+LGYDQSTLNLLG FKD+
Sbjct  11    NWFHLMLHVIRGRWFSVFASFLIMAGAGATYLFGTYSKDIKASLGYDQSTLNLLGFFKDL  70

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGV SGL+ E+TPTWFVLLVGS MNFAGY +IWL+VT +I KP VW MC YIC+GAN
Sbjct  71    GANVGVPSGLLGEITPTWFVLLVGSGMNFAGYLMIWLAVTGKIPKPAVWHMCAYICIGAN  130

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQNFANTGALVTCVKNFP SRG M+GL+KGF GLSGA+ TQ+YLA+YGNDS++LILLIGW
Sbjct  131   SQNFANTGALVTCVKNFPESRGNMIGLLKGFTGLSGAILTQVYLAVYGNDSKSLILLIGW  190

Query  1150  LPAILSIVFIPSIRPMKISSH-PNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             LPA +S++F+ +IR + +  H  +E KVF+ +L  SI LAL LM +TI +K + F   AY
Sbjct  191   LPAAISVIFVYTIRIIPVVQHTSHEAKVFYHFLYASIVLALFLMVMTILEKVMSFPREAY  250

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKK--QLLSSENVEDppppaeniekaeeekAG  800
              A AT    LLF+P  IA+ EELA    KK+    ++ E   +  P  E +   +E K  
Sbjct  251   AASATGCIVLLFVPLAIAIREELAIWNLKKQPPSEVTVEKPAEIEPKKEPLPPPDEPKGS  310

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF  I  KP RGEDY+ILQALLS+DML+LF+  F G G SL AIDNLGQIGESLGYP
Sbjct  311   TKSCFLTICDKPPRGEDYTILQALLSIDMLILFVATFGGLGSSLTAIDNLGQIGESLGYP  370

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
              +TI +FVSLVSIWNYFGRVF+GFVSE ++ ++K+PR LM+T  L+L C G LL+AFPFP
Sbjct  371   TKTIKSFVSLVSIWNYFGRVFAGFVSEGLLAKYKMPRPLMLTLVLVLSCIGLLLIAFPFP  430

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+I+GFS+G QL L+F IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G L
Sbjct  431   GSVYVASVIIGFSFGAQLPLIFAIISELFGLKYYSTLFNCGQLASPLGSYILNVKVAGSL  490

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD +AVK++A +G     V EL C+G +CY++ FI+LA V  FGALVS +LV RT  +Y+
Sbjct  491   YDHQAVKELAKKGMNRSDVKELICIGVKCYRLPFIILACVTCFGALVSFILVIRTREFYR  550

Query  94    TDIYKRFRDE  65
             +DIYK+FR+ 
Sbjct  551   SDIYKKFREN  560



>ref|XP_009612261.1| PREDICTED: uncharacterized protein LOC104105617 isoform X2 [Nicotiana 
tomentosiformis]
Length=582

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/556 (65%), Positives = 435/556 (78%), Gaps = 15/556 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             +F   + +GRWF +FASFLIMAGAGATYLFG YSKEIKA+LGYDQ+TLNLLG FKD+GAN
Sbjct  14    HFANHVVKGRWFSLFASFLIMAGAGATYLFGTYSKEIKASLGYDQTTLNLLGFFKDLGAN  73

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV SGLIAEVTPTWFVLLVG+AMNF GYF+IWLSV  +I KPKVW MC+YIC+GANSQN
Sbjct  74    VGVFSGLIAEVTPTWFVLLVGAAMNFTGYFMIWLSVVGKIPKPKVWHMCIYICLGANSQN  133

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVT V+NFP SRG M+GL+KGF GLSGA+ TQLYLA+YGNDS++LILLI WLPA
Sbjct  134   FANTGALVTSVRNFPESRGNMIGLLKGFTGLSGAIMTQLYLAVYGNDSKSLILLIAWLPA  193

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S++F+ +IR M++   PN+ +VF+  L I+I LAL LM +T+ +K V FSH AY+  A
Sbjct  194   AVSVIFVYTIREMRVVKQPNQLRVFYYCLTIAIVLALFLMVMTLVEKAVAFSHAAYVVTA  253

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL----LSSENVEDppppaeniekaeeekAGDY  794
             T+ CALLFLP L+ V EEL   + K   +    + +E+        E+     E K GD 
Sbjct  254   TVACALLFLPLLVFVREELDVFRRKNMPISPPQIDTEH-RPVVLEKEDNSTTLEIKKGDT  312

Query  793   S--CF---GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
             +  CF      F KP+RGEDYSILQALLS DML+LF+  FCG G SL A+DNLGQIGESL
Sbjct  313   NSKCFWFTDIFFNKPERGEDYSILQALLSTDMLILFLATFCGLGTSLTAVDNLGQIGESL  372

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
             GYP  TI +FVSL+SIWN+FGR+FSGFVSET++ ++K PR LMMT  LLL C G LL+AF
Sbjct  373   GYPTTTIKSFVSLLSIWNFFGRIFSGFVSETLLVKYKFPRPLMMTLVLLLSCIGLLLIAF  432

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
             PFPGSVY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ 
Sbjct  433   PFPGSVYVASVIIGFSFGAQLPLLFSIISELFGLKYYSTLFNCGQLASPLGSYILNVKVT  492

Query  268   GRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAA  104
             G LYD +A+K++A +G     V ELTC+G QCY+ +FI+LA V  FGAL SL+LVART  
Sbjct  493   GPLYDRQALKELAKKGLTRSSVKELTCIGNQCYRQAFIILASVAFFGALASLILVARTRN  552

Query  103   YYKTDIYKRFRDEMGA  56
             +YK DIYK+FR++  A
Sbjct  553   FYKGDIYKKFREQAEA  568



>ref|XP_009612260.1| PREDICTED: uncharacterized protein LOC104105617 isoform X1 [Nicotiana 
tomentosiformis]
Length=600

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/556 (65%), Positives = 435/556 (78%), Gaps = 15/556 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             +F   + +GRWF +FASFLIMAGAGATYLFG YSKEIKA+LGYDQ+TLNLLG FKD+GAN
Sbjct  32    HFANHVVKGRWFSLFASFLIMAGAGATYLFGTYSKEIKASLGYDQTTLNLLGFFKDLGAN  91

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV SGLIAEVTPTWFVLLVG+AMNF GYF+IWLSV  +I KPKVW MC+YIC+GANSQN
Sbjct  92    VGVFSGLIAEVTPTWFVLLVGAAMNFTGYFMIWLSVVGKIPKPKVWHMCIYICLGANSQN  151

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVT V+NFP SRG M+GL+KGF GLSGA+ TQLYLA+YGNDS++LILLI WLPA
Sbjct  152   FANTGALVTSVRNFPESRGNMIGLLKGFTGLSGAIMTQLYLAVYGNDSKSLILLIAWLPA  211

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S++F+ +IR M++   PN+ +VF+  L I+I LAL LM +T+ +K V FSH AY+  A
Sbjct  212   AVSVIFVYTIREMRVVKQPNQLRVFYYCLTIAIVLALFLMVMTLVEKAVAFSHAAYVVTA  271

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL----LSSENVEDppppaeniekaeeekAGDY  794
             T+ CALLFLP L+ V EEL   + K   +    + +E+        E+     E K GD 
Sbjct  272   TVACALLFLPLLVFVREELDVFRRKNMPISPPQIDTEH-RPVVLEKEDNSTTLEIKKGDT  330

Query  793   S--CF---GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
             +  CF      F KP+RGEDYSILQALLS DML+LF+  FCG G SL A+DNLGQIGESL
Sbjct  331   NSKCFWFTDIFFNKPERGEDYSILQALLSTDMLILFLATFCGLGTSLTAVDNLGQIGESL  390

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
             GYP  TI +FVSL+SIWN+FGR+FSGFVSET++ ++K PR LMMT  LLL C G LL+AF
Sbjct  391   GYPTTTIKSFVSLLSIWNFFGRIFSGFVSETLLVKYKFPRPLMMTLVLLLSCIGLLLIAF  450

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
             PFPGSVY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ 
Sbjct  451   PFPGSVYVASVIIGFSFGAQLPLLFSIISELFGLKYYSTLFNCGQLASPLGSYILNVKVT  510

Query  268   GRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAA  104
             G LYD +A+K++A +G     V ELTC+G QCY+ +FI+LA V  FGAL SL+LVART  
Sbjct  511   GPLYDRQALKELAKKGLTRSSVKELTCIGNQCYRQAFIILASVAFFGALASLILVARTRN  570

Query  103   YYKTDIYKRFRDEMGA  56
             +YK DIYK+FR++  A
Sbjct  571   FYKGDIYKKFREQAEA  586



>ref|XP_006366091.1| PREDICTED: uncharacterized protein LOC102598479 [Solanum tuberosum]
Length=580

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/549 (64%), Positives = 430/549 (78%), Gaps = 10/549 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              FV  + RGRWF +FASFLIM+GAGATYLFGVYS+EIK TLGYDQ+TL LLG FKD+GAN
Sbjct  14    QFVLHVLRGRWFSLFASFLIMSGAGATYLFGVYSQEIKNTLGYDQTTLVLLGFFKDLGAN  73

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLIAEV+PTWFVLLVG+AMNF GYF+IWLSV  +I+KPKVWQMC+YIC+GANSQN
Sbjct  74    VGVLSGLIAEVSPTWFVLLVGAAMNFTGYFMIWLSVIGKISKPKVWQMCIYICLGANSQN  133

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVT V+NFP SRG M+GL+KGF GLSGA+ TQLYLA+YGND+Q+LILLI W+PA
Sbjct  134   FANTGALVTSVRNFPESRGNMIGLLKGFTGLSGAIMTQLYLAVYGNDAQSLILLIAWMPA  193

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS++F+ +IR MK+   PN+  VFF  L ISI LAL LM  T+ +K + FSH AY+  A
Sbjct  194   ALSLIFVYTIRQMKVVRQPNQQTVFFHCLLISIVLALFLMVTTLLEKAISFSHAAYVVAA  253

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSEN--VED--ppppaeniekaeeekAGDY  794
             T+ CALLF P L+ + EELA  ++ K+      N  VE+  P    +  +     K    
Sbjct  254   TVSCALLFSPLLVFIREELAIWRQMKQNNGGVANTIVENPPPTEIPQPQKDQVNSKTSTS  313

Query  793   SCFGNI-FKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPP  617
             SCF  I F+KP RGEDY+ILQALLS DML+LF+   CG G SL A+DN+GQIG SLGYP 
Sbjct  314   SCFSKIFFEKPARGEDYTILQALLSTDMLILFVATLCGLGSSLTAVDNMGQIGGSLGYPK  373

Query  616   RTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPG  437
              T+ +F+SL+SIWN+FGR+FSGFVSE+++ R+K PRTLMMT  LLL C G LL+AFPFPG
Sbjct  374   TTVKSFLSLLSIWNFFGRIFSGFVSESLLVRYKFPRTLMMTLVLLLSCIGLLLIAFPFPG  433

Query  436   SVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLY  257
             S+Y AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G L 
Sbjct  434   SLYVASIIIGFSFGAQLPLLFTIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGPLC  493

Query  256   DGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
             D EA+K +  +G     V ELTC+G QCY++ FI+LA V  FGA+ SL+LVART  +YK 
Sbjct  494   DREALKDLEKKGLTRASVKELTCIGNQCYQLPFIILACVTFFGAMASLILVARTRQFYKG  553

Query  91    DIYKRFRDE  65
             DIYK+F+++
Sbjct  554   DIYKKFKEQ  562



>ref|XP_004250977.1| PREDICTED: uncharacterized membrane protein YMR155W [Solanum 
lycopersicum]
Length=555

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/550 (64%), Positives = 426/550 (77%), Gaps = 23/550 (4%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + +GRWF +FASFLIMAGAGATYLFG YSKEIK++LGYDQ+TLNLLG FKD+GAN
Sbjct  14    QFTNHVIQGRWFSLFASFLIMAGAGATYLFGTYSKEIKSSLGYDQTTLNLLGFFKDLGAN  73

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV SGL+AE+TPTWFVLLVG++MNF GYF+IWLSV  +I KPKVW M +YIC+GANSQN
Sbjct  74    VGVFSGLLAEITPTWFVLLVGASMNFIGYFMIWLSVAGKIQKPKVWLMSMYICIGANSQN  133

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVT V+NFP SRG M+GL+KGF GLSGA+ TQLYLA+YGND+ +L+LLI WLPA
Sbjct  134   FANTGALVTSVRNFPQSRGNMIGLLKGFTGLSGAILTQLYLALYGNDATSLVLLIAWLPA  193

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +S++F+ +IR M++ + PN+ KVF   L I+I LAL LM +T+ ++ V F+H AY+A A
Sbjct  194   AISLIFVYTIREMRVVNQPNQLKVFNYCLAIAIVLALFLMVMTLVERAVSFTHAAYVATA  253

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSC--  788
             TI CALLF P L+ V EEL +      +++     ED                 +  C  
Sbjct  254   TIACALLFTPLLVFVREELLSVFRNPPEVVVVVEKED---------------TNNLKCLS  298

Query  787   FGNIF-KKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRT  611
             F +IF  KP+RGEDYSILQALLS DML+LF+  FCG G SL A+DNLGQIGESLGYP  T
Sbjct  299   FNDIFLNKPERGEDYSILQALLSTDMLILFVATFCGLGTSLTAVDNLGQIGESLGYPTTT  358

Query  610   IGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSV  431
             I +FVSL+SIWN+FGR+FSGFVSE ++ ++K PRTLMMT  LLL C G LL+AFPF GSV
Sbjct  359   IKSFVSLLSIWNFFGRIFSGFVSEALLVKYKFPRTLMMTLVLLLSCIGLLLIAFPFNGSV  418

Query  430   YGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDG  251
             Y AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LYD 
Sbjct  419   YVASVIIGFSFGAQLPLLFSIISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGPLYDR  478

Query  250   EAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDI  86
             EA+K +A +G     V ELTC+G QCY+ +FI+LA V  FGAL SLVLVART  +YK+DI
Sbjct  479   EALKDLARKGLTRSSVKELTCIGNQCYRQAFIILASVAFFGALASLVLVARTRKFYKSDI  538

Query  85    YKRFRDEMGA  56
             YK+FR++  A
Sbjct  539   YKKFREQAEA  548



>ref|XP_002273103.2| PREDICTED: uncharacterized protein LOC100249900 [Vitis vinifera]
Length=599

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/557 (60%), Positives = 420/557 (75%), Gaps = 14/557 (3%)
 Frame = -1

Query  1684  ENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGA  1505
               F   + +GRWF + ASFL+M G G+TYLFG+YS+EIK+ LGYDQ+TLNLLG FKD+G 
Sbjct  22    SRFAVHVIKGRWFSVCASFLVMIGPGSTYLFGIYSQEIKSALGYDQTTLNLLGFFKDMGT  81

Query  1504  NVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQ  1325
             N+GV +GL+AEVTPTWFVLL+GSA+N  GY +IWL+VT RIA+PKVW MC+Y  VG+NSQ
Sbjct  82    NIGVPAGLVAEVTPTWFVLLLGSALNLWGYLMIWLAVTARIARPKVWHMCVYNFVGSNSQ  141

Query  1324  NFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLP  1145
             NFANTGALVTCVKNFP SRG+M+GL+KGFVGL GA+ TQ Y AIYG+DS+ LIL++GW P
Sbjct  142   NFANTGALVTCVKNFPESRGIMIGLLKGFVGLGGAIMTQFYFAIYGDDSKALILMVGWFP  201

Query  1144  AILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
             A L ++F+ +IR MK+   PNE K+F+++L +SI LAL LM +TI QK + F   AY   
Sbjct  202   AALCVIFVYTIRTMKVVRQPNEVKMFYQFLYVSIVLALFLMVMTIVQKQIVFPRAAYAGS  261

Query  964   ATIVCALLFLPFLIAVMEELATRKEKKKQLLS---------SENVEDppppaeniekaee  812
              T+VC LLFLPF+IA+ EEL     +++   S          E    P          EE
Sbjct  262   VTVVCVLLFLPFVIAIREELTFWNLERQHDNSPTEVTVEKPQEEESKPVALPPVSSTQEE  321

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
             EK    S F N+FKKP RGEDY+ILQALLS+DML LF+   CG G SL AIDNLGQIG +
Sbjct  322   EKPNSSSFFANVFKKPPRGEDYTILQALLSIDMLTLFLATMCGLGSSLTAIDNLGQIGGA  381

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             LGYP RTI +FVSLVSIWNYFGRVFSGFVSE ++ +WK+PR LM+T +L+L C G L++A
Sbjct  382   LGYPTRTISSFVSLVSIWNYFGRVFSGFVSEILIAKWKVPRPLMLTLTLVLLCVGHLMIA  441

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             FP PGS+Y AS+ +GF+YG QLTL+F IISELFGLKYY+TLFNCGQLA+P+G+Y+LNVK+
Sbjct  442   FPAPGSIYVASVFIGFAYGAQLTLIFAIISELFGLKYYATLFNCGQLATPIGTYVLNVKV  501

Query  271   VGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G  YD EA+K++A +G     V EL C+G QCYK SFI+LA   LFGA VS++LV RT 
Sbjct  502   TGMFYDQEALKELAKKGMTRSSVKELICIGVQCYKKSFIILAAGTLFGAAVSMILVIRTQ  561

Query  106   AYYKTDIYKRFRDEMGA  56
              +Y+ DIYK+FR++  A
Sbjct  562   EFYRGDIYKKFREQADA  578



>emb|CAN82898.1| hypothetical protein VITISV_026994 [Vitis vinifera]
Length=599

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/557 (60%), Positives = 419/557 (75%), Gaps = 14/557 (3%)
 Frame = -1

Query  1684  ENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGA  1505
               F   + +GRWF + ASFL+M G G TYLFG+YS+EIK+ LGYDQ+TLNLLG FKD+G 
Sbjct  22    SRFAVHVIKGRWFSVCASFLVMIGPGTTYLFGIYSQEIKSALGYDQTTLNLLGFFKDMGT  81

Query  1504  NVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQ  1325
             N+GV +GL+AEVTPTWFVLL+GSA+N  GY +IWL+VT RIA+PKVW MC+Y  VG+NSQ
Sbjct  82    NIGVPAGLVAEVTPTWFVLLLGSALNLWGYLMIWLAVTARIARPKVWHMCVYNFVGSNSQ  141

Query  1324  NFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLP  1145
             NFANTGALVTCVKNFP SRG+M+GL+KGFVGL GA+ TQ Y AIYG+DS+ LIL++GW P
Sbjct  142   NFANTGALVTCVKNFPESRGIMIGLLKGFVGLGGAIMTQFYFAIYGDDSKALILMVGWFP  201

Query  1144  AILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
             A L ++F+ +IR MK+   PNE K+F+++L +SI LAL LM +TI QK + F   AY   
Sbjct  202   AALCVIFVYTIRTMKVVRQPNEVKMFYQFLYVSIVLALFLMVMTIVQKQIVFPRAAYAGS  261

Query  964   ATIVCALLFLPFLIAVMEELATRKEKKKQLLS---------SENVEDppppaeniekaee  812
              T+VC LLFLPF+IA+ EEL     +++   S          E    P          EE
Sbjct  262   VTVVCVLLFLPFVIAIREELTFWNLERQHDNSPTEVTVEKPQEEESKPVALPPVSSTQEE  321

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
             EK    S F N+FKKP RGEDY+ILQALLS+DML LF+   CG G SL AIDNLGQIG +
Sbjct  322   EKPNSSSFFANVFKKPPRGEDYTILQALLSIDMLTLFLATMCGLGSSLTAIDNLGQIGGA  381

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             LGYP RTI +FVSLVSIWNYFGRVFSGFVSE ++ +WK+PR LM+T +L+L C G L++A
Sbjct  382   LGYPTRTISSFVSLVSIWNYFGRVFSGFVSEILIAKWKVPRPLMLTLTLVLLCVGHLMIA  441

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             FP PGS+Y AS+ +GF+YG QLTL+F IISELFGLKYY+TLFNCGQLA+P+G+Y+LNVK+
Sbjct  442   FPAPGSIYVASVFIGFAYGAQLTLIFAIISELFGLKYYATLFNCGQLATPIGTYVLNVKV  501

Query  271   VGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G  YD EA+K++A +G     V EL C+G QCYK SFI+LA   LFGA VS++LV RT 
Sbjct  502   TGMFYDQEALKELAKKGMTRSSVKELICIGVQCYKKSFIILAAGTLFGAAVSMILVIRTQ  561

Query  106   AYYKTDIYKRFRDEMGA  56
              +Y+ DIYK+FR++  A
Sbjct  562   EFYRGDIYKKFREQADA  578



>emb|CDX77158.1| BnaC04g39530D [Brassica napus]
Length=548

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/553 (63%), Positives = 411/553 (74%), Gaps = 37/553 (7%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+  LF GRWFM+FASFLIMA AGATYLFG YSK+IK+TLGYDQ+TLNLLG FKD+GAN
Sbjct  9     RFLIHLFNGRWFMVFASFLIMACAGATYLFGTYSKDIKSTLGYDQTTLNLLGFFKDLGAN  68

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV+SGLIAEVTPTWFVL VGSAMNF GYF+IWL+VT ++AKPKVWQMCLYIC+GANSQN
Sbjct  69    VGVMSGLIAEVTPTWFVLTVGSAMNFVGYFMIWLTVTGKVAKPKVWQMCLYICIGANSQN  128

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG+MLGL+KG+VGLSGA+ TQLY AIYGNDS++LILLI WLPA
Sbjct  129   FANTGALVTCVKNFPESRGVMLGLLKGYVGLSGAIMTQLYFAIYGNDSKSLILLIAWLPA  188

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++S+VF+ SIR  K+    NE  VF+ +L +SI LAL LM + IA+K V F+  AY A A
Sbjct  189   VVSLVFVYSIREKKVVRQRNELNVFYNFLYLSIFLALFLMAMNIAEKQVHFTKAAYAASA  248

Query  961   TIVCALLFLPFLIAVMEELATRKEKK--KQLLSSEN----VEDppppaeniekaeeekAG  800
             TI C LLF+P  +AV +E+     KK     +  EN    + D P           E+  
Sbjct  249   TICCVLLFVPLTVAVKQEIEVWNMKKLPPSEVKVENPPSRMGDLPGSLGKEIDLVHEEKE  308

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF  +F  P RGEDY+ILQALLS+DM++LFI  FCG G SL A+DNLGQIGESLGYP
Sbjct  309   MKSCFLTVFDPPPRGEDYTILQALLSLDMIILFIATFCGLGSSLTAVDNLGQIGESLGYP  368

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
               T+ +FVSLVSIWNYFGRVFSGFVSE ++ ++K+PR LMMTF LLL CAG LL+AFP P
Sbjct  369   NHTVSSFVSLVSIWNYFGRVFSGFVSEYLLAKYKLPRPLMMTFVLLLSCAGHLLIAFPVP  428

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+++GFS+G QL LLF IISELFGLKYYSTL                       
Sbjct  429   GSVYIASILMGFSFGAQLPLLFAIISELFGLKYYSTL-----------------------  465

Query  259   YDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
                EA+KQ+ ARG     V +LTCLG+QCYK+ F++LA V  FGALVSL L  RT  +YK
Sbjct  466   ---EALKQLKARGLTRKDVKDLTCLGSQCYKLPFVILASVTFFGALVSLGLAIRTRKFYK  522

Query  94    TDIYKRFRDEMGA  56
              DIYK+FR+  G+
Sbjct  523   GDIYKKFRETPGS  535



>gb|KDO60260.1| hypothetical protein CISIN_1g037996mg [Citrus sinensis]
Length=535

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/527 (65%), Positives = 412/527 (78%), Gaps = 8/527 (2%)
 Frame = -1

Query  1621  MAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLIAEVTPTWFVLLV  1442
             MAGAGATYLFG YSK+IKA+LGYDQSTLNLLG FKD+GANVGV SGL+ E+TPTWFVLLV
Sbjct  1     MAGAGATYLFGTYSKDIKASLGYDQSTLNLLGFFKDLGANVGVPSGLLGEITPTWFVLLV  60

Query  1441  GSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALVTCVKNFPASRGM  1262
             GS MNFAGY +IWL+VT +IAKP VW MC YIC+GANSQNFANTGALVTCVKNFP SRG 
Sbjct  61    GSGMNFAGYLMIWLAVTGKIAKPAVWHMCAYICIGANSQNFANTGALVTCVKNFPESRGN  120

Query  1261  MLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIPSIRPMKISSH-P  1085
             M+GL+KGF GLSGA+ TQ+YLA+YGNDS++LILLIGWLPA +S++F+ +IR + +  H  
Sbjct  121   MIGLLKGFTGLSGAILTQVYLAVYGNDSKSLILLIGWLPAAISVIFVYTIRIIPVVQHTS  180

Query  1084  NETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLFLPFLIAVMEEL  905
             +E KVF+ +L  SI LAL LM +TI +K + F   AY A AT    LLF+P  IA+ EEL
Sbjct  181   HEAKVFYHFLYASIVLALFLMVMTILEKVMSFPREAYAASATGCIVLLFVPLAIAIREEL  240

Query  904   ATRKEKKK--QLLSSENVEDppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQA  731
             A    KK+    ++ E   +  P  E +   +E K    SCF  I  KP RGEDY+ILQA
Sbjct  241   AIWNLKKQPPSEVTVEKPAEIEPKKEPLPPPDEPKGSTKSCFLTICDKPPRGEDYTILQA  300

Query  730   LLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSG  551
             LLS+DML+LF+  F G G SL AIDNLGQIGESLGYP +TI +FVSLVSIWNYFGRVF+G
Sbjct  301   LLSIDMLILFVATFGGLGSSLTAIDNLGQIGESLGYPTKTIKSFVSLVSIWNYFGRVFAG  360

Query  550   FVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFI  371
             FVSE ++ ++K+PR LM+T  L+L C G LL+AFPFPGSVY AS+I+GFS+G QL L+F 
Sbjct  361   FVSEGLLAKYKMPRPLMLTLVLVLSCIGLLLIAFPFPGSVYVASVIIGFSFGAQLPLIFA  420

Query  370   IISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARG-----VGELT  206
             IISELFGLKYYSTLFNCGQLASPLGSYILNVK+ G LYD +AVK++A +G     V EL 
Sbjct  421   IISELFGLKYYSTLFNCGQLASPLGSYILNVKVTGSLYDHQAVKELAKKGMNRSDVKELI  480

Query  205   CLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDE  65
             C+G +CY++ FI+LA V  FGALVS +LV RT  +Y++DIYK+FR+ 
Sbjct  481   CIGVKCYRLPFIILACVTCFGALVSFILVIRTREFYRSDIYKKFREN  527



>gb|KDP43974.1| hypothetical protein JCGZ_05441 [Jatropha curcas]
Length=558

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/547 (62%), Positives = 411/547 (75%), Gaps = 13/547 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   +  GRWF +FASFLIM GAG+TY+FG YSK+IKATLGYDQSTLNLLG FK+VG  
Sbjct  6     RFAIHVISGRWFSVFASFLIMVGAGSTYIFGTYSKDIKATLGYDQSTLNLLGFFKEVGGT  65

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
              GV SGLIAEVTPTWF+LLVGSAMNF GYF+IWL+VT++IAKPK+WQMC+YIC+GANSQN
Sbjct  66    FGVPSGLIAEVTPTWFMLLVGSAMNFIGYFMIWLAVTRKIAKPKIWQMCIYICIGANSQN  125

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCV NFP SRG++LGL+KG+VGLSGA+ TQ+YLA+YGNDS+ LILLI WLPA
Sbjct  126   FANTGALVTCVLNFPESRGVVLGLLKGYVGLSGAIMTQVYLAVYGNDSKALILLIAWLPA  185

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              LS++F+ +IR MK    PNE K+F+++L  SI LAL LM + I +K V F   AY    
Sbjct  186   ALSVIFVFTIRIMKAERQPNELKIFYQFLYASIMLALFLMVMNILEKKVNFPKGAYATVT  245

Query  961   TIVCALLFLPFLIAVMEELATRKEKKK-------QLLSSENVEDppppaeniekaeeekA  803
             +++C LLF+P LIA+ EE      KK+       +L + + +E+    +     + EE  
Sbjct  246   SLICVLLFVPLLIAIREEWVQWNIKKQEAMRPPCELTTEKPLEERDELSVETRISTEENN  305

Query  802   G-DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
                 SCF  +F KP+RGEDY+ILQALLS+DMLLL    FC  G +L A+DNLGQIGESLG
Sbjct  306   KISKSCFLTVFDKPERGEDYTILQALLSIDMLLLISATFCSLGPTLTAVDNLGQIGESLG  365

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             Y   TI +FVSLVSIWNYFGRVF+GFVSET++ ++K PR LMM   LLL   G L++AFP
Sbjct  366   YSTETINSFVSLVSIWNYFGRVFAGFVSETLIVKYKTPRPLMMVGVLLLSSIGYLIIAFP  425

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
             FP SVY AS+I+GFS+G    L + IISELFGLKYY+TLFNCG LASPLGSYILNVK+ G
Sbjct  426   FPNSVYIASVIIGFSFGALYVLFYAIISELFGLKYYATLFNCGLLASPLGSYILNVKVTG  485

Query  265   RLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              LYD EA++Q+  +G     V EL C+G +CY+  FIVL  V LFGALVS +LVART  +
Sbjct  486   TLYDNEALRQLKKKGLDRSSVQELVCIGVECYRKPFIVLCSVALFGALVSFILVARTRKF  545

Query  100   YKTDIYK  80
             Y  DIYK
Sbjct  546   YSGDIYK  552



>ref|XP_002272443.3| PREDICTED: uncharacterized protein LOC100242799 [Vitis vinifera]
Length=569

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/540 (61%), Positives = 415/540 (77%), Gaps = 16/540 (3%)
 Frame = -1

Query  1645  MMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLIAEVT  1466
             M+ A+FL+MAGAGATYL+GVYSK+IKA LGYDQSTLNLL S KD+GANVG+ +GL+AEV 
Sbjct  1     MIPAAFLVMAGAGATYLYGVYSKDIKARLGYDQSTLNLLASMKDLGANVGIPAGLLAEVA  60

Query  1465  PTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALVTCVK  1286
             PTW VLLVGS MNF GYFLIWL+V  +I KP VW MC+YIC+GANSQNF+NTGALVTCVK
Sbjct  61    PTWVVLLVGSIMNFGGYFLIWLAVVGKIPKPAVWHMCVYICLGANSQNFSNTGALVTCVK  120

Query  1285  NFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIPSIRP  1106
             NFP +RGMMLGLMKGFVGLSGA+FTQLY AIYGNDS ++ILLIGWLP+++SIVF+ ++RP
Sbjct  121   NFPEARGMMLGLMKGFVGLSGALFTQLYYAIYGNDSTSMILLIGWLPSVISIVFLTTLRP  180

Query  1105  MKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLFLPFL  926
             MK S+HP    V ++ + +++ LA  LMGL IAQK V+FS  AYI  A  V  L+ LPF 
Sbjct  181   MKASTHPRVLNVLYQNMYVTVGLAAFLMGLIIAQKQVQFSQTAYIGSAIAVIVLILLPFG  240

Query  925   IAVMEELATRKEKKKQLLSSENV----------EDppppaeniekaeeekAGDYSCFGNI  776
             IAV EEL   +EKK+ + +  ++          E P    +  ++   E+   YSC  N+
Sbjct  241   IAVREELLVWREKKQPVAAPTDIVIAKESKTLPESPQTDTQKEKEGATEEMPCYSC-TNV  299

Query  775   FKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFV  596
               KP RGEDYSI QALLS DM+++F+   CG GC+L  ++NLGQIGESLGY   TIG  V
Sbjct  300   CNKPSRGEDYSIFQALLSADMIIMFVAMCCGLGCNLTTMNNLGQIGESLGYKKNTIGISV  359

Query  595   SLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASL  416
             SL SIW +FGRVF+GF+SET++ + K+PRTL MT  LLL   G L++AFPFP SVY ASL
Sbjct  360   SLASIWGFFGRVFTGFISETLLLKKKVPRTLFMTIFLLLSAVGQLMIAFPFPNSVYIASL  419

Query  415   ILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQ  236
             ++GFS+G QLTL+F ++SELFGLKYYSTLFNCGQL++PLGSY+L+V +VG+LYD EA+KQ
Sbjct  420   VVGFSHGAQLTLVFTVVSELFGLKYYSTLFNCGQLSAPLGSYVLSVLVVGKLYDREAIKQ  479

Query  235   VAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFR  71
             +  + V      ELTC+GT+CYK+S+++LA  N+F A VSL+LV RT  +Y  DIYK+FR
Sbjct  480   LGQKSVKRSMTEELTCIGTKCYKISYLILACTNVFAAFVSLILVCRTRKFYSGDIYKKFR  539



>ref|XP_006349027.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Solanum 
tuberosum]
Length=573

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/557 (63%), Positives = 431/557 (77%), Gaps = 11/557 (2%)
 Frame = -1

Query  1699  EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSF  1520
             +   +  F   + +GRWF +FASFLIMAGAGATYLFG YSKEIK++LGYDQ+TLNLLG F
Sbjct  8     KSHEILQFTNHVIQGRWFSLFASFLIMAGAGATYLFGTYSKEIKSSLGYDQTTLNLLGFF  67

Query  1519  KDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICV  1340
             KD+GANVGV SGL+AEVTPTWFVLLVG++MNF GYF+IW SV  +I KP VW MC+YIC+
Sbjct  68    KDLGANVGVFSGLLAEVTPTWFVLLVGASMNFTGYFMIWFSVVGKIQKPNVWLMCMYICL  127

Query  1339  GANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILL  1160
             GANSQNFANTGALVT VKNFP SRG ++GL+KGF GLSGA+ TQLYLA+YGND+ +LILL
Sbjct  128   GANSQNFANTGALVTSVKNFPESRGNLIGLLKGFTGLSGAIMTQLYLAVYGNDATSLILL  187

Query  1159  IGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHF  980
             I WLPA +S++F+ +IR M++   PN+ +VF+  L I+I LAL LM +T+ ++ VRF+H 
Sbjct  188   IAWLPAAISLIFVYTIREMRVVKQPNQLRVFYYCLAIAIVLALFLMVVTLVERTVRFTHG  247

Query  979   AYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeek-A  803
             AY+  ATI CALLFLP L+ + EEL   +  +K ++    V     P   +    E K  
Sbjct  248   AYVGTATIACALLFLPLLVFLREELGVFR--RKNVIDPPRVSTTEHPPVPVVVVVENKDT  305

Query  802   GDYSC--FGNIF-KKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
              +  C  F +IF  KP+RGEDYSILQALLS DML+LF+  FCG G SL A+DNLGQIGES
Sbjct  306   NNLKCLSFNDIFLNKPERGEDYSILQALLSTDMLILFVATFCGLGTSLTAVDNLGQIGES  365

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             LGYP  TI +FVSL+SIWN+FGR+FSGFVSE ++ ++K PRTLMMT  LLL C G LL+A
Sbjct  366   LGYPTTTIKSFVSLLSIWNFFGRIFSGFVSEALLVKYKFPRTLMMTLVLLLSCIGLLLIA  425

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             FPF GSVY AS+I+GFS+G QL LLF IISELFGLKYYSTLFNCGQLASPLGSYILNVK+
Sbjct  426   FPFNGSVYVASVIIGFSFGAQLPLLFSIISELFGLKYYSTLFNCGQLASPLGSYILNVKV  485

Query  271   VGRLYDGEAVKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G LYD EA+K +A +G     V ELTC+G QCY+ +F++LA V  FGAL SL+LVART 
Sbjct  486   TGPLYDREALKDLAKKGLTRSSVKELTCIGNQCYRQAFVILASVAFFGALASLILVARTR  545

Query  106   AYYKTDIYKRFRDEMGA  56
              +YK DIYK+FR++  A
Sbjct  546   KFYKGDIYKKFREQAEA  562



>gb|EPS63290.1| hypothetical protein M569_11492, partial [Genlisea aurea]
Length=541

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/546 (60%), Positives = 415/546 (76%), Gaps = 19/546 (3%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  ++ RGRWF +FASFLIMAGAGATYLFG YS+EIK  LGYDQ+TLNLLG FKD+GANV
Sbjct  3     FSGEVIRGRWFSLFASFLIMAGAGATYLFGTYSQEIKNNLGYDQTTLNLLGFFKDLGANV  62

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GV+SGLIAEVTPTWFVLLVG+AMNF GYF+IWL+V  RI+KP+VW+MC+YIC GANSQNF
Sbjct  63    GVMSGLIAEVTPTWFVLLVGAAMNFGGYFMIWLAVAGRISKPRVWEMCVYICAGANSQNF  122

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVT V NFP SRG+MLGL+KG+VGLSGA+ TQ+YLA+YGNDS+ LILLI WLPA 
Sbjct  123   ANTGALVTAVMNFPESRGVMLGLLKGYVGLSGAILTQIYLAVYGNDSKALILLIAWLPAA  182

Query  1138  LSIVFIPSIRPMKISSH-PNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             +S++F+ SIR +++      E KVF++ L IS+ +AL L+ +TIA++ ++FS   Y   A
Sbjct  183   ISVIFVYSIRKLEVRRQTAAELKVFYQILYISVAMALFLLIITIAERVIKFSEGGYAISA  242

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSCFG  782
               V  LLF P ++A+ EE    K+K K L      ED           E  K+     + 
Sbjct  243   AAVTLLLFAPLILAIREESKLWKQKPKLL------ED-------PPPPEPSKSAGTPWYA  289

Query  781   NIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGT  602
             ++F+KP+RGEDY+ILQAL S DM +LF+  FCG G SL A+DNLGQIG+SLGYP +T+ T
Sbjct  290   DVFRKPERGEDYTILQALTSTDMSILFVATFCGLGSSLTAVDNLGQIGQSLGYPSKTVKT  349

Query  601   FVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGA  422
             F+S++SIWNYFGR+F+GF SET++ ++  PR LMM   L L   G LLVAFPF GS+Y A
Sbjct  350   FLSILSIWNYFGRIFAGFASETLLSKYGFPRPLMMASILALSGVGLLLVAFPFRGSLYAA  409

Query  421   SLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAV  242
             S+I+GF++G Q+ L+  +ISELFGLK+Y+TLFNCGQLASPLGSY+ NV+I G LYD +AV
Sbjct  410   SVIVGFAFGAQMPLILAVISELFGLKHYATLFNCGQLASPLGSYVFNVRITGPLYDRKAV  469

Query  241   KQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKR  77
             +Q+AARG     V ELTC+G +CY++ F++LA     GALVSLVLVART  +Y+ DIY +
Sbjct  470   EQLAARGMAREAVKELTCIGEECYRLPFVILAATTFAGALVSLVLVARTREFYRGDIYNK  529

Query  76    FRDEMG  59
             F+   G
Sbjct  530   FKGRGG  535



>emb|CBI17146.3| unnamed protein product [Vitis vinifera]
Length=1107

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/548 (60%), Positives = 417/548 (76%), Gaps = 19/548 (3%)
 Frame = -1

Query  1684  ENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGA  1505
               F   + +GRWF + ASFL+M G G+TYLFG+YS+EIK+ LGYDQ+TLNLLG FKD+G 
Sbjct  553   SRFAVHVIKGRWFSVCASFLVMIGPGSTYLFGIYSQEIKSALGYDQTTLNLLGFFKDMGT  612

Query  1504  NVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQ  1325
             N+GV +GL+AEVTPTWFVLL+GSA+N  GY +IWL+VT RIA+PKVW MC+Y  VG+NSQ
Sbjct  613   NIGVPAGLVAEVTPTWFVLLLGSALNLWGYLMIWLAVTARIARPKVWHMCVYNFVGSNSQ  672

Query  1324  NFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLP  1145
             NFANTGALVTCVKNFP SRG+M+GL+KGFVGL GA+ TQ Y AIYG+DS+ LIL++GW P
Sbjct  673   NFANTGALVTCVKNFPESRGIMIGLLKGFVGLGGAIMTQFYFAIYGDDSKALILMVGWFP  732

Query  1144  AILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
             A L ++F+ +IR MK+   PNE K+F+++L +SI LAL LM +TI QK + F   AY   
Sbjct  733   AALCVIFVYTIRTMKVVRQPNEVKMFYQFLYVSIVLALFLMVMTIVQKQIVFPRAAYAGS  792

Query  964   ATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSCF  785
              T+VC LLFLPF+IA+ EEL     +++   S    E+              K    S F
Sbjct  793   VTVVCVLLFLPFVIAIREELTFWNLERQHDNSPTEEEE--------------KPNSSSFF  838

Query  784   GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIG  605
              N+FKKP RGEDY+ILQALLS+DML LF+   CG G SL AIDNLGQIG +LGYP RTI 
Sbjct  839   ANVFKKPPRGEDYTILQALLSIDMLTLFLATMCGLGSSLTAIDNLGQIGGALGYPTRTIS  898

Query  604   TFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYG  425
             +FVSLVSIWNYFGRVFSGFVSE ++ +WK+PR LM+T +L+L C G L++AFP PGS+Y 
Sbjct  899   SFVSLVSIWNYFGRVFSGFVSEILIAKWKVPRPLMLTLTLVLLCVGHLMIAFPAPGSIYV  958

Query  424   ASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEA  245
             AS+ +GF+YG QLTL+F IISELFGLKYY+TLFNCGQLA+P+G+Y+LNVK+ G  YD EA
Sbjct  959   ASVFIGFAYGAQLTLIFAIISELFGLKYYATLFNCGQLATPIGTYVLNVKVTGMFYDQEA  1018

Query  244   VKQVAARG-----VGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYK  80
             +K++A +G     V EL C+G QCYK SFI+LA   LFGA VS++LV RT  +Y+ DIYK
Sbjct  1019  LKELAKKGMTRSSVKELICIGVQCYKKSFIILAAGTLFGAAVSMILVIRTQEFYRGDIYK  1078

Query  79    RFRDEMGA  56
             +FR++  A
Sbjct  1079  KFREQADA  1086


 Score =   259 bits (662),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = -1

Query  769  KPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSL  590
            KP RGEDY+ILQALLS+DM +LF+    G G SL AIDNLGQIGESLGYP +TI +FVSL
Sbjct  243  KPPRGEDYTILQALLSIDMSILFLATLFGLGSSLTAIDNLGQIGESLGYPTKTISSFVSL  302

Query  589  VSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLIL  410
            VSIWN+FGRVF+GF+SE +V +WK PRTLM+T  LLL C G L++AFP  GSVY AS+IL
Sbjct  303  VSIWNFFGRVFAGFLSEALVAKWKFPRTLMLTLVLLLLCVGHLMIAFPISGSVYVASVIL  362

Query  409  GFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVA  230
            GFS+G QLTLLF IISELFGLKYYSTLFNCGQLASPLG+Y+LNVKI G  YD EA+K++A
Sbjct  363  GFSFGAQLTLLFTIISELFGLKYYSTLFNCGQLASPLGTYVLNVKITGMFYDNEALKELA  422

Query  229  ARGVGELT  206
             +     T
Sbjct  423  KKEPDNFT  430


 Score =   236 bits (601),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + RGRWF ++ASFLIM GAGATYLFG+YSKEIK+++GYDQSTLNL+G FKD+GAN
Sbjct  101   RFAVHVIRGRWFSVYASFLIMVGAGATYLFGIYSKEIKSSMGYDQSTLNLIGFFKDLGAN  160

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV +GLIAEVTPTWFVLLVGSA+NF+G+F+IWL+VT +IAKPKVWQ+C YICVGANSQN
Sbjct  161   VGVPAGLIAEVTPTWFVLLVGSALNFSGFFMIWLAVTGQIAKPKVWQICAYICVGANSQN  220

Query  1321  FANTGALVTCVKNFPASRG  1265
             FANTGALVT VKNFP SRG
Sbjct  221   FANTGALVTSVKNFPESRG  239



>emb|CAN72050.1| hypothetical protein VITISV_016339 [Vitis vinifera]
Length=561

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/532 (61%), Positives = 408/532 (77%), Gaps = 16/532 (3%)
 Frame = -1

Query  1621  MAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLIAEVTPTWFVLLV  1442
             MAGAGATYL+GVYSK+IKA LGYDQSTLNLL S KD+GANVG+ +GL+AEV PTW +LLV
Sbjct  1     MAGAGATYLYGVYSKDIKARLGYDQSTLNLLASMKDLGANVGIPAGLLAEVAPTWVILLV  60

Query  1441  GSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALVTCVKNFPASRGM  1262
             GS MNF GYFLIWL+V  +I KP VW MC+YIC+GANSQNF+NTGALVTCVKNFP +RGM
Sbjct  61    GSIMNFGGYFLIWLAVVXKIPKPAVWHMCVYICLGANSQNFSNTGALVTCVKNFPEARGM  120

Query  1261  MLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIPSIRPMKISSHPN  1082
             MLGLMKGFVGLSGA+FTQLY AIYGNDS ++ILLIGWLP+++SIVF+ ++RPMK S+HP 
Sbjct  121   MLGLMKGFVGLSGALFTQLYYAIYGNDSTSMILLIGWLPSVISIVFLTTLRPMKASTHPR  180

Query  1081  ETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLFLPFLIAVMEELA  902
                V ++ + +++ LA  LMGL IAQK V+FS  AYI  A  V  L+ LPF IAV EEL 
Sbjct  181   VLNVLYQNMYVTVALAAFLMGLIIAQKQVQFSQTAYIGSAIAVIVLILLPFGIAVREELL  240

Query  901   TRKEKKKQLLSSENV----------EDppppaeniekaeeekAGDYSCFGNIFKKPKRGE  752
               +EKK+ + +  ++          E P    +  ++  +E+   YSC  N+  KP RGE
Sbjct  241   VWREKKQPVAAPTDIVIAKESKTLPESPQTDTQKEKEGAKEEMPCYSC-TNVCNKPSRGE  299

Query  751   DYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNY  572
             DYSI QALLS DM+++F+   CG GC+L  ++NLGQIGESLGY   TIG  VSL SIW +
Sbjct  300   DYSIFQALLSTDMIIMFVAMCCGLGCNLTTMNNLGQIGESLGYKKNTIGISVSLASIWGF  359

Query  571   FGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGV  392
             FGRVF+GF+SET++ + K+PRTL MT  LLL   G L++ FPFP SVY ASL++GFS+G 
Sbjct  360   FGRVFTGFISETLLLKKKVPRTLFMTIFLLLSAVGQLMIXFPFPNSVYIASLVVGFSHGA  419

Query  391   QLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARGVG-  215
             QLTL+F ++SELFGLKYYSTLFNCGQL++PLGSY+L+V +VG+LYD EA+KQ+  + V  
Sbjct  420   QLTLVFTVVSELFGLKYYSTLFNCGQLSAPLGSYVLSVLVVGKLYDREAIKQLGQKSVKR  479

Query  214   ----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFR  71
                 ELTC+GT+CYK+S+++LA  N+F A VSL+LV RT  +Y  DIYK+FR
Sbjct  480   SMTEELTCIGTKCYKISYLILACTNVFAAFVSLILVCRTRKFYSGDIYKKFR  531



>ref|XP_006491715.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Citrus 
sinensis]
Length=609

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/540 (59%), Positives = 395/540 (73%), Gaps = 6/540 (1%)
 Frame = -1

Query  1657  GRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLI  1478
             GRWFM+FAS LIMA AGATY+FG+YS +IK +LGYDQSTLNLL   KDVG NVGVLSGLI
Sbjct  27    GRWFMVFASLLIMAVAGATYMFGLYSSDIKTSLGYDQSTLNLLSFSKDVGGNVGVLSGLI  86

Query  1477  AEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALV  1298
              E+TP W VL +GS MNF+GYF+IWL+VT RI KP+VWQMCLYIC+GANSQ+FANTGALV
Sbjct  87    NEITPPWVVLAIGSIMNFSGYFMIWLAVTGRIPKPQVWQMCLYICIGANSQSFANTGALV  146

Query  1297  TCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIP  1118
             TCVKNFP SRG +LGL+KGFVGLSGA+ TQLY A YG++S+ LILLI WLPA +S VF+ 
Sbjct  147   TCVKNFPESRGSVLGLLKGFVGLSGAILTQLYHAFYGDNSKALILLIAWLPAAISFVFLR  206

Query  1117  SIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLF  938
             + R +KI    NE K+F++ L IS+ LA  LM + I Q    F  F Y+  A++V  LLF
Sbjct  207   TFRIIKIVRQANELKIFYKMLYISLGLAGFLMVVIILQNKYAFKRFEYVGSASLVLILLF  266

Query  937   LPFLIAVMEELATRKEKKKQLL-SSENVEDppppaeniekaeeekAGDYSCFGNIFKKPK  761
             LP  I + EE++ RK KK  L  ++ + E         ++A         C  NIFK P 
Sbjct  267   LPIAIVIKEEISVRKSKKPSLEDANSHPELKIVTELPPQQASPSTEAQVCCTENIFKPPD  326

Query  760   RGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSI  581
             RGEDY+ILQAL S+DML++FI   CG G +L AIDNLGQI  SLGYP R+  TFVSLVSI
Sbjct  327   RGEDYTILQALFSIDMLIIFIATTCGVGGTLTAIDNLGQISSSLGYPARSTTTFVSLVSI  386

Query  580   WNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFS  401
             WNY GRV +GF SE ++K++KIPR L+ TF LL  C G   +A+  P S+Y AS+I+GF 
Sbjct  387   WNYLGRVVAGFASEILLKKYKIPRPLLFTFVLLFSCVGHPFIAYGIPNSLYAASVIIGFC  446

Query  400   YGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARG  221
             +G Q  LLF IISE+FGLKYYSTL+N G +ASP+G+YILNVK+ G+LYD EA+ Q+ A G
Sbjct  447   FGAQWPLLFAIISEIFGLKYYSTLYNFGAVASPVGAYILNVKVAGQLYDKEALNQMEALG  506

Query  220   V-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             +      +LTC G QCYK++FI++    LFG LVS++LV RT  +YK DIYK+FR+E  A
Sbjct  507   ITRQAGQDLTCNGVQCYKMAFIIITTATLFGCLVSVILVIRTNKFYKGDIYKKFREEAKA  566



>ref|NP_181454.1| major facilitator protein [Arabidopsis thaliana]
 gb|AAL31925.1|AF419593_1 At2g39210/T16B24.15 [Arabidopsis thaliana]
 gb|AAC28987.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEC09646.1| major facilitator protein [Arabidopsis thaliana]
Length=601

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/562 (56%), Positives = 410/562 (73%), Gaps = 24/562 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWFM F S LIM+ AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  9     SMKSLTIQILTGRWFMFFGSLLIMSTAGATYMFGIYSGDIKETLGYDQTTLNLLSFFKDL  68

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GL+ EVTP WF+LL+G+ +NF GYF+IWL+VT+RI+KP+VW MCLYICVGAN
Sbjct  69    GANVGVLAGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTERISKPQVWHMCLYICVGAN  128

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D++ LIL+IGW
Sbjct  129   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRAFYGEDTKELILMIGW  188

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPAI+S  F+ +IR MK+    NE KVF+ +L IS+ LA  LM + I  K   F+   + 
Sbjct  189   LPAIVSFAFLRTIRIMKVKRQTNELKVFYNFLYISLGLATFLMVVIIINKLSGFTQSEFG  248

Query  970   ACATIVCALLFLPFLIAVMEELATRKEK---------------KKQLLSSENVEDppppa  836
               A +V  LL LP ++ ++EE    KEK               K +L SSE  +D    +
Sbjct  249   GSAAVVIVLLLLPIIVVILEEKKLWKEKQVALNDPAPINVVTEKPKLDSSEFKDDDGEES  308

Query  835   eniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAID  656
             + + +  +      SC+  +F  P+RG+DY+ILQAL SVDML+LF+   CG G +L AID
Sbjct  309   KEVVEKVKTP----SCWTTVFNPPERGDDYTILQALFSVDMLILFLATICGVGGTLTAID  364

Query  655   NLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLP  476
             NLGQIG SLGYP R++ TFVSLVSIWNY+GRV SG VSE  + ++K PR LM+T  LLL 
Sbjct  365   NLGQIGNSLGYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLS  424

Query  475   CAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLG  296
             CAG LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+G
Sbjct  425   CAGHLLIAFNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIG  484

Query  295   SYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVS  131
             SY+LNV++ G LYD EA KQ  A G       +L C+GT C+K+SFI++A V LFG LVS
Sbjct  485   SYLLNVRVAGYLYDVEAGKQYKALGKTRVEGQDLNCIGTSCFKLSFIIIAAVTLFGVLVS  544

Query  130   LVLVARTAAYYKTDIYKRFRDE  65
             +VLV RT  +YK+DIYK+FR++
Sbjct  545   MVLVIRTKKFYKSDIYKKFREK  566



>ref|XP_006436518.1| hypothetical protein CICLE_v10030988mg [Citrus clementina]
 ref|XP_006485321.1| PREDICTED: uncharacterized protein LOC102627686 [Citrus sinensis]
 gb|ESR49758.1| hypothetical protein CICLE_v10030988mg [Citrus clementina]
Length=611

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/566 (56%), Positives = 407/566 (72%), Gaps = 25/566 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             NM++   Q+  GRWFM+FASFLIMA AGATY+F +YS +IK  LGYDQ+TLNLL  FKD+
Sbjct  24    NMKSLAIQVITGRWFMVFASFLIMAAAGATYMFSLYSGDIKYALGYDQTTLNLLSFFKDL  83

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVG+LSGLI E+TP W VL++G+ +NF GYF+IWL+VTK+IA+P+VW MCLYICVGAN
Sbjct  84    GANVGILSGLINEITPPWVVLVLGAVLNFFGYFMIWLAVTKKIARPQVWHMCLYICVGAN  143

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A+YG+D+++LIL IGW
Sbjct  144   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRALYGDDTKSLILFIGW  203

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR +K+   PNE KVF+ +L IS+ LA  LM + I +K   F+   Y 
Sbjct  204   LPAAISFAFLRTIRILKVIRQPNELKVFYNFLYISLALAGFLMMIIIVEKQTDFTRSEYG  263

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLS-----------------SENVEDppp  842
               A IV  LLF P ++ V+EE    K K+  L +                 S N+E    
Sbjct  264   VSAAIVMFLLFFPLVVVVIEEFKLWKSKQMALNNPSVEIITEKPSQEVHSPSSNLEQTVS  323

Query  841   paen---iekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCS  671
              A     +       + + SC+   F  P RGEDY+ILQAL S+DML+LF    CG G +
Sbjct  324   VAAAPEEVSSGSTSSSKEPSCWTTCFSPPDRGEDYTILQALFSLDMLILFFATICGVGGT  383

Query  670   LAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTF  491
             L AIDNLGQIG SLGYP ++I TFVSLVSIWNY GRV SGFVSE  + ++K PR LM+T 
Sbjct  384   LTAIDNLGQIGGSLGYPKKSISTFVSLVSIWNYLGRVVSGFVSEIFLAKYKFPRPLMLTI  443

Query  490   SLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQL  311
              LLL C G LL+AF  PG +Y AS+I+GF +G Q  L+F IISELFGLKYYSTL+N G  
Sbjct  444   ILLLSCIGHLLIAFNVPGGLYVASIIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGS  503

Query  310   ASPLGSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLF  146
             ASPLGSY+LNV++ G LYD EA +Q+AA G+     G+LTC+G +C+K+SFI++    LF
Sbjct  504   ASPLGSYLLNVRVAGHLYDKEAKRQMAASGITRKKGGDLTCIGVECFKLSFIIITAATLF  563

Query  145   GALVSLVLVARTAAYYKTDIYKRFRD  68
             GA +SL+LV RT  +YK+DIYK+FR+
Sbjct  564   GAFISLILVLRTKKFYKSDIYKKFRE  589



>ref|XP_010243234.1| PREDICTED: uncharacterized protein LOC104587357 [Nelumbo nucifera]
Length=633

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/571 (55%), Positives = 402/571 (70%), Gaps = 26/571 (5%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             ++ +   ++  GRWFM+FASFLIM+ AGATY+F +YS +IK TLGYDQ+TLNLL   KDV
Sbjct  19    DVRSLTARILLGRWFMVFASFLIMSAAGATYMFALYSNDIKTTLGYDQTTLNLLSFAKDV  78

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVG+LSGLI E+TP W VL++G+ MNF GYF+IWL+VT+RIA+P+VWQMCLYIC+GAN
Sbjct  79    GANVGILSGLINEITPPWVVLVIGAIMNFGGYFMIWLAVTERIARPQVWQMCLYICIGAN  138

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ FANTG+LVTCVKNFP SRG++LGL+KGFVGLSGA+ TQLY A+YGN+++ LIL IGW
Sbjct  139   SQTFANTGSLVTCVKNFPESRGIVLGLLKGFVGLSGAIITQLYHALYGNNTKALILFIGW  198

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ ++R MK+   PNE KVF+++L IS+ LA  LM + I QK   F+ + + 
Sbjct  199   LPAAISFAFVRTVRIMKVIRQPNELKVFYKFLYISLGLAGFLMVIIIVQKRFDFNQYEFG  258

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQL------------------LSSENVEDpp  845
               A  V  LLFLP  +   EE+   K K++ L                  + +E V+   
Sbjct  259   GSAAAVLFLLFLPVAVIAKEEIELWKSKRQPLRGNSPRLEVTVEKPPAPVVEAEPVKPAA  318

Query  844   pp---aeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGC  674
                                 SC   +F+ P RGEDYSILQAL+S+DML+LF    CG G 
Sbjct  319   AELPPVAPPPNPLPVSQKSASCLSTMFRPPNRGEDYSILQALVSIDMLVLFFSTICGVGG  378

Query  673   SLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMT  494
             +L AIDNLGQIG+SLGYP R+  TF+SLVSIWNY GRV SGF SE  +K++K PR LM+T
Sbjct  379   TLTAIDNLGQIGQSLGYPSRSTSTFISLVSIWNYLGRVASGFASEIFLKKYKFPRPLMLT  438

Query  493   FSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQ  314
               LLL C G LL+AF  PGS+Y AS+I+GF +G Q  L+F IISE+FGLKYYSTL+N G 
Sbjct  439   MVLLLSCVGHLLIAFGVPGSLYVASVIIGFCFGAQWPLVFAIISEIFGLKYYSTLYNFGG  498

Query  313   LASPLGSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNL  149
              ASP+G YILNV++ G LYD EA KQ+A  G       EL+C G QCY++SFI++  V L
Sbjct  499   AASPVGLYILNVRVAGHLYDREARKQMAGSGTTRTAGKELSCTGVQCYQLSFIIITTVTL  558

Query  148   FGALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
              GA VSL+LV RT  +YK+DIYK+FR+E  A
Sbjct  559   LGAFVSLILVVRTRKFYKSDIYKKFREEARA  589



>ref|XP_010103517.1| putative transporter MCH1 [Morus notabilis]
 gb|EXB96177.1| putative transporter MCH1 [Morus notabilis]
Length=593

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/548 (59%), Positives = 407/548 (74%), Gaps = 13/548 (2%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             Q+  GRWFM+FAS LIM+ AGATY+FG+YS EIK  LGYDQ+TLNLL  FKD+G+NVGVL
Sbjct  23    QVLTGRWFMVFASLLIMSAAGATYMFGLYSSEIKEVLGYDQTTLNLLSFFKDLGSNVGVL  82

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SGLI EVTP W VL VG+ +NF GYF+IWL+V+KRIA PKVW MCLYIC+GANSQ+FANT
Sbjct  83    SGLINEVTPPWVVLSVGAVLNFFGYFMIWLAVSKRIATPKVWHMCLYICIGANSQSFANT  142

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             G+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A+YG+D ++LILLIGWLPA +S 
Sbjct  143   GSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHALYGDDLKSLILLIGWLPAAISF  202

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
              F+ +IR MK+    NE KVF+  L IS+ LA  LM + I QK V F+   Y A A +V 
Sbjct  203   AFLRTIRYMKVIRQANELKVFYNLLYISLGLAGFLMIMIIIQKQVVFTGAEYGASAAMVI  262

Query  949   ALLFLPFLIAVMEELATRKEKKKQLLSS--ENVEDpppp------aeniekaeeekAGDY  794
              LLFLP  + V+EE    + KK  + ++  E  E    P      A   +++E E   + 
Sbjct  263   FLLFLPMTVVVLEEYKLYQSKKFDINNNDPERTESLSLPPPPQNGAVTEKESEPETEPEP  322

Query  793   SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPR  614
             SC+  +F+ P RGED++ILQAL SVDML+LF    CG G +L AIDNLGQIG SLGYP R
Sbjct  323   SCWTTVFQPPNRGEDFTILQALFSVDMLILFCSCICGVGGTLTAIDNLGQIGTSLGYPKR  382

Query  613   TIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGS  434
             TI TFVSLVSIWNY GRVFSGFVSE  +KR+K PR LM+T  +LL C G LL+AF   G 
Sbjct  383   TISTFVSLVSIWNYLGRVFSGFVSEIFLKRYKFPRPLMLTLIMLLSCVGHLLIAFDVSGG  442

Query  433   VYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYD  254
             +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N G +ASP+G Y+LNV++ G LYD
Sbjct  443   LYAASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGLYVLNVRLTGHLYD  502

Query  253   GEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
              EA +Q+  +G+      +L C G +C+++SFI++A V LFG+LVSL+LV RT  +YK+D
Sbjct  503   KEAKRQMEIKGLVRKAGEQLNCDGVKCFQLSFIIIAAVALFGSLVSLILVVRTRKFYKSD  562

Query  88    IYKRFRDE  65
             IYK+FR+E
Sbjct  563   IYKKFREE  570



>gb|KDP29179.1| hypothetical protein JCGZ_16568 [Jatropha curcas]
Length=618

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/551 (56%), Positives = 396/551 (72%), Gaps = 7/551 (1%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             + M+ F  ++  GRWFM+FAS LIMA AGATY+FG+YS +IK +LGYDQ+TLNLL  FKD
Sbjct  14    REMKGFFLKMILGRWFMVFASILIMAVAGATYMFGLYSNDIKTSLGYDQTTLNLLSFFKD  73

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G NVGVLSGLI EVTP W VL +G+ MNF GYF+IWL+VT  I KPKVWQMCLYIC+GA
Sbjct  74    LGGNVGVLSGLINEVTPPWVVLSIGAIMNFFGYFMIWLAVTGHIPKPKVWQMCLYICIGA  133

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FANTGALVTCVKNFP SRG +LGL+K FVGLSGA+FTQ+Y A+YG DS++LILLI 
Sbjct  134   NSQAFANTGALVTCVKNFPESRGAVLGLLKSFVGLSGAIFTQIYHALYGYDSKSLILLIA  193

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S +F+ +IR +++    NE K+F++ L IS+ LA  LM L I Q    F+   Y
Sbjct  194   WLPAAISFIFLRTIRIIEVVRQANELKIFYKLLYISLGLAGFLMVLIIMQNKFNFTRIEY  253

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE--DppppaeniekaeeekAG  800
             I  ++IV  LLFLP ++ + EE   RK KK  L +  +++      P+     +      
Sbjct  254   IGSSSIVLLLLFLPIVVVIKEEYHVRKSKKAALANQSSIKVITQENPSSVEVSSSSPPRA  313

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SC  NIF  P RGEDY+ILQAL SVDML+LFI   CG G +L A+DNLGQIG SLGYP
Sbjct  314   QPSCTNNIFNPPNRGEDYTILQALFSVDMLILFIATTCGVGGTLTAVDNLGQIGNSLGYP  373

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
               +  TFVSLVSIWNY GR  +GF SE ++ ++KIPR L+ T  LL  C G LL+AF  P
Sbjct  374   SHSTTTFVSLVSIWNYLGRAVAGFASEFLLTKYKIPRPLLFTLVLLFSCVGHLLIAFGVP  433

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
              S+Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSYILNV++ G L
Sbjct  434   NSLYFASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPVGSYILNVRVAGHL  493

Query  259   YDGEAVKQVAARGVGE-----LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA+KQ+   G+       LTC G QCYK++F+++    LFG ++S +LV RT  +Y+
Sbjct  494   YDKEALKQIEGLGLKREAGKYLTCSGVQCYKMAFLIITAATLFGCVISSILVVRTRKFYQ  553

Query  94    TDIYKRFRDEM  62
              DIYK+FR+++
Sbjct  554   GDIYKKFREQV  564



>ref|XP_007010014.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY18824.1| Major facilitator superfamily protein [Theobroma cacao]
Length=624

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/569 (56%), Positives = 406/569 (71%), Gaps = 24/569 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             NM++F  Q+  G W M+F S LIM+ AGATY+F +YS EIK +LGYDQ+TLNLL  FKD+
Sbjct  13    NMKSFGVQILTGPWLMVFGSLLIMSAAGATYMFSLYSNEIKKSLGYDQTTLNLLSFFKDL  72

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G NVGVLSGLIAEVTP WFVL VG+ +NF GYF+IW++V+KRIA+ +VW MCLYIC+GAN
Sbjct  73    GTNVGVLSGLIAEVTPPWFVLSVGAVLNFFGYFMIWMAVSKRIARTQVWHMCLYICIGAN  132

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG+DS++LILLIGW
Sbjct  133   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGDDSKSLILLIGW  192

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA++S+ F+ +IR MK++   NE KVF+++L IS+ LA  LM + I +K   F+   Y 
Sbjct  193   LPAVISLCFVRTIRIMKVAHQANEVKVFYKFLYISLGLASFLMIIIIVEKKFLFTRPEYG  252

Query  970   ACATIVCALLFLPFLIAVMEE----------------LATRKEKKKQLLSSENVEDpppp  839
               A +V  LLFLP  + +MEE                L    EK    +S EN E     
Sbjct  253   GSAAMVLFLLFLPLGVVIMEEYKLWEAKNRALNDPSPLKIVTEKPSSEVSLENTEAHSSS  312

Query  838   aeniekaeeekAGDY---SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSL  668
             +     A  E + D    SC+   F  P RG+DY+ILQAL S+DML+LF+   CG G +L
Sbjct  313   STAKILANNESSHDQANVSCWKTAFNPPNRGDDYTILQALFSLDMLILFLATTCGIGGTL  372

Query  667   AAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFS  488
              AIDNLGQIG SLGYP R+I TFVSLVSIWNY GRV +GFVSE  + ++K PR LM+T  
Sbjct  373   TAIDNLGQIGTSLGYPKRSISTFVSLVSIWNYLGRVTAGFVSEIFLAKYKFPRPLMLTLI  432

Query  487   LLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLA  308
             +L  C G LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +A
Sbjct  433   MLFSCVGHLLIAFGVPGGLYIASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVA  492

Query  307   SPLGSYILNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFG  143
             SP+GSYILNVK+ G LYD EA KQ+AA    R  GE L C G +C+K+SFI++A   LFG
Sbjct  493   SPIGSYILNVKVAGNLYDREAKKQMAALGLKRKAGEDLDCNGVECFKLSFIIIAAATLFG  552

Query  142   ALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
              +V+ +L  RT  +YK+DIYK+FR+E  A
Sbjct  553   TVVAFLLALRTRKFYKSDIYKKFREEAKA  581



>gb|KDP30491.1| hypothetical protein JCGZ_16170 [Jatropha curcas]
Length=608

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/569 (55%), Positives = 403/569 (71%), Gaps = 27/569 (5%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+N   Q+  GRWFM+FASFLIMA AGATY+F +YS +IK  LGYDQ+T+ LL  FKD+
Sbjct  21    DMKNLTVQVITGRWFMVFASFLIMAAAGATYMFALYSNDIKTALGYDQTTITLLSFFKDL  80

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVLSGLI EVTP W VL +G+ +NF GYF+IWL+VT++I+   VW MCLYIC+GAN
Sbjct  81    GANVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTRKISGVHVWHMCLYICIGAN  140

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQ+Y A+YG+DS++LILLIGW
Sbjct  141   SQAFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQIYHAVYGDDSKSLILLIGW  200

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+   PNE KVF+ +L IS+ LA  LM + I QK ++F+   Y 
Sbjct  201   LPAAISFAFLRTIRIMKVIRQPNELKVFYNFLYISLGLAAFLMIIIILQKRLQFTRSEYG  260

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaee-------  812
             A A +V  LLFLP  I ++EE    + KK   L+S N             A         
Sbjct  261   ASAAMVLFLLFLPLAIVLIEEYKIWQNKK---LASNNPSPLKIITTEENTATATDTVTVT  317

Query  811   ------------ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSL  668
                             + SC+   FK P RGEDY+ILQAL S+DML+LF+   CG G +L
Sbjct  318   AATASTAASSGNVIDENVSCWKTAFKPPNRGEDYTILQALFSIDMLVLFLSTICGVGGTL  377

Query  667   AAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFS  488
              AIDNLGQIG SL YP R+I TFVSLVSIWNY GRV +GF SE  + ++K PR LM+T  
Sbjct  378   TAIDNLGQIGTSLEYPKRSISTFVSLVSIWNYLGRVVAGFASEHFLSKYKFPRPLMLTLI  437

Query  487   LLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLA  308
             LL  C G LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +A
Sbjct  438   LLFSCVGHLLIAFNVPGGLYVASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGVA  497

Query  307   SPLGSYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFG  143
             SP+GSY+L+V++ G+LYD EA KQ+AA+G+      EL+C+GT+C+K+SFI++  V LFG
Sbjct  498   SPIGSYVLSVRVAGQLYDIEANKQLAAKGLKRQHGQELSCIGTECFKLSFIIITAVTLFG  557

Query  142   ALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
               VSL+LV RT  +YK+DIYK+FR+   A
Sbjct  558   TFVSLILVLRTRKFYKSDIYKKFREAAQA  586



>gb|KFK36814.1| hypothetical protein AALP_AA4G174900 [Arabis alpina]
Length=591

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/546 (57%), Positives = 396/546 (73%), Gaps = 11/546 (2%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             Q+  GRWFM FAS L+M+ AGATY+FG+YS +IK  LGYDQ+TLNLL  FKD+GANVGVL
Sbjct  17    QIITGRWFMFFASLLVMSTAGATYMFGIYSADIKGNLGYDQTTLNLLSFFKDLGANVGVL  76

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             +GLI EVTP WFVL +G+ +NF GYF+IWL+VTKRI+KP+VW MCLYICVGANSQ+FANT
Sbjct  77    AGLINEVTPPWFVLAIGAVLNFFGYFMIWLAVTKRISKPQVWHMCLYICVGANSQSFANT  136

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             GALVTCVKNFP SRG +LG++KG+VGLSGA+ TQL+ A+YG+D+++LILLIGWLPA +S 
Sbjct  137   GALVTCVKNFPESRGTILGILKGYVGLSGAIITQLFRALYGDDTRSLILLIGWLPAAVSF  196

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
              F+ +IR MK+    +E KVF+ +L IS+ LA  LM + I  K   F+   Y   AT+V 
Sbjct  197   AFLRTIRLMKVVRQKDELKVFYNFLYISLGLATFLMVVIITDKLSGFTKSEYGGSATVVI  256

Query  949   ALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDY------SC  788
             ALL LP ++ V+EE     EK+  L     +            +E +   D       SC
Sbjct  257   ALLLLPIIVVVLEEKKLWTEKQVALNDPAPIRVVTEKPIIDSSSEVKHDDDESKVKTASC  316

Query  787   FGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTI  608
             +  +F  P+RG+DY+ILQAL SVDM++LF+   CG G +L AIDNLGQIG S GY  +++
Sbjct  317   WTTMFSPPERGDDYTILQALFSVDMMILFLATICGVGGTLTAIDNLGQIGGSFGYSKKSV  376

Query  607   GTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVY  428
              TFVSLVSIWNYFGRV SG VSE  + ++K PR LM+T  LL  CAG LL+AF  PG +Y
Sbjct  377   STFVSLVSIWNYFGRVVSGVVSEIFLIKYKFPRPLMLTMILLFSCAGHLLIAFNIPGGLY  436

Query  427   GASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGE  248
              AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSY+LNV++ G LYD E
Sbjct  437   VASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRVAGYLYDVE  496

Query  247   AVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIY  83
             A KQ  A G       +L C+GT C+K+SFI++  V LFG LVS++LV RT  +YK+DIY
Sbjct  497   AEKQYKALGKTREEGKDLDCIGTACFKLSFIIITAVTLFGVLVSMILVIRTRKFYKSDIY  556

Query  82    KRFRDE  65
             K+FR+ 
Sbjct  557   KKFRER  562



>ref|XP_006381386.1| hypothetical protein POPTR_0006s12430g [Populus trichocarpa]
 gb|ERP59183.1| hypothetical protein POPTR_0006s12430g [Populus trichocarpa]
Length=610

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/565 (57%), Positives = 398/565 (70%), Gaps = 22/565 (4%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             + M+ F  Q+  GRWFM+FASFLIMA +GATY+F +YS +IK +LGYDQSTLNLL  FKD
Sbjct  19    REMKRFGLQVLLGRWFMVFASFLIMAMSGATYMFSLYSTDIKRSLGYDQSTLNLLSFFKD  78

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             VG NVG+L G+I EV+P W +L  G  MNF GYF+IWL++T +IAKPKVWQMCLYIC+GA
Sbjct  79    VGGNVGLLPGVINEVSPPWVILSAGVVMNFFGYFMIWLAITGKIAKPKVWQMCLYICIGA  138

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FA TGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQ+Y A YG+DS+  ILLI 
Sbjct  139   NSQTFATTGALVTCVKNFPESRGSVLGLLKGFVGLSGAIMTQVYHAFYGDDSKAFILLIA  198

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S +F+ +IR MKI    NE KVF++ L IS+ LA  LM L I Q   RF+   Y
Sbjct  199   WLPAAVSFIFLRTIRIMKIVRQANEIKVFYQLLYISLGLAGFLMILIIIQNKFRFTRIEY  258

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKK-------KQLLSSENVEDp----------p  845
             I  A +V  LLFLP  +A+ EE    K KK       +  + +EN  +            
Sbjct  259   IGGAIVVLILLFLPVAVAIKEEYDIWKSKKVVFSDPSQVKIVTENPPEVELPLSTQPPES  318

Query  844   ppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLA  665
              P+   + A        SCF NIFK P+RGEDY+ILQAL S+DML+LFI   CG G +L 
Sbjct  319   LPSNASDPAATSAEKQTSCFENIFKPPERGEDYTILQALFSLDMLVLFIAATCGIGGTLT  378

Query  664   AIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSL  485
             A+DNLGQIG SLGYP R+I TFVSLVSIWNY GRV SGF SE ++K++KIPR L+++  L
Sbjct  379   AVDNLGQIGHSLGYPSRSITTFVSLVSIWNYLGRVVSGFASEILLKKYKIPRPLLLSIVL  438

Query  484   LLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLAS  305
             L  CAG +L+AFP   S+Y AS+ILGF +G Q  L++ IISE+FGLKYYSTL+N G +AS
Sbjct  439   LFTCAGHILIAFPSSNSLYFASVILGFCFGAQWPLMYAIISEIFGLKYYSTLYNFGAVAS  498

Query  304   PLGSYILNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGA  140
             P+GSYILNV I G LYD EA KQ+ A    R  GE LTC G QCY++S I++    LFG+
Sbjct  499   PVGSYILNVVIAGDLYDKEASKQMKALGLKRNAGEDLTCNGVQCYRMSSIIITAATLFGS  558

Query  139   LVSLVLVARTAAYYKTDIYKRFRDE  65
               S +L  RT  +YK DIYK+FRDE
Sbjct  559   FASFILTLRTRKFYKGDIYKKFRDE  583



>ref|XP_011018791.1| PREDICTED: uncharacterized protein LOC105121728 [Populus euphratica]
Length=607

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/565 (57%), Positives = 396/565 (70%), Gaps = 22/565 (4%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             + M+ F  Q+  GRWFM+FASFLIMA +GATY+F +YS +IK +LGYDQSTLNLL  FKD
Sbjct  16    REMKRFGLQVLLGRWFMVFASFLIMAMSGATYMFSLYSTDIKTSLGYDQSTLNLLSFFKD  75

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             VG NVG+L G+I EV+P W +L  G  MNF GYF+IWL++T +IAKPKVWQMCLYIC+GA
Sbjct  76    VGGNVGLLPGVINEVSPPWVILSAGVVMNFFGYFMIWLAITGKIAKPKVWQMCLYICIGA  135

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FA TGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQ+Y A YG+DS+  ILLI 
Sbjct  136   NSQTFATTGALVTCVKNFPESRGSVLGLLKGFVGLSGAIMTQVYHAFYGDDSKAFILLIA  195

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S +F+ +IR MKI    NE KVF++ L IS+ LA  LM L I Q   RF+   Y
Sbjct  196   WLPAAVSFIFLRTIRIMKIVRQANEIKVFYQLLYISLGLAGFLMILIIIQNKFRFTRIEY  255

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKK-------KQLLSSENVEDppppaenie---  824
             I  A +V  LLFLP  +A+ EE    K KK       +  + +EN  +   P        
Sbjct  256   IGGAIVVLILLFLPVAVAIKEEYEIWKSKKVVFSDPSQVKIVTENPPEVELPLSTQPPES  315

Query  823   -------kaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLA  665
                              SCF NIFK P+RGEDY+ILQAL S+DML+LFI   CG G +L 
Sbjct  316   LPSNASGPVATSAEKQTSCFENIFKPPERGEDYTILQALFSLDMLVLFIAATCGIGGTLT  375

Query  664   AIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSL  485
             A+DNLGQIG SLGYP R+I TFVSLVSIWNY GRV SGF SE ++K++KIPR L+++  L
Sbjct  376   AVDNLGQIGHSLGYPSRSITTFVSLVSIWNYLGRVVSGFASEILLKKYKIPRPLLLSIVL  435

Query  484   LLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLAS  305
             L  C G +L+AFP   S+Y AS+ILGF +G Q  L++ IISE+FGLKYYSTL+N G +AS
Sbjct  436   LFTCVGHILIAFPSSNSLYFASVILGFCFGAQWPLMYAIISEIFGLKYYSTLYNFGAVAS  495

Query  304   PLGSYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGA  140
             P+GSYILNV I G LYD EA+KQ+ A G+      +LTC G QCY++S I++    LFG+
Sbjct  496   PVGSYILNVVIAGDLYDKEALKQMKALGLKRKEGEDLTCNGVQCYRMSSIIITAATLFGS  555

Query  139   LVSLVLVARTAAYYKTDIYKRFRDE  65
               SL+L  RT  +YK DIYK+FRDE
Sbjct  556   FASLILTLRTRKFYKGDIYKKFRDE  580



>emb|CDY44632.1| BnaC04g06300D [Brassica napus]
Length=577

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/546 (56%), Positives = 400/546 (73%), Gaps = 7/546 (1%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M++   Q+  GRWFM FAS LIM+ AGATY+FG+YS +IK  LGYDQ+TLNLL  FKD+G
Sbjct  1     MKSLAIQILTGRWFMFFASLLIMSAAGATYMFGLYSGDIKTALGYDQTTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVG+++GL+ EV+P WF L++G+ +NF GYF+IWL+VTKRI+KPKVW MCLYICVGANS
Sbjct  61    ANVGIIAGLLNEVSPPWFTLIIGAILNFFGYFMIWLAVTKRISKPKVWHMCLYICVGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q+FANTG++VTCVKNFP SRG +LG++KG+VGLSGA+ TQLY A YG+D+++LIL+IGWL
Sbjct  121   QSFANTGSIVTCVKNFPESRGFVLGILKGYVGLSGAIITQLYHAFYGDDTKSLILMIGWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             PA +S  F+ ++R MK+    NE KVF+ +L IS  LA  LM + IA K   F+   +  
Sbjct  181   PAAISFAFLWTVRNMKVVRQTNELKVFYNFLYISFGLATFLMVVIIADKLSGFTRSEFGG  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSC  788
              A +V  LL LP ++ V+EE   +  K KQ+  +          +N    + E     SC
Sbjct  241   SAAVVIVLLLLPIIVVVLEE--RKLWKDKQVAFNNPAPINIVKDDNERSTKVESVKTASC  298

Query  787   FGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTI  608
             +  IF  P+RG+DY+ILQAL SVDML+LF+   CG G +L AIDNLGQIG SLGYP R++
Sbjct  299   WTTIFSPPERGDDYTILQALFSVDMLILFLATICGAGGTLTAIDNLGQIGGSLGYPKRSV  358

Query  607   GTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVY  428
              TFVSLVSIWNYFGRV SG +SE  + ++K PR +M+T  LL  C G LL+AF  PG +Y
Sbjct  359   STFVSLVSIWNYFGRVTSGVLSEIFLIKYKFPRPIMLTMILLFSCTGHLLIAFNVPGGLY  418

Query  427   GASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGE  248
              AS+I+GF +G Q  LLF IISE+FGLKYYSTL N G +ASP+G+Y+LNV++ G LYD E
Sbjct  419   VASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLINFGSVASPIGAYLLNVRVAGYLYDKE  478

Query  247   AVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIY  83
             A KQ  A G+      +L+C+GT C+K+SFI++  V LFG LVS++LV RT  +YK+DIY
Sbjct  479   AEKQHKALGILRKEGQDLSCMGTACFKLSFIIITVVTLFGVLVSMILVVRTKKFYKSDIY  538

Query  82    KRFRDE  65
             KRFR++
Sbjct  539   KRFREK  544



>ref|XP_002268663.2| PREDICTED: uncharacterized protein LOC100248651 [Vitis vinifera]
Length=638

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/555 (57%), Positives = 392/555 (71%), Gaps = 20/555 (4%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             Q+  GRWFM+FAS LIM+ AGATY+F +YS EIK +LGYDQ+TLNLL  FKD+G NVGVL
Sbjct  21    QVLVGRWFMVFASLLIMSVAGATYMFSLYSGEIKTSLGYDQTTLNLLSFFKDLGGNVGVL  80

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SGLI EVTP W VL +G+ MNF GYF+IWL+VT RIAKP++WQMCLYIC+GANSQ+FANT
Sbjct  81    SGLINEVTPPWVVLCIGAVMNFFGYFMIWLAVTDRIAKPQIWQMCLYICIGANSQSFANT  140

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             GALVTCV+NFP SRG++LGL+KGFVGLSGA+ TQLY A YG+DS++LIL I WLPA +S 
Sbjct  141   GALVTCVRNFPESRGIVLGLLKGFVGLSGAIITQLYRAFYGDDSKSLILFIAWLPAAVSF  200

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
             VF+ +IR MK+    NE KVF++ L +S+ LA  LM + I Q    FS   Y   A +V 
Sbjct  201   VFLRTIRIMKVGRQANELKVFYDLLYMSLGLAGFLMVIIIIQNKFTFSRIEYSGSAAVVL  260

Query  949   ALLFLPFLIAVMEELATRKEKKKQL------LSSENVEDppppaeni---------ekae  815
              LLFLP  + + EE+   K KK+ L      + +EN       +  +           A 
Sbjct  261   ILLFLPLAVVIKEEINIWKGKKQALDAAQVKVITENPPAVELASSPVVSLDQLPPPTAAP  320

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
             E      SCF  +FK P RGEDY+ILQAL S+DML+LFI   CG G +L AIDNLGQIG 
Sbjct  321   ENAEKSVSCFKTMFKPPDRGEDYTILQALFSIDMLILFIVTTCGVGGTLTAIDNLGQIGS  380

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             S GY   +  TFVSLVSIWNY GRV SGF SE  + R+K PR LM+TF LL  C G LL+
Sbjct  381   SQGYTAHSTTTFVSLVSIWNYLGRVVSGFASEIFLTRYKFPRPLMLTFVLLFSCVGHLLI  440

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AF  P S+Y AS+I+GF +G Q  L+F IISELFGLKYYSTL+N G +ASP+GSYILNVK
Sbjct  441   AFAVPNSLYFASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGAVASPVGSYILNVK  500

Query  274   IVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             + G LYD EA+KQ+ A GV      +LTC G  CYK+SFI++    LFG ++S +LV RT
Sbjct  501   VAGHLYDKEALKQLEASGVTRVAGQDLTCTGAACYKLSFIIITAATLFGCIISFILVIRT  560

Query  109   AAYYKTDIYKRFRDE  65
               +Y+ DIYK+FR E
Sbjct  561   KKFYQGDIYKKFRQE  575



>ref|XP_009780392.1| PREDICTED: uncharacterized protein LOC104229438 [Nicotiana sylvestris]
Length=598

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/559 (55%), Positives = 402/559 (72%), Gaps = 17/559 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             NM +   Q+F GRWFM+FA+ LI++ +GATY+FG+YS +IK +LGYDQ+TLNLL  FKD+
Sbjct  14    NMRSLTLQVFTGRWFMVFATVLILSASGATYIFGIYSSDIKTSLGYDQTTLNLLSFFKDL  73

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGVLSGL+ EVTP W VL VG+ +NF GYF+IWL+VTK+I KPKVW MC+YIC+GAN
Sbjct  74    GSNVGVLSGLLNEVTPPWVVLSVGAVLNFFGYFMIWLAVTKKIPKPKVWHMCVYICIGAN  133

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTGALVTCVKNFP SRG +LGL+KG+VGLSGA+ TQ+Y AIYGN+S++LILLIGW
Sbjct  134   SQSFANTGALVTCVKNFPESRGAVLGLLKGYVGLSGAMLTQIYHAIYGNESKSLILLIGW  193

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA++S VF+  IR MK+    +E KVF+ +L IS+ LA  LM + I QK + F    Y 
Sbjct  194   LPAVVSFVFLRIIRIMKVVRIAHEMKVFYRFLYISLGLAGFLMLIIILQKRLDFKQSEYG  253

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLS------------SENVEDppppaeni  827
                 IV   L LP  I + EE+ + K KK+ L S            SE  +    P    
Sbjct  254   LSTAIVLFFLCLPLGIVIKEEVDSWKTKKQALESISQVKLVTEEPNSEVAQPQIQPQTPS  313

Query  826   ekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLG  647
                  +     SC+  +F+ P RGEDY+ILQ L S+DML+LF    CG G +L AIDNLG
Sbjct  314   SATISKNQETVSCWKTVFRAPDRGEDYTILQTLFSIDMLILFFATICGVGGTLTAIDNLG  373

Query  646   QIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAG  467
             QIG SLGYP  +I TFVSLVSIWNY GRV SGF+SE  + ++K PR LM+T +L++ C G
Sbjct  374   QIGTSLGYPKTSISTFVSLVSIWNYLGRVASGFLSEHFLSKYKFPRPLMLTITLIISCLG  433

Query  466   DLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI  287
              LL+AF   G +Y AS+++GF +G Q  LL+ IISELFGLKYYSTL+N G +ASP+G+Y+
Sbjct  434   HLLIAFDVRGGLYIASIVIGFCFGAQWPLLYAIISELFGLKYYSTLYNFGSVASPIGAYV  493

Query  286   LNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             LNV++ G LYD EA KQ+ A    R +GE L C+G +C+K++FI++  V + GALVS++L
Sbjct  494   LNVRLAGHLYDKEAEKQMKALGRSRKIGEDLECVGAECFKLAFIIITAVTILGALVSIIL  553

Query  121   VARTAAYYKTDIYKRFRDE  65
             V RT  +YK DIYK+FR+E
Sbjct  554   VLRTRNFYKNDIYKKFREE  572



>ref|XP_004240185.2| PREDICTED: uncharacterized protein LOC101262315 [Solanum lycopersicum]
Length=566

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/546 (55%), Positives = 399/546 (73%), Gaps = 5/546 (1%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M+    Q+F GRWFM+FA+ LI++ +GATY+FG+YS +IK +LGYDQ+TLNLL  FKD+G
Sbjct  1     MKKLTLQVFTGRWFMVFATILILSSSGATYIFGIYSTDIKTSLGYDQTTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
              NVG+LSGLI EVTP W VL  G+ +N  GY +IWLSVTK+I KPK+W MCLYICVG+NS
Sbjct  61    GNVGILSGLINEVTPPWVVLSFGAILNLFGYLMIWLSVTKKIPKPKIWHMCLYICVGSNS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q+FANTGALVTCVKNFP SRG +LGL+KG+VGLSGA+ TQ+Y AIYGN+S++LILLI WL
Sbjct  121   QSFANTGALVTCVKNFPESRGAVLGLLKGYVGLSGAMLTQIYHAIYGNESKSLILLIAWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             P+++S+VF+  IR MK+    +E KVF+++L  S+ LA  LM + I QK + F+   Y  
Sbjct  181   PSVVSLVFLRIIRVMKVIRVEHEMKVFYKFLYTSLGLAGFLMLVIILQKKMHFNQIEYGL  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSC  788
                IV  LL LP +I V EE  T K  K+ +     V +         +  + +  D SC
Sbjct  241   STLIVLFLLCLPLVIVVKEEFDTLKINKQSVSLVTEVTNTQLQMVIQSEIIQVQQHDVSC  300

Query  787   FGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTI  608
             +  +F+ P RGEDY+ILQ L S+DML+LF    CG G +L AIDNLGQIG SLGYP  +I
Sbjct  301   WKTVFRAPDRGEDYTILQTLFSIDMLILFFATICGVGGTLTAIDNLGQIGASLGYPKTSI  360

Query  607   GTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVY  428
              TFVSLVSIWNY GRV SGF+SE  + +++ PR LM+T +L++ C G LL+AF   G +Y
Sbjct  361   STFVSLVSIWNYLGRVVSGFLSEHFLTKYRFPRPLMLTITLVISCLGHLLIAFNVSGGLY  420

Query  427   GASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGE  248
              AS+++GF +G Q  LL+ IISELFGLKYYSTL+N G +ASP+G+Y+LNV++VG LYD E
Sbjct  421   VASIVIGFCFGAQWPLLYAIISELFGLKYYSTLYNFGSVASPIGAYLLNVRVVGYLYDKE  480

Query  247   AVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIY  83
             A +Q+ A    R +GE L C+G +C+K++F+++ GV + GA VS++LV RT  +YK DIY
Sbjct  481   ANRQIVAMGKIRKIGEDLECIGDECFKLAFLIITGVTILGAFVSIILVLRTRKFYKNDIY  540

Query  82    KRFRDE  65
             K+FR+E
Sbjct  541   KKFREE  546



>ref|XP_008362281.1| PREDICTED: uncharacterized protein LOC103425934 [Malus domestica]
Length=598

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/564 (58%), Positives = 405/564 (72%), Gaps = 18/564 (3%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
              N +    Q+  GRWFMMFAS LIM+ AGATY+FG+YS +IK  LGYDQSTLNLL  FKD
Sbjct  13    SNTKTLALQVLYGRWFMMFASLLIMSAAGATYMFGLYSGDIKDVLGYDQSTLNLLSFFKD  72

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G+NVGVLSGLI EVTP W VL VG  +NF GYF+IW++VTKRIA+P VWQMCLYIC+GA
Sbjct  73    LGSNVGVLSGLINEVTPPWVVLSVGGVLNFFGYFMIWMAVTKRIARPXVWQMCLYICIGA  132

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+FTQLY A Y ND++ LILLI 
Sbjct  133   NSQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIFTQLYSAFYYNDTKALILLIX  192

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S VF+  IR MK+  HPNE KVF+  L IS+ LA  LM + I QK V F+   Y
Sbjct  193   WLPAAISFVFLRIIRIMKVIRHPNEVKVFYNMLYISLGLAGFLMVMIIIQKNVHFTQGEY  252

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSS----------ENVEDppppaenie  824
              A AT+V  LL LP  + ++EE    + KK +L  S          E+ E+  P   +  
Sbjct  253   GASATMVIFLLVLPLAVVIIEEFKILEGKKLELNGSSDLKIVTEKPESEEESVPSDMSRP  312

Query  823   kaeeekAGDY---SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
             +            SC+  +F+ P RGEDY+ILQAL S+DML+LFI   CG G +L AIDN
Sbjct  313   REALATTTTETEPSCWKTMFRPPDRGEDYTILQALFSIDMLILFIACICGVGGTLTAIDN  372

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG SLGYP ++I TFVSLVSIWNY GRV SGF SE ++KR+K PR LM+T +LLL C
Sbjct  373   LGQIGASLGYPKQSISTFVSLVSIWNYLGRVVSGFGSEILLKRYKFPRPLMLTLTLLLSC  432

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              G LLVAF     +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N G  ASP+G 
Sbjct  433   VGHLLVAFNVKNGLYLASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSSASPVGL  492

Query  292   YILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             Y+LNV++ G +YD EA KQ+AA+G+      ELTC+G +C+K+SFI++A   LFG  VSL
Sbjct  493   YLLNVRLTGHVYDKEAKKQLAAKGLVRQAGKELTCVGGECFKLSFIIIAAATLFGTFVSL  552

Query  127   VLVARTAAYYKTDIYKRFRDEMGA  56
             +LV RT  +Y++DIYK+FR E  A
Sbjct  553   ILVMRTRKFYQSDIYKKFRQETEA  576



>ref|XP_003637404.1| Nitrate and chloride transporter [Medicago truncatula]
Length=596

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/554 (57%), Positives = 394/554 (71%), Gaps = 12/554 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q   GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQSTLNLL  FKD 
Sbjct  14    DMKSLTVQFITGRWFVIFASFLIMAAAGATYMFGLYSPDIKTTLGYDQSTLNLLSFFKDF  73

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGVLSGLI E+ P W VL +G+ +NF GYF+IWLSVTK+IA+P+VWQMCLYIC+GAN
Sbjct  74    GSNVGVLSGLINELYPPWVVLTIGAILNFFGYFMIWLSVTKKIARPQVWQMCLYICIGAN  133

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY AIY +D++ LIL IGW
Sbjct  134   SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYSAIYYDDTKALILFIGW  193

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK     NE KVF+ +L IS+ LA  L+ + I QK V FS   Y 
Sbjct  194   LPAAISFAFLRTIRYMKPVRQVNELKVFYNFLYISLGLAGFLLVMIIIQKKVSFSQSEYG  253

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE-------Dppppaeniekaee  812
               A +V  LLFLP  +  +EE    + KK  L+    V+              N   +  
Sbjct  254   LSAAVVIFLLFLPLAVVFIEENKIWQSKKLALVDPSPVKIVTEGETVTETEKVNSAVSVS  313

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
                 D   + ++F  P RGEDY+ILQAL S+DML+LF+   CG G +L AIDNLGQIG S
Sbjct  314   APKKDPKWWEDVFNPPARGEDYTILQALFSMDMLILFVACICGVGGTLTAIDNLGQIGTS  373

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             L YP ++I TFVSLVSIWNY GRVFSGFVSE  + +++ PR LM+T +L + C G LL+A
Sbjct  374   LRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLTKYRFPRPLMLTMTLFVSCVGHLLIA  433

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             F  P  +Y AS+I+GF +G Q  LLF IISELFGLKYY+TL+N G +ASPLG Y+LNVKI
Sbjct  434   FDVPEGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYVLNVKI  493

Query  271   VGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G LYD EA KQ+ A G       EL C+G  CYK+SFI++     FGA+VSL+LVART 
Sbjct  494   AGHLYDKEAKKQLEALGKQRIEGQELNCVGVDCYKLSFIIITAATFFGAVVSLILVARTR  553

Query  106   AYYKTDIYKRFRDE  65
              +YK DIYKR+R+E
Sbjct  554   KFYKGDIYKRYREE  567



>ref|XP_009143336.1| PREDICTED: uncharacterized protein LOC103867059 [Brassica rapa]
Length=588

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/561 (55%), Positives = 399/561 (71%), Gaps = 26/561 (5%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M++   Q+  GRWFM FAS LIM+ AGATY+FG+YS +IK  LGYDQ+TLNLL  FKD+G
Sbjct  1     MKSLAIQILTGRWFMFFASLLIMSAAGATYMFGLYSGDIKTALGYDQTTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVG+++GL+ EV+P WF L++G+ +NF GYF+IWL+VTKRI+KPKVW MCLYICVGANS
Sbjct  61    ANVGIIAGLLNEVSPPWFTLIIGAILNFFGYFMIWLAVTKRISKPKVWHMCLYICVGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q+FANTG++VTCVKNFP SRG +LG++KG+VGLSGA+FTQLY A YG+D+++LIL+IGWL
Sbjct  121   QSFANTGSIVTCVKNFPESRGFVLGILKGYVGLSGAIFTQLYHAFYGDDTKSLILMIGWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             PA +S  F+ ++R MK+    NE KVF+ +L IS  LA  LM + I  K   F+   +  
Sbjct  181   PAAISFAFLWTVRNMKVVRQTNELKVFYNFLYISFGLATFLMVVIITDKLSGFTRSEFGG  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEK---------------KKQLLSSENVEDppppae  833
              A +V  LL LP ++ V+EE    K+K               K  L+S E  +D     +
Sbjct  241   SAAVVIVLLLLPIIVVVLEERKLWKDKQVALNDPAPINIVTEKASLVSLEVKDDNERSTK  300

Query  832   niekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
                          SC+  IF  P+RG+DY+ILQAL S DML+LF+   CG G +L AIDN
Sbjct  301   VERVKTA------SCWTTIFSPPERGDDYTILQALFSFDMLILFLATICGAGGTLTAIDN  354

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG SLGYP R++ TFVSLVSIWNYFGRV SG +SE  + ++K PR +M+T  LL  C
Sbjct  355   LGQIGGSLGYPKRSVSTFVSLVSIWNYFGRVTSGVLSEIFLIKYKFPRPIMLTMILLFSC  414

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              G LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL N G +ASP+G+
Sbjct  415   TGHLLIAFNVPGGLYVASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLINFGSVASPIGA  474

Query  292   YILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             Y+LNV++ G LYD EA KQ  A G+      +L+C+GT C+K+SFI++  V LFG  VS+
Sbjct  475   YLLNVRVAGYLYDKEAEKQHKALGIVRKEGQDLSCMGTACFKLSFIIITLVTLFGVFVSM  534

Query  127   VLVARTAAYYKTDIYKRFRDE  65
             +LV RT  +YK+DIYKRFR++
Sbjct  535   ILVVRTKKFYKSDIYKRFREK  555



>ref|XP_002862889.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39148.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/547 (56%), Positives = 391/547 (71%), Gaps = 39/547 (7%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWFM F S LIM+ AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  9     SMKSLTIQILTGRWFMFFGSLLIMSTAGATYMFGIYSGDIKKTLGYDQTTLNLLSFFKDL  68

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GL+ EVTP WF+LL+G  +NF GYF+IWL+VT+RI+KP+VW MCLYICVGAN
Sbjct  69    GANVGVLAGLLNEVTPPWFILLIGGILNFFGYFMIWLAVTERISKPQVWHMCLYICVGAN  128

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D++ LIL+IGW
Sbjct  129   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRAFYGEDTKELILMIGW  188

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPAI+S  F+ +IR MK+    NE KVF+ +L IS+ LA  LM + I  K   F+   + 
Sbjct  189   LPAIVSFAFLRTIRIMKVKRQTNELKVFYNFLYISLGLATFLMVVIIINKLSGFTQSEFG  248

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYS  791
               A +V  LL LP ++ ++EE       K                               
Sbjct  249   GSAAVVIVLLLLPIIVVILEEKKLGGRNK-------------------------------  277

Query  790   CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRT  611
                 +F  P+RG+DY+ILQAL SVDML+LF+   CG G +L AIDNLGQIG+SLGYP R+
Sbjct  278   ---TVFDPPERGDDYTILQALFSVDMLILFLATICGVGGTLTAIDNLGQIGDSLGYPKRS  334

Query  610   IGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSV  431
             + TFVSLVSIWNY+GRV SG VSE  + ++K PR LM+T  LLL CAG LL+AF  PG +
Sbjct  335   VSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAGHLLIAFNVPGGL  394

Query  430   YGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDG  251
             Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSY+LNV++ G LYD 
Sbjct  395   YVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRVAGYLYDV  454

Query  250   EAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDI  86
             EA KQ  A G       +L C+GT C+K+SFI++  V LFG LVS+VLV RT  +YK+DI
Sbjct  455   EAGKQYKALGKTRVEGQDLNCIGTSCFKLSFIIITAVTLFGVLVSMVLVIRTKKFYKSDI  514

Query  85    YKRFRDE  65
             YK+FR++
Sbjct  515   YKKFREK  521



>ref|XP_009598854.1| PREDICTED: uncharacterized protein LOC104094596 [Nicotiana tomentosiformis]
Length=603

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/564 (55%), Positives = 403/564 (71%), Gaps = 22/564 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             NM +   Q+F GRWFM+FA+ LI++ +GATY+FG+YS +IK +LGYDQ+TLNLL  FKD+
Sbjct  14    NMRSLTLQVFTGRWFMVFATVLILSASGATYIFGIYSSDIKTSLGYDQTTLNLLSFFKDL  73

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGVLSGLI EVTP W VL VG+ +NF GYF+IWL+VTK+I  PKVW MC+YIC+GAN
Sbjct  74    GSNVGVLSGLINEVTPPWVVLSVGAILNFFGYFMIWLAVTKKIPTPKVWHMCVYICIGAN  133

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTGALVTCVKNFP SRG +LGL+KG+VGLSGA+ TQ+Y AIYGN+S++LILLIGW
Sbjct  134   SQSFANTGALVTCVKNFPESRGAVLGLLKGYVGLSGAMLTQIYHAIYGNESKSLILLIGW  193

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA++S VF+  IR MK+    +E KVF+ +L IS+ LA  LM + I QK + F    Y 
Sbjct  194   LPAVVSFVFLRIIRVMKVVRIAHEMKVFYRFLYISLGLAGFLMLIIILQKKLEFKQSEYG  253

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE-----------------Dppp  842
                 IV  LL LP  I + EE+ + K KK+ L S   V+                   P 
Sbjct  254   LSTAIVLFLLCLPLGIVIKEEVDSWKAKKQALESISQVKLVTEEPNCESAQPQILPQTPS  313

Query  841   paeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAA  662
              A     +  +     SC+  +F+ P RGEDY+ILQ L S+DML+LF    CG G +L A
Sbjct  314   SATANRASTSKNQETVSCWKTVFRAPDRGEDYTILQTLFSIDMLILFFATICGVGGTLTA  373

Query  661   IDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLL  482
             IDNLGQIG SLGYP  +I TFVSLVSIWNY GRV SGF+SE  + ++K PR LM+T +L+
Sbjct  374   IDNLGQIGTSLGYPKTSISTFVSLVSIWNYLGRVVSGFLSEHFLSKYKFPRPLMLTITLI  433

Query  481   LPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASP  302
             + C G LL+AF   G +Y AS+++GF +G Q  LL+ IISELFGLKYYSTL+N G +ASP
Sbjct  434   ISCLGHLLIAFDVRGGLYIASIVIGFCFGAQWPLLYAIISELFGLKYYSTLYNFGSVASP  493

Query  301   LGSYILNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGAL  137
             +G+Y+LNV++ G LYD EA KQ+ A    R +GE L C+G +C+K++FI++  V + GAL
Sbjct  494   IGAYVLNVRVAGHLYDKEAEKQMKALGRSRKIGEDLECIGAECFKLAFIIITAVTILGAL  553

Query  136   VSLVLVARTAAYYKTDIYKRFRDE  65
             VS++LV RT  +YK DIYK+FR+E
Sbjct  554   VSIILVLRTRNFYKNDIYKKFREE  577



>gb|KEH44269.1| MFS transporter [Medicago truncatula]
Length=596

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/554 (57%), Positives = 394/554 (71%), Gaps = 12/554 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q   GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQSTLNLL  FKD 
Sbjct  14    DMKSLTVQFITGRWFVIFASFLIMAAAGATYMFGLYSPDIKTTLGYDQSTLNLLSFFKDF  73

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGVLSGLI E+ P W VL +G+ +NF GYF+IWLSVTK+IA+P+VWQMCLYIC+GAN
Sbjct  74    GSNVGVLSGLINELYPPWVVLTIGAILNFFGYFMIWLSVTKKIARPQVWQMCLYICIGAN  133

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY AIY +D++ LIL IGW
Sbjct  134   SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYSAIYYDDTKALILFIGW  193

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK     NE KVF+ +L IS+ LA  L+ + I QK V FS   Y 
Sbjct  194   LPAAISFAFLRTIRYMKPVRQVNELKVFYNFLYISLGLAGFLLVMIIIQKKVSFSQSEYG  253

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE-------Dppppaeniekaee  812
               A +V  LLFLP  +  +EE    + KK  L+    V+              N   +  
Sbjct  254   LSAAVVIFLLFLPLAVVFIEENKIWQSKKLALVDPSPVKIVTEGETVTETEKVNSAVSVS  313

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
                 D   + ++F  P RGEDY+ILQAL S+DML+LF+   CG G +L AIDNLGQIG S
Sbjct  314   APKKDPKWWEDVFNPPARGEDYTILQALFSMDMLILFVACICGVGGTLTAIDNLGQIGTS  373

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             L YP ++I TFVSLVSIWNY GRVFSGFVSE  + +++ PR LM+T +L + C G LL+A
Sbjct  374   LRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLTKYRFPRPLMLTLTLFVSCVGHLLIA  433

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             F  P  +Y AS+I+GF +G Q  LLF IISELFGLKYY+TL+N G +ASPLG Y+LNVKI
Sbjct  434   FDVPEGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYVLNVKI  493

Query  271   VGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G LYD EA KQ+ A G       EL C+G  CYK+SFI++     FGA+VSL+LVART 
Sbjct  494   AGHLYDKEAKKQLEALGKQRIEGQELNCVGVDCYKLSFIIITAATFFGAVVSLILVARTR  553

Query  106   AYYKTDIYKRFRDE  65
              +YK DIYKR+R+E
Sbjct  554   KFYKGDIYKRYREE  567



>ref|XP_010067354.1| PREDICTED: uncharacterized protein LOC104454252 isoform X3 [Eucalyptus 
grandis]
Length=604

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/569 (56%), Positives = 404/569 (71%), Gaps = 24/569 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M +   Q+  GRWFM+FA FLIMA AGATY+FG+YS++IK +LGYDQSTLNLL  FKD+
Sbjct  18    DMRHLAVQVIMGRWFMVFACFLIMAAAGATYMFGLYSEDIKHSLGYDQSTLNLLSFFKDL  77

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVLSGLI EVTP W VL +G+ +NF GYF+IWL+VTKRIAKP+VWQMCLYIC+GAN
Sbjct  78    GANVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTKRIAKPQVWQMCLYICIGAN  137

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ FANTGALVTCV+NFP SRG++LG++KG+VGLSGA+ TQL+ A Y  D++ LILLIGW
Sbjct  138   SQAFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFYYKDTKALILLIGW  197

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYV-RFSHFAY  974
             LPA +S  F+ +IR MK+   PNE KVF+ +L IS+ LA  LM + I +K+   F+   Y
Sbjct  198   LPAAISFAFVRTIRIMKVVRQPNEVKVFYRFLYISLGLATFLMIMIIIEKHFNNFTRPEY  257

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE------------------Dp  848
                A  V  LLFLP  I V+EE     +K++ L     +E                    
Sbjct  258   GLSAAGVLFLLFLPLAIVVIEEYKQWAQKREALNDPSPIEITTEKPNLETSLPLPPPPPE  317

Query  847   pppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSL  668
               P   I  + E+     SC+   F+ P RGEDY+ILQAL S+DML+LF+   CG G +L
Sbjct  318   TAPPTAILNSGEQLEKQPSCWRTAFRPPDRGEDYTILQALFSIDMLILFLSTICGVGGTL  377

Query  667   AAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFS  488
              AIDNLGQIG+SLGY  ++  TFVSLVSIWNY GRV +GFVSE ++ R+K PRTLM+T  
Sbjct  378   TAIDNLGQIGKSLGYATQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLMLTII  437

Query  487   LLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLA  308
             LL+ CAG LL+AF  P  +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +A
Sbjct  438   LLISCAGHLLIAFDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVA  497

Query  307   SPLGSYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFG  143
             SP+G Y+LNV++ G LYD EA KQ+AA G+      +L C G +CY++SF+++    LFG
Sbjct  498   SPIGGYLLNVRVAGHLYDKEAKKQLAALGLARQPGQDLECTGVKCYQLSFLIITFATLFG  557

Query  142   ALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             A VS +LV RT  +Y++DIYK+FR+E  A
Sbjct  558   AFVSFILVVRTRKFYRSDIYKKFREEAKA  586



>ref|XP_006354409.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Solanum 
tuberosum]
Length=579

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/572 (53%), Positives = 402/572 (70%), Gaps = 31/572 (5%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M +F   +F GRWFM+FA+ LIM+ AGATY+FG+YS EIK++LGYDQ+TLNLL  FKD+G
Sbjct  1     MASFGHHVFTGRWFMVFANLLIMSMAGATYMFGLYSDEIKSSLGYDQTTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
              NVG++SGLI EVTP W VL +G+ MNF GYF+IWL VT  IAKP++WQMCLYIC+GANS
Sbjct  61    GNVGIISGLINEVTPPWVVLFIGAIMNFFGYFMIWLCVTGHIAKPRIWQMCLYICIGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q FANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQLY A YGN+ ++LILLIGWL
Sbjct  121   QTFANTGALVTCVKNFPESRGSLLGLLKGFVGLSGAIITQLYHAFYGNNGKSLILLIGWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             PA++S +F+ +IR +++    NETK+ +++L IS+ LA  +M + I Q  + F+ F Y  
Sbjct  181   PAVVSCIFLRTIRILRVVRQANETKILYKFLYISLGLAGFIMLVIIIQNKIDFARFEYGG  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQL--------------------------LSS  866
              A +V  +LF P +I   EE+   K K++ L                           S 
Sbjct  241   SAAVVLIMLFAPLIIVFQEEIKLWKVKQQALDEPRLKVVSENPPSVELTQPQKLALSESE  300

Query  865   ENVEDppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFC  686
             EN+              E +    SCF N+F  P RGEDY+ILQAL S+DM++LFI    
Sbjct  301   ENLTSVDLTQPQKLAQNEYEEKQTSCFSNVFNPPPRGEDYTILQALFSIDMIILFIATTF  360

Query  685   GQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRT  506
             G G +L AIDNLGQIG++LGYP ++I TFVSLVSIWNY GRV SGFVSE  +K++K PR 
Sbjct  361   GVGGTLTAIDNLGQIGKALGYPEKSITTFVSLVSIWNYLGRVVSGFVSEIFLKKYKFPRP  420

Query  505   LMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLF  326
             +M+T  LLL C+G LL+AF  P S+Y AS+++GF +G Q  L+F IISELFGLKYYSTL+
Sbjct  421   MMLTLVLLLSCSGHLLIAFGVPNSLYIASILMGFCFGAQWPLIFAIISELFGLKYYSTLY  480

Query  325   NCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLA  161
             N G  ASP+G+Y+LNV++ G LYD  A KQ+ A+G+      +LTC+G +CYK++F+++ 
Sbjct  481   NFGGGASPVGAYLLNVRVTGHLYDKVATKQMLAKGLKRKIGQDLTCIGVECYKLAFLIIT  540

Query  160   GVNLFGALVSLVLVARTAAYYKTDIYKRFRDE  65
             G  L    +SL+LV RT  +YK DIYK+FR++
Sbjct  541   GATLLSCAISLILVIRTRKFYKGDIYKKFREQ  572



>ref|XP_010067352.1| PREDICTED: uncharacterized protein LOC104454252 isoform X1 [Eucalyptus 
grandis]
Length=619

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/569 (56%), Positives = 404/569 (71%), Gaps = 24/569 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M +   Q+  GRWFM+FA FLIMA AGATY+FG+YS++IK +LGYDQSTLNLL  FKD+
Sbjct  18    DMRHLAVQVIMGRWFMVFACFLIMAAAGATYMFGLYSEDIKHSLGYDQSTLNLLSFFKDL  77

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVLSGLI EVTP W VL +G+ +NF GYF+IWL+VTKRIAKP+VWQMCLYIC+GAN
Sbjct  78    GANVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTKRIAKPQVWQMCLYICIGAN  137

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ FANTGALVTCV+NFP SRG++LG++KG+VGLSGA+ TQL+ A Y  D++ LILLIGW
Sbjct  138   SQAFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFYYKDTKALILLIGW  197

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYV-RFSHFAY  974
             LPA +S  F+ +IR MK+   PNE KVF+ +L IS+ LA  LM + I +K+   F+   Y
Sbjct  198   LPAAISFAFVRTIRIMKVVRQPNEVKVFYRFLYISLGLATFLMIMIIIEKHFNNFTRPEY  257

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE------------------Dp  848
                A  V  LLFLP  I V+EE     +K++ L     +E                    
Sbjct  258   GLSAAGVLFLLFLPLAIVVIEEYKQWAQKREALNDPSPIEITTEKPNLETSLPLPPPPPE  317

Query  847   pppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSL  668
               P   I  + E+     SC+   F+ P RGEDY+ILQAL S+DML+LF+   CG G +L
Sbjct  318   TAPPTAILNSGEQLEKQPSCWRTAFRPPDRGEDYTILQALFSIDMLILFLSTICGVGGTL  377

Query  667   AAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFS  488
              AIDNLGQIG+SLGY  ++  TFVSLVSIWNY GRV +GFVSE ++ R+K PRTLM+T  
Sbjct  378   TAIDNLGQIGKSLGYATQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLMLTII  437

Query  487   LLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLA  308
             LL+ CAG LL+AF  P  +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +A
Sbjct  438   LLISCAGHLLIAFDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVA  497

Query  307   SPLGSYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFG  143
             SP+G Y+LNV++ G LYD EA KQ+AA G+      +L C G +CY++SF+++    LFG
Sbjct  498   SPIGGYLLNVRVAGHLYDKEAKKQLAALGLARQPGQDLECTGVKCYQLSFLIITFATLFG  557

Query  142   ALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             A VS +LV RT  +Y++DIYK+FR+E  A
Sbjct  558   AFVSFILVVRTRKFYRSDIYKKFREEAKA  586



>emb|CDX74863.1| BnaA05g06090D [Brassica napus]
Length=577

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/546 (56%), Positives = 399/546 (73%), Gaps = 7/546 (1%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M++   Q+  GRWFM FAS LIM+ AGATY+FG+YS +IK  LGYDQ+TLNLL  FKD+G
Sbjct  1     MKSLAIQILTGRWFMFFASLLIMSAAGATYMFGLYSGDIKTALGYDQTTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVG+++GL+ EV+P WF L++G+ +NF GYF+IWL+VTKRI+KPKVW MCLYICVGANS
Sbjct  61    ANVGIIAGLLNEVSPPWFTLIIGAILNFFGYFMIWLAVTKRISKPKVWHMCLYICVGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q+FANTG++VTCVKNFP SRG +LG++KG+VGLSGA+FTQLY A YG+D+++LIL+IGWL
Sbjct  121   QSFANTGSIVTCVKNFPESRGFVLGILKGYVGLSGAIFTQLYHAFYGDDTKSLILMIGWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             PA +S  F+ ++R MK+    NE KVF+ +L IS  LA  LM + I  K   F+   +  
Sbjct  181   PAAISFAFLWTVRNMKVVRQTNELKVFYNFLYISFGLATFLMVVIITDKLSGFTRSEFGG  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSC  788
              A +V  LL LP ++ V+EE   +  K KQ+  +          +N    + E+    SC
Sbjct  241   SAAVVIVLLLLPIIVVVLEE--RKLWKDKQVAFNNPAPINIVKDDNERSVKVERVKTASC  298

Query  787   FGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTI  608
             +  IF  P+RG+DY+ILQAL S DML+LF+   CG G +L AIDNLGQIG SLGYP R++
Sbjct  299   WTTIFSPPERGDDYTILQALFSFDMLILFLATICGAGGTLTAIDNLGQIGGSLGYPKRSV  358

Query  607   GTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVY  428
              TFVSLVSIWNYFGRV SG +SE  + ++K PR +M+T  LL  C G LL+AF  PG +Y
Sbjct  359   STFVSLVSIWNYFGRVTSGVLSEIFLIKYKFPRPIMLTMILLFSCTGHLLIAFNVPGGLY  418

Query  427   GASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGE  248
              AS+I+GF +G Q  LLF IISE+FGLKYYSTL N G +ASP+G+Y+LNV++ G LYD E
Sbjct  419   VASVIIGFCFGAQWPLLFAIISEVFGLKYYSTLINFGSVASPIGAYLLNVRVAGYLYDKE  478

Query  247   AVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIY  83
             A KQ  A G+      +L+C+GT C+K+SFI++  V LFG  VS++LV RT  +YK+DIY
Sbjct  479   AEKQHKALGIVRKEGQDLSCMGTACFKLSFIIITLVTLFGVFVSMILVVRTKKFYKSDIY  538

Query  82    KRFRDE  65
             KRFR++
Sbjct  539   KRFREK  544



>ref|XP_009765800.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Nicotiana 
sylvestris]
Length=601

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/559 (56%), Positives = 402/559 (72%), Gaps = 16/559 (3%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             ++M NFV   F  RWFM+FAS LIM+ AGATY+FG+YS EIK++LGYDQ+TLNLL  FKD
Sbjct  9     RSMANFVHHFFTSRWFMVFASLLIMSMAGATYMFGLYSGEIKSSLGYDQTTLNLLSFFKD  68

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G NVG++SGLI EVTP W VL +G+ MNF GYF+IWLSV+  IAKP +WQMCLYIC+GA
Sbjct  69    LGGNVGIISGLINEVTPPWVVLFIGAIMNFFGYFMIWLSVSGHIAKPAIWQMCLYICIGA  128

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQLY A YGN+ ++LILLIG
Sbjct  129   NSQTFANTGALVTCVKNFPESRGSVLGLLKGFVGLSGAIITQLYHAFYGNNGKSLILLIG  188

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             +LPA++S +F+ +IR MK+    NETK+F+++L IS+ LA  +M + I Q  V F+   Y
Sbjct  189   YLPAVVSCIFLRTIRIMKVVRQSNETKIFYKFLYISLGLAGFIMIVIIIQNKVSFTRPEY  248

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQL------LSSENVEDppppaeniekaee  812
                A +V  LLF P +I   E+L     K++ L      + SEN             +  
Sbjct  249   SGSAAVVLILLFAPLVIVFKEDLKLWNIKQQALNDHILKVVSENPPSVELTRPQKLASSP  308

Query  811   ekAGD-----YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLG  647
             E   +      SCF N+F  P RG+DY+ILQAL S+DM++LF     G G +L AIDNLG
Sbjct  309   ELPKECDEKATSCFSNVFNPPPRGDDYTILQALFSIDMIILFTATTFGVGGTLTAIDNLG  368

Query  646   QIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAG  467
             QIG++LGYP ++I TFVSLVSIWNY GRV SGFVSE  + ++K PR +M+T  LLL CAG
Sbjct  369   QIGKALGYPEKSITTFVSLVSIWNYLGRVVSGFVSEIFLTKYKCPRPMMLTLVLLLSCAG  428

Query  466   DLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI  287
              LL+AF  P S+Y AS+++GF +G Q  L+F IISELFGLKYYSTL+N G  ASP+G+Y+
Sbjct  429   HLLIAFGVPNSLYLASVLMGFCFGAQWPLIFAIISELFGLKYYSTLYNFGAGASPVGAYL  488

Query  286   LNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             LNVK+ G+LYD  A KQ+ A+G+      +LTC+G +CYK++F+V+ G  L    VSL+L
Sbjct  489   LNVKVAGQLYDKVATKQMLAKGLKRKDGEDLTCIGVECYKLAFLVITGATLISCAVSLIL  548

Query  121   VARTAAYYKTDIYKRFRDE  65
             V RT  +YK DIYK+FR++
Sbjct  549   VIRTRKFYKGDIYKKFREQ  567



>ref|XP_009792652.1| PREDICTED: uncharacterized protein LOC104239662 [Nicotiana sylvestris]
Length=598

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/560 (55%), Positives = 411/560 (73%), Gaps = 15/560 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             NM N   ++   RWFM+FA+ LI++ AGATY+FG+YS +IK++LGYDQ+TLNLL  FKD+
Sbjct  17    NMTNLPVRVLMSRWFMVFATMLILSAAGATYMFGLYSGDIKSSLGYDQTTLNLLSFFKDL  76

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGVLSGLI E++P W VL +G+ +NF GYF+IW++VTK+++ PKVW MCLYIC+GAN
Sbjct  77    GSNVGVLSGLINEISPPWVVLSIGAVLNFFGYFMIWMAVTKKMSTPKVWLMCLYICIGAN  136

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQ+Y AIYGNDS++LILLIGW
Sbjct  137   SQSFANTGALVTCVKNFPESRGAVLGLLKGFVGLSGAILTQIYQAIYGNDSKSLILLIGW  196

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA++S VF+ +IR +++    +E KVF+ +L +S+ LA  LM + I QK + F+   + 
Sbjct  197   LPAVISFVFLRTIRIIEVVRIAHELKVFYRFLYMSLGLAGYLMVIIILQKKLNFTRVEFG  256

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLS----------SENVEDppppaeniek  821
               A  V  LLFLP  I + EE+ + K KK+ L S           +N    PP +     
Sbjct  257   LSAAFVVFLLFLPLGIVIKEEIISWKAKKQALDSISEVKVVTEKPKNEAQLPPSSSCSSV  316

Query  820   aeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQI  641
              ++    + SC+  +F+ P RGEDY+ILQAL S+DML+LF+   CG G +L AIDNLGQI
Sbjct  317   VDDLTDPEVSCWKTVFRPPNRGEDYTILQALFSLDMLILFLATICGIGGTLTAIDNLGQI  376

Query  640   GESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDL  461
             G SLGYP ++I TFVSLVSIWNY GRV +GF+SE  +K++K PR L +T +L++ C G +
Sbjct  377   GSSLGYPKKSISTFVSLVSIWNYLGRVVAGFLSEYFLKKYKFPRPLALTITLIISCIGHI  436

Query  460   LVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILN  281
             L+AF  PG +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N G +ASP+GSY+LN
Sbjct  437   LIAFNVPGGLYIASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGSYLLN  496

Query  280   VKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVA  116
             V++ G LYD EA KQ+ A    R  GE L C G  C+K++FI++  V +FGA VS++LV 
Sbjct  497   VRVAGHLYDKEAEKQLKALGRTRRQGEDLNCDGVVCFKLAFIIITAVTIFGAFVSIILVI  556

Query  115   RTAAYYKTDIYKRFRDEMGA  56
             RT  +YK+DIYK+FR++  A
Sbjct  557   RTRKFYKSDIYKKFREQAKA  576



>ref|XP_010534423.1| PREDICTED: uncharacterized protein LOC104809977 [Tarenaya hassleriana]
Length=593

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/560 (58%), Positives = 406/560 (73%), Gaps = 22/560 (4%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             Q+  GRWFM FAS LIM+ AGATY+FG+YS EIK TLGYDQ+TLNLL  FKD+GANVGVL
Sbjct  19    QIMTGRWFMFFASLLIMSTAGATYMFGLYSNEIKHTLGYDQTTLNLLSFFKDLGANVGVL  78

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SGLI EVTP W VL +G+ +NF GYF+IWL+VTKRI KP VW MCLYICVGANSQ+FANT
Sbjct  79    SGLINEVTPPWVVLSIGAILNFFGYFMIWLAVTKRIPKPHVWHMCLYICVGANSQSFANT  138

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             GALVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG+D+++LILLIGWLPA +S 
Sbjct  139   GALVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGDDTKSLILLIGWLPAAISF  198

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
              F+ +IR M++   PNE KVF+ +L IS+ LA  LM + I  K   F+   Y   A +V 
Sbjct  199   AFLRTIRIMRVVRQPNELKVFYNFLYISLGLATFLMIVIITDKLSGFTRSEYGGSAGVVI  258

Query  949   ALLFLPFLIAVMEELATRKEKKKQL-----------------LSSENVEDppppaeniek  821
              LL LP ++ V+EE    KEK+  L                   + N ++      + E+
Sbjct  259   LLLLLPIIVVVIEEQRLWKEKQSALNDPSPLDIITEKPAAIDSDTNNKDNSKNEDVSNEE  318

Query  820   aeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQI  641
              +EEKA   SC+  +F  P RGEDY+ILQAL SVDML+LF+   CG G +L AIDNLGQI
Sbjct  319   EKEEKAKSRSCWTTVFSPPDRGEDYTILQALFSVDMLILFLATICGVGGTLTAIDNLGQI  378

Query  640   GESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDL  461
             G SLGYP R+I TFVSLVSIWNYFGRV SG VSE  + ++K PR L++T  L + C G L
Sbjct  379   GGSLGYPKRSISTFVSLVSIWNYFGRVTSGVVSEIFLIKYKFPRPLLLTIILFISCIGHL  438

Query  460   LVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILN  281
             L+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+G+Y+LN
Sbjct  439   LIAFNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGAYLLN  498

Query  280   VKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVA  116
             V++ G LYD EA KQ+ A G+      +LTC GT+C+K+SFI++  V LFG LVS VLVA
Sbjct  499   VRVAGHLYDKEAEKQMRALGLKRREGEDLTCNGTECFKLSFIIITAVTLFGVLVSAVLVA  558

Query  115   RTAAYYKTDIYKRFRDEMGA  56
             RT  +YK+DIYK+FR+E  A
Sbjct  559   RTKKFYKSDIYKKFREEAKA  578



>emb|CDY07663.1| BnaA03g18480D [Brassica napus]
Length=579

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/552 (56%), Positives = 395/552 (72%), Gaps = 27/552 (5%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+    Q+  GRWFM FAS LIM+ AGATY+F +YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  10    SMKTLTIQILTGRWFMFFASLLIMSAAGATYMFSLYSGDIKRTLGYDQTTLNLLSFFKDL  69

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GLI EVTP WF+L++G+ +NF GYF+IWL+VTKRI KP+VW MCLYIC+GAN
Sbjct  70    GANVGVLAGLINEVTPPWFILIIGAILNFFGYFMIWLAVTKRIPKPQVWHMCLYICIGAN  129

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D+++LIL+IGW
Sbjct  130   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGEDTKSLILMIGW  189

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+    +E KVF+ +L IS+ LA  LM   IA K   F+   + 
Sbjct  190   LPAAISFAFLRTIRNMKVVRQKDELKVFYNFLYISLGLATFLMAAIIADKLSGFTRSEFG  249

Query  970   ACATIVCALLFLPFL-----IAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeek  806
               A +V  LL LP L     +A+ +        +K  L S   E                
Sbjct  250   GSAAVVIILLLLPKLWTDKQVALNDPAPINIVTEKPSLDSSESEKTA-------------  296

Query  805   AGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
                 SC+  +F  P+RG+DY+ILQAL SVDML+LF+   CG G +L AIDNLGQIG SLG
Sbjct  297   ----SCWTTMFSPPERGDDYTILQALFSVDMLILFLATICGVGGTLTAIDNLGQIGGSLG  352

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP R++ TFVSLVSIWNYFGRV SG VSE  + ++K PR L++T  LL  CAG LL+AF 
Sbjct  353   YPQRSVSTFVSLVSIWNYFGRVVSGVVSEIFLIKYKFPRPLVLTLILLFSCAGHLLIAFN  412

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
              PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSY+LNV++ G
Sbjct  413   VPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRVAG  472

Query  265   RLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              LYD EA KQ  A G+      +L+C GT C+K+SFI++  V LFG LVS++LV RT  +
Sbjct  473   YLYDKEAEKQNNALGIQRSGGQDLSCTGTACFKLSFIIITAVTLFGVLVSMILVIRTRKF  532

Query  100   YKTDIYKRFRDE  65
             YK+DIYK+FR++
Sbjct  533   YKSDIYKKFREK  544



>ref|XP_010267223.1| PREDICTED: uncharacterized protein LOC104604543 [Nelumbo nucifera]
Length=636

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/576 (56%), Positives = 405/576 (70%), Gaps = 35/576 (6%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             +++     Q+  GRWFM+FASFLIM+ AGATY+FG+YS +IK +LGYDQ+TLNLL  FKD
Sbjct  14    RDVRGVTAQIVLGRWFMVFASFLIMSAAGATYMFGLYSNDIKTSLGYDQTTLNLLSFFKD  73

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G+NVG+LSGLI EVTP W VL++G+ MNF+GYF+IWL+V+ RIA+P VW MC+YIC+GA
Sbjct  74    LGSNVGILSGLINEVTPPWVVLVIGAVMNFSGYFMIWLAVSGRIARPHVWHMCIYICLGA  133

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ+FANTGALVTCVKNFP SRG++LGL+KGFVGLSGA+ TQ+Y A+YGN+S+ LILLIG
Sbjct  134   NSQSFANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIITQIYHALYGNNSKALILLIG  193

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S  F+ +IR M++   PNE KVF+ +L IS+ LA  LM L I QK   F+ + Y
Sbjct  194   WLPAAISFGFVRTIRIMRVVRQPNELKVFYHFLYISLGLAGFLMILIIVQKRFDFNQYEY  253

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKK-KQLLSSENVEDppppaeniekaeeekAGD  797
                A  V  LLFLP  + + EE+A  K K+ +Q L+           E           +
Sbjct  254   GGSAAAVLILLFLPLAVVIREEIAMWKSKRQRQALNRSCSSQLMVTVEKPSAPAPTTTAE  313

Query  796   -----------------------------YSCFGNIFKKPKRGEDYSILQALLSVDMLLL  704
                                           SC   +F+ P RGEDY+ILQAL+SVDML+L
Sbjct  314   AAEPPKAEALPPQAPAAAAPSSSPVSQKSASCMSTMFRPPDRGEDYTILQALVSVDMLIL  373

Query  703   FICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKR  524
             F    CG G +L AIDNLGQIG SLGYP R+I TFVSLVSIWNY GRV SGF SE  +K+
Sbjct  374   FFATICGVGGTLTAIDNLGQIGLSLGYPSRSISTFVSLVSIWNYLGRVVSGFASEIFLKK  433

Query  523   WKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLK  344
             +K PR LM+T +LLL C G LL+AF  PGS+Y AS+I+GF +G Q  LLF IISE+FGLK
Sbjct  434   YKFPRPLMLTMTLLLSCVGHLLIAFGVPGSLYVASVIIGFCFGAQWPLLFAIISEIFGLK  493

Query  343   YYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAA----RGVG-ELTCLGTQCYKV  179
             YYSTL+N G +ASP+G YILNV++ G LYD EA KQ+AA    R  G +L+C G  CYK+
Sbjct  494   YYSTLYNFGAVASPIGLYILNVRVAGHLYDKEANKQMAAFGRTRAPGTDLSCTGVDCYKL  553

Query  178   SFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFR  71
             SFI++  V LFGA+VS VLV RT  +Y++DIYK+FR
Sbjct  554   SFIIITAVTLFGAVVSYVLVHRTRDFYRSDIYKKFR  589



>ref|XP_009627853.1| PREDICTED: uncharacterized protein LOC104118334 [Nicotiana tomentosiformis]
Length=600

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/562 (55%), Positives = 411/562 (73%), Gaps = 17/562 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             NM N   ++   RWFM+FA+ LI++ AGATY+FG+YS +IK+ LGYDQ+TLNLL  FKD+
Sbjct  17    NMTNLPVRVLMSRWFMVFATILILSAAGATYMFGIYSGDIKSALGYDQTTLNLLSFFKDL  76

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGVLSGLI E++P W VL +G+ +NF GYF+IW++VTK+++ PKVW MCLYIC+G N
Sbjct  77    GSNVGVLSGLINEISPPWVVLSIGAVLNFFGYFMIWMAVTKKMSTPKVWLMCLYICIGGN  136

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQ+Y AIYGNDS++LILLIGW
Sbjct  137   SQSFANTGALVTCVKNFPESRGAVLGLLKGFVGLSGAILTQIYHAIYGNDSKSLILLIGW  196

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA++S VF+ +IR +++    +E KVF+ +L +S+ LA  LM + I QK + F+   + 
Sbjct  197   LPAVISFVFLRTIRIIEVVRIAHELKVFYRFLYMSLGLAGYLMVIIILQKKLDFTRAEFG  256

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLS------------SENVEDppppaeni  827
               A  V  LLFLP  I + EE+ + K KK+ L S            SE      PP+  +
Sbjct  257   LSAAFVVFLLFLPLGIVIKEEIVSWKAKKQALDSISEVKVVTEKPKSECSAPELPPSSAV  316

Query  826   ekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLG  647
               A E K  + SC+  +F+ P RGEDY+ILQAL S+DML+LF+   CG G +L AIDNLG
Sbjct  317   IAAVELKDPEVSCWKTVFQPPNRGEDYTILQALFSLDMLILFLATICGIGGTLTAIDNLG  376

Query  646   QIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAG  467
             QIG SLGYP ++I TFVSLVSIWNY GRV +GF+SE  +K++K PR L +T +L++ C G
Sbjct  377   QIGASLGYPKKSISTFVSLVSIWNYLGRVVAGFLSEYFLKKYKFPRPLALTITLIISCIG  436

Query  466   DLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI  287
              +L+AF  PG +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N G +ASP+GSY+
Sbjct  437   HILIAFNVPGGLYIASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGSYL  496

Query  286   LNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             LNV++ G LYD EA KQ+ A G       +L C G +C+K++FI++  V +FGA VS++L
Sbjct  497   LNVRVAGHLYDKEAEKQLNAMGRTRQQGKDLNCDGVECFKLAFIIITAVTIFGAFVSIIL  556

Query  121   VARTAAYYKTDIYKRFRDEMGA  56
             V RT  +YK+DIYK+FR++  A
Sbjct  557   VIRTRKFYKSDIYKKFREQAKA  578



>ref|XP_003555226.2| PREDICTED: uncharacterized protein LOC100819661 [Glycine max]
Length=571

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/549 (58%), Positives = 399/549 (73%), Gaps = 9/549 (2%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M++    +  GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQSTLNLL  FKD+G
Sbjct  1     MKSLTVNVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQSTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             +NVG+LSGLI E+TP W VL +G+ +NF GYF+IWLSVTK+IAKPKVWQMCLYIC+GANS
Sbjct  61    SNVGILSGLINELTPPWVVLAIGAILNFFGYFMIWLSVTKKIAKPKVWQMCLYICIGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY AIY +D+++LILLIGWL
Sbjct  121   QSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYHAIYYDDTRSLILLIGWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             PA +S  F+ +IR MK    PNE KVF+ +L +S+ LA  LM + I Q  V F+   +  
Sbjct  181   PAAISFAFLRTIRYMKPVRKPNELKVFYNFLYVSLGLAGFLMVMIIVQNKVDFTQSEFGV  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV----EDppppaeniekaeeekAG  800
              A I+  LLFLP  I  +EE      K+  L+    V    +    P E         + 
Sbjct  241   SAAIMLFLLFLPLTIVSVEEYKVWLSKRLALVDPSPVKIVTDQVMKPNEPTNNGNNSVSD  300

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
             D   + N+F  P RGEDY+ILQAL SVDML+LF+   CG G +L AIDNLGQIG SL YP
Sbjct  301   DTKWWENVFSPPARGEDYTILQALFSVDMLILFMTCICGVGGTLTAIDNLGQIGTSLRYP  360

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
              +T  TFVSLVSIWNY GRVFSGFVSE  ++++K PR LM+T +LLL C G LL+AF  P
Sbjct  361   KKTRSTFVSLVSIWNYLGRVFSGFVSEYFLQKYKFPRPLMLTLTLLLSCVGHLLIAFDVP  420

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
               +Y AS+I+GF +G Q  LLF IISELFGLKYY+TL+N G  ASPLG Y+LNVK+ G L
Sbjct  421   NGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSAASPLGLYVLNVKMTGYL  480

Query  259   YDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA KQ+AA G+      EL C+G  C+K+SFI++     FGA+VSL+LVART  +YK
Sbjct  481   YDKEAKKQLAALGLKRIEGQELNCVGVHCFKLSFIIITAATFFGAIVSLILVARTRTFYK  540

Query  94    TDIYKRFRD  68
             +DIYKR+R+
Sbjct  541   SDIYKRYRN  549



>ref|XP_008369817.1| PREDICTED: uncharacterized protein LOC103433347 [Malus domestica]
Length=603

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/559 (57%), Positives = 409/559 (73%), Gaps = 19/559 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             N+ +FV    + +WF +FAS ++M+G+G  YLFG YSKE+K T GYDQ TLNLLG FKD+
Sbjct  15    NLPSFVLFAAKSQWFSVFASLMVMSGSGTIYLFGTYSKELKTTFGYDQETLNLLGFFKDL  74

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GAN+G+ +GLIAEVTPT FVLL+G+AMNF GYF++WL VT +IAKP++W MC+Y+C+ AN
Sbjct  75    GANIGIFAGLIAEVTPTSFVLLIGAAMNFLGYFMMWLGVTGKIAKPEIWHMCVYMCIAAN  134

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYG-NDSQNLILLIG  1154
             S +F NTG +VTCVKNFP SRG+M+GL+KG++GLSGA+ TQ+YLA+YG  D + LILLIG
Sbjct  135   SLSFVNTGVMVTCVKNFPQSRGIMIGLLKGYIGLSGAIITQIYLALYGFQDRRALILLIG  194

Query  1153  WLPAILSIVFIPSIRPMKISS------HPNETKVFFEYLGISITLALCLMGLTIAQKYVR  992
             WLPA +S+VF+ +IRP+KI++         + KVFF +L +SI LAL LM +T+ QK V 
Sbjct  195   WLPAAISVVFLCTIRPIKITAAAENQQQKRQLKVFFRFLYVSIVLALFLMAMTLTQKSVV  254

Query  991   FSHFAYIACATIVCALLFLPFLIAVMEELA----TRKEKKKQLL--SSENVEDppppaen  830
             F   A    A +VC LL +P LI + EEL     T++E  +  L  + E  +    P E 
Sbjct  255   FPRAAQAMTAAVVCFLLLIPLLIIIREELVSWTLTKQEPHRIALEETQEQGQPDQGPQEL  314

Query  829   iekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNL  650
                 E +  G  S F NIFKKP RGEDY+ILQA+LS+DMLL+FI    G G S  A DNL
Sbjct  315   ELDQEIKPKGT-SLFSNIFKKPPRGEDYTILQAILSIDMLLIFIATLFGLGSSFTATDNL  373

Query  649   GQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCA  470
             GQIGE+LGY P+TI TFVSL+SIWN+FGR+FSGFVSE ++ R+KIPR LM+T  L L   
Sbjct  374   GQIGEALGYKPQTINTFVSLISIWNFFGRIFSGFVSEILLTRYKIPRPLMLTVVLTLEGI  433

Query  469   GDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSY  290
               LL+AF FPGS+Y AS+I+GF+ G QL L   IISE+FGLKYYSTLFNCG LASPLGSY
Sbjct  434   AYLLIAFAFPGSLYIASVIVGFTLGAQLPLALAIISEVFGLKYYSTLFNCGHLASPLGSY  493

Query  289   ILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLV  125
             +LNV++ G LYD EA K++A  G+      +LTC+GT+CYK+SF VL    L  AL SL+
Sbjct  494   LLNVRVTGMLYDREAEKELARLGLHRIKGQDLTCIGTRCYKLSFTVLTATTLISALASLI  553

Query  124   LVARTAAYYKTDIYKRFRD  68
             L+ RT  +YK+DIYK+FR+
Sbjct  554   LLMRTLKFYKSDIYKKFRE  572



>ref|XP_007142881.1| hypothetical protein PHAVU_007G024800g [Phaseolus vulgaris]
 gb|ESW14875.1| hypothetical protein PHAVU_007G024800g [Phaseolus vulgaris]
Length=636

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/554 (57%), Positives = 403/554 (73%), Gaps = 12/554 (2%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             ++M++   Q+  GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD
Sbjct  50    RDMKSLTLQVITGRWFVVFASFLIMAAAGATYMFGLYSGDIKTTLGYDQTTLNLLSFFKD  109

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G NVGVLSGLI E+TP W VL +G+ +NF GYF+IWLSVT++IAKP+VWQMCLYIC+GA
Sbjct  110   LGTNVGVLSGLINELTPPWVVLAIGAVLNFFGYFMIWLSVTQKIAKPQVWQMCLYICIGA  169

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY AIY +D++ LILLIG
Sbjct  170   NSQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYSAIYYDDTRALILLIG  229

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S  F+ +IR MK     NE KVF+ +L IS+ LA  L+ +   QK V F+   Y
Sbjct  230   WLPAAISFAFLRTIRYMKPVRQQNELKVFYNFLYISLGLAGFLLVMITIQKRVNFTQSEY  289

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLS-------SENVEDppppaeniekae  815
                A IV  LLFLP  +  +EE    + K+  L+        +E+    P    N   + 
Sbjct  290   GISAAIVIFLLFLPLAVVSIEEHKIWQSKRLALVDPSPVKIVTESERVKPNETTNGSNSV  349

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
                + D   + N+F  P+RGEDY+ILQAL S+DML+LFIC+ CG G +L AIDNLGQIG+
Sbjct  350   TAVSSDTKWWENVFSPPERGEDYTILQALFSIDMLILFICSICGIGGTLTAIDNLGQIGK  409

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             SL YP ++I TFVSLVSIWNY GRVFSGFVSE  + ++  PR LM+T ++LL C G LL+
Sbjct  410   SLRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLHKYNFPRPLMLTLTMLLSCVGHLLI  469

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AF  P  +Y AS+I+GF +G Q  LLF IISELFGLKYY+TL+N G  ASP+G Y+LNV 
Sbjct  470   AFDVPNGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSAASPVGLYLLNVV  529

Query  274   IVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             + G LYD EA KQ+AA G+      EL C+G  C+K+SFI++     FGA+VS+VLV RT
Sbjct  530   MTGHLYDKEAKKQLAALGLERKEGQELNCVGVHCFKLSFIIITAATFFGAMVSVVLVGRT  589

Query  109   AAYYKTDIYKRFRD  68
               +YK DIYKRFR+
Sbjct  590   RKFYKGDIYKRFRE  603



>ref|XP_006428454.1| hypothetical protein CICLE_v10013568mg [Citrus clementina]
 gb|ESR41694.1| hypothetical protein CICLE_v10013568mg [Citrus clementina]
Length=597

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/530 (58%), Positives = 386/530 (73%), Gaps = 6/530 (1%)
 Frame = -1

Query  1627  LIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLIAEVTPTWFVL  1448
             L +A AGATY+FG+YS +IK +LGYDQSTLNLL   KDVG NVGVLSGLI E+TP W VL
Sbjct  25    LTVAVAGATYMFGLYSSDIKTSLGYDQSTLNLLSFSKDVGGNVGVLSGLINEITPPWVVL  84

Query  1447  LVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALVTCVKNFPASR  1268
              +GS MNF+GYF+IWL+VT RI KP+VWQMCLYIC+GANSQ+FANTGALVTCVKNFP SR
Sbjct  85    AIGSIMNFSGYFMIWLAVTGRIPKPQVWQMCLYICIGANSQSFANTGALVTCVKNFPESR  144

Query  1267  GMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIPSIRPMKISSH  1088
             G +LGL+KGFVGLSGA+ TQLY A YG++S+ LILLI WLPA +S VF+ + R +KI   
Sbjct  145   GSVLGLLKGFVGLSGAILTQLYHAFYGDNSKALILLIAWLPAAISFVFLRTFRIIKIVRQ  204

Query  1087  PNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLFLPFLIAVMEE  908
              NE K+F++ L IS+ LA  LM + I Q    F  F Y+  A++V  LLFLP  I + EE
Sbjct  205   ANELKIFYKMLYISLGLAGFLMVVIILQNKYAFKRFEYVGSASLVLILLFLPIAIVIKEE  264

Query  907   LATRKEKKKQLL-SSENVEDppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQA  731
             ++ RK KK  L  ++ + E         ++A         C  NIFK P RGEDY+ILQA
Sbjct  265   ISVRKSKKPSLEDANSHPELKIVTELPPQQASPSTEAQVCCTENIFKPPDRGEDYTILQA  324

Query  730   LLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSG  551
             L S+DML++FI   CG G +L AIDNLGQI  SLGYP R+  TFVSLVSIWNY GRV +G
Sbjct  325   LFSIDMLIIFIATTCGVGGTLTAIDNLGQISSSLGYPARSTTTFVSLVSIWNYLGRVVAG  384

Query  550   FVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFI  371
             F SE ++K++KIPR L+ TF LL  C G L +A+  P S+Y AS+I+GF +G Q  LLF 
Sbjct  385   FASEILLKKYKIPRPLLFTFVLLFSCVGHLFIAYGIPNSLYAASVIIGFCFGAQWPLLFA  444

Query  370   IISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARGV-----GELT  206
             IISE+FGLKYYSTL+N G +ASP+G+YILNVK+ G+LYD EA+ Q+ A G+      +LT
Sbjct  445   IISEIFGLKYYSTLYNFGAVASPVGAYILNVKVAGQLYDKEALNQMEALGITRQAGQDLT  504

Query  205   CLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             C G QCYK++FI++    LFG LVS++LV RT  +YK DIYK+FR+E  A
Sbjct  505   CNGVQCYKMAFIIITTATLFGCLVSVILVIRTNKFYKGDIYKKFREEAKA  554



>ref|XP_009338584.1| PREDICTED: uncharacterized protein LOC103930905 [Pyrus x bretschneideri]
Length=707

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/556 (56%), Positives = 407/556 (73%), Gaps = 23/556 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             N+ +FV    + RWF +FAS ++M+G+G  YLFG YSKE+K T GYDQ TLNLLG FKD+
Sbjct  15    NLPSFVIFAAKSRWFSVFASLMVMSGSGTIYLFGTYSKELKTTFGYDQETLNLLGFFKDL  74

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GAN+G+ +GLIAEVTPTW VLL+G+AMNF GYF++WL V  +IAKP++W MC+Y+ + AN
Sbjct  75    GANIGIFAGLIAEVTPTWLVLLIGAAMNFFGYFMMWLGVRGKIAKPEIWHMCVYMYIAAN  134

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYG-NDSQNLILLIG  1154
             S +F NTG +VTCVKNFP SRG+M+GL+KG++GLSGA+ TQ+YLA+YG  D + LILLIG
Sbjct  135   SLSFVNTGVMVTCVKNFPQSRGIMIGLLKGYIGLSGAIITQIYLALYGFQDRRALILLIG  194

Query  1153  WLPAILSIVFIPSIRPMKISS------HPNETKVFFEYLGISITLALCLMGLTIAQKYVR  992
             WLPA +S+VF+ +IRP+KI++         + KVFF +L +SI LAL LM +T+ QK V 
Sbjct  195   WLPAAISVVFLCTIRPIKITAAVENQQQKRQHKVFFRFLYVSIVLALFLMAMTLTQKSVV  254

Query  991   FSHFAYIACATIVCALLFLPFLIAVMEELAT---RKEKKKQLLSSENVEDppppaeniek  821
             F   A    A +VC LL +P +I + EEL +    K++ +++   E  E        +E 
Sbjct  255   FPRVAQATTAAVVCFLLLIPLVIIIREELVSWTLTKQEPRRIALEETQE--------LEL  306

Query  820   aeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQI  641
              +E K    S F NIFKKP RGEDY+ILQA+LS+DMLL+FI    G G S  A DNLGQI
Sbjct  307   DQEIKPKGTSFFSNIFKKPPRGEDYTILQAILSIDMLLIFIATLFGLGSSFTATDNLGQI  366

Query  640   GESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDL  461
             GE+LGY P+TI TFVSL+SIWN+FGR+FSGFVSE ++ R+KIPR LM+T  L L     L
Sbjct  367   GEALGYKPQTINTFVSLISIWNFFGRIFSGFVSEILLTRYKIPRPLMLTVVLTLEGIAYL  426

Query  460   LVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILN  281
             LVAF FPGS+Y AS+I+GF+ G QL L   IISE+FGLKYYSTLFNCG LASPLGSY+LN
Sbjct  427   LVAFAFPGSLYIASVIIGFTLGAQLPLALAIISEVFGLKYYSTLFNCGHLASPLGSYLLN  486

Query  280   VKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVA  116
             V++ G LYD EA K++A  G+      +LTC+GT+CYK+SF VL    L  AL SL+L+ 
Sbjct  487   VRVTGMLYDKEAEKELARLGLHRIKGQDLTCIGTRCYKLSFTVLTATTLVSALASLILLM  546

Query  115   RTAAYYKTDIYKRFRD  68
             RT  +Y++DIYK+FR+
Sbjct  547   RTFKFYRSDIYKKFRE  562



>ref|XP_002519465.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42879.1| conserved hypothetical protein [Ricinus communis]
Length=624

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/561 (57%), Positives = 400/561 (71%), Gaps = 20/561 (4%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             ++M+ F F++  GRWFM+FAS LIM+ AGATY+FG+YS +IK +LGYDQSTLNLL  FKD
Sbjct  17    RDMKGFSFRVILGRWFMVFASLLIMSVAGATYMFGLYSNDIKTSLGYDQSTLNLLSFFKD  76

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G NVG+LSGLI EVTP W VL +G+ MNF GYF+IWL+VT  IAKP VWQMCLYIC+GA
Sbjct  77    LGGNVGILSGLINEVTPPWVVLSIGAVMNFFGYFMIWLAVTGHIAKPTVWQMCLYICIGA  136

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ+FANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQLY AIYG++S+ LILLI 
Sbjct  137   NSQSFANTGALVTCVKNFPESRGSILGLLKGFVGLSGAILTQLYHAIYGDNSKALILLIA  196

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S +F+ +IR ++I    NE KVF++ L IS+ LA  LM L I Q    F+   Y
Sbjct  197   WLPAAVSFIFLRTIRIIRIVRQANELKVFYKLLYISLGLAGLLMVLIIIQNKFSFTRIEY  256

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQL-------LSSENVEDppppaeniekae  815
             I+ + +V  LLFLP +I + EE      KK+ L       + +E        A      +
Sbjct  257   ISSSALVVGLLFLPIVIVIKEEYDLWNSKKEALNDPFPVKIVTETPPQVELTASTTPLEQ  316

Query  814   eekAGDY--------SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAI  659
                  +         SC  NIFK P RGEDY+ILQAL SVDML+LFI   CG G +L AI
Sbjct  317   STPHTEIPQPTETQPSCADNIFKPPDRGEDYTILQALFSVDMLILFIATTCGVGGTLTAI  376

Query  658   DNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLL  479
             DNLGQIG +LGYP R+  TFVSLVSIWNY GRV +GF SE ++ ++KIPR L+ TF LL 
Sbjct  377   DNLGQIGNALGYPTRSTTTFVSLVSIWNYLGRVVAGFASEILLTKYKIPRPLLFTFVLLF  436

Query  478   PCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPL  299
              C G LL+AF  P S+Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+
Sbjct  437   SCVGHLLIAFGVPNSLYIASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPI  496

Query  298   GSYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALV  134
             GSYILNV++ G LYD EA+KQ+   G+      +LTC G QCYK++F+++    +FG L+
Sbjct  497   GSYILNVRVAGHLYDKEALKQMKDLGLTREAGQDLTCNGVQCYKLAFLIITAATVFGCLI  556

Query  133   SLVLVARTAAYYKTDIYKRFR  71
             S++LV RT  +Y+ DIYK+FR
Sbjct  557   SVLLVLRTRKFYQGDIYKKFR  577



>gb|KHN11442.1| Putative transporter MCH1 [Glycine soja]
Length=582

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/551 (58%), Positives = 401/551 (73%), Gaps = 9/551 (2%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             ++M++    +  GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQSTLNLL  FKD
Sbjct  10    RDMKSLTVNVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQSTLNLLSFFKD  69

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G+NVG+LSGLI E+TP W VL +G+ +NF GYF+IWLSVTK+IA+PKVWQMCLYIC+GA
Sbjct  70    LGSNVGILSGLINELTPPWVVLAIGAILNFFGYFMIWLSVTKKIARPKVWQMCLYICIGA  129

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY AIY +D+++LILLIG
Sbjct  130   NSQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYHAIYYDDTRSLILLIG  189

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S  F+ +IR MK    PNE KVF+ +L +S+ LA  LM + I Q  V F+   +
Sbjct  190   WLPAAISFAFLRTIRYMKPVRKPNELKVFYNFLYVSLGLAGFLMVMIIVQNKVDFTQSEF  249

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV----EDppppaeniekaeeek  806
                A I+  LLFLP  I  +EE      K+  L+    V    +    P E         
Sbjct  250   GVSAAIMLFLLFLPLTIVSVEEYKVWLSKRLALVDPSPVKIVTDQVMKPNEPTNNGNNSV  309

Query  805   AGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
             + D   + N+F  P RGEDY+ILQAL SVDML+LF+   CG G +L AIDNLGQIG SL 
Sbjct  310   SDDTKWWENVFSPPARGEDYTILQALFSVDMLILFMTCICGVGGTLTAIDNLGQIGTSLR  369

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP +T  TFVSLVSIWNY GRVFSGFVSE  ++++K PR LM+T +LLL C G LL+AF 
Sbjct  370   YPKKTRSTFVSLVSIWNYLGRVFSGFVSEYFLQKYKFPRPLMLTLTLLLSCVGHLLIAFD  429

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
              P  +Y AS+I+GF +G Q  LLF IISELFGLKYY+TL+N G  ASPLG Y+LNVK+ G
Sbjct  430   VPNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSAASPLGLYVLNVKMTG  489

Query  265   RLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              LYD EA KQ+AA G+      EL C+G  C+K+SFI++     FGA+VSL+LVART  +
Sbjct  490   YLYDKEAKKQLAALGLKRIEGQELNCVGVHCFKLSFIIITAATFFGAIVSLILVARTRTF  549

Query  100   YKTDIYKRFRD  68
             YK+DIY+R+R+
Sbjct  550   YKSDIYQRYRN  560



>emb|CDO99801.1| unnamed protein product [Coffea canephora]
Length=612

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/574 (54%), Positives = 400/574 (70%), Gaps = 33/574 (6%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q+   RWFM+FA+  IMA AGATY+FG+YS++IK TLGYDQSTLNLL  FKD+G+NV
Sbjct  19    FAVQVITSRWFMIFATIFIMAAAGATYMFGLYSQQIKTTLGYDQSTLNLLSFFKDLGSNV  78

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGLI EVTP W VL +G+ +NF GYF+IWL+VTKRI+KP+VW MCLYIC+G NSQ+F
Sbjct  79    GVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTKRISKPQVWHMCLYICIGGNSQSF  138

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVT VKNFP SRG++LGL+KGFVGLSGA+ TQLY A+Y +D+++LIL+I WLP +
Sbjct  139   ANTGALVTAVKNFPESRGVVLGLLKGFVGLSGAIITQLYHAVYVDDTKSLILMIAWLPTV  198

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S  F+ +IR MK+    +E KVF+  L IS+ LA  LM + I Q   +FSH  +     
Sbjct  199   VSFAFLRTIRIMKVVRIKHELKVFYRVLYISLGLAGFLMVMIILQNRFKFSHSEFSISGV  258

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQL--------------------------LSSENV  857
             +V  LLFLP  + + EEL T ++KK  L                           + E V
Sbjct  259   VVIILLFLPLAVVIQEELDTWRKKKAALDGISQLKVITENPSPDQAAATDNQPKSTEEQV  318

Query  856   E--DppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCG  683
             E           E+    +  + SC+   F+ P RGED++ILQAL S+DM +LF+   CG
Sbjct  319   ELPSSSAVKNTTEQQPTTEIQEVSCWRTAFRPPNRGEDFTILQALFSMDMFILFLATICG  378

Query  682   QGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTL  503
              G +L AIDNLGQIG SLGYP R+I TFVSLVSIWNY GRV SGFVSE  + ++K PRTL
Sbjct  379   VGGTLTAIDNLGQIGASLGYPKRSISTFVSLVSIWNYLGRVVSGFVSEHFLTKYKFPRTL  438

Query  502   MMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFN  323
             M+T  L++ C G LL+AF     +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N
Sbjct  439   MLTIILVISCTGHLLIAFGVSNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYN  498

Query  322   CGQLASPLGSYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAG  158
              G +ASP+GSY+LNV++ G LYD EA +Q+ A G+      +L C G +C+K+SFI++  
Sbjct  499   FGSVASPIGSYLLNVRVAGHLYDREAERQLNALGLKRKHGEDLNCDGVECFKLSFIIITA  558

Query  157   VNLFGALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             V +FGAL+SL+LV+RT  +YK DIYK+FR+E  A
Sbjct  559   VTVFGALISLILVSRTRNFYKGDIYKKFREEAKA  592



>ref|XP_003536696.1| PREDICTED: uncharacterized protein LOC100776865 [Glycine max]
 gb|KHN05588.1| Putative transporter MCH1 [Glycine soja]
Length=586

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/554 (57%), Positives = 402/554 (73%), Gaps = 13/554 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             ++++   Q+  GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQSTL+LL  FKD+
Sbjct  11    DIKSLSVQVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQSTLDLLSFFKDL  70

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVG+LSGLI E+TP W VL +G+ +NF GYF+IWLSVTK+IAKPKVWQMCLYIC+GAN
Sbjct  71    GSNVGILSGLINELTPPWVVLAIGAILNFFGYFMIWLSVTKKIAKPKVWQMCLYICIGAN  130

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY AIY +D+++LILLIGW
Sbjct  131   SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYHAIYYDDTRSLILLIGW  190

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK    PNE KVF+ +L +S+ LA  LM + I +  V F+   + 
Sbjct  191   LPAAISFAFLRTIRYMKPVRKPNELKVFYNFLYVSLGLAGFLMVMIIVENKVNFTQSEFG  250

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDpppp--------aeniekae  815
               A I+  LLFLP  I  +EE    + K+  L+    V+               N     
Sbjct  251   VSAAIMLFLLFLPLTIVSIEEYKVWQGKRLALVDPSPVKVVTDQGEKVKPNETINGSNNN  310

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
                + D   + N+F  P RGEDY+ILQAL SVDML+LF+   CG G +L AIDNLGQIG 
Sbjct  311   SVSSNDTKWWENVFSPPARGEDYTILQALFSVDMLILFMTCICGVGGTLTAIDNLGQIGT  370

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             SL YP +T  TFVSLVSIWNY GRVFSGFVSE  ++++K PR LM+T +LLL C G LL+
Sbjct  371   SLRYPKKTRSTFVSLVSIWNYLGRVFSGFVSEHFLQKYKFPRPLMLTLTLLLSCVGHLLI  430

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AF  P  +Y AS+I+GF +G Q  LLF IISELFGLKYY+TL+N G +ASPLG Y+LNVK
Sbjct  431   AFDVPNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYVLNVK  490

Query  274   IVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             + G LYD EA KQ+AA G+      EL C+G  C+K+SFI++     FGA+VSL+LVART
Sbjct  491   MTGYLYDKEAKKQLAASGLTREEGHELNCVGVNCFKLSFIIITAATFFGAIVSLILVART  550

Query  109   AAYYKTDIYKRFRD  68
               +Y++DIYKR+RD
Sbjct  551   RTFYRSDIYKRYRD  564



>ref|XP_009333629.1| PREDICTED: uncharacterized protein LOC103926552 [Pyrus x bretschneideri]
Length=641

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/559 (57%), Positives = 407/559 (73%), Gaps = 19/559 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             N+ +FV    + RWF +FAS ++M+G+G  YLFG YSKE+K T GYDQ TLNLLG FKD+
Sbjct  15    NLPSFVIFAAKSRWFSVFASLMVMSGSGTIYLFGTYSKELKTTFGYDQETLNLLGFFKDL  74

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GAN+G+ +GLIAEVTPTW VLL+G+AMNF GY ++WL VT +IAKP++W MC+Y+ + AN
Sbjct  75    GANIGIFAGLIAEVTPTWLVLLIGAAMNFFGYLMMWLGVTGKIAKPEIWHMCVYMYIAAN  134

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYG-NDSQNLILLIG  1154
             S  F NTG +VTCVKNFP SRG+M+GL+KG++GLSGA+ TQ+YLA+YG  D + LILLIG
Sbjct  135   SLGFVNTGVMVTCVKNFPQSRGIMIGLLKGYIGLSGAIITQIYLALYGFQDRRALILLIG  194

Query  1153  WLPAILSIVFIPSIRPMKISS------HPNETKVFFEYLGISITLALCLMGLTIAQKYVR  992
             WLPA +S+VF+ +IRP+KI++         + KVFF +L +SI LAL LM +T+ QK V 
Sbjct  195   WLPAAISVVFLCTIRPIKITAAVENQQQKRQHKVFFRFLYVSIVLALFLMAMTLTQKSVV  254

Query  991   FSHFAYIACATIVCALLFLPFLIAVMEELA----TRKEKKKQLL--SSENVEDppppaen  830
             F   A    A +VC LL +P LI + EEL     T++E ++  L  + E  +    P E 
Sbjct  255   FPRVAQATTAAVVCFLLLIPLLIIIREELVSWTLTKQEPRRIALEETQEQGQRDQGPQEL  314

Query  829   iekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNL  650
                 E +  G  S F NIFKKP RGEDY+ILQA+LS+DMLL+FI    G G S  A DNL
Sbjct  315   ELDQEIKPKGT-SFFSNIFKKPPRGEDYTILQAILSIDMLLIFIATLFGLGSSFTATDNL  373

Query  649   GQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCA  470
             GQIGE+LGY P+TI TFVSL+SIWN+FGR+FSGFVSE ++ R+KIPR LM+T  L L   
Sbjct  374   GQIGEALGYKPQTINTFVSLISIWNFFGRIFSGFVSEILLTRYKIPRPLMLTVVLTLEGI  433

Query  469   GDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSY  290
               LL+AF FPGS+Y AS+I+GF+ G QL L   IISE+FGLKYYSTLFNCG LASPLGSY
Sbjct  434   AYLLIAFAFPGSLYIASVIIGFTLGAQLPLALAIISEVFGLKYYSTLFNCGHLASPLGSY  493

Query  289   ILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLV  125
             +LNV++ G LYD EA K++A  G+      +LTC+GT+CYK+SF VL    L  AL SL+
Sbjct  494   LLNVRVTGMLYDKEAEKELARLGLHRIKGQDLTCIGTRCYKLSFTVLTATTLVSALASLI  553

Query  124   LVARTAAYYKTDIYKRFRD  68
             L+ RT  +Y++DIYK+FR+
Sbjct  554   LLMRTLKFYRSDIYKKFRE  572



>ref|XP_010691115.1| PREDICTED: uncharacterized protein LOC104904540 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/557 (56%), Positives = 403/557 (72%), Gaps = 20/557 (4%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             +FV ++  GRWF++F++ L+M+ AGATY+FG YSK+IK +LGYDQ+TLNLL  FKD+G+ 
Sbjct  13    HFVARVLMGRWFLVFSTLLVMSAAGATYMFGSYSKDIKTSLGYDQTTLNLLSFFKDLGST  72

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+ +GL+ E+ P WFVL VG+ +NF GYF+IWLSVT+RIAKP VWQMCLYICVGANSQ 
Sbjct  73    VGIPAGLLMEIAPPWFVLAVGAVLNFFGYFMIWLSVTRRIAKPAVWQMCLYICVGANSQA  132

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIY-GNDSQNLILLIGWLP  1145
             FANTGALVTCVKNFP SRG++LGL+KGFVGLSGA+ TQ Y A+Y G++S+ LILLIGWLP
Sbjct  133   FANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIITQFYFALYGGHNSKALILLIGWLP  192

Query  1144  AILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
             A++S+ F+ +IR MK+    NE K+F+E L IS+ LA  LM + I QK + F+   YI  
Sbjct  193   AVISLAFLGTIRYMKVVRQKNEVKIFYEMLYISLGLASFLMIMIILQKQLTFTRNEYIGS  252

Query  964   ATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE-------------Dppppaenie  824
                V  LL LP    V EE    K+K++ L ++  V+                PP    E
Sbjct  253   GVAVLILLLLPIYTVVKEEYRLWKKKQEVLQNAPKVDIVVNGGDGKEETVKKSPPKIYDE  312

Query  823   kaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
                 ++  D SCF N+F+ PKRGEDY+ILQAL S+DML+LF+   CG G +L AIDNLGQ
Sbjct  313   TPIVQREAD-SCFQNVFRPPKRGEDYTILQALFSIDMLILFLSVICGIGGTLTAIDNLGQ  371

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IG SLGYPP++I TFVSLVSIWNY GRV +GF SE ++K++K+PR L +TF LLL CAG 
Sbjct  372   IGASLGYPPKSISTFVSLVSIWNYLGRVVAGFYSEHLLKKYKLPRPLFLTFMLLLSCAGH  431

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             LL+AF     +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+G YIL
Sbjct  432   LLIAFNVRNGLYVASVIIGFCFGAQWPLLFGIISEIFGLKYYSTLYNFGSVASPIGGYIL  491

Query  283   NVKIVGRLYDGEAVKQVAA-----RGVGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
             NV+I G LYD EA +Q+ A     R   EL C+G +C+ ++FI++    L G  +SL+LV
Sbjct  492   NVRITGHLYDKEATRQMLALGRSRRSGEELNCVGQECFHLAFIIITAATLVGMFISLILV  551

Query  118   ARTAAYYKTDIYKRFRD  68
              RT  +Y++DIY+RFR+
Sbjct  552   FRTRKFYQSDIYQRFRE  568



>gb|KEH44271.1| MFS transporter [Medicago truncatula]
Length=594

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/554 (56%), Positives = 394/554 (71%), Gaps = 12/554 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q   GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQSTLNLL  FKD 
Sbjct  14    DMKSLTVQFITGRWFVIFASFLIMAAAGATYMFGLYSGDIKTTLGYDQSTLNLLSFFKDF  73

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGVL+GL+ E+ P W VL +G+ +NF GYF+IWLSVTK+IA+PKVWQMCLYIC+GAN
Sbjct  74    GSNVGVLAGLVNELYPPWVVLTIGAILNFFGYFMIWLSVTKKIARPKVWQMCLYICIGAN  133

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY AIY +D++ LIL IGW
Sbjct  134   SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYSAIYYDDTKALILFIGW  193

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK     NE KVF+ +L +S+ LA  L+ + I QK   F+   + 
Sbjct  194   LPAAISFAFLRTIRYMKPVRQVNELKVFYNFLYVSLGLAGFLLVMIIIQKKSSFTQGEFG  253

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE-------Dppppaeniekaee  812
               A +V  LLFLP ++  +EE    + KK  L+    V+              N   +  
Sbjct  254   LSAAVVVFLLFLPLVVVFIEENKIWQSKKHALVDPSPVKIVTEGETVTETEKVNSAVSVS  313

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
                 D   + ++F  P RGEDY+ILQAL S+DML+LF+   CG G +L AIDNLGQIG S
Sbjct  314   APKKDPKWWEDVFNPPARGEDYTILQALFSMDMLILFVACICGVGGTLTAIDNLGQIGTS  373

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             L YP ++I TFVSLVSIWNY GRVFSGFVSE  + +++ PR LM+T +L + C G LL+A
Sbjct  374   LRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLTKYRFPRPLMLTLTLFVSCVGHLLIA  433

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             F  P  +Y AS+I+GF +G Q  LLF IISELFGLKYY+TL+N G +ASPLG Y+LNVKI
Sbjct  434   FDVPEGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYVLNVKI  493

Query  271   VGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G LYD EA KQ+ A G       EL C+G  C+K+SFI++     FGA+VSL+LV+RT 
Sbjct  494   TGHLYDKEAKKQLEALGKHRIEGHELNCVGVDCFKLSFIIITAATFFGAVVSLILVSRTR  553

Query  106   AYYKTDIYKRFRDE  65
              +YK DIYKR+R+E
Sbjct  554   KFYKGDIYKRYREE  567



>emb|CBI30156.3| unnamed protein product [Vitis vinifera]
Length=601

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/532 (58%), Positives = 378/532 (71%), Gaps = 29/532 (5%)
 Frame = -1

Query  1645  MMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLIAEVT  1466
             M+FAS LIM+ AGATY+F +YS EIK +LGYDQ+TLNLL  FKD+G NVGVLSGLI EVT
Sbjct  1     MVFASLLIMSVAGATYMFSLYSGEIKTSLGYDQTTLNLLSFFKDLGGNVGVLSGLINEVT  60

Query  1465  PTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALVTCVK  1286
             P W VL +G+ MNF GYF+IWL+VT RIAKP++WQMCLYIC+GANSQ+FANTGALVTCV+
Sbjct  61    PPWVVLCIGAVMNFFGYFMIWLAVTDRIAKPQIWQMCLYICIGANSQSFANTGALVTCVR  120

Query  1285  NFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIPSIRP  1106
             NFP SRG++LGL+KGFVGLSGA+ TQLY A YG+DS++LIL I WLPA +S VF+ +IR 
Sbjct  121   NFPESRGIVLGLLKGFVGLSGAIITQLYRAFYGDDSKSLILFIAWLPAAVSFVFLRTIRI  180

Query  1105  MKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLFLPFL  926
             MK+    NE KVF++ L +S+ LA  LM + I Q    FS   Y   A +V  LLFLP  
Sbjct  181   MKVGRQANELKVFYDLLYMSLGLAGFLMVIIIIQNKFTFSRIEYSGSAAVVLILLFLPLA  240

Query  925   IAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSCFGNIFKKPKRGEDY  746
             + + EE+   K       + EN E                    SCF  +FK P RGEDY
Sbjct  241   VVIKEEINIWK-------APENAEKSV-----------------SCFKTMFKPPDRGEDY  276

Query  745   SILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFG  566
             +ILQAL S+DML+LFI   CG G +L AIDNLGQIG S GY   +  TFVSLVSIWNY G
Sbjct  277   TILQALFSIDMLILFIVTTCGVGGTLTAIDNLGQIGSSQGYTAHSTTTFVSLVSIWNYLG  336

Query  565   RVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQL  386
             RV SGF SE  + R+K PR LM+TF LL  C G LL+AF  P S+Y AS+I+GF +G Q 
Sbjct  337   RVVSGFASEIFLTRYKFPRPLMLTFVLLFSCVGHLLIAFAVPNSLYFASVIIGFCFGAQW  396

Query  385   TLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARGV----  218
              L+F IISELFGLKYYSTL+N G +ASP+GSYILNVK+ G LYD EA+KQ+ A GV    
Sbjct  397   PLVFAIISELFGLKYYSTLYNFGAVASPVGSYILNVKVAGHLYDKEALKQLEASGVTRVA  456

Query  217   -GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDE  65
               +LTC G  CYK+SFI++    LFG ++S +LV RT  +Y+ DIYK+FR E
Sbjct  457   GQDLTCTGAACYKLSFIIITAATLFGCIISFILVIRTKKFYQGDIYKKFRQE  508



>ref|XP_007142882.1| hypothetical protein PHAVU_007G024900g [Phaseolus vulgaris]
 gb|ESW14876.1| hypothetical protein PHAVU_007G024900g [Phaseolus vulgaris]
Length=596

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/550 (57%), Positives = 399/550 (73%), Gaps = 9/550 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWF++FASFLIMA AGATY+F +YS +IK TLGYDQSTLNLL  FKD+
Sbjct  17    DMKSLTLQVITGRWFVVFASFLIMAAAGATYMFALYSGDIKTTLGYDQSTLNLLSFFKDL  76

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVG+L+GLI E TP W VL +G+ +NF GYF+IWLSVT++IA+P+VWQMCLYIC+GAN
Sbjct  77    GSNVGILAGLINEFTPPWVVLTIGAVLNFFGYFMIWLSVTQKIARPQVWQMCLYICIGAN  136

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY AIY +D++ LILLIGW
Sbjct  137   SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYSAIYYDDTRALILLIGW  196

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK     NE KVF+ +L IS+ LA  L+ +   QK V F+   Y 
Sbjct  197   LPAAISFAFLRTIRYMKPVRQLNELKVFYNFLYISLGLAGFLLVMITIQKRVNFTQSEYG  256

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV----EDppppaeniekaeeekA  803
               A IV  LLFLP L+  +EE    + K+  L+    V    E            +   +
Sbjct  257   VSAGIVIFLLFLPLLVVSIEEHKIWQSKRLALVDPSPVKIVTEGEKVKPNEATDGKTAVS  316

Query  802   GDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGY  623
              D     N+F  P+RGEDY+ILQAL S+DML+LF+   CG G +L AIDNLGQIG SL Y
Sbjct  317   SDTKWCENVFSPPERGEDYTILQALFSIDMLILFMTCICGVGGTLTAIDNLGQIGSSLRY  376

Query  622   PPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPF  443
             P ++I TFVSLVSIWNY GRVFSGFVSE  + ++K PR LM+T +LL+ C G LL+AF  
Sbjct  377   PKKSISTFVSLVSIWNYLGRVFSGFVSEHFLVKYKFPRPLMLTLTLLVSCVGHLLIAFDV  436

Query  442   PGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGR  263
             P  +Y AS+I+GF +G Q  LLF IISELFGLKYY+TL+N G +ASPLG Y+LNVK+ G 
Sbjct  437   PNGLYAASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGLYLLNVKMTGY  496

Query  262   LYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYY  98
             LYD EA KQ+AA G+      EL C+G  C+++SFIV+A    FGA+VSL+LVART  +Y
Sbjct  497   LYDKEAKKQLAALGLQRKEGQELKCIGVDCFRLSFIVIAAATFFGAIVSLILVARTRKFY  556

Query  97    KTDIYKRFRD  68
              +DIYKRFRD
Sbjct  557   SSDIYKRFRD  566



>ref|XP_008233256.1| PREDICTED: uncharacterized protein LOC103332309 [Prunus mume]
Length=600

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/564 (56%), Positives = 402/564 (71%), Gaps = 19/564 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             N +    Q+  GRWFMMFAS LIM+ AGATY+FG+YS +IK+ LGYDQ+TLNLL  FKD+
Sbjct  14    NTKALTLQVLNGRWFMMFASLLIMSAAGATYMFGIYSSDIKSVLGYDQTTLNLLSFFKDL  73

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVLSGLI EVTP W VL +G+ +NF GYF+IW++VTK+IA+P+VW MCLYIC+GAN
Sbjct  74    GANVGVLSGLINEVTPPWVVLSIGAVLNFFGYFMIWMAVTKKIARPQVWHMCLYICIGAN  133

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY A Y +D++ LILLIGW
Sbjct  134   SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYYAFYYDDTKALILLIGW  193

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA++S  F+ +IR MK++  PNE KVF+  L IS+ LA  LM + I +K V F+   Y 
Sbjct  194   LPAVISFAFLRTIRIMKVTRRPNELKVFYNMLYISLGLAGFLMIMIIVEKSVTFNQSEYG  253

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGD--  797
             A A +V  LL LP  + ++EE    + KK +L    +++      +    +++       
Sbjct  254   ASAAMVIFLLVLPLAVVIIEEFKIWEGKKVELNGGSDLKIVTEKPQPEVTSDDLSRPRET  313

Query  796   ------------YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
                          SC+  +F+ P RGEDY+ILQAL S+DML+LF+   CG G +L AIDN
Sbjct  314   LATTTTEAEPPTASCWKTMFRPPDRGEDYTILQALFSIDMLILFMACICGVGGTLTAIDN  373

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG S GYP R+  TFVSLVSIWNY GRV SGF SE ++KR+K PR LM+T +LLL C
Sbjct  374   LGQIGTSFGYPKRSASTFVSLVSIWNYLGRVMSGFGSEILLKRYKFPRPLMLTLTLLLSC  433

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              G LL+AF  P  +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N G  ASP+G 
Sbjct  434   VGHLLIAFNVPNGLYVASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSSASPVGL  493

Query  292   YILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             Y+LNVK+ G LYD EA KQ+AA G+      EL C G +C+K++FIV+A    FG LVSL
Sbjct  494   YLLNVKLTGHLYDKEAKKQLAASGLVRKAEEELNCAGGECFKLAFIVIAAATFFGTLVSL  553

Query  127   VLVARTAAYYKTDIYKRFRDEMGA  56
             +LV RT  +YK+DIYK+FR+   A
Sbjct  554   ILVIRTRKFYKSDIYKKFREAAQA  577



>ref|XP_003553561.1| PREDICTED: uncharacterized protein LOC100798313 [Glycine max]
 gb|KHN02306.1| Putative transporter MCH1 [Glycine soja]
Length=571

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/552 (56%), Positives = 388/552 (70%), Gaps = 11/552 (2%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M+  ++ +  GRWFM+FAS LIMA AGA Y+FG+YS E+K +LGYDQ+TLNL   FKDVG
Sbjct  1     MKTLIYHVLTGRWFMLFASLLIMAAAGAAYMFGMYSNEVKTSLGYDQTTLNLFSFFKDVG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             A VG++SGL+ E+TP W VL +G  MNF GYF+I+L+VT RIAKP+VWQMCLYIC+G+NS
Sbjct  61    ATVGIISGLVNEITPPWVVLSIGVIMNFFGYFMIFLAVTGRIAKPQVWQMCLYICIGSNS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGN-DSQNLILLIGW  1151
             Q FANTG  VTCVKNFP SRG +LGL+KG+VGLSGA+  QLY A YG+ + Q LILLI W
Sbjct  121   QTFANTGGTVTCVKNFPGSRGNVLGLLKGYVGLSGAIIAQLYHAFYGDHNPQALILLIAW  180

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S +F+P+IR      HPNE KVF+  L IS+ LA  LM L I Q  +RF+   YI
Sbjct  181   LPAAVSFLFLPTIRIFNTVHHPNENKVFYHLLYISLVLAGFLMVLIIMQNKLRFTRPEYI  240

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSS-----ENVEDppppaeniekaeeek  806
             A   +V   L LP ++   EE+   K K + L  S     E +  P    + +       
Sbjct  241   ADGVVVFFFLLLPLVVVFREEINQLKAKTQGLTDSVKVVTEVIPPPNVVEQEVPSTTTSS  300

Query  805   AGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
                 SCFGNI K PKRGEDY+ILQAL S+DML+LFI    G G +L AIDNLGQIG SLG
Sbjct  301   HEKSSCFGNILKPPKRGEDYTILQALFSIDMLILFIATTFGAGGALTAIDNLGQIGRSLG  360

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP ++I T VSL+SIWNY GRV +G+ SE  + ++K+PR  M+T  LLL C G +L+A  
Sbjct  361   YPRKSITTCVSLLSIWNYLGRVVAGYASEIFLTKYKLPRPYMLTLVLLLSCVGHILIAIG  420

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
              P S+Y AS+I+GF  G Q  L+F IISE+FGLKYYSTLFN G +ASP+GSYILNVK+ G
Sbjct  421   APNSLYLASVIIGFCLGAQWPLMFAIISEIFGLKYYSTLFNFGAVASPVGSYILNVKVAG  480

Query  265   RLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              LYD EA+KQ+ A+G+      +LTC+G QCYK++FI++    LF  +VS VLV RT  +
Sbjct  481   VLYDKEALKQLKAKGLTREEGKDLTCVGVQCYKMAFIIITASTLFACIVSFVLVVRTRKF  540

Query  100   YKTDIYKRFRDE  65
             YK DIY++FR E
Sbjct  541   YKGDIYRKFRVE  552



>ref|XP_009141793.1| PREDICTED: uncharacterized protein LOC103865707 [Brassica rapa]
Length=588

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/562 (56%), Positives = 402/562 (72%), Gaps = 26/562 (5%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWFM F S  IM+ AGATY+F +YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  9     SMKSLTIQILTGRWFMFFGSLWIMSAAGATYMFSLYSGDIKKTLGYDQTTLNLLSFFKDL  68

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GLI EVTP WF+L++G+ +NF GYF+IWL+VTKRI+KP+VW MCLYICVGAN
Sbjct  69    GANVGVLAGLINEVTPPWFILIIGAVLNFFGYFMIWLAVTKRISKPQVWHMCLYICVGAN  128

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D+++LIL+IGW
Sbjct  129   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGEDTKSLILMIGW  188

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+    NE KVF+ +L IS+ LA  LM   I  K   F+   Y 
Sbjct  189   LPAAVSFAFLRTIRNMKVVRQTNELKVFYNFLYISLGLATFLMVAIITDKLSGFTRSEYG  248

Query  970   ACATIVCALLFLPFLIAVMEE--LATRKE-------------KKKQLLSSENVEDppppa  836
               A +V  LL LP ++ V EE  L + K+             +K  L SSE  +D     
Sbjct  249   GSAAVVIILLVLPIIVVVWEEKKLWSNKQVALNDPAPINIVTEKPNLDSSEVKDDNERST  308

Query  835   eniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAID  656
             E             SC+  +F  P+RG+DY+ILQAL SVDML+LF+   CG G +L AID
Sbjct  309   EAESVKTA------SCWTTMFSPPERGDDYTILQALFSVDMLILFLATICGVGGTLTAID  362

Query  655   NLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLP  476
             NLGQIG SLGYP R++ TFVSLVSIWNYFGRV SG VSE  + +++ PR LM+T  LLL 
Sbjct  363   NLGQIGGSLGYPKRSVSTFVSLVSIWNYFGRVVSGVVSEIFLIKYRFPRPLMLTLILLLS  422

Query  475   CAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLG  296
             CAG LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+G
Sbjct  423   CAGHLLIAFNAPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIG  482

Query  295   SYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVS  131
             SY+LNV++ G LYD EA KQ  A  +      +LTC GT C+K+SFI++  V LFG LVS
Sbjct  483   SYLLNVRVAGYLYDVEAEKQNNALKIPRIDGRDLTCTGTACFKLSFIIITAVTLFGVLVS  542

Query  130   LVLVARTAAYYKTDIYKRFRDE  65
             ++LV RT  +YK+DIYK+FR++
Sbjct  543   MILVIRTRKFYKSDIYKKFREK  564



>emb|CDY24976.1| BnaC03g21960D [Brassica napus]
Length=579

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/552 (56%), Positives = 396/552 (72%), Gaps = 27/552 (5%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+    Q+  GRWFM FAS LIM+ AGATY+F +YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  10    SMKTLTVQILTGRWFMFFASLLIMSAAGATYMFSLYSGDIKRTLGYDQTTLNLLSFFKDL  69

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GLI EVTP WF+L++G+ +NF GYF+IWL+VTKRI KP VW MCLYIC+GAN
Sbjct  70    GANVGVLAGLINEVTPPWFILIIGAILNFFGYFMIWLAVTKRIPKPHVWHMCLYICIGAN  129

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D+++LIL+IGW
Sbjct  130   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGEDTKSLILMIGW  189

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+    NE KVF+ +L IS+ LA  LM   IA K   F+   + 
Sbjct  190   LPAAISFAFLRTIRNMKVVRQKNELKVFYNFLYISLGLATFLMAAIIADKLSGFTRSEFG  249

Query  970   ACATIVCALLFLPFL-----IAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeek  806
               A +V  LL LP L     +A+ +        +K+ L S   E                
Sbjct  250   GSAAVVIILLLLPKLWTDKQVALNDPAPINIVTEKRSLDSSESEKTA-------------  296

Query  805   AGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
                 SC+  +F  P+RG+DY+ILQAL SVDML+LF+   CG G +L AIDNLGQIG SLG
Sbjct  297   ----SCWTTMFSPPERGDDYTILQALFSVDMLILFLATICGVGGTLTAIDNLGQIGGSLG  352

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP R++ TFVSLVSIWNYFGRV SG VSE  + ++K PR L++T  LLL CAG LL+AF 
Sbjct  353   YPQRSVSTFVSLVSIWNYFGRVVSGVVSEIFLIKYKFPRPLVLTLILLLSCAGHLLIAFN  412

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
              PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSY+LNV++ G
Sbjct  413   VPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRVAG  472

Query  265   RLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              LYD EA KQ  A G+      +L+C GT C+K+SFI++  V LFG LVS++LV RT  +
Sbjct  473   YLYDKEAEKQNNALGIQRSDGQDLSCTGTACFKLSFIIITAVTLFGVLVSMILVIRTRKF  532

Query  100   YKTDIYKRFRDE  65
             YK+DIYK+FR++
Sbjct  533   YKSDIYKKFREK  544



>ref|XP_004497124.1| PREDICTED: uncharacterized protein LOC101508657 [Cicer arietinum]
Length=607

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/561 (55%), Positives = 396/561 (71%), Gaps = 19/561 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             + ++   Q   GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQSTLNLL  FKD 
Sbjct  14    DTKSLAVQFITGRWFVVFASFLIMAAAGATYMFGLYSSDIKITLGYDQSTLNLLSFFKDF  73

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGVLSGLI E++P W VL +G+ +NF GYF+IWLSVTK+I++P+VWQMCLYIC+GAN
Sbjct  74    GSNVGVLSGLINELSPPWVVLTIGAVLNFFGYFMIWLSVTKKISRPQVWQMCLYICIGAN  133

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY AIY +D++ LIL IGW
Sbjct  134   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYSAIYYDDTKALILFIGW  193

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK     NE KVF+ +L IS+ LA  L+ + I +K   FS   + 
Sbjct  194   LPAAISFAFLRTIRYMKPVRQVNELKVFYNFLYISLGLAGFLLVMIIIEKKSNFSQGEFG  253

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE--------------Dppppae  833
               A +V  LLFLP ++  +EE      KK  L+    V+              +      
Sbjct  254   FSAAVVIFLLFLPLVVVFIEEHKIWMNKKLALVDPSPVKIVTESETDKKVNNINSNRTNT  313

Query  832   niekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
              +  +   K  D   + ++F  PKRGEDY+ILQAL S+DML+LF+   CG G +L AIDN
Sbjct  314   AVSVSSVPKKDDVKWWQDVFNPPKRGEDYTILQALFSIDMLILFVACICGVGGTLTAIDN  373

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG SL YP ++I TFVSLVSIWNY GRVFSGF SE  +++++ PR LM+T +L + C
Sbjct  374   LGQIGTSLRYPKKSISTFVSLVSIWNYLGRVFSGFASEHFLRKYRFPRPLMLTLTLFVSC  433

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              G LL+AF  P  +Y AS+I+GF +G Q  LLF IISELFGLKYY+TL+N G +ASPLG 
Sbjct  434   VGHLLIAFDVPDGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSVASPLGL  493

Query  292   YILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             Y+LNVKI G LYD EA KQ+ A G       EL C+G  C+K+SFI++      GA+VSL
Sbjct  494   YVLNVKITGHLYDREAKKQLLAIGKVREQGQELNCVGVDCFKLSFIIITIATFLGAVVSL  553

Query  127   VLVARTAAYYKTDIYKRFRDE  65
             VLVART  +YK DIYKR+R+E
Sbjct  554   VLVARTRKFYKGDIYKRYREE  574



>emb|CDX93282.1| BnaC04g46140D [Brassica napus]
Length=576

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/547 (57%), Positives = 396/547 (72%), Gaps = 8/547 (1%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWFM F S  IM+ AGATY+F +YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  9     SMKSLTIQILTGRWFMFFGSLWIMSAAGATYMFSLYSGDIKKTLGYDQTTLNLLSFFKDL  68

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GLI EVTP WF+L++G+ +NF GYF+IWL+VTKRI+KP+VW MCLYICVGAN
Sbjct  69    GANVGVLAGLINEVTPPWFILIIGAVLNFFGYFMIWLAVTKRISKPQVWHMCLYICVGAN  128

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D+++LIL+IGW
Sbjct  129   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGEDTKSLILMIGW  188

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+    NE KVF+ +L IS+ LA  LM   I  K   F+   Y 
Sbjct  189   LPAAVSFAFLRTIRNMKVVRQTNELKVFYNFLYISLGLATFLMVAIITDKLSGFTRSEYG  248

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYS  791
               A +V  LL LP ++ V EE     +K+  L     +       E       E     S
Sbjct  249   GSAAVVIILLVLPIIVVVWEEKKLWSDKQVALNDPAPIN---IVTEKPNLDLSESVKTAS  305

Query  790   CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRT  611
             C+  +F  P+RG+DY+ILQAL SVDML+LF+   CG G +L AIDNLGQIG SLGYP R+
Sbjct  306   CWTTMFSPPERGDDYTILQALFSVDMLILFLATICGVGGTLTAIDNLGQIGGSLGYPKRS  365

Query  610   IGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSV  431
             + TFVSLVSIWNYFGRV SG VSE  + +++ PR LM+T  LLL CAG LL+AF  PG +
Sbjct  366   VSTFVSLVSIWNYFGRVVSGVVSEIFLIKYRFPRPLMLTLILLLSCAGHLLIAFNVPGGL  425

Query  430   YGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDG  251
             Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSY+LNV++ G LYD 
Sbjct  426   YVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVRVAGYLYDV  485

Query  250   EAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDI  86
             EA KQ  A  +      +LTC GT C+K+SFI++  V LFG LVS++LV RT  +YK+DI
Sbjct  486   EAEKQNNALKIPRIDGRDLTCTGTACFKLSFIIITAVTLFGVLVSMILVIRTRKFYKSDI  545

Query  85    YKRFRDE  65
             YK+FR++
Sbjct  546   YKKFREK  552



>ref|XP_004497125.1| PREDICTED: uncharacterized protein LOC101508976 [Cicer arietinum]
Length=591

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/547 (55%), Positives = 391/547 (71%), Gaps = 8/547 (1%)
 Frame = -1

Query  1684  ENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGA  1505
             +  + Q+  GRWF++FASFLIM+ +GATY+FG+YS +IK +L YDQ+TLNLL  FKD+G 
Sbjct  16    KTLITQVITGRWFVVFASFLIMSASGATYMFGLYSSDIKTSLAYDQTTLNLLSFFKDLGG  75

Query  1504  NVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQ  1325
             N GVLSGLI E+TP W VL +GS +NF GYF+IWL+VTK+I KP+VWQMCLYIC+GANSQ
Sbjct  76    NFGVLSGLINELTPPWVVLAMGSLLNFFGYFMIWLAVTKKIKKPQVWQMCLYICIGANSQ  135

Query  1324  NFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLP  1145
             +FANTG+LVTCVKNFP +RG++LG++KG+VGLSGA+ TQLY AIY +D++ LILLI WLP
Sbjct  136   SFANTGSLVTCVKNFPETRGVVLGILKGYVGLSGAIITQLYSAIYFDDTKALILLIAWLP  195

Query  1144  AILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
             A++S VF+  +R MK     NE  VF+++L IS+ LA  L+ + I QK V F    YI  
Sbjct  196   AVISFVFLRIVRYMKPVRQSNELGVFYKFLYISLGLAGFLLVMIIVQKKVSFKQSEYIGS  255

Query  964   ATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAG---DY  794
             A++V  LLFLP  +  +E+   +   K    S +   +           +    G   + 
Sbjct  256   ASVVLILLFLPLAVVFVEQKKIQMSHKLDPFSVKIATNHQVEKVANCDDDAVVLGGEKET  315

Query  793   SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPR  614
               + NIF  P++GED++ILQAL S+DMLLLF    CG G +L AIDNLGQIG SLGYP  
Sbjct  316   RWWQNIFSPPEKGEDFTILQALFSIDMLLLFFAGTCGVGGTLTAIDNLGQIGTSLGYPKT  375

Query  613   TIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGS  434
             +I TFVSLVSIWNY GRVFSGFVSE  + ++  PR LM+T ++ L C G LL+AF  P  
Sbjct  376   SISTFVSLVSIWNYLGRVFSGFVSEHFLTKYNFPRPLMLTLTMFLSCVGHLLIAFDVPNG  435

Query  433   VYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYD  254
             +Y AS+I+GF +G Q  L+F IISELFGLKYYSTL+N G +ASP+G Y+LNV++ G LYD
Sbjct  436   LYVASVIIGFCFGAQWPLIFAIISELFGLKYYSTLYNFGGVASPIGLYVLNVRVAGHLYD  495

Query  253   GEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
              EA KQ+   GV      EL C+G  CYK+SFI++    LFGA++SL+LVART  +YK D
Sbjct  496   KEAKKQLLKSGVPRKYGHELNCVGASCYKLSFIIITATTLFGAIISLILVARTIKFYKGD  555

Query  88    IYKRFRD  68
             IYKR+R+
Sbjct  556   IYKRYRE  562



>ref|XP_009133348.1| PREDICTED: uncharacterized protein LOC103857852 [Brassica rapa]
Length=600

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/561 (56%), Positives = 406/561 (72%), Gaps = 24/561 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+    Q+  GRWFM FAS LIM+ AGATY+F +YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  10    SMKTLTIQILTGRWFMFFASLLIMSAAGATYMFSLYSGDIKRTLGYDQTTLNLLSFFKDL  69

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GLI EVTP WF+L++G+ +NF GYF+IWL+VTKRI KP+VW MCLYIC+GAN
Sbjct  70    GANVGVLAGLINEVTPPWFILIIGAILNFFGYFMIWLAVTKRIPKPQVWHMCLYICIGAN  129

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D+++LIL+IGW
Sbjct  130   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGEDTKSLILMIGW  189

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+    +E KVF+ +L IS+ LA  LM   IA K   F+   + 
Sbjct  190   LPAAISFAFLRTIRNMKVVRQKDELKVFYNFLYISLGLATFLMAAIIADKLSGFTRSEFG  249

Query  970   ACATIVCALLFLPFLIAVMEE--LATRKE------------KKKQLLSSENVEDppppae  833
               A +V  LL LP LI V+EE  L T K+             +K  L S  V+D    + 
Sbjct  250   GSAAVVIILLLLPVLIVVLEEKKLWTDKQVALNDPAPINIVTEKPSLDSSEVKDSDERST  309

Query  832   niekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
              +E  +       SC+  +F  P+RG+DY+ILQAL SVDML+LF+   CG G +L AIDN
Sbjct  310   EVESEKTA-----SCWTTMFSPPERGDDYTILQALFSVDMLILFLATICGVGGTLTAIDN  364

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG SLGYP R++ TFVSLVSIWNYFGRV SG VSE  + ++K PR L++T  LL  C
Sbjct  365   LGQIGGSLGYPQRSVSTFVSLVSIWNYFGRVVSGVVSEIFLIKYKFPRPLVLTLILLFSC  424

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
             AG LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GS
Sbjct  425   AGHLLIAFNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGS  484

Query  292   YILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             Y+LNV++ G LYD EA KQ  A G+      +L+C GT C+K+SFI++  V LFG LVS+
Sbjct  485   YLLNVRVAGYLYDKEAEKQNNALGIQRSGGQDLSCTGTACFKLSFIIITAVTLFGVLVSM  544

Query  127   VLVARTAAYYKTDIYKRFRDE  65
             +LV RT  +YK+DIYK+FR++
Sbjct  545   ILVIRTRKFYKSDIYKKFREK  565



>ref|XP_008387534.1| PREDICTED: uncharacterized protein LOC103449994 [Malus domestica]
Length=612

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/564 (55%), Positives = 397/564 (70%), Gaps = 24/564 (4%)
 Frame = -1

Query  1696  EQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFK  1517
              + M +F FQ+  GRWFM+FAS LI++ +GATY+FG+YS E+K +LGYDQ+T+NLL  FK
Sbjct  15    NKEMRSFGFQVLHGRWFMVFASMLILSMSGATYMFGLYSBEVKISLGYDQTTVNLLSFFK  74

Query  1516  DVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVG  1337
             D+G NVG+++GLI EVT  W VLL+G+ MNF GYF+IW++VT R +KP+VWQMCLYIC+G
Sbjct  75    DLGGNVGIIAGLINEVTGPWVVLLIGALMNFFGYFMIWMAVTGRTSKPRVWQMCLYICIG  134

Query  1336  ANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLI  1157
             ANSQ F NTGA+V+CVKNFP SRG +LG++KG VGLSGA+ TQL+ A YGND ++LILLI
Sbjct  135   ANSQTFXNTGAVVSCVKNFPESRGSVLGILKGLVGLSGAIITQLFHAFYGNDLKSLILLI  194

Query  1156  GWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFA  977
             GWLPA +S+VF+P IR +K     NE KVF+  L I++ LA  LM + I Q  + FS   
Sbjct  195   GWLPASVSMVFLPIIRLIKYVRQSNELKVFYNLLYITLGLAGFLMAIIIIQHKLXFSRTE  254

Query  976   YIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE----------------Dpp  845
             YI  A +V  LL LP    + EEL  RK K + L     ++                +  
Sbjct  255   YIGSAXVVTVLLCLPLGXVIFEELKIRKSKIRALNDQSELKVVAENPVPAPPPPPPVEVA  314

Query  844   ppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLA  665
              P        + +    SC      +P RGEDY+ILQA+ SVDML+LF+   CG G +L 
Sbjct  315   LPLAAESPQTQSQQKPTSC---CXSRPNRGEDYTILQAVFSVDMLILFLATSCGVGGTLT  371

Query  664   AIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSL  485
             AIDNLGQIG SLGYP  +I TF+SLVSIWNY GRV SGF SE ++K++K PR LM+TF L
Sbjct  372   AIDNLGQIGSSLGYPSDSISTFISLVSIWNYLGRVTSGFSSEVLLKKYKFPRPLMLTFVL  431

Query  484   LLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLAS  305
             LL CAG LL+AF  P S+Y AS+I+GF +G Q  L+F IISE+FGLKYY+TL N G  AS
Sbjct  432   LLSCAGHLLIAFGVPNSLYFASVIIGFCFGAQWPLIFAIISEIFGLKYYATLINVGGAAS  491

Query  304   PLGSYILNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGA  140
             P+G+Y+LNVK+ G LYD EA+KQ+ A    R  GE L C+G QCYK++FI++A V  FG+
Sbjct  492   PIGAYLLNVKVAGNLYDAEALKQLKALGRTRKXGEDLRCVGVQCYKLAFIIMAAVAFFGS  551

Query  139   LVSLVLVARTAAYYKTDIYKRFRD  68
             LVS +LV RT  +YK+DIYK+FR+
Sbjct  552   LVSFILVIRTRKFYKSDIYKKFRE  575



>ref|XP_010325963.1| PREDICTED: uncharacterized protein LOC101257997 [Solanum lycopersicum]
Length=615

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/594 (51%), Positives = 407/594 (69%), Gaps = 51/594 (9%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
              +M +F   +F GRWFM+FA+ LIM+ AGATY+FG+YS EIK++LGYDQ+TLNLL  FKD
Sbjct  15    NSMASFGHHVFTGRWFMVFANLLIMSMAGATYMFGLYSDEIKSSLGYDQTTLNLLSFFKD  74

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G N+G++SGLI EVTP W VL +G+ MNF GYF+IWL VT  IAKP++WQMCLYIC+GA
Sbjct  75    LGGNIGIISGLINEVTPPWVVLFIGAIMNFFGYFMIWLCVTGHIAKPRIWQMCLYICIGA  134

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQLY A YGN+ ++LILLIG
Sbjct  135   NSQTFANTGALVTCVKNFPESRGSLLGLLKGFVGLSGAIITQLYHAFYGNNGKSLILLIG  194

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLP+++S +F+ +IR +++    NETK+ +++L IS+ LA  +M + I Q  + F+ F Y
Sbjct  195   WLPSVVSCIFLRTIRILRVVKQANETKILYKFLYISLGLACFIMLVIIIQNKINFARFEY  254

Query  973   IACATIVCALLFLPFLIAVMEELA--------------------------TRKEK-----  887
                A +V  LLF P +I   EE+                           T+ +K     
Sbjct  255   AGSAAVVLILLFAPLIIVFQEEVKLWNAKQQALDEPRLKVVSENPPSVELTQPQKLALSE  314

Query  886   -----------KKQLLS----SENVEDppppaeniekaeeekAGDYSCFGNIFKKPKRGE  752
                        ++Q L+     E +             +E +  + SCF N+F  P RGE
Sbjct  315   SEESLTSVDLSQRQKLALSEFEEKLSSVDLTQPQKLAQKEYEEKETSCFSNVFNPPPRGE  374

Query  751   DYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNY  572
             DY+ILQAL S+DM++LFI    G G +L AIDNLGQIG++LGYP ++I TFVSLVSIWNY
Sbjct  375   DYTILQALFSIDMIILFIATTFGVGGTLTAIDNLGQIGKALGYPEKSITTFVSLVSIWNY  434

Query  571   FGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGV  392
              GRV SGFVSE  +K++K PR +M+T  LLL C+G LL+AF  P S+Y AS+++GF +G 
Sbjct  435   LGRVVSGFVSEIFLKKYKFPRPMMLTLVLLLSCSGHLLIAFGVPNSLYIASILMGFCFGA  494

Query  391   QLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARGVG-  215
             Q  L+F IISELFGLKYYSTL+N G  ASP+G+Y+LNV++ G LYD  A KQ+ A+G+  
Sbjct  495   QWPLIFAIISELFGLKYYSTLYNFGGGASPVGAYLLNVRVTGHLYDKVAKKQMLAKGLKR  554

Query  214   ----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDE  65
                 +LTC+G +CYK++F+++ G  L    +SL+LV RT  +YK DIYK+FR++
Sbjct  555   EIGQDLTCIGVECYKMAFLIITGATLLSCAISLILVIRTRKFYKGDIYKKFREQ  608



>ref|XP_010509061.1| PREDICTED: uncharacterized protein LOC104785527 [Camelina sativa]
Length=594

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/558 (55%), Positives = 400/558 (72%), Gaps = 21/558 (4%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M++   Q+  GRWFM FAS L+M+ AGATY+F +YS +IK TLGYDQ+TLN L  FKD+G
Sbjct  10    MKSLAIQILTGRWFMFFASLLVMSMAGATYMFSLYSSDIKKTLGYDQTTLNPLSFFKDLG  69

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVGVL+GL+ EVTP W VLL+G+ +NF GYF+IWL+VTKRI+KP+VW MCLYICVGANS
Sbjct  70    ANVGVLAGLLNEVTPPWVVLLIGAVLNFFGYFMIWLAVTKRISKPQVWHMCLYICVGANS  129

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D++ LIL+IGWL
Sbjct  130   QAFANTGSLVTCVKNFPESRGVILGILKGYVGLSGAIITQLYHAFYGEDTKALILMIGWL  189

Query  1147  PAILS-----IVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSH  983
             PA +S       F+ +IR M++    NE KVF+ +  IS+ LA  LM   I  K   F+ 
Sbjct  190   PAAVSNYPTSFAFLRTIRIMEVQRQTNEVKVFYNFFYISLGLATFLMLAIIIDKLSGFTR  249

Query  982   FAYIACATIVCALLFLPFLIAVMEELATRKEKKKQL--LSSENVEDppppaeniekaeee  809
               +   A +V  LL LP ++  +EE     EK+  L  L+  N+       ++++   E 
Sbjct  250   SEFGGSAAVVIVLLLLPIIVVFLEEKKLWTEKQVALNDLAQINIVPEKSNIDSLKDENEG  309

Query  808   kAGDY-----SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
                +      SC+  +F +PKRGEDY+ILQAL SVDML+LF+ + CG G +L AIDNLGQ
Sbjct  310   SEKEERVKMKSCWTTMFNQPKRGEDYTILQALFSVDMLILFLASICGVGGTLTAIDNLGQ  369

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IG SLGYP R I TFVSLVSIWNYFGRV    VSE I+ ++K PR LM+T  LLL CAG 
Sbjct  370   IGSSLGYPKRGISTFVSLVSIWNYFGRV----VSEIILVKYKFPRPLMLTMVLLLSCAGH  425

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             LL+AF  PG +Y AS+I+GF +G Q  L+F IISE+FGLK+YSTL+N G +ASP+GSY+L
Sbjct  426   LLIAFNVPGGLYVASVIIGFCFGAQWPLIFAIISEIFGLKHYSTLYNFGSVASPVGSYLL  485

Query  283   NVKIVGRLYDGEAVKQ-----VAARGVGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
             NV++ G LYD EA KQ     +  +GV +L+C+GT C+K+SFI++  V LFG  VS +LV
Sbjct  486   NVRVAGYLYDVEADKQNKTLRITRKGVQDLSCIGTSCFKLSFIIITAVTLFGVFVSTILV  545

Query  118   ARTAAYYKTDIYKRFRDE  65
              RT  +YK+DIYK+FR++
Sbjct  546   IRTKTFYKSDIYKKFREK  563



>gb|KEH44270.1| MFS transporter [Medicago truncatula]
Length=588

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/554 (55%), Positives = 394/554 (71%), Gaps = 12/554 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWF++FASFLIM+ AGATY+FG+YS +IK TLGYDQSTL+LL  FKD 
Sbjct  10    DMKSLTVQVITGRWFVIFASFLIMSAAGATYMFGLYSSDIKETLGYDQSTLDLLSFFKDF  69

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVG+L+GLI E++P W VL +G+ +NF GYF+IWLS+TK+IA+P VWQMCLYIC+GAN
Sbjct  70    GSNVGILAGLINEISPPWVVLAIGAILNFFGYFMIWLSITKKIARPHVWQMCLYICIGAN  129

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG++GLSGA+ TQLY AIY NDS+ LILLIGW
Sbjct  130   SQSFANTGSLVTCVKNFPESRGAVLGILKGYLGLSGAIITQLYSAIYYNDSKALILLIGW  189

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR +K     NE KVF+ +L IS+ LA  L+ + I +K   F+   + 
Sbjct  190   LPAAISFAFLRTIRYIKPVRQVNELKVFYNFLYISLALAGFLLVIIIIEKSSSFTQGGFG  249

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE-------Dppppaeniekaee  812
               A +V  LLFLP  +  +EE    + KK  L+    V+              N   +  
Sbjct  250   LSAAVVIFLLFLPLAVVFIEENKIWQSKKLALVDPSPVKIVTEGETVTETEKVNSAVSVS  309

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
                 D   + ++F  P RGEDY+ILQAL S+DML+LF+   CG G SL A+DNLGQIG S
Sbjct  310   VPKKDPKWWEDVFNPPARGEDYTILQALFSIDMLILFVACICGIGGSLTAVDNLGQIGTS  369

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             L YP ++I TFVSLVSIWNY GRVFSGFVSE  + +++ PR LM++ +L + C G LL+A
Sbjct  370   LRYPKKSISTFVSLVSIWNYLGRVFSGFVSEHFLTKYRFPRPLMLSLTLFVSCVGHLLIA  429

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             F  P  +Y AS+I+GF +G Q  LLF IISELFGLKYY+TL+N G + SP+G Y+LNV I
Sbjct  430   FDVPQGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYATLYNFGSITSPIGLYVLNVAI  489

Query  271   VGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G LYD EA KQ+ A G       EL C+G  C+K+SFI++A    FGA+V+L+LVART 
Sbjct  490   TGHLYDKEAEKQLEALGKQRIEGQELNCVGVDCFKLSFIIIAAATFFGAVVNLILVARTR  549

Query  106   AYYKTDIYKRFRDE  65
              +YK DIYKR+R+E
Sbjct  550   KFYKGDIYKRYREE  563



>ref|XP_007220549.1| hypothetical protein PRUPE_ppa003180mg [Prunus persica]
 gb|EMJ21748.1| hypothetical protein PRUPE_ppa003180mg [Prunus persica]
Length=595

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/564 (55%), Positives = 398/564 (71%), Gaps = 19/564 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             N +    Q+  GRWFMMFAS LIM+ AGATY+FG+YS +IK  LGYDQ+TLNLL  FKD+
Sbjct  14    NTKALTLQVLNGRWFMMFASLLIMSAAGATYMFGIYSGDIKTVLGYDQTTLNLLSFFKDL  73

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVLSGLI EVTP W VL +G+ +NF GYF+IW++VTK+IA+P+VW MCLYIC+GAN
Sbjct  74    GANVGVLSGLINEVTPPWVVLSIGAVLNFFGYFMIWMAVTKKIARPQVWHMCLYICIGAN  133

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQ Y A Y  D++ LILLIGW
Sbjct  134   SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQFYYAFYYKDTKALILLIGW  193

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK++  PNE KVF+  L IS+ LA  LM + I +K V F+   Y 
Sbjct  194   LPAAISFAFLRTIRIMKVTRRPNELKVFYNMLYISLGLAGFLMIMIIVEKSVTFNQSEYG  253

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGD--  797
             A A +V  LL LP  + ++EE    + KK +L    +++      +    +++       
Sbjct  254   ASAAMVIFLLVLPLAVVIIEEFKIWEGKKVELNGGSDLKIVTEKPQPEVTSDDLSRPRET  313

Query  796   ------------YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
                          SC+  +F+ P RGEDY+ILQAL S+DML+LF+   CG G +L AIDN
Sbjct  314   LATTTTEAEPPTASCWKTMFRPPDRGEDYTILQALFSIDMLILFMACICGVGGTLTAIDN  373

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG S GYP R+  TFVSLVSIWNY GRV SGF SE ++KR+K PR LM+T +LLL C
Sbjct  374   LGQIGTSFGYPKRSASTFVSLVSIWNYLGRVMSGFGSEILLKRYKFPRPLMLTLTLLLSC  433

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              G LL+AF  P  +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N G  ASP+G 
Sbjct  434   VGHLLIAFNVPNGLYVASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSSASPVGL  493

Query  292   YILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             Y+LNVK+ G LYD EA KQ+AA G+      EL C G +C+K++FIV+A    FG LVSL
Sbjct  494   YLLNVKLTGYLYDKEAKKQLAALGLERKAGEELNCAGGECFKLAFIVIAAATFFGTLVSL  553

Query  127   VLVARTAAYYKTDIYKRFRDEMGA  56
             +LV RT  +YK+DIYK+FR+   A
Sbjct  554   ILVIRTRKFYKSDIYKKFREAAQA  577



>ref|XP_010691116.1| PREDICTED: uncharacterized protein LOC104904540 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/557 (55%), Positives = 398/557 (71%), Gaps = 20/557 (4%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             +F  ++  GRWFM+F++ L+M+ AGATY+FG YS +IK +LGYDQSTLNLL  FKD+G+ 
Sbjct  13    HFAIRVITGRWFMVFSTLLVMSAAGATYMFGSYSPDIKKSLGYDQSTLNLLSFFKDLGST  72

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+ SGL+ E+ P W VL VG+ +NF GYF++WL+V+  IA+P VWQMCLYICVGANSQ 
Sbjct  73    VGIPSGLLMEIAPPWVVLAVGAVLNFFGYFMVWLAVSGHIARPAVWQMCLYICVGANSQA  132

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIY-GNDSQNLILLIGWLP  1145
             FANTGALVTCVKNFP SRG++LGL+KGFVGLSGA+ TQ Y A+Y G++S+ LILLIGWLP
Sbjct  133   FANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIITQFYFALYGGHNSKALILLIGWLP  192

Query  1144  AILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
             A++S+ F+ +IR MK+    NE K+F+E L IS+ LA  LM + I QK + F+   YI  
Sbjct  193   AVISLAFLGTIRYMKVVRQKNEVKIFYEMLYISLGLASFLMIMIILQKQLTFTRNEYIGS  252

Query  964   ATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE-------------Dppppaenie  824
                V  LL LP    V EE    K+K++ L ++  V+                PP    E
Sbjct  253   GVAVLILLLLPIYTVVKEEYRLWKKKQEVLQNAPKVDIVVNGGDGKEETVKKSPPKIYDE  312

Query  823   kaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
                 ++  D SCF N+F+ PKRGEDY+ILQAL S+DML+LF+   CG G +L AIDNLGQ
Sbjct  313   TPIVQREAD-SCFQNVFRPPKRGEDYTILQALFSIDMLILFLSVICGIGGTLTAIDNLGQ  371

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IG SLGYPP++I TFVSLVSIWNY GRV +GF SE ++K++K+PR L +TF LLL CAG 
Sbjct  372   IGASLGYPPKSISTFVSLVSIWNYLGRVVAGFYSEHLLKKYKLPRPLFLTFMLLLSCAGH  431

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             LL+AF     +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+G YIL
Sbjct  432   LLIAFNVRNGLYVASVIIGFCFGAQWPLLFGIISEIFGLKYYSTLYNFGSVASPIGGYIL  491

Query  283   NVKIVGRLYDGEAVKQVAA-----RGVGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
             NV+I G LYD EA +Q+ A     R   EL C+G +C+ ++FI++    L G  +SL+LV
Sbjct  492   NVRITGHLYDKEATRQMLALGRSRRSGEELNCVGQECFHLAFIIITAATLVGMFISLILV  551

Query  118   ARTAAYYKTDIYKRFRD  68
              RT  +Y++DIY+RFR+
Sbjct  552   FRTRKFYQSDIYQRFRE  568



>ref|XP_010067353.1| PREDICTED: uncharacterized protein LOC104454252 isoform X2 [Eucalyptus 
grandis]
 gb|KCW65467.1| hypothetical protein EUGRSUZ_G02877 [Eucalyptus grandis]
Length=604

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/571 (54%), Positives = 406/571 (71%), Gaps = 28/571 (5%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             N+++   Q+  GRWFM+FAS LIMA AGATY+FG+YS++IK +LGYDQSTLNLL  FKD+
Sbjct  18    NVKHLAAQVIMGRWFMVFASLLIMAAAGATYMFGLYSEDIKTSLGYDQSTLNLLSFFKDL  77

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G +VG+ SGLI EV+P W VL +G+ +NF GYF+IWL+VTKRI  P+VWQMCLYIC+GAN
Sbjct  78    GGSVGIPSGLINEVSPPWVVLSIGAVLNFFGYFMIWLAVTKRITTPQVWQMCLYICIGAN  137

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ FANTGALVTCV+NFP SRG++LG++KG+VGLSGA+ TQLYLA+Y +D++ LILLIGW
Sbjct  138   SQAFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLYLAVYYHDTKALILLIGW  197

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFA--  977
             LPA +S VF+ +IR MK+   PNE KVF+ +L IS+ LA  LM + I +K  RF++F   
Sbjct  198   LPAAISFVFLRTIRIMKVVRQPNELKVFYRFLYISLGLATFLMIMIIIEK--RFNNFTRP  255

Query  976   -YIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE------------------  854
              Y   A  V  LLFLP  + V+EE     +K++ L     +E                  
Sbjct  256   EYGLSAAGVLFLLFLPLAVVVIEESKQWAQKREALNDPAPIEIATEKPSLETSLPPPPPP  315

Query  853   DppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGC  674
               P P+  +   +++     SC+   F+ P RGEDY+ILQAL S+DM +LF+    G G 
Sbjct  316   PEPAPSTTVLDNDDKLEKQLSCWRTAFRPPDRGEDYTILQALFSIDMFILFLATIFGVGG  375

Query  673   SLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMT  494
             +L AIDNLGQIG SLGY  ++  TFVSLVSIWNY GRV +GF+SE ++K++K PR LM+T
Sbjct  376   TLTAIDNLGQIGASLGYQKQSTSTFVSLVSIWNYLGRVVAGFLSEILLKQYKFPRPLMLT  435

Query  493   FSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQ  314
             F LL+ CAG LL+AF  P  +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G 
Sbjct  436   FILLISCAGHLLIAFNVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGT  495

Query  313   LASPLGSYILNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNL  149
             +ASP+G Y+LNV++ G LYD EA KQ+AA    R  GE L C G +CY+++F+++    L
Sbjct  496   VASPIGGYLLNVRVAGHLYDKEARKQMAALGLVRKAGEDLDCTGVKCYQLAFLIITFTTL  555

Query  148   FGALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             FG  VS +LV RT  +Y++DIYK+FR+E  A
Sbjct  556   FGTFVSFILVVRTRKFYRSDIYKKFREEAKA  586



>emb|CAN63260.1| hypothetical protein VITISV_029213 [Vitis vinifera]
Length=613

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/546 (58%), Positives = 384/546 (70%), Gaps = 20/546 (4%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M  F  Q+  GRWFM+FAS LIM+ AGATY+F +YS  IK +LGYDQ+TLNLL  FKD+G
Sbjct  1     MRRFGLQVLVGRWFMVFASLLIMSVAGATYMFSLYSGXIKTSLGYDQTTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
              NVGVLSGLI EVTP W VL +G+ MNF GYF+IWL+VT RIAKP++WQMCLYIC+GANS
Sbjct  61    GNVGVLSGLINEVTPPWVVLCIGAVMNFFGYFMIWLAVTDRIAKPQIWQMCLYICIGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q+FANTGALVTCV+NFP SRG++LGL+KGFVGLSGA+ TQLY A YG+DS++LIL I WL
Sbjct  121   QSFANTGALVTCVRNFPESRGIVLGLLKGFVGLSGAIITQLYRAFYGDDSKSLILFIAWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             P  +S VF+ +IR MK+    NE KVF++ L +S+ LA  LM + I Q    FS   Y  
Sbjct  181   PXAVSFVFLRTIRIMKVGRQANELKVFYDLLYMSLGLAGFLMVIIIIQNKFTFSRIEYSG  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQL------LSSEN---VEDppppaeni----  827
              A +V  LLFLP  + + EE+   K KK+ L      + +EN   VE    P  ++    
Sbjct  241   SAAVVLILLFLPLAVVIKEEINIWKXKKQALDAAQVKVITENPXAVELASSPVVSLXQLP  300

Query  826   --ekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
                 A E      SCF  +FK P RGEDY+ILQAL S+DML+LFI   CG G +L AIDN
Sbjct  301   PPTAAPENAEKSVSCFKTMFKPPDRGEDYTILQALFSIDMLILFIVTTCGVGGTLTAIDN  360

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG S GY   +  TFVSLVSIWNY GRV SGF SE  + R+K PR LM+TF LL  C
Sbjct  361   LGQIGSSXGYTAHSTTTFVSLVSIWNYLGRVVSGFASEIFLTRYKFPRPLMLTFVLLFSC  420

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              G LL+AF  P S+Y AS+I+GF +G Q  L+F IISELFGLKYYSTL+N G +ASP+GS
Sbjct  421   VGHLLIAFAVPNSLYFASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGAVASPVGS  480

Query  292   YILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             YILNVK+ G LYD EA+KQ+ A GV      +LTC G  CYK+SFI++    LFG ++S 
Sbjct  481   YILNVKVAGHLYDKEALKQLEASGVTRVAGQDLTCTGAACYKLSFIIITAATLFGCIISF  540

Query  127   VLVART  110
             +LV RT
Sbjct  541   ILVIRT  546



>ref|XP_010068847.1| PREDICTED: uncharacterized protein LOC104455819 [Eucalyptus grandis]
Length=619

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/570 (54%), Positives = 402/570 (71%), Gaps = 25/570 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             ++ +   ++  GRWFM+FASFLIMA AGATY+FG+YS++IK +LGYDQSTLNLL  FKD+
Sbjct  18    DVRHLAVKVIMGRWFMVFASFLIMAAAGATYMFGLYSEDIKDSLGYDQSTLNLLSFFKDL  77

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G NVGVLSGLI EVTP W VL +G+ +NF GYF+IWL+VTKRIAKP+VWQMCLYIC+GAN
Sbjct  78    GGNVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTKRIAKPQVWQMCLYICIGAN  137

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAI-YGNDSQNLILLIG  1154
             SQ FANTGALVTCV+NFP SRG++LG++KG+VGLSGA+ TQL+ A  Y  D++ LILLIG
Sbjct  138   SQTFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFYYYKDTKTLILLIG  197

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYV-RFSHFA  977
             WLPA +S  F+ +IR MK+   PNE KVF+++L IS+ LA  LM + + +K+   F+   
Sbjct  198   WLPAAVSFAFLRTIRVMKVVRQPNEVKVFYKFLYISLGLATFLMIMIVIEKHFNNFTRPE  257

Query  976   YIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE------------------D  851
             Y   A  V  LLFLP  I ++EE     +K++ L     +E                   
Sbjct  258   YGLSAAGVLFLLFLPIAIVLIEEYKQWAQKREALNDPSPIEITMEKPNLETSLPPPPPPL  317

Query  850   ppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCS  671
                P   +    E+     SC+   F+ P RGEDY+ILQAL S+DM +LF+ + CG G +
Sbjct  318   ETAPPTAVLNGGEQLEKQPSCWRTAFRPPHRGEDYTILQALFSIDMFILFLASICGLGGT  377

Query  670   LAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTF  491
             L AIDNLGQIG+SLGY  ++  TFVSLVSIWNY GRV +GFVSE ++ R+K PRTL++T 
Sbjct  378   LTAIDNLGQIGKSLGYQKQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLVLTI  437

Query  490   SLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQL  311
              LL+ CAG LL+AF  P  +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +
Sbjct  438   ILLISCAGHLLIAFDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSV  497

Query  310   ASPLGSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLF  146
             ASP+G Y+LNV++ G LYD EA KQ+AA G       +L C G +CY++SF+++    LF
Sbjct  498   ASPIGGYLLNVRVAGHLYDKEAKKQLAALGHVRQPGQDLECTGVKCYQLSFLIITFATLF  557

Query  145   GALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             G  VS +LV RT  +Y++DIYK+FR+E  A
Sbjct  558   GVFVSFILVLRTRKFYRSDIYKKFREEAKA  587



>emb|CDP15282.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/562 (56%), Positives = 407/562 (72%), Gaps = 24/562 (4%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F +QL  GRWFM+FAS LIMA AGATY+FG+YS +IK++LGYDQ+++N L  FKD+G NV
Sbjct  18    FGYQLLTGRWFMVFASNLIMAVAGATYMFGLYSGDIKSSLGYDQTSVNYLSFFKDLGGNV  77

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             G++SGLI E+TP W VL++G+AMNFAGYF+IWL+VT  +AKP +WQMCLYICVGA+SQ F
Sbjct  78    GIISGLINEITPPWVVLIIGAAMNFAGYFMIWLAVTGHVAKPPLWQMCLYICVGASSQTF  137

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRG++LGL+KGFVGLSGA+ TQLY A+YG++S++LILLIGWLPA 
Sbjct  138   ANTGALVTCVKNFPESRGVVLGLLKGFVGLSGAIITQLYHALYGHNSKSLILLIGWLPAA  197

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S +F+ +IR MK+  H NE K+F+  L +S+ LA  LM L I Q  + F+   Y   A+
Sbjct  198   VSFIFLRTIRIMKVVRHENELKIFYNLLYLSLGLAGFLMILIILQNRLVFTAGEYAGSAS  257

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQLLSSENV-------------------EDppppa  836
             +V  LLF P LI + EEL   K K++ L  S  +                   ++  PPA
Sbjct  258   VVLLLLFAPLLIVIKEELNLWKSKRQVLHDSSQLNVATENPPPVLQLSLQVGQQEETPPA  317

Query  835   eniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAID  656
                  A +      SC+ + FK P RGEDY+ILQAL SVDM++LF     G G +L AID
Sbjct  318   PGDPCAPQNPEKQVSCWSSAFKPPDRGEDYTILQALFSVDMIILFTATTFGIGGTLTAID  377

Query  655   NLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLP  476
             NLGQIG++LGYP ++I TF+SLVSIWNY GRV SGF SE ++ ++K PR LM+T  LLL 
Sbjct  378   NLGQIGKALGYPTKSISTFISLVSIWNYLGRVTSGFASEILLAKYKFPRPLMLTMVLLLS  437

Query  475   CAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLG  296
             CAG LL+AF  P S+Y AS+I+GFS+G Q  L+F IISELFGLKYYSTL+N G  ASP+G
Sbjct  438   CAGHLLIAFGVPNSLYVASVIMGFSFGAQWPLIFAIISELFGLKYYSTLYNLGAGASPVG  497

Query  295   SYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVS  131
             +YILNV++ G LYD EA+KQ+AA+G+      +LTC G  CYK++F+++    + G  +S
Sbjct  498   AYILNVRVAGHLYDKEALKQMAAKGLIRKAGEDLTCNGVMCYKLAFLIITAATMCGCAIS  557

Query  130   LVLVARTAAYYKTDIYKRFRDE  65
              +LV RT  +YK DIYK+FR++
Sbjct  558   FILVFRTRNFYKGDIYKKFREQ  579



>gb|KCW65468.1| hypothetical protein EUGRSUZ_G02878, partial [Eucalyptus grandis]
Length=607

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/570 (54%), Positives = 402/570 (71%), Gaps = 25/570 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             ++ +   Q+  GRWFM+FASFLIMA AGATY+FG+YS++IK +LGYDQSTLNLL  FKD+
Sbjct  18    DVRHLAVQVIMGRWFMVFASFLIMAAAGATYMFGLYSEDIKDSLGYDQSTLNLLSFFKDL  77

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G NVGV+SGLI EVTP W VL +G+ +NF GYF+IWL+VTKRIAKP+VWQMCLYIC+GAN
Sbjct  78    GGNVGVISGLINEVTPPWVVLSMGALLNFYGYFMIWLAVTKRIAKPQVWQMCLYICIGAN  137

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAI-YGNDSQNLILLIG  1154
             SQ FANTGALVTCV+NFP SRG++LG++KG+VGLSGA+ TQL+ A  Y  D++ LILLIG
Sbjct  138   SQTFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFYYYKDTKALILLIG  197

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYV-RFSHFA  977
             WLPA +S  F+ +IR MK+   PNE KVF+++L IS+ LA  LM + + +K+   F+   
Sbjct  198   WLPAAVSFAFLRTIRVMKVVRQPNEVKVFYKFLYISLGLATFLMIMIVIEKHFNNFTRPE  257

Query  976   YIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE------------------D  851
             Y   A  V  LLFLP  I ++EE     +K++ L     +E                   
Sbjct  258   YGLSAAGVLFLLFLPIAIVLIEEYKQWAQKREALNDPSPIEITMEKPNLETSLPPPPPPL  317

Query  850   ppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCS  671
                P   +    E+     SC+   F+ P RGEDY+ILQAL S+DM +LF+ + CG G +
Sbjct  318   ETAPPTAVLNGGEQLEKQPSCWRTAFRPPHRGEDYTILQALFSIDMFILFLASICGLGGT  377

Query  670   LAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTF  491
             L AIDNLGQIG+SLGY  ++  TFVSLVSIWNY GRV +GFVSE ++ R+K PRTL++T 
Sbjct  378   LTAIDNLGQIGKSLGYQKQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLVLTI  437

Query  490   SLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQL  311
              LL+ CAG LL+AF  P  +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +
Sbjct  438   ILLISCAGHLLIAFDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSV  497

Query  310   ASPLGSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLF  146
             ASP+G Y+LNV++ G LYD EA KQ+AA G       +L C G +CY++SF+++    LF
Sbjct  498   ASPIGGYLLNVRVAGHLYDKEAKKQLAALGHVRQPGQDLECTGVKCYQLSFLIITFATLF  557

Query  145   GALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             G  VS +LV RT  +Y++D+YK+FR+E  A
Sbjct  558   GVFVSFILVLRTRKFYRSDLYKKFREEAKA  587



>gb|KCW65302.1| hypothetical protein EUGRSUZ_G02759 [Eucalyptus grandis]
Length=621

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/559 (55%), Positives = 395/559 (71%), Gaps = 25/559 (4%)
 Frame = -1

Query  1657  GRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLI  1478
             GRWFM+FASFLIMA AGATY+FG+YS++IK +LGYDQSTLNLL  FKD+G NVGVLSGLI
Sbjct  2     GRWFMVFASFLIMAAAGATYMFGLYSEDIKDSLGYDQSTLNLLSFFKDLGGNVGVLSGLI  61

Query  1477  AEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALV  1298
              EVTP W VL +G+ +NF GYF+IWL+VTKRIAKP+VWQMCLYIC+GANSQ FANTGALV
Sbjct  62    NEVTPPWVVLSMGAVLNFFGYFMIWLAVTKRIAKPQVWQMCLYICIGANSQTFANTGALV  121

Query  1297  TCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAI-YGNDSQNLILLIGWLPAILSIVFI  1121
             TCV+NFP SRG++LG++KG+VGLSGA+ TQL+ A  Y  D++ LILLIGWLPA +S  F+
Sbjct  122   TCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFYYYKDTKTLILLIGWLPAAVSFAFL  181

Query  1120  PSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYV-RFSHFAYIACATIVCAL  944
              +IR MK+   PNE KVF+++L IS+ LA  LM + + +K+   F+   Y   A  V  L
Sbjct  182   RTIRVMKVVRQPNEVKVFYKFLYISLGLATFLMIMIVIEKHFNNFTRPEYGLSAAGVLFL  241

Query  943   LFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekae-----------------  815
             LFLP  I ++EE     +K++ L     +E                              
Sbjct  242   LFLPIAIVLIEEYKQWAQKREALNDPSPIEITMEKPNLETSLPPPPPPLETAPPTAVLNG  301

Query  814   -eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIG  638
              E+     SC+   F+ P RGEDY+ILQAL S+DM +LF+ + CG G +L AIDNLGQIG
Sbjct  302   GEQLEKQPSCWRTAFRPPHRGEDYTILQALFSIDMFILFLASICGLGGTLTAIDNLGQIG  361

Query  637   ESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLL  458
             +SLGY  ++  TFVSLVSIWNY GRV +GFVSE ++ R+K PRTL++T  LL+ CAG LL
Sbjct  362   KSLGYQKQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLVLTIILLISCAGHLL  421

Query  457   VAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNV  278
             +AF  P  +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+G Y+LNV
Sbjct  422   IAFDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNV  481

Query  277   KIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVAR  113
             ++ G LYD EA KQ+AA G       +L C G +CY++SF+++    LFG  VS +LV R
Sbjct  482   RVAGHLYDKEAKKQLAALGHVRQPGQDLECTGVKCYQLSFLIITFATLFGVFVSFILVLR  541

Query  112   TAAYYKTDIYKRFRDEMGA  56
             T  +Y++DIYK+FR+E  A
Sbjct  542   TRKFYRSDIYKKFREEAKA  560



>gb|KEH44272.1| MFS transporter [Medicago truncatula]
Length=595

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/551 (54%), Positives = 390/551 (71%), Gaps = 11/551 (2%)
 Frame = -1

Query  1684  ENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGA  1505
             +N + Q+  GRWF++FASFLIM+ +GATY+FG+YS  IK +L YDQ+TLNLL  FKD+G 
Sbjct  15    KNLIIQVITGRWFVVFASFLIMSASGATYMFGLYSSTIKTSLAYDQTTLNLLSFFKDLGG  74

Query  1504  NVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQ  1325
             N+GV SGLI E+TP + VL +GS +NF GYF+IWL+VTK+I KPKVWQMCLYIC+GANSQ
Sbjct  75    NLGVFSGLINEITPPYVVLAIGSLLNFFGYFMIWLAVTKKIPKPKVWQMCLYICIGANSQ  134

Query  1324  NFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLP  1145
             +F+NTG+LVTCVKNFP +RG++LG++KG+VGLSGA+ TQLY AIY +D + LILLI WLP
Sbjct  135   SFSNTGSLVTCVKNFPETRGVVLGILKGYVGLSGAIITQLYSAIYFDDPKALILLIAWLP  194

Query  1144  AILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
             A +S +F+ +IR MK     NE  VF+++L IS+ LA  LM + I QK V F    YI  
Sbjct  195   AAISFLFLRTIRYMKPVKQNNELGVFYKFLYISLGLAGFLMVMIILQKKVSFKQSEYIGS  254

Query  964   ATIVCALLFLPFLIAVMEELATRKE------KKKQLLSSENVEDppppaeniekaeeekA  803
             A++V  LLFLP  +  +E+  ++K         K +   E  E      +        + 
Sbjct  255   ASVVLILLFLPLAVVFVEQKKSQKLAFVDPFSVKIVTDQEVKESAAKNCDTNAMVCVVEV  314

Query  802   GDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGY  623
              +   + NIF  P++GED++ILQAL S+DMLLLF    CG G +L AIDNLGQIG SLGY
Sbjct  315   KETRWWQNIFSPPEQGEDFTILQALFSIDMLLLFFAGTCGVGGTLTAIDNLGQIGTSLGY  374

Query  622   PPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPF  443
             P  +I TFVSLVSIWNY GRVFSGFVSE ++ ++K PR LM T  + L C G LL+AF  
Sbjct  375   PKTSISTFVSLVSIWNYLGRVFSGFVSEHVLTKYKFPRPLMFTLIMFLSCVGHLLIAFDV  434

Query  442   PGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGR  263
                +Y AS+I+GF +G Q  L+F IISELFGLKYYSTL N G +ASP+G Y LNV++ G 
Sbjct  435   QNGIYFASVIIGFCFGAQWPLVFAIISELFGLKYYSTLMNFGGVASPIGLYFLNVRVAGH  494

Query  262   LYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYY  98
             LYD EA +Q+  +GV      EL C+G  C+++SFI++    LFGA++SL+LVART  +Y
Sbjct  495   LYDKEAKRQLIEKGVKRKLGQELNCVGASCFRLSFIIITAATLFGAIISLILVARTNKFY  554

Query  97    KTDIYKRFRDE  65
             K DIYKR+R E
Sbjct  555   KGDIYKRYRSE  565



>ref|XP_006345994.1| PREDICTED: uncharacterized protein LOC102592436 [Solanum tuberosum]
Length=582

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/562 (54%), Positives = 403/562 (72%), Gaps = 21/562 (4%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M+N   Q+  GRWFM+FA+ LI++ +GATY+FG+YS +IK +LGYDQ+TLNLL  FKD+G
Sbjct  1     MKNLTLQVLTGRWFMVFATVLILSASGATYIFGIYSTDIKISLGYDQTTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
              NVG+LSGLI EVTP W VL  G+ +NF GYF+IWLSVTK+I KPK+W MCLYICVG+NS
Sbjct  61    GNVGILSGLINEVTPPWVVLSFGAVLNFFGYFMIWLSVTKKIPKPKIWHMCLYICVGSNS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q+FANTGALVTCVKNFP SRG +LGL+KG+VGLSGA+ TQ+Y AIYGNDS++LILLIGWL
Sbjct  121   QSFANTGALVTCVKNFPESRGAVLGLLKGYVGLSGAMLTQIYHAIYGNDSKSLILLIGWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             P ++S+ F+  IR MK+    +E KVF+++L  S+ LA  LM + I QK + F    Y  
Sbjct  181   PPVVSLFFLRIIRVMKVVRVEHEMKVFYKFLYTSLGLAGFLMLVIILQKKMHFKQIEYGL  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE----------------Dppppa  836
               +IV  LL LP ++ V EE  + K KK++L S   V+                      
Sbjct  241   STSIVLFLLCLPLVVVVKEEFDSWKIKKQELESVSQVKLVTEVPNCDISQLQMVTQSDAK  300

Query  835   eniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAID  656
             +   ++E +     SC+  +F+ P RGEDY+ILQ L S+DML+LF    CG G +L AID
Sbjct  301   DQENRSEIQTQEHISCWRTVFRAPDRGEDYTILQTLFSIDMLILFFATICGVGGTLTAID  360

Query  655   NLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLP  476
             NLGQIG SLGYP  +I TFVSLVSIWNY GRV SGF+SE  + ++K PR LM+T +L++ 
Sbjct  361   NLGQIGTSLGYPKTSISTFVSLVSIWNYLGRVVSGFLSEHFLTKYKFPRPLMLTITLVIS  420

Query  475   CAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLG  296
             C G LL+AF   G +Y AS+++GF +G Q  LL+ IISELFGLKYYSTL+N G +ASP+G
Sbjct  421   CLGHLLIAFNVSGGLYVASIVIGFCFGAQWPLLYAIISELFGLKYYSTLYNFGSVASPIG  480

Query  295   SYILNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVS  131
             +Y+LNV++VG LYD EA +Q+ A    R +GE L C G +C+K++F+++ GV + GA VS
Sbjct  481   AYLLNVRVVGYLYDKEANRQIMAMGKIRKIGEDLECNGDECFKLAFLIITGVTILGAFVS  540

Query  130   LVLVARTAAYYKTDIYKRFRDE  65
             ++LV RT  +YK DIYK+FR+E
Sbjct  541   IILVLRTRKFYKNDIYKKFREE  562



>ref|XP_010068870.1| PREDICTED: uncharacterized protein LOC104455846 [Eucalyptus grandis]
Length=619

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/570 (54%), Positives = 402/570 (71%), Gaps = 25/570 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             ++ +   Q+  GRWFM+FASFLIMA AGATY+FG+YS++IK +LGYDQSTLNLL  FKD+
Sbjct  18    DVRHLAVQVIMGRWFMVFASFLIMAAAGATYMFGLYSEDIKDSLGYDQSTLNLLSFFKDL  77

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G NVGV+SGLI EVTP W VL +G+ +NF GYF+IWL+VTKRIAKP+VWQMCLYIC+GAN
Sbjct  78    GGNVGVISGLINEVTPPWVVLSMGALLNFYGYFMIWLAVTKRIAKPQVWQMCLYICIGAN  137

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAI-YGNDSQNLILLIG  1154
             SQ FANTGALVTCV+NFP SRG++LG++KG+VGLSGA+ TQL+ A  Y  D++ LILLIG
Sbjct  138   SQTFANTGALVTCVQNFPESRGVVLGILKGYVGLSGAIITQLFYAFYYYKDTKALILLIG  197

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYV-RFSHFA  977
             WLPA +S  F+ +IR MK+   PNE KVF+++L IS+ LA  LM + + +K+   F+   
Sbjct  198   WLPAAVSFAFLRTIRVMKVVRQPNEVKVFYKFLYISLGLATFLMIMIVIEKHFNNFTRPE  257

Query  976   YIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE------------------D  851
             Y   A  V  LLFLP  I ++EE     +K++ L     +E                   
Sbjct  258   YGLSAAGVLFLLFLPIAIVLIEEYKQWAQKREALNDPSPIEITMEKPNLETSLPPPPPPL  317

Query  850   ppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCS  671
                P   +    E+     SC+   F+ P RGEDY+ILQAL S+DM +LF+ + CG G +
Sbjct  318   ETAPPTAVLNGGEQLEKQPSCWRTAFRPPHRGEDYTILQALFSIDMFILFLASICGLGGT  377

Query  670   LAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTF  491
             L AIDNLGQIG+SLGY  ++  TFVSLVSIWNY GRV +GFVSE ++ R+K PRTL++T 
Sbjct  378   LTAIDNLGQIGKSLGYQKQSTSTFVSLVSIWNYLGRVVAGFVSEILLTRYKFPRTLVLTI  437

Query  490   SLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQL  311
              LL+ CAG LL+AF  P  +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +
Sbjct  438   ILLISCAGHLLIAFDVPNGLYFASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSV  497

Query  310   ASPLGSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLF  146
             ASP+G Y+LNV++ G LYD EA KQ+AA G       +L C G +CY++SF+++    LF
Sbjct  498   ASPIGGYLLNVRVAGHLYDKEAKKQLAALGHVRQPGQDLECTGVKCYQLSFLIITFATLF  557

Query  145   GALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             G  VS +LV RT  +Y++D+YK+FR+E  A
Sbjct  558   GVFVSFILVLRTRKFYRSDLYKKFREEAKA  587



>ref|XP_003554397.1| PREDICTED: uncharacterized protein LOC100818752 [Glycine max]
Length=581

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/562 (56%), Positives = 391/562 (70%), Gaps = 16/562 (3%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             + M+ F + +  GRWFM+FAS LIM+ AGATY+FG+YS E+K +LGYDQSTLNLL  FKD
Sbjct  12    RGMKAFSYHVLTGRWFMLFASLLIMSVAGATYMFGIYSNEVKTSLGYDQSTLNLLSFFKD  71

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +GANVGV+SGL+ EVTP + VL +G  MNF GYF+I+L+V+ RIAKP+VWQMCLYIC+GA
Sbjct  72    LGANVGVISGLVNEVTPPFVVLSIGVIMNFFGYFMIFLAVSGRIAKPQVWQMCLYICIGA  131

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGN-DSQNLILLI  1157
             NSQ FANTGALVTCVKNFP SRG +LGL+KG+VGLSGA+ TQLY A YGN +SQ LILLI
Sbjct  132   NSQTFANTGALVTCVKNFPGSRGSILGLLKGYVGLSGAIITQLYHAFYGNHNSQALILLI  191

Query  1156  GWLPAILSIVFIPSIRPMKISSH-PNE-TKVFFEYLGISITLALCLMGLTIAQKYVRFSH  983
              WLPA +S +F+P+IR M    H P E  +VF+  L IS+ LA  LM L + Q  + FS 
Sbjct  192   AWLPAAVSSLFLPTIRIMNTVLHQPKEGNRVFYHLLYISLGLAAFLMVLILVQNKLSFSR  251

Query  982   FAYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSS--------ENVEDppppaeni  827
               YI    +V   L LP ++   EE+   K   + L  S        E +  P    E +
Sbjct  252   IEYIVDGLVVFFFLLLPLVVVFREEINQLKANTQCLTDSPPQLKVVTEAIPPPNVEQEEV  311

Query  826   ekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLG  647
                        SC  NIF  PKRGEDY+ILQAL S+DML+LFI    G G +L AIDNLG
Sbjct  312   PPTTTSSHEKSSCLRNIFNPPKRGEDYTILQALFSIDMLILFIATTFGAGGTLTAIDNLG  371

Query  646   QIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAG  467
             QIG SLGYP ++  TFVSLVSIWNY GRV SG+ SE  + ++KIPR  M+T  LL+ C G
Sbjct  372   QIGHSLGYPNKSTTTFVSLVSIWNYLGRVASGYASEIFLTKYKIPRPYMLTLVLLVSCVG  431

Query  466   DLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI  287
              +L+A   P S+Y AS+I+GF +G Q  L+F IISE+FGLKYYSTL+N G  ASPLGSYI
Sbjct  432   HVLIALGVPNSLYFASVIIGFCFGAQWPLMFAIISEVFGLKYYSTLYNFGAAASPLGSYI  491

Query  286   LNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             LNVK+ G LYD EA+KQ+ A+G+      +LTC+G QCYK++FI++    L G L S++L
Sbjct  492   LNVKVAGVLYDKEALKQLKAKGLTREEGKDLTCVGVQCYKMAFIIITASTLVGCLASVIL  551

Query  121   VARTAAYYKTDIYKRFRDEMGA  56
               RT  +YK DIY++FR E  A
Sbjct  552   ALRTRKFYKGDIYRKFRMEHEA  573



>ref|XP_006293868.1| hypothetical protein CARUB_v10022856mg [Capsella rubella]
 gb|EOA26766.1| hypothetical protein CARUB_v10022856mg [Capsella rubella]
Length=597

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/561 (56%), Positives = 404/561 (72%), Gaps = 20/561 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+    Q+  GRWFM F S LIM+ AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  9     SMKGLAVQILTGRWFMFFGSLLIMSTAGATYMFGIYSTDIKKTLGYDQTTLNLLSFFKDL  68

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GL+ EVTP WF+LL+G+ +NF GYF+IWL+VTKRI+KP+VW MCLYIC+GAN
Sbjct  69    GANVGVLAGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTKRISKPQVWHMCLYICIGAN  128

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D++ LIL+IGW
Sbjct  129   SQSFANTGSLVTCVKNFPESRGVILGILKGYVGLSGAIITQLYHAFYGEDTKELILMIGW  188

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPAI+S  F+ +IR MK+    +E KVF+ +L IS+ LA  LM + I  K   F+   + 
Sbjct  189   LPAIVSFAFLRTIRIMKVKRQTDELKVFYNFLYISLGLATFLMVVIIINKLSGFTQSEFG  248

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKK--------------KQLLSSENVEDppppae  833
               A +V  LL LP ++ ++EE     EK+              K  L S  V+D      
Sbjct  249   GSAAVVIILLLLPIIVVILEEKKLWTEKQVALNNPAPINIVTEKPSLDSSEVKDEDKERS  308

Query  832   niekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
               E+  E+     SC+  IF  P+RG+DY+ILQAL SVDML+LF+   CG G +L AIDN
Sbjct  309   EKEEEGEKVKTP-SCWTTIFDPPERGDDYTILQALFSVDMLILFLATICGVGGTLTAIDN  367

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG S GYP R++ TFVSLVSIWNY+GRV SG VSE  + ++K PRTLM+T  LLL C
Sbjct  368   LGQIGSSFGYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRTLMLTLVLLLSC  427

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
             AG LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GS
Sbjct  428   AGHLLIAFNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGS  487

Query  292   YILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             Y+LNV++ G LYD EA KQ  A G       +L C+GT C+K+SFI++  V LFG LVS 
Sbjct  488   YLLNVRVAGHLYDVEANKQYTALGTQRTEGQDLNCIGTSCFKLSFIIITAVTLFGVLVSF  547

Query  127   VLVARTAAYYKTDIYKRFRDE  65
             VLV RT  +YK+DIYK+FR++
Sbjct  548   VLVIRTKKFYKSDIYKKFREK  568



>ref|XP_004307342.1| PREDICTED: uncharacterized protein LOC101306672 [Fragaria vesca 
subsp. vesca]
Length=597

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/560 (56%), Positives = 400/560 (71%), Gaps = 18/560 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             + ++   Q+  GRWFM+FA  LIM+ AGATY+FG+YS +IK  L YDQSTLNLL  FKD 
Sbjct  11    DTKSLTLQVLNGRWFMVFACLLIMSAAGATYMFGLYSPDIKTALAYDQSTLNLLSFFKDF  70

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVG+LSGL+ EVTP W VLLVG+ +NF GY +IWLSVTK+IA+PKVWQMCLYIC+GAN
Sbjct  71    GSNVGILSGLLNEVTPPWVVLLVGAVLNFLGYLMIWLSVTKKIARPKVWQMCLYICIGAN  130

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LGL+KG+VGLSGA+ TQ+Y A Y ND++ LILLIGW
Sbjct  131   SQSFANTGSLVTCVKNFPESRGVVLGLLKGYVGLSGAIITQMYFAFYYNDTRALILLIGW  190

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+    NE +VF+  L IS+ LA  LM + I +  V F+   Y 
Sbjct  191   LPAAISFAFLRTIRIMKVIRQSNEVQVFYNMLYISLGLAGFLMIMIIVENRVNFTQQEYG  250

Query  970   ACATIVCALLFLPFLIAVMEE--LATRKE-----------KKKQLLSSENVEDppppaen  830
             A   +V  LL LP ++ V+EE  L  RK+           +K  + + E +E    P   
Sbjct  251   ASTAMVLFLLALPVVVVVIEEYKLWERKQLEMNGDVKIVTEKPVVPTEEQLEVSKEPVTY  310

Query  829   iekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNL  650
                   E+    SC+   F+ P RGEDY+ILQAL S+DML+LF+   CG G +L AIDNL
Sbjct  311   ETPESTEEQPSQSCWKTCFRPPNRGEDYTILQALFSIDMLILFMACICGVGGTLTAIDNL  370

Query  649   GQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCA  470
             GQIG SLGYP R+  TFV LVSIWNY GRV +GFVSE ++KR+K PR L++T +L + C 
Sbjct  371   GQIGTSLGYPTRSRKTFVGLVSIWNYLGRVVAGFVSEFLLKRYKFPRPLILTLTLFVSCF  430

Query  469   GDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSY  290
             G LL+AF     +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N G  ASP+G Y
Sbjct  431   GHLLIAFNVKNGLYLASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSAASPVGLY  490

Query  289   ILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLV  125
             +LNVK+ G +YD EA+KQ+ A+G+      ELTCLG +C+K+SFI++     FGALVSL+
Sbjct  491   LLNVKLTGHVYDKEAMKQLVAKGLERNKDEELTCLGGECFKLSFIIITAATFFGALVSLI  550

Query  124   LVARTAAYYKTDIYKRFRDE  65
             LV RT  +Y++DIYK+FR+E
Sbjct  551   LVMRTRKFYQSDIYKKFREE  570



>ref|XP_008446819.1| PREDICTED: uncharacterized protein LOC103489435 [Cucumis melo]
Length=582

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/542 (58%), Positives = 402/542 (74%), Gaps = 8/542 (1%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
              +  GRWF++FAS LIMA AGATY+FG+YS +IK+ LGYDQ+TLNLL  FKD+GANVGVL
Sbjct  19    HVITGRWFVVFASLLIMAAAGATYMFGLYSSDIKSVLGYDQTTLNLLSFFKDLGANVGVL  78

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SGLI EVTP W VL +G+ +NF GYF+IWL+VT+RI+ PKVWQMCLYIC+GANSQ+FANT
Sbjct  79    SGLINEVTPPWVVLSIGAVLNFFGYFMIWLAVTRRISTPKVWQMCLYICIGANSQSFANT  138

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             G+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQL+ A YGND+++LILLIGWLPA +S 
Sbjct  139   GSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLFHAFYGNDTKSLILLIGWLPAAISF  198

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
               + +IR MK+   PNE KVF+ +L IS+ LA  LM + I +    F+   Y   A +V 
Sbjct  199   ASLRTIRIMKVIRQPNELKVFYNFLYISLALAGFLMLMIIVESKKEFNQNEYGGSAAVVL  258

Query  949   ALLFLPFLIAVMEELATRKEKKKQLLSSEN--VEDppppaeniekaeeekAGDYSCFGNI  776
              LLFLP  + ++EE    K  K  L+ S N  V+         E  ++ +  + SC+  I
Sbjct  259   LLLFLPLSVVIIEEYNLWK-LKTALVKSPNPSVQIVTEKLPKTEHPKQLEQKEPSCWTTI  317

Query  775   FKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFV  596
             F  P+RGED++ILQAL S DML+LFI   CG G +L AIDNLGQIG SLGYP R+I TFV
Sbjct  318   FNPPQRGEDFTILQALFSFDMLILFIAAICGVGGTLTAIDNLGQIGMSLGYPKRSISTFV  377

Query  595   SLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASL  416
             +LVSIWNY GRV SGF+SE ++ ++K PR L+++ +LLL C G L++AF  P  +Y AS+
Sbjct  378   TLVSIWNYLGRVASGFISEIVLTKYKFPRPLILSLTLLLSCVGHLIIAFDVPNGLYVASI  437

Query  415   ILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQ  236
             ++GF +G Q  L+F IISELFGLKYYSTL+N G +ASP+G YILNVK+ G  YD EA KQ
Sbjct  438   VIGFCFGAQWPLIFAIISELFGLKYYSTLYNFGSVASPIGLYILNVKVAGNFYDREAEKQ  497

Query  235   VAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFR  71
             ++A+G+      EL C G +C+K+SFIV+  V L G LVSLVLV RT ++YK+DIYK+FR
Sbjct  498   LSAKGIIRKAGEELKCFGGECFKLSFIVITAVTLLGMLVSLVLVIRTRSFYKSDIYKKFR  557

Query  70    DE  65
             DE
Sbjct  558   DE  559



>ref|XP_010505589.1| PREDICTED: uncharacterized protein LOC104782373 [Camelina sativa]
Length=599

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/563 (56%), Positives = 404/563 (72%), Gaps = 22/563 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+    Q   GRWFM F S LIM+ AGATY+F +YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  9     SMKGLAVQTLTGRWFMFFGSLLIMSTAGATYMFSIYSSDIKKTLGYDQTTLNLLSFFKDL  68

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GL+ EVTP WF+LL+G+ +NF GYF+IWL+VTKRI+KP+VW MCLYICVGAN
Sbjct  69    GANVGVLAGLLNEVTPPWFILLIGAVLNFFGYFMIWLAVTKRISKPQVWHMCLYICVGAN  128

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D++ LIL+IGW
Sbjct  129   SQAFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGEDTKELILMIGW  188

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA++S  F+ +IR MK+    NE KVF+ +L IS+ LA  LM + I  K   F+   + 
Sbjct  189   LPAVVSFAFLRTIRIMKVKRQTNELKVFYNFLYISLGLATFLMVVIIINKLSGFTQSEFG  248

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKK--------------KQLLSSENVEDppppae  833
               A +V  LL LP +I V+EE     EK+              K  L +  V+D    ++
Sbjct  249   GSAAVVIVLLLLPIIIVVLEERKLWTEKQVALNNPTPINIVTEKPALDTSEVKDQDERSD  308

Query  832   niekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
               E+  E      SC+  +F  P+RG+DY+ILQAL S+DML+LF+   CG G +L AIDN
Sbjct  309   KEEEKRETVKTP-SCWTTMFNPPERGDDYTILQALFSIDMLILFLATICGVGGTLTAIDN  367

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG SLGYP R++ TFVSLVSIWNY+GRV SG VSE  + ++K PR LM+T  LLL C
Sbjct  368   LGQIGSSLGYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTLVLLLSC  427

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
             AG LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GS
Sbjct  428   AGHLLIAFNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGS  487

Query  292   YILNVKIVGRLYDGEAVKQVAARGVG-------ELTCLGTQCYKVSFIVLAGVNLFGALV  134
             Y+LNV++ G LYD EA KQ  A G+G       +L C+GT C+K+SFI++  V  FG LV
Sbjct  488   YLLNVRVAGYLYDVEAQKQNKALGIGNARRDGEDLNCIGTSCFKLSFIIITAVTFFGVLV  547

Query  133   SLVLVARTAAYYKTDIYKRFRDE  65
             SLVLV RT  +YK+DIYK+FR++
Sbjct  548   SLVLVIRTKKFYKSDIYKKFREK  570



>ref|XP_009377045.1| PREDICTED: uncharacterized protein LOC103965696 [Pyrus x bretschneideri]
Length=611

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/567 (54%), Positives = 400/567 (71%), Gaps = 23/567 (4%)
 Frame = -1

Query  1696  EQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFK  1517
              + M +F FQ+  GRWFM+FAS LI++ +GATY+FG+YS E+K +LGYDQ+T+NLL  FK
Sbjct  12    NKEMRSFGFQVLHGRWFMVFASMLILSMSGATYMFGLYSNEVKTSLGYDQTTVNLLSFFK  71

Query  1516  DVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVG  1337
             D+G NVG+++GLI EVT  W VLL+G+ MNF GYF+IWL+VT R +KP++WQMCLYIC+G
Sbjct  72    DLGGNVGIIAGLINEVTGPWVVLLIGALMNFFGYFMIWLAVTGRTSKPRMWQMCLYICIG  131

Query  1336  ANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLI  1157
             ANSQ FANTGA+V+CVKNFP SRG +LG++KG VGLSGA+ TQL+ A YGND ++LILLI
Sbjct  132   ANSQTFANTGAVVSCVKNFPESRGSVLGILKGLVGLSGAIITQLFHAFYGNDVKSLILLI  191

Query  1156  GWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFA  977
             GWLPA +S+VF+P IR +K     NE KVF+  L I++ LA  LM + I Q   +FS   
Sbjct  192   GWLPASVSMVFLPIIRLIKYVRQSNELKVFYNLLYITLGLAGFLMAIIIIQHKFKFSRIE  251

Query  976   YIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE---------------Dppp  842
             YIA A++V  LL LP  + + EEL  RK K + L     ++               +  P
Sbjct  252   YIASASVVTLLLCLPLSVVIFEELKIRKSKIRALNDQSELKVVAENPIPAPPPAPVEVAP  311

Query  841   paeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAA  662
                      + +    SC    F +P RGEDY+ILQA+ S+DML+LF+   CG G +L A
Sbjct  312   QLAAESPQTQSQQKPTSC---CFSRPNRGEDYTILQAVFSIDMLILFLATSCGVGGTLTA  368

Query  661   IDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLL  482
             IDNLGQIG SLGYP  +I TF+SLVSIWNY GRV SGF SE ++K++  PR LM+T  LL
Sbjct  369   IDNLGQIGSSLGYPSDSISTFISLVSIWNYLGRVTSGFSSEVLLKKYMFPRPLMLTLVLL  428

Query  481   LPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASP  302
             L C G LL+AF  P S+Y AS+I+GF +G Q  L+F IISE+FGLKYY+TL N G  ASP
Sbjct  429   LSCVGHLLIAFGVPNSLYFASVIIGFCFGAQWPLIFAIISEIFGLKYYATLINVGGAASP  488

Query  301   LGSYILNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGAL  137
             +G+Y+LNVK+ G LYD EA+KQ+ A    R  GE L C+G QCYK++FI++A V  FG+L
Sbjct  489   IGAYLLNVKVAGNLYDAEAMKQLKALGRTRKAGEDLRCVGVQCYKLAFIIMAAVAFFGSL  548

Query  136   VSLVLVARTAAYYKTDIYKRFRDEMGA  56
             +S +LV RT  +YK+DIYK+FR+   A
Sbjct  549   ISFILVIRTRKFYKSDIYKKFREAAEA  575



>ref|XP_006838710.1| hypothetical protein AMTR_s00002p00250920 [Amborella trichopoda]
 gb|ERN01279.1| hypothetical protein AMTR_s00002p00250920 [Amborella trichopoda]
Length=590

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/543 (55%), Positives = 386/543 (71%), Gaps = 12/543 (2%)
 Frame = -1

Query  1660  RGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGL  1481
             RGRWFM FASFLIM+ AGATY+FGVYS++IK++LGY Q  LN L  FKD+GANVGV+SGL
Sbjct  15    RGRWFMFFASFLIMSAAGATYIFGVYSEDIKSSLGYTQQNLNTLSFFKDLGANVGVISGL  74

Query  1480  IAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGAL  1301
             I EVTP W VL +G  MN  GY +IWL+VT RI  PK+W MC+YICVGANSQ+FANTGAL
Sbjct  75    INEVTPPWVVLAMGGVMNLGGYLMIWLAVTDRIPTPKLWHMCVYICVGANSQSFANTGAL  134

Query  1300  VTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFI  1121
             VT VKNFP SRG++LGL+KGFVGLSGA+ TQLY A+YG+DS++LILL+ WLPA +S +F+
Sbjct  135   VTAVKNFPESRGIVLGLLKGFVGLSGAIITQLYHALYGHDSKSLILLVAWLPAAISFMFL  194

Query  1120  PSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALL  941
              +IR MK +   +E KVF+ +L I+++L   LM + I +  + FS  A+     +V  LL
Sbjct  195   STIRIMKPTRDRDEIKVFYSFLYIALSLGAYLMVVIIIETRINFSGSAFKGATVMVVVLL  254

Query  940   FLPFLIAVMEELATRKE------KKKQLLSSENVEDppppaeniekaeeekAGDY---SC  788
             F P  + + +ELA  ++      +   + S E                +  A D    S 
Sbjct  255   FFPLAVVIKQELAKIRQPILPSNQSYPIESPEPKPSESMLEPAKAAEAQAVATDTKPASL  314

Query  787   FGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTI  608
             +   FK PKRG+DY+ILQAL SVDM++LF+   CG G +L AIDN+GQIG+SLGY P+ I
Sbjct  315   WRGTFKAPKRGDDYTILQALFSVDMIILFLATICGVGGTLTAIDNMGQIGKSLGYGPQGI  374

Query  607   GTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVY  428
              TFVSL+SIWN+ GRV SGF SE ++ ++K PR LM+T  +L  C G +L+AFPFPGSV+
Sbjct  375   STFVSLISIWNFLGRVMSGFGSEIVLAKYKFPRPLMLTIVMLFSCVGQILIAFPFPGSVF  434

Query  427   GASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGE  248
              AS+I+G  +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSYI NV++ G LYD E
Sbjct  435   IASVIIGLCFGAQWPLLFAIISEIFGLKYYSTLYNFGAVASPVGSYIFNVRVAGHLYDIE  494

Query  247   AVKQVAARGVG---ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKR  77
             A KQ+  + +    ELTC G +C+++SFI++    L GAL+S+VLV RT  +YK DIY R
Sbjct  495   AAKQLGGKALAPGVELTCTGNRCFRLSFIIITACTLLGALISIVLVVRTREFYKGDIYAR  554

Query  76    FRD  68
             FR+
Sbjct  555   FRE  557



>ref|XP_010557206.1| PREDICTED: uncharacterized protein LOC104826258 [Tarenaya hassleriana]
Length=599

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/561 (55%), Positives = 393/561 (70%), Gaps = 19/561 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
              M++F  Q   GRWFM F S L+M+ +GATY+FG+YS EIK +LGYDQ+T+ LL  FKD+
Sbjct  15    TMKSFAVQTITGRWFMFFVSLLVMSSSGATYMFGLYSNEIKRSLGYDQTTVTLLSFFKDL  74

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVLSGLI EVTP W VL +G+ +NF GYF+IWL+VT RI KP VW MCLYICVGAN
Sbjct  75    GANVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTNRIPKPHVWHMCLYICVGAN  134

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTGALVTCVKNFP SRG++LG++KG+VGLSGA+ TQL+ A YG+D+++LILLIGW
Sbjct  135   SQSFANTGALVTCVKNFPESRGVVLGILKGYVGLSGAIITQLFHAFYGDDTKSLILLIGW  194

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR M++   PNE K+F+++L IS+ LA  LM + I  K   F+   Y 
Sbjct  195   LPAAISFAFLRTIRIMRVVRQPNELKIFYKFLYISLGLATFLMIVIITDKVTGFTRSEYG  254

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKK--------------KQLLSSENVEDppppae  833
               A +V  LL LP ++ ++EE    KEK+              K  +  E   +      
Sbjct  255   GSAGVVILLLLLPIVVVILEEKRLWKEKQSALNDPSPLNIVTEKPAIDQETSSNNEDSGS  314

Query  832   niekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
                K    +    SC+  +F  P RGEDY+ILQAL S DML+LF+   CG G +L AIDN
Sbjct  315   KSVKDVSNEVKSPSCWKTVFSPPDRGEDYTILQALFSADMLILFLATICGVGGTLTAIDN  374

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG+SLGYP R+I TFVSLVSIWNYFGRV SG VSE  + ++K PR LM T  LL+ C
Sbjct  375   LGQIGDSLGYPKRSISTFVSLVSIWNYFGRVSSGVVSEIFLIKYKFPRPLMFTIILLVSC  434

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              G LL+AF  PG +Y AS+I+GF +G Q  L+F IISE+FGLKYYSTL+N G +ASP+GS
Sbjct  435   IGHLLIAFNVPGGLYIASVIIGFCFGAQWPLIFAIISEIFGLKYYSTLYNFGGMASPVGS  494

Query  292   YILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             Y+L+V++ G LYD EA +Q+   G+      +LTC GT C+K SFI++    LFG LVS 
Sbjct  495   YLLSVRVAGNLYDKEAERQMRELGLTRQEGEDLTCNGTACFKTSFIIITAATLFGVLVSA  554

Query  127   VLVARTAAYYKTDIYKRFRDE  65
             +LV RT  +YK+DIYK+FR +
Sbjct  555   LLVVRTKKFYKSDIYKKFRAD  575



>ref|XP_009413295.1| PREDICTED: uncharacterized protein LOC103994629 [Musa acuminata 
subsp. malaccensis]
Length=631

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/560 (57%), Positives = 397/560 (71%), Gaps = 19/560 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F  ++ RGRWFM+F+SFLIMA AGATY+F +YSK+IK++LGYDQSTLN L  FKD+GAN
Sbjct  23    RFAVRVVRGRWFMLFSSFLIMAAAGATYIFSIYSKDIKSSLGYDQSTLNTLSFFKDLGAN  82

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGVLSGLI EVTP W VL +G+ MN  GY +I+L++T R A P VW MCLYICVGANSQ 
Sbjct  83    VGVLSGLINEVTPPWVVLAMGAGMNLFGYLMIYLAITGRTAPPHVWLMCLYICVGANSQT  142

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG++LGL+KGFVGLSGA+ TQLY AIYG+DS++L+LLI WLPA
Sbjct  143   FANTGALVTCVKNFPESRGIVLGLLKGFVGLSGAIMTQLYYAIYGDDSKSLVLLIAWLPA  202

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +SIVF+ +IR MK+ +     K FF +L ISI LA  L+   + +  V FSH  +   A
Sbjct  203   AISIVFVHTIRIMKVETQGKTPKPFFCFLYISIALATYLLIAIVIENKVTFSHSEFGISA  262

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSE----NVED------------ppppaen  830
              +V  LL LP  + V EE    K+ K+ L + +     VE                P   
Sbjct  263   AVVMLLLVLPLAVVVKEEFRVFKQTKQDLQNPQPLAITVEKPSPPEPLPLPESKQSPPTT  322

Query  829   iekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNL  650
                  + K    SC G++F+ P RGEDYSILQAL+S+DM++LF    CG G +L AIDN+
Sbjct  323   ATAGTKHKNHVVSCVGDMFRPPDRGEDYSILQALVSIDMIILFFATICGVGGTLTAIDNM  382

Query  649   GQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCA  470
             GQIGESLGYP R+I TFVSL+SIWNY GRV SGF SE  + ++K PR LM+T  LLL C 
Sbjct  383   GQIGESLGYPKRSIATFVSLISIWNYAGRVASGFASEIFLTKYKFPRPLMLTAVLLLSCV  442

Query  469   GDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSY  290
             G LL+AF    S+Y AS+++GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSY
Sbjct  443   GHLLIAFGVSNSLYFASVVIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGVASPIGSY  502

Query  289   ILNVKIVGRLYDGEAVKQ-VAARGVG--ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
             ILNV++ G LYD EA+KQ    RG    +LTC+G +CYK+SFI++  V + GALVSLVLV
Sbjct  503   ILNVRVAGYLYDREALKQNNGVRGPNGTDLTCIGVECYKLSFIIITAVTVLGALVSLVLV  562

Query  118   ARTAAYYKTDIYKRFRDEMG  59
              RT  +YK DIY +FR++M 
Sbjct  563   WRTKDFYKGDIYAKFREQMA  582



>ref|XP_010509060.1| PREDICTED: uncharacterized protein LOC104785526 [Camelina sativa]
Length=596

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/563 (55%), Positives = 405/563 (72%), Gaps = 25/563 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+    Q+  GRWFM F S LIM+ AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  9     SMKGLAVQILTGRWFMFFGSLLIMSTAGATYMFGIYSSDIKKTLGYDQTTLNLLSFFKDL  68

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GL+ EVTP WF+LL+G+ +NF GYF+IWL+VTKRI+KP+VW MCLYICVGAN
Sbjct  69    GANVGVLAGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTKRISKPQVWHMCLYICVGAN  128

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D++ LIL+IGW
Sbjct  129   SQSFANTGSLVTCVKNFPESRGVILGILKGYVGLSGAIITQLYHAFYGEDTKELILMIGW  188

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA++S  F+ +IR MK+    +E KVF+ +L IS+ LA  LM + I  K   F+   + 
Sbjct  189   LPAVVSFAFLRTIRIMKVKRQTDELKVFYNFLYISLGLATFLMVVIIINKVSGFTQSEFG  248

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKK--------------KQLLSSENVEDppppae  833
               A +V  LL LP +I V+EE    +EK+              K  L  ++ ++     E
Sbjct  249   GSAAVVIVLLLLPIIIVVLEERKLWREKQVALNNPAPINIVTEKPTLEVKDQDEGSHKEE  308

Query  832   niekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
                +  +      SC+  IF  P+RG+DY+ILQAL SVDML+LF+   CG G +L AIDN
Sbjct  309   EERETVKTA----SCWKTIFSPPERGDDYTILQALFSVDMLILFLATICGVGGTLTAIDN  364

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG S GYP R++ TFVSLVSIWNY+GRV +G VSE  + ++K PR LM+T  LLL C
Sbjct  365   LGQIGSSFGYPKRSVSTFVSLVSIWNYYGRVVAGVVSEIFLIKYKFPRPLMLTLVLLLSC  424

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
             AG LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYY+TL+N G +ASP+GS
Sbjct  425   AGHLLIAFNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYATLYNFGSVASPIGS  484

Query  292   YILNVKIVGRLYDGEAVKQVAARGVG-------ELTCLGTQCYKVSFIVLAGVNLFGALV  134
             Y+LNV++ G LYD EA KQ  A G+G       +L C+GT C+K+SFI++  V  FG LV
Sbjct  485   YLLNVRVAGYLYDVEAHKQNKALGIGNERRDGEDLNCIGTSCFKLSFIIITAVTFFGVLV  544

Query  133   SLVLVARTAAYYKTDIYKRFRDE  65
             SLVLV RT  +YK+DIYK+FR++
Sbjct  545   SLVLVIRTKKFYKSDIYKKFREK  567



>ref|XP_007162787.1| hypothetical protein PHAVU_001G180500g [Phaseolus vulgaris]
 gb|ESW34781.1| hypothetical protein PHAVU_001G180500g [Phaseolus vulgaris]
Length=573

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/554 (54%), Positives = 383/554 (69%), Gaps = 13/554 (2%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M++  + +  GRWFM+FAS LIM+ AGATY+F +YS E+K +LGYDQSTLNLL  FKD+G
Sbjct  1     MKSLSYHVITGRWFMLFASLLIMSVAGATYMFAIYSNEVKTSLGYDQSTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVGV+SGL+ E+TP W VL +G  MNF GYF+IWL+V+ RIAKP+VWQMCLYIC+GANS
Sbjct  61    ANVGVISGLVNEITPPWVVLSIGVLMNFFGYFMIWLAVSGRIAKPQVWQMCLYICIGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGN-DSQNLILLIGW  1151
             Q FANTGALVTCVKNFP SRG +LGL+KG+VGLSGA+ TQLY A YG+ + Q LILLI W
Sbjct  121   QTFANTGALVTCVKNFPESRGSLLGLLKGYVGLSGAIITQLYHAFYGDHNPQALILLIAW  180

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S +F+P+IR       P   +VF+  L IS+ LA  LM L + Q  + FS   Y 
Sbjct  181   LPAAVSFLFLPTIRIFNTVHQPKNNRVFYHLLYISLCLAGLLMVLILVQNKLSFSRIEYT  240

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSS-------ENVEDppppaeniekaee  812
                 +V + L LP  +   EE+   K K + L  S         V  PP   + +     
Sbjct  241   VDGLVVFSFLLLPLAVVFREEVNHLKAKTQGLTDSAPELKVVTEVTPPPIVEQEVLSTST  300

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
                   SCF N+   PKRGEDY+ILQAL S+DML LF+    G G +L AIDNLGQIG S
Sbjct  301   SSPEKISCFRNVLNPPKRGEDYTILQALFSMDMLTLFVATTFGAGGTLTAIDNLGQIGNS  360

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             LGYP ++  TFVSLVSIWNY GRV +G+ SE ++ ++K+PR  M+T  LLL C G +L+A
Sbjct  361   LGYPSKSTTTFVSLVSIWNYLGRVAAGYGSEVLLAKYKVPRPYMVTLVLLLSCVGHILIA  420

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
                P S+Y +S+I+GF +G Q  L+F IISE+FGLKYYSTL+N G  ASP+GSYILNVK+
Sbjct  421   LGIPNSLYLSSVIIGFCFGAQWPLMFAIISEIFGLKYYSTLYNLGGAASPVGSYILNVKV  480

Query  271   VGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G LYD EA+KQ+ A+G+      +LTC+G QCY+++FI++    L G L S +L  RT 
Sbjct  481   AGILYDKEALKQLKAKGLMREAGKDLTCVGVQCYRMAFIIITASTLVGCLASFILALRTR  540

Query  106   AYYKTDIYKRFRDE  65
              +YK DIY++FR E
Sbjct  541   KFYKGDIYRKFRTE  554



>ref|XP_007027453.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY07955.1| Major facilitator superfamily protein [Theobroma cacao]
Length=611

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/568 (56%), Positives = 402/568 (71%), Gaps = 22/568 (4%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             + M++F   L  GRWFM+FAS LIM+ +GATY+FG+YS  IK++LGYDQ+TLNLL   KD
Sbjct  14    REMQSFGLNLIIGRWFMVFASLLIMSVSGATYMFGLYSTVIKSSLGYDQTTLNLLSFSKD  73

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G NVGVLSGLI EVTP W VLL+GS MNF GYF+IWL+VT R AKP VWQMC+YIC+GA
Sbjct  74    LGGNVGVLSGLINEVTPPWVVLLIGSVMNFFGYFMIWLAVTGRTAKPHVWQMCVYICLGA  133

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FANTGALVTCVKNFP SRG +LGL+K +VGLSGA+ TQLY A YG +S++LILLI 
Sbjct  134   NSQAFANTGALVTCVKNFPESRGSVLGLLKSYVGLSGAILTQLYHAFYGENSKSLILLIA  193

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S VF+ +IR +KI    NE +VF+    IS+ LA  LM L + Q  + F+   Y
Sbjct  194   WLPAAVSFVFLRTIRIIKIVRQTNELRVFYNMFYISLALAGFLMVLIVIQNRLSFNRIEY  253

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQL-------LSSENVE--Dppppaeniek  821
             +  A++V  LL  P  + V E+    + KK+ L       + +EN    +  P    +E 
Sbjct  254   VGSASLVTLLLLFPLTVVVREDFKIWRRKKQALNDVSQMKVVTENPPTVELAPQTMAVES  313

Query  820   aeeekAGD--------YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLA  665
              + + AGD         +C  NIFK P RGEDY+ILQAL S+DML+LFI   CG G +L 
Sbjct  314   LQPQPAGDPKSPDQKHVACMENIFKPPDRGEDYTILQALFSIDMLILFIATTCGVGGTLT  373

Query  664   AIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSL  485
             AIDNLGQIG SLGYP R+I TFVSLVSIWNY GR  +GF SE ++ ++KIPR L+ T  +
Sbjct  374   AIDNLGQIGNSLGYPSRSITTFVSLVSIWNYLGRAVAGFFSEYLLTKYKIPRPLLFTSVI  433

Query  484   LLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLAS  305
             L  C G LL+AF  P S+Y AS+I+GF +G Q  L++ IISE+FGLKYYSTL+N G +AS
Sbjct  434   LFSCVGHLLIAFAVPNSLYFASVIIGFCFGAQWPLMYAIISEIFGLKYYSTLYNFGAVAS  493

Query  304   PLGSYILNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGA  140
             P+GSYILNV++ G LYD EA+KQ+ A    R  GE LTC G QCY+++FI++    LFG 
Sbjct  494   PVGSYILNVRVAGHLYDKEALKQMKALGRTRKPGEDLTCTGGQCYRMAFIIIIATTLFGF  553

Query  139   LVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             LVS +LV RT  +YK+DIYK+FR+E  A
Sbjct  554   LVSCILVLRTRKFYKSDIYKKFREEAEA  581



>ref|XP_002519464.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42878.1| conserved hypothetical protein [Ricinus communis]
Length=581

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/561 (55%), Positives = 391/561 (70%), Gaps = 18/561 (3%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             + M+ FV  +  GRWFM+F+S LIMA AG  Y+FG+YS +IK +LGYDQ+TLNLL  FKD
Sbjct  15    REMKGFVLTVLVGRWFMVFSSLLIMAMAGTGYMFGMYSNDIKTSLGYDQTTLNLLSFFKD  74

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             VG NVG+LSGLI EV+P W VL +G+ MNF GYF+IW+SVT RI KPKVWQMCLY+ +  
Sbjct  75    VGGNVGILSGLINEVSPPWVVLSIGAIMNFLGYFMIWISVTGRITKPKVWQMCLYMYLST  134

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             N+Q F+NTGALVTCVKNFP SRG ++GL+K FVGLSGA+ TQ Y A YG++S+ LILL+ 
Sbjct  135   NAQAFSNTGALVTCVKNFPESRGGVIGLLKSFVGLSGAIMTQFYHAFYGDNSKALILLLA  194

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             W PA +S VF+  +R MKI    NE K+F ++  IS+ LA  LM L I QK   F+   Y
Sbjct  195   WFPACVSFVFLRVVRIMKIVRQANENKIFHKFFYISLGLASVLMVLIIIQKKFSFTRIEY  254

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQL-------LSSENVEDppppaeniekae  815
             +  A++V  LL LP  I V EE   RK KK  L       + +EN+        ++E++ 
Sbjct  255   VGSASVVVVLLLLPIAIVVKEEHDLRKSKKVALNGPSPLDVVTENLPPVELTKLSLEQST  314

Query  814   ------eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDN  653
                          SC  +IF  P RGEDY ILQAL SVDML+LF+   CG G +L AIDN
Sbjct  315   PPARAPTAAEKQVSCVTSIFNPPARGEDYGILQALFSVDMLVLFVATACGIGGTLTAIDN  374

Query  652   LGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPC  473
             LGQIG+SLGYP R+  TFVSLVSIWNY GR  +GF SE ++ ++KIPR L+ T  LL  C
Sbjct  375   LGQIGQSLGYPARSTATFVSLVSIWNYLGRAVAGFASEILLTKYKIPRPLLFTIVLLFSC  434

Query  472   AGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGS  293
              G LL+AF  P S+Y AS+I+GF +G QL L+F IISELFGLKYYSTL+N G +ASP+GS
Sbjct  435   FGHLLIAFGVPNSLYFASVIIGFCFGAQLPLMFAIISELFGLKYYSTLYNFGAVASPVGS  494

Query  292   YILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSL  128
             Y+LNV + G LYD EA+KQ+ A+G+      +L C G QCYK+SF+++  V + G L+SL
Sbjct  495   YVLNVIVAGHLYDKEALKQLKAKGLRMEAGQDLICYGVQCYKLSFLIITAVTISGCLISL  554

Query  127   VLVARTAAYYKTDIYKRFRDE  65
             VLV RT  +YK DIY++FR+E
Sbjct  555   VLVLRTRKFYKGDIYRKFREE  575



>gb|KDP30493.1| hypothetical protein JCGZ_16172 [Jatropha curcas]
Length=599

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/562 (54%), Positives = 396/562 (70%), Gaps = 17/562 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+N   Q   GRWFM+FAS +IMA +GATY+FG+YS +IK  LGYDQ+TL LL  FKD+
Sbjct  17    DMKNLTVQAIAGRWFMVFASLVIMAASGATYMFGLYSNDIKTALGYDQTTLTLLSFFKDL  76

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+++GV SGLI EVT  W VL +G+ +NF GYF+IWL+VT +I+   VW MCLYI +GAN
Sbjct  77    GSSLGVFSGLINEVTSPWVVLSMGAVLNFFGYFMIWLAVTGKISGVHVWHMCLYIYIGAN  136

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ FANTG+LVTCVKNFP SRG ++G++KG+VGLSGA+ TQ+Y A+YG+DS++LILLIGW
Sbjct  137   SQAFANTGSLVTCVKNFPESRGAVIGILKGYVGLSGAIITQIYYAVYGDDSKSLILLIGW  196

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             +PA +S  F+ +IR MK+   PNE KVF+ +L IS+ LA  LM + I QK ++F+   Y 
Sbjct  197   VPAAISFAFLRTIRIMKVIRQPNELKVFYNFLYISLGLATLLMIIIILQKGMQFTRSEYG  256

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKK------KQLLSSENVEDppppaeniekaeee  809
             A A +V  LLFLP  I ++EE    + KK        L  +   E+          A   
Sbjct  257   ASAAMVLLLLFLPLAIVLIEEYKIWQSKKLASNNPSSLTITTTEENTATGTPMDATASTA  316

Query  808   kAGD------YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLG  647
              + +       SC+   FK P RGEDY+ILQAL S+DML+LF+    G G +L AIDNLG
Sbjct  317   VSSENVIEENVSCWKTAFKPPSRGEDYTILQALFSIDMLVLFLATISGAGGTLTAIDNLG  376

Query  646   QIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAG  467
             QIG SLGYP R+I TFVSLVSIW Y GRV +GF SE  + ++K PR LM+T  LL  C G
Sbjct  377   QIGTSLGYPKRSISTFVSLVSIWGYLGRVVAGFASEHFLTKYKFPRPLMLTLILLFSCVG  436

Query  466   DLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI  287
              LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSY+
Sbjct  437   HLLIAFNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGMASPIGSYV  496

Query  286   LNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             LNVK+ G LYD EA KQ+AA+G+      EL+C+G +C+K+SFI++  V +F  LVSL+L
Sbjct  497   LNVKVAGHLYDIEAKKQLAAKGLTRQHGQELSCIGIECFKLSFIIITAVTIFSTLVSLIL  556

Query  121   VARTAAYYKTDIYKRFRDEMGA  56
             V RT  +YK+DIYK+FR+   A
Sbjct  557   VLRTRKFYKSDIYKKFREAAQA  578



>ref|XP_009630642.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Nicotiana 
tomentosiformis]
Length=608

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/557 (56%), Positives = 400/557 (72%), Gaps = 16/557 (3%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M NF    F GRWFM+FAS LIM+ AGATY+FG+YS EIK++LGYDQ+TLNLL  FKD+G
Sbjct  15    MANFGHHFFTGRWFMVFASLLIMSMAGATYMFGLYSGEIKSSLGYDQTTLNLLSFFKDLG  74

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
              NVG+++GLI EVTP W VL +G+ MNF GYF+IWLSV+  IAKP +WQMCLYIC+GANS
Sbjct  75    GNVGIIAGLINEVTPPWVVLFIGAIMNFFGYFMIWLSVSGHIAKPAIWQMCLYICIGANS  134

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q FANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQLY A YGN+ ++LILLIGWL
Sbjct  135   QTFANTGALVTCVKNFPESRGSLLGLLKGFVGLSGAIITQLYHAFYGNNGKSLILLIGWL  194

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             PA++S +F+ +IR MK+    NETK+F+++L IS+ LA  +M + I Q  V F+   Y  
Sbjct  195   PAVVSCIFLRTIRIMKVVRQANETKIFYKFLYISLGLAGFIMIIIIVQNKVNFTRPEYSG  254

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQL------LSSENVEDppppaeniekaeeek  806
              A +V  LLF P +I   E+L     K++ L      + SEN+            +  E 
Sbjct  255   SAAVVLILLFAPLVIVFKEDLKLWNIKQQALNDHPLKVVSENLASVELTQPQKLASSPEL  314

Query  805   AGD-----YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQI  641
               +      SCF N+F  P RG+DY+ILQAL S+DM++LF     G G +L AIDNLGQI
Sbjct  315   PKECDEKTTSCFSNVFNPPPRGDDYTILQALFSIDMIILFTTTTFGVGGTLTAIDNLGQI  374

Query  640   GESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDL  461
             G++LGYP ++I TFVSLVSIWNY GRV SGFVSE  + ++K PR LM+T  LLL CAG L
Sbjct  375   GKALGYPEKSITTFVSLVSIWNYLGRVVSGFVSEIFLTKYKCPRPLMLTLVLLLSCAGHL  434

Query  460   LVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILN  281
             L+AF  P S+Y AS+++GF +G Q  L+F IISELFGLKYYSTL+N G  ASP+G+Y+LN
Sbjct  435   LIAFGVPNSLYIASVLMGFCFGAQWPLIFAIISELFGLKYYSTLYNFGAGASPVGAYLLN  494

Query  280   VKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVA  116
             VK+ G LYD  A KQ+ A+G+      +LTC+G +CYK++F+++ G  L    VSL+LV 
Sbjct  495   VKVAGHLYDKVATKQMLAKGLKRKDGEDLTCIGVECYKLAFLIITGATLISCAVSLILVI  554

Query  115   RTAAYYKTDIYKRFRDE  65
             RT  +YK DIYK+FR++
Sbjct  555   RTRKFYKGDIYKKFREQ  571



>ref|XP_004142499.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Cucumis 
sativus]
Length=581

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/541 (56%), Positives = 399/541 (74%), Gaps = 5/541 (1%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
              +  GRWF++FAS LIMA AGATY+FG+YS +IK+ LGYDQ+TLNLL  FKD+GANVGVL
Sbjct  19    HVITGRWFVVFASLLIMAAAGATYMFGLYSSDIKSVLGYDQTTLNLLSFFKDLGANVGVL  78

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SGLI EVTP W VL +G+ +NF GYF+IWL+VT+RI+ PKVWQMCLYIC+GANSQ+FANT
Sbjct  79    SGLINEVTPPWVVLSIGAVLNFFGYFMIWLAVTRRISAPKVWQMCLYICIGANSQSFANT  138

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             G+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQL+ A YG+D+++LILLIGWLPA +S 
Sbjct  139   GSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLFHAFYGDDTKSLILLIGWLPAAISF  198

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
               + +IR MK+   PNE KVF+ +L IS+ LA  LM + I +   +F+   Y   A +V 
Sbjct  199   ASLRTIRIMKVIRQPNELKVFYNFLYISLALAGFLMLMIIVESKKQFNQNEYGGSAAVVL  258

Query  949   ALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSCFGNIFK  770
              LL LP  + ++EE    K K   + S               +  +++  + SC+  IF 
Sbjct  259   LLLILPLAVVIIEEYNLWKLKTAVIKSPNPSVQIVTEKLPKTEHPKQERKEPSCWTTIFS  318

Query  769   KPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSL  590
              P+RGED++ILQAL SVDML+LFI   CG G +L AIDNLGQIG +LGYP R+I TFVSL
Sbjct  319   PPQRGEDFTILQALFSVDMLILFIAAICGVGGTLTAIDNLGQIGLALGYPKRSISTFVSL  378

Query  589   VSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLIL  410
             VSIWNY GRV SGF+SE ++ ++K PR L+++ +LLL C G L++AF  P  +Y AS+++
Sbjct  379   VSIWNYLGRVASGFISEIVLTKYKFPRPLILSLTLLLSCVGHLMIAFDVPNGLYVASIVI  438

Query  409   GFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVA  230
             GF +G Q  L+F IISELFGLKYYSTL+N G +ASP+G Y+LNVK+ G  YD EA KQ+ 
Sbjct  439   GFCFGAQWPLIFAIISELFGLKYYSTLYNFGSVASPIGLYVLNVKVAGNFYDREAEKQLE  498

Query  229   ARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDE  65
             A+ +      EL C G +C+K+SFIV+ GV L G LVSL+LV RT ++YK+DIYK+FRDE
Sbjct  499   AKRIIRKAGEELKCFGGECFKLSFIVITGVTLLGMLVSLILVIRTRSFYKSDIYKKFRDE  558

Query  64    M  62
             +
Sbjct  559   V  559



>gb|KHN18681.1| Putative transporter MCH1 [Glycine soja]
Length=573

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/558 (55%), Positives = 388/558 (70%), Gaps = 17/558 (3%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M+   + +  GRWFM+FAS LIM+ AGATY+FG+YS E+K +LGYDQSTLNLL  FKD+G
Sbjct  1     MKALSYHVLTGRWFMLFASLLIMSVAGATYMFGIYSNEVKTSLGYDQSTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVGV+SGL+ EVTP + VL +G  MNF GYF+I+L+V+ RI KP+VWQMCLYIC+GANS
Sbjct  61    ANVGVISGLVNEVTPPFVVLSIGVIMNFFGYFMIFLAVSGRIDKPQVWQMCLYICIGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGN-DSQNLILLIGW  1151
             Q FANTGALVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY A YG+ DSQ LILLI W
Sbjct  121   QTFANTGALVTCVKNFPGSRGSILGILKGYVGLSGAIITQLYHAFYGDHDSQALILLIAW  180

Query  1150  LPAILSIVFIPSIRPMKISSH-PNE-TKVFFEYLGISITLALCLMGLTIAQKYVRFSHFA  977
             LPA +S +F+P+IR M    H P E  +VF+  L IS+ LA  LM L + Q  + FS   
Sbjct  181   LPAAVSFLFLPTIRLMNTVHHQPKEDNRVFYHLLYISLGLAAFLMVLIVVQNKLSFSRIE  240

Query  976   YIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSS--------ENVEDppppaeniek  821
             YI    +V + L LP  +   EE+   K K + L  S        E +       + +  
Sbjct  241   YIVDGLVVFSFLLLPLAVVFREEINQLKAKTQGLTDSPPQLKVVTEAIPSSNVVEQEVVP  300

Query  820   aeeekAGDYS-CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
             A    + + S C  NIF  PKRGEDY+ILQAL S+DML+LFI    G G +L AIDNLGQ
Sbjct  301   AATTSSHEKSSCLRNIFNPPKRGEDYTILQALFSIDMLILFIATTFGAGGTLTAIDNLGQ  360

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IG SLGYP ++  TFVSLVSIWNY GRV SG+ SE  + ++K+PR  M+T  LLL C G 
Sbjct  361   IGHSLGYPNKSTTTFVSLVSIWNYLGRVASGYASEIFLTKYKVPRPYMLTLVLLLSCVGH  420

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             +L+A   P S+Y AS+++GF +G Q  L+F IISE+FGLKYYSTL+N G  ASPLGSYIL
Sbjct  421   VLIALGVPNSLYLASVVIGFCFGAQWPLMFAIISEVFGLKYYSTLYNFGAAASPLGSYIL  480

Query  283   NVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
             NVK+ G LYD EA+K + A+G+      +LTC+G QCYK++FI++    L G   S++L 
Sbjct  481   NVKVAGVLYDKEALKLLKAKGLTRQEGKDLTCVGVQCYKMAFIIITASTLVGCFASIILA  540

Query  118   ARTAAYYKTDIYKRFRDE  65
              RT  +YK DIY++FR E
Sbjct  541   LRTRKFYKGDIYRKFRTE  558



>ref|XP_008456537.1| PREDICTED: uncharacterized protein LOC103496460 [Cucumis melo]
Length=600

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/555 (54%), Positives = 392/555 (71%), Gaps = 15/555 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             +F  ++  G WFM+FASFL+M+ AG  Y+FG+YS  IK+ LGYDQSTLNL+  FKD+G N
Sbjct  31    SFFVEVLTGPWFMVFASFLVMSTAGTPYMFGLYSGAIKSVLGYDQSTLNLISFFKDLGTN  90

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+++GLIAE+ P W VL +G+ MNF GYF+IWLSVT+++A P VW MCLYIC+GANS +
Sbjct  91    VGIIAGLIAEIMPPWVVLAIGAGMNFVGYFMIWLSVTEKVAAPPVWLMCLYICIGANSTS  150

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKN+PA RG +LG++KG+VGLSGA+ TQ Y AIYG+DS++LILL+ WLPA
Sbjct  151   FANTGALVTCVKNYPARRGAVLGILKGYVGLSGAIMTQFYHAIYGDDSKSLILLLAWLPA  210

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++ +VF+ +IR MK+   PNE  VF+ +L +S+ LA  LM + + Q+  +FS   Y + A
Sbjct  211   VILVVFLRTIRIMKVQHRPNELTVFYRFLYVSLGLAGFLMVMIVLQQKFKFSRIEYSSSA  270

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAG------  800
              +V  LLFLP  I + E+    + K  QLL+   +               E +G      
Sbjct  271   AVVVFLLFLPIFIVIAEDYKFWRVKLSQLLNPSPLTIITQKPTPPPPQNLETSGISPAGK  330

Query  799   ----DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
                   SC+    K P RGEDY+ILQAL S DM LLF+   CG G +L AIDNLGQIG S
Sbjct  331   PTSSTPSCWTTALKPPPRGEDYTILQALFSADMFLLFLSTACGVGGTLTAIDNLGQIGAS  390

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             L YP R+I TFVSLVSIWNY GRV SGF SE  + ++K PRTL++T  LLL C G +L+A
Sbjct  391   LQYPKRSISTFVSLVSIWNYLGRVVSGFTSEIFLTKYKFPRTLILTLILLLSCVGHILIA  450

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             F  PG +Y AS+++GF YG Q  +LF IISE+FGLKYYSTL+N G +ASP+G Y +NV++
Sbjct  451   FNPPGGLYFASIVIGFCYGAQWPILFAIISEIFGLKYYSTLYNFGSVASPIGLYFVNVRV  510

Query  271   VGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G LYD EA +Q+AA G+      EL C+G  C+K+SFI++ GV L GAL S VLV RT 
Sbjct  511   AGHLYDEEAKRQLAASGMKRIPGKELNCVGVNCFKMSFIIITGVTLLGALFSFVLVLRTR  570

Query  106   AYYKTDIYKRFRDEM  62
             A+YKTDIY++FR+E+
Sbjct  571   AFYKTDIYRKFREEV  585



>ref|XP_003521414.2| PREDICTED: uncharacterized protein LOC100797779 [Glycine max]
Length=616

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/560 (54%), Positives = 389/560 (69%), Gaps = 17/560 (3%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             + M+   + +  GRWFM+FAS LIM+ AGATY+FG+YS E+K +LGYDQSTLNLL  FKD
Sbjct  42    RGMKALSYHVLTGRWFMLFASLLIMSVAGATYMFGIYSNEVKTSLGYDQSTLNLLSFFKD  101

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +GANVGV+SGL+ EVTP + VL +G  MNF GYF+I+L+V+ RI KP+VWQMCLYIC+GA
Sbjct  102   LGANVGVISGLVNEVTPPFVVLSIGVIMNFFGYFMIFLAVSGRIDKPQVWQMCLYICIGA  161

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGN-DSQNLILLI  1157
             NSQ FANTGALVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY A YG+ DSQ LILLI
Sbjct  162   NSQTFANTGALVTCVKNFPGSRGSILGILKGYVGLSGAIITQLYHAFYGDHDSQALILLI  221

Query  1156  GWLPAILSIVFIPSIRPMKISSH-PNE-TKVFFEYLGISITLALCLMGLTIAQKYVRFSH  983
              WLPA +S +F+P+IR M    H P E  +VF+  L IS+ LA  LM L + Q  + FS 
Sbjct  222   AWLPAAVSFLFLPTIRLMNTVHHQPKEDNRVFYHLLYISLGLAAFLMVLIVVQNKLSFSR  281

Query  982   FAYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSS--------ENVEDppppaeni  827
               YI    +V + L LP  +   EE+   K K + L  S        E +       + +
Sbjct  282   IEYIVDGLVVFSFLLLPLAVVFREEINQLKAKTQGLTDSPPQLKVVTEAIPSSNVVEQEV  341

Query  826   ekaeeekAGDYS-CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNL  650
               A    + + S C  NIF  PKRGEDY+ILQAL S+DML+LFI    G G +L AIDNL
Sbjct  342   VPAATTSSHEKSSCLRNIFNPPKRGEDYTILQALFSIDMLILFIATTFGAGGTLTAIDNL  401

Query  649   GQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCA  470
             GQIG SLGYP ++  TFVSLVSIWNY GRV SG+ SE  + ++K+PR  M+T  LLL C 
Sbjct  402   GQIGHSLGYPNKSTTTFVSLVSIWNYLGRVASGYASEIFLTKYKVPRPYMLTLVLLLSCV  461

Query  469   GDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSY  290
             G +L+A   P S+Y AS+++GF +G Q  L+F IISE+FGLKYYSTL+N G  ASPLGSY
Sbjct  462   GHVLIALGVPNSLYLASVVIGFCFGAQWPLMFAIISEVFGLKYYSTLYNFGAAASPLGSY  521

Query  289   ILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLV  125
             ILNVK+ G LYD EA+K + A+G+      +LTC+G QCYK++FI++    L G   S++
Sbjct  522   ILNVKVAGVLYDKEALKLLKAKGLTRQEGKDLTCVGVQCYKMAFIIITASTLVGCFASII  581

Query  124   LVARTAAYYKTDIYKRFRDE  65
             L  RT  +YK DIY++FR E
Sbjct  582   LALRTRKFYKGDIYRKFRTE  601



>ref|XP_008379735.1| PREDICTED: uncharacterized protein LOC103442697 [Malus domestica]
Length=610

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/566 (55%), Positives = 396/566 (70%), Gaps = 18/566 (3%)
 Frame = -1

Query  1699  EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSF  1520
             E  N +    Q+  GRWF +FAS LIM+ +GATY+FG+YS +IK+ LGYDQSTLNLL  F
Sbjct  11    EXSNTKTLTLQVLNGRWFTVFASLLIMSASGATYMFGLYSSDIKSVLGYDQSTLNLLSLF  70

Query  1519  KDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICV  1340
             KD G+NVGVLSGLI EVT  W VL VG  +NF GYF+IW++VTK+IAKP+VW MC+YIC+
Sbjct  71    KDFGSNVGVLSGLINEVTSPWVVLSVGGVLNFFGYFMIWMAVTKKIAKPQVWHMCMYICM  130

Query  1339  GANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILL  1160
             GA SQ+FANTG+L+T VKNFP SRG +LG +KG+ GLSGA+FTQLY A Y +D+++LILL
Sbjct  131   GATSQSFANTGSLITSVKNFPESRGSVLGFLKGYAGLSGAIFTQLYSAFYYDDTKDLILL  190

Query  1159  IGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHF  980
             IGWLP  +S V + +IR MK+  HPNE KVF+  L IS+ LA  LM + I QK V F+  
Sbjct  191   IGWLPTAVSFVSLRTIRIMKVIRHPNELKVFYNMLYISLGLAGFLMVMIIIQKNVHFTQG  250

Query  979   AYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE-------------Dpppp  839
              Y A A +V  LL LP  + + EE    + KK +L    +++                  
Sbjct  251   EYGASAAMVIFLLVLPLAVVIFEEFKILEGKKLELNGGSDLKVVTEKPKSEEVGVTSDLS  310

Query  838   aeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAI  659
                   A   +  + SC+  +F+ P+RGEDY+ILQAL S+DML+LF+   CG G +  AI
Sbjct  311   RPKEALATTTRETEPSCWKTMFRPPERGEDYTILQALFSIDMLILFVACICGVGGAFTAI  370

Query  658   DNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLL  479
             DNLGQIG SLGY   +I TFVSLVSIWNY GRV SGF SE ++KR+K PR LM+T +LLL
Sbjct  371   DNLGQIGASLGYHKHSISTFVSLVSIWNYLGRVVSGFGSEILLKRYKFPRPLMLTLTLLL  430

Query  478   PCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPL  299
              CAG LL+AF     +Y AS+I+GF  G    LLF IISELFGLKYYSTLFN G  ASP+
Sbjct  431   SCAGHLLIAFNVKNGLYVASVIIGFCLGALWPLLFAIISELFGLKYYSTLFNFGACASPV  490

Query  298   GSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALV  134
             G Y+LNV++ G +YD EA KQ+AA+G+      ELTC+G +C+K+SFIV+A V LFG  V
Sbjct  491   GLYLLNVRLAGHIYDKEANKQLAAKGLVREVGEELTCVGGECFKLSFIVIAAVTLFGTFV  550

Query  133   SLVLVARTAAYYKTDIYKRFRDEMGA  56
             SLVLV RT  +Y++DIYK+FR++  A
Sbjct  551   SLVLVMRTRKFYQSDIYKKFREKTEA  576



>ref|XP_011094505.1| PREDICTED: uncharacterized protein LOC105174183 [Sesamum indicum]
Length=610

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/574 (53%), Positives = 404/574 (70%), Gaps = 30/574 (5%)
 Frame = -1

Query  1699  EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSF  1520
             E      F  Q+  GRWFM+FA+ LIM+ AGATY+FG+YS EIK+ LGYDQ+TLNLL  F
Sbjct  15    EWPTTRAFATQVLTGRWFMVFATTLIMSAAGATYMFGLYSSEIKSALGYDQTTLNLLSFF  74

Query  1519  KDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICV  1340
             KD+G+NVGVLSGLI EVTP W VL +G+ +NF GY +IWL+V+K+I++P+VW MCLYIC+
Sbjct  75    KDLGSNVGVLSGLINEVTPPWVVLSIGAVLNFFGYLMIWLAVSKKISRPQVWHMCLYICI  134

Query  1339  GANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILL  1160
             GANSQ+FANTGALVT VKNFP SRG +LGL+KGFVGLSGA+ TQ+Y A+Y +D ++LILL
Sbjct  135   GANSQSFANTGALVTAVKNFPESRGAVLGLLKGFVGLSGAIITQIYHAVYEDDLKSLILL  194

Query  1159  IGWLPAILSI--VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFS  986
             IGW+PA L+I   F+ +IR MK+    +E KVF+ +L +S+ LA  LM + I QK + FS
Sbjct  195   IGWVPAALAISFAFLRTIRIMKVVRIAHELKVFYRFLYVSLGLAGFLMLVIILQKQMDFS  254

Query  985   HFAYIACATIVCALLFLPFLIAVMEELATRKEKKKQL--LSSENVE--------------  854
                Y   A  V  LLFLP  + V EE    ++KK++L  +SS+ ++              
Sbjct  255   RGEYGVSAATVIFLLFLPVAVVVKEEFDLWRKKKQELDNISSQPIKIVTDKPPPAATVVE  314

Query  853   -----DppppaeniekaeeekAGDYSCFG--NIFKKPKRGEDYSILQALLSVDMLLLFIC  695
                   PP P          +  + SC+   ++F+ P RGEDY+ILQAL S+DML+LF  
Sbjct  315   ATATATPPVPPPRASTVTPPQNEELSCWNPRSMFRPPDRGEDYTILQALFSIDMLILFFA  374

Query  694   NFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKI  515
               CG G +L AIDNLGQIG SLGYP ++I TFVSLVSIWNY GRV +GF+SE  +K++K 
Sbjct  375   TICGVGGTLTAIDNLGQIGSSLGYPKKSISTFVSLVSIWNYLGRVVAGFLSEHFLKKYKF  434

Query  514   PRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYS  335
             PR LM+T +L++   G +L+AF  P  +Y AS+I+GF +G Q  LLF IISELFGLKYYS
Sbjct  435   PRPLMLTLTLIISSIGHVLIAFNVPNGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYS  494

Query  334   TLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFI  170
             TL+N G +ASP+G Y+LNV++ G LYD EA KQ+ A G       EL C G +C+K++F+
Sbjct  495   TLYNFGSVASPIGLYVLNVRVTGHLYDREAEKQLLASGRSRRPGEELDCNGVECFKLAFV  554

Query  169   VLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRD  68
             ++  V +FGA+VSL+LV RT  +YK+DIYK+FR 
Sbjct  555   IITAVTVFGAIVSLLLVIRTRKFYKSDIYKKFRQ  588



>ref|XP_007132716.1| hypothetical protein PHAVU_011G118800g [Phaseolus vulgaris]
 gb|ESW04710.1| hypothetical protein PHAVU_011G118800g [Phaseolus vulgaris]
Length=595

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/550 (53%), Positives = 395/550 (72%), Gaps = 11/550 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+ Q+ +GRWFM+ ASF IM G+G +Y+FG YS+ IK+T GYDQSTLNLLG FKD+G N
Sbjct  18    KFIAQVIKGRWFMLCASFFIMGGSGGSYVFGSYSEVIKSTQGYDQSTLNLLGFFKDLGGN  77

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             +G   GLI E++P W VLL+GS++NF GYF+IWL VT +I KP +WQ+CLYI +G +SQN
Sbjct  78    LGAPIGLIGEISPPWLVLLMGSSLNFVGYFMIWLVVTGKILKPPIWQVCLYIAIGVSSQN  137

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG + TCVKNFP SRG +LG++KG++GLSGA+ TQLYLAIYGNDS++LILL+ WLPA
Sbjct  138   FANTGIITTCVKNFPESRGTILGVLKGYIGLSGAIMTQLYLAIYGNDSESLILLVAWLPA  197

Query  1141  ILSIVFIPSIRPMKI-SSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
             ++  +F   +R MK+ +  PNE K+  ++L  S+ LA+ +M + I QK V FS  AY   
Sbjct  198   VIPAIFACVVRFMKVGTKQPNEEKIINQFLFASVVLAIFIMVMIIVQKQVVFSKAAYAGS  257

Query  964   ATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV-----EDppppaeniekaeeekAG  800
             AT VC L  LP  I + +EL+    K+K  LS+  V     E   P   +    E+ K  
Sbjct  258   ATGVCILFILPLFIVIRQELSLWNIKEKLALSANEVVIEKPEIVEPKESSPIPEEKTKDP  317

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               SCF NIF KP+RGED++ILQAL+S+DMLLL   +F G G ++  +DNLGQIG+SLGY 
Sbjct  318   KLSCFANIFNKPERGEDHTILQALVSIDMLLLLTSSFVGYGTNVTVVDNLGQIGKSLGYT  377

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
               T+ +FVSLVSIWNY GRV SG VS+T+++++K+PR +++ FS  L C G LL+ FP P
Sbjct  378   GNTVKSFVSLVSIWNYSGRVLSGLVSDTLLRKYKVPRPMLLVFSHFLTCIGHLLIVFPKP  437

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
             GSVY AS+I+GF++GV L +L+ ++SELFGLK++STL NC  +  P+GSY+LNV++ G L
Sbjct  438   GSVYFASVIIGFAFGVLLPMLYALVSELFGLKHFSTLQNCVLMVIPIGSYVLNVRVTGFL  497

Query  259   YDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA  Q+   G       ELTC+GT+CYK S I++A ++    L SL+ VART+ +YK
Sbjct  498   YDQEAKNQLKRSGKERLQGTELTCIGTECYKHSLIIMACLSFLAGLTSLIFVARTSKFYK  557

Query  94    TDIYKRFRDE  65
             +DIYK+F  +
Sbjct  558   SDIYKKFTHD  567



>ref|XP_010517258.1| PREDICTED: uncharacterized protein LOC104792736 [Camelina sativa]
Length=594

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/556 (56%), Positives = 399/556 (72%), Gaps = 27/556 (5%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             Q+  GRWFM F S LIM+ AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD+GANVG+L
Sbjct  16    QILTGRWFMFFGSLLIMSTAGATYMFGIYSSDIKKTLGYDQTTLNLLSFFKDLGANVGIL  75

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             +GL+ EVTP WF+LL+G+ +NF GYF+IWL+VTKRI+KP++W MCLYIC+GANSQ+FANT
Sbjct  76    AGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTKRISKPQIWHMCLYICIGANSQSFANT  135

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             G+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D++ LIL+IGWLPA++S 
Sbjct  136   GSLVTCVKNFPESRGVILGILKGYVGLSGAIITQLYHAFYGEDTKELILMIGWLPAVVSF  195

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
              F+ +IR MK+    +E KVF+ +L IS+ LA  LM + I  K   F+   +   A +V 
Sbjct  196   AFLRTIRIMKVKRQTDELKVFYNFLYISLGLATFLMVVIIINKLSGFTQSEFGGSAAVVI  255

Query  949   ALLFLPFLIAVMEELATRKEKK---------------KQLLSSENVEDppppaeniekae  815
              LL LP +I V+EE    +EK+               K  L S  V+D      +     
Sbjct  256   VLLLLPIIIVVLEERKLWREKQVALNNPAPINIVVTEKPTLDSSEVKDQDEEGPDKAVKT  315

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
                    SC+  IF  P+RG+DY+ILQAL S+DML+LF+   CG G +L AIDNLGQIG 
Sbjct  316   A------SCWKTIFNPPERGDDYTILQALFSIDMLILFLATICGVGGTLTAIDNLGQIGS  369

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             SLGYP R++ TFVSLVSIWNY+GRV +G VSE  + ++K PR LM+T  LLL CAG LL+
Sbjct  370   SLGYPKRSVSTFVSLVSIWNYYGRVVAGVVSEIFLIKYKFPRPLMLTLVLLLSCAGHLLI  429

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYY+TL+N G +ASP+G+Y+L+V+
Sbjct  430   AFNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYATLYNFGSVASPIGTYLLSVR  489

Query  274   IVGRLYDGEAVKQVAA-----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVAR  113
             + G LYD EA KQ  A     R  GE L C+GT CYK+SFI++  V  FG LVSLVLV R
Sbjct  490   VAGYLYDMEADKQYKALGKTPRTDGEDLNCIGTSCYKLSFIIITAVTFFGVLVSLVLVIR  549

Query  112   TAAYYKTDIYKRFRDE  65
             T  +Y +DIYK+FR++
Sbjct  550   TKKFYNSDIYKKFREK  565



>ref|XP_003555885.1| PREDICTED: uncharacterized protein LOC100808975 [Glycine max]
Length=591

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/551 (56%), Positives = 395/551 (72%), Gaps = 9/551 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +    + Q+  GRWF++FASFLIMA AGATY+F +YS +IK+ L YDQ+TLNLL  FKD+
Sbjct  10    DTNGLMVQVITGRWFVVFASFLIMAAAGATYMFSLYSGDIKSALAYDQTTLNLLSFFKDL  69

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G NVGVLSGLI E+TP W VL +GS +NF GYF+IWL+VTK+I KP VW MCLYIC+G+N
Sbjct  70    GGNVGVLSGLINEITPPWVVLAMGSVLNFFGYFMIWLAVTKKIPKPHVWHMCLYICIGSN  129

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A Y +DS++LILLIGW
Sbjct  130   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYFAFYYDDSRSLILLIGW  189

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S +F+ +IR MK    PNE  VF+++L IS+ LA  L+ + I QK V FS   Y 
Sbjct  190   LPAAISFLFLRTIRYMKPVRQPNELSVFYKFLYISLGLAGFLLVMIIVQKQVHFSQSEYG  249

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV----EDppppaeniekaeeekA  803
               A +V  LLFLP  +  +E+   R+ +K   +    V    E               + 
Sbjct  250   VSAGVVLFLLFLPLAVVFVEQYKIRESQKLAFIDPSPVKIVAEGESANGNTSNTPISTEI  309

Query  802   GDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGY  623
              +   +  +   P RGEDY+ILQAL S+DM+LLF    CG G +L AIDNLGQIG SLGY
Sbjct  310   EETRWWQKVLSPPPRGEDYTILQALFSLDMILLFFAGTCGVGGTLTAIDNLGQIGTSLGY  369

Query  622   PPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPF  443
             P  +I TFVSLVSIWNY GRVFSGFVSE  ++++K PR LM+T +LLL CAG LL+AF  
Sbjct  370   PKASISTFVSLVSIWNYLGRVFSGFVSEHFLQKYKFPRPLMLTLTLLLSCAGHLLIAFDV  429

Query  442   PGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGR  263
             P  +Y AS+I+GF +G Q  L+F IISELFGLKYYSTL+N G  ASP+G Y+LNV++ G 
Sbjct  430   PNGLYVASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGAASPIGLYVLNVRVTGH  489

Query  262   LYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYY  98
             LYD EA+KQ+A  G+      ELTC+G+ C+K+SFI++     FGAL+SL+LVART  +Y
Sbjct  490   LYDKEALKQLAVAGIPRNDAKELTCIGSSCFKLSFIIITAATFFGALISLILVARTIKFY  549

Query  97    KTDIYKRFRDE  65
             K DIYKR+R++
Sbjct  550   KGDIYKRYREQ  560



>gb|KHN11444.1| hypothetical protein glysoja_015339 [Glycine soja]
Length=584

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/551 (56%), Positives = 395/551 (72%), Gaps = 9/551 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +    + Q+  GRWF++FASFLIMA AGATY+F +YS +IK+ L YDQ+TLNLL  FKD+
Sbjct  3     DTNGLMVQVITGRWFVVFASFLIMAAAGATYMFSLYSGDIKSALAYDQTTLNLLSFFKDL  62

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G NVGVLSGLI E+TP W VL +GS +NF GYF+IWL+VTK+I KP VW MCLYIC+G+N
Sbjct  63    GGNVGVLSGLINEITPPWVVLAMGSVLNFFGYFMIWLAVTKKIPKPHVWHMCLYICIGSN  122

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A Y +DS++LILLIGW
Sbjct  123   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYFAFYYDDSRSLILLIGW  182

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S +F+ +IR MK    PNE  VF+++L IS+ LA  L+ + I QK V FS   Y 
Sbjct  183   LPAAISFLFLRTIRYMKPVRQPNELSVFYKFLYISLGLAGFLLVMIIVQKQVHFSQSEYG  242

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV----EDppppaeniekaeeekA  803
               A +V  LLFLP  +  +E+   R+ +K   +    V    E               + 
Sbjct  243   VSAGVVLFLLFLPLAVVFVEQYKIRESQKLAFIDPSPVKIVAEGESANGNTSNTPISTEI  302

Query  802   GDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGY  623
              +   +  +   P RGEDY+ILQAL S+DM+LLF    CG G +L AIDNLGQIG SLGY
Sbjct  303   EETRWWQKVLSPPPRGEDYTILQALFSLDMILLFFAGTCGVGGTLTAIDNLGQIGTSLGY  362

Query  622   PPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPF  443
             P  +I TFVSLVSIWNY GRVFSGFVSE  ++++K PR LM+T +LLL CAG LL+AF  
Sbjct  363   PKASISTFVSLVSIWNYLGRVFSGFVSEHFLQKYKFPRPLMLTLTLLLSCAGHLLIAFDV  422

Query  442   PGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGR  263
             P  +Y AS+I+GF +G Q  L+F IISELFGLKYYSTL+N G  ASP+G Y+LNV++ G 
Sbjct  423   PNGLYVASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGAASPIGLYVLNVRVTGH  482

Query  262   LYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYY  98
             LYD EA+KQ+A  G+      ELTC+G+ C+K+SFI++     FGAL+SL+LVART  +Y
Sbjct  483   LYDKEALKQLAVAGIPRNDAKELTCIGSSCFKLSFIIITAATFFGALISLILVARTIKFY  542

Query  97    KTDIYKRFRDE  65
             K DIYKR+R++
Sbjct  543   KGDIYKRYREQ  553



>ref|XP_011094591.1| PREDICTED: uncharacterized protein LOC105174255 [Sesamum indicum]
Length=568

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/547 (54%), Positives = 398/547 (73%), Gaps = 14/547 (3%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             ++   RWFM+FA  LIM+ +GATY+FG+YS +IK +LGYDQ+TLNL+G FKD+G N+GV+
Sbjct  19    EVLTSRWFMVFACLLIMSMSGATYIFGIYSNDIKTSLGYDQTTLNLIGFFKDLGGNIGVM  78

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SG+I EVTP W VL +G AMNF+GYF+IWL+VT RIAKP+VW+MCLYIC+GANSQ F+NT
Sbjct  79    SGVINEVTPPWVVLAIGVAMNFSGYFMIWLAVTGRIAKPRVWEMCLYICIGANSQTFSNT  138

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             GALVTCVKNFP SRG+++GL+KGF GLSGA+ TQL+ A YG++S+ LILLI WLPA +S 
Sbjct  139   GALVTCVKNFPESRGIVIGLLKGFTGLSGAIITQLFHAFYGHNSKALILLISWLPAAVSC  198

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
             VF+ ++R MK+    NE ++F++ L  S+ LA  LM L I Q  + FS   Y   A++V 
Sbjct  199   VFLRTVRLMKVVRQENELQIFYDLLYASLGLAGFLMILIILQNELVFSRAEYAGSASVVL  258

Query  949   ALLFLPFLIAVMEELATRKEKKKQLLSSEN-------VEDppppaeniekaeeekAGDYS  791
              LLF P  I   EEL  +  K KQ+  +E+       V    PP + + +  +++     
Sbjct  259   ILLFAPLAIVFREEL--KIWKSKQVAGNESNDPSPLKVTTENPPQQMVAQPPKDQETSVP  316

Query  790   CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRT  611
              + ++FK P+RG+DY+ILQAL S+DM++LF     G G +L AIDNLGQIG++LGYP ++
Sbjct  317   WWRDVFKPPERGQDYNILQALFSIDMIILFTAITFGVGGTLTAIDNLGQIGKALGYPSKS  376

Query  610   IGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSV  431
             I TFVSLVSIWNY GRV +GF SE  + ++K PR LM+T  LL+ C G LL+AF  P S+
Sbjct  377   ITTFVSLVSIWNYLGRVAAGFASEIFLAKYKFPRPLMLTLVLLVSCTGHLLIAFGVPNSL  436

Query  430   YGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDG  251
             Y AS+I+GF +G Q  L+F IISELFGLKYYSTL+  G  ASPLG+YILNV+I G LYD 
Sbjct  437   YAASVIMGFCFGAQWPLIFAIISELFGLKYYSTLYTLGGGASPLGAYILNVRITGHLYDR  496

Query  250   EAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDI  86
             EA+KQ+AA+G+      +L+C+G QCYK++F+++    L G  VS +LV RT  +YK DI
Sbjct  497   EAMKQLAAKGLVRKEGEDLSCVGAQCYKLAFLIITATTLVGFFVSSILVIRTRKFYKGDI  556

Query  85    YKRFRDE  65
             YK+FR++
Sbjct  557   YKKFREQ  563



>ref|XP_004150375.1| PREDICTED: uncharacterized protein LOC101208506 [Cucumis sativus]
 ref|XP_004173310.1| PREDICTED: uncharacterized protein LOC101227399 [Cucumis sativus]
Length=607

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/555 (54%), Positives = 388/555 (70%), Gaps = 15/555 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             +F  ++  G WFM+FASFLIM+ AG  Y+FG+YS  IK+ LGYDQSTLNL+  FKD+G N
Sbjct  31    SFFVEVLTGPWFMVFASFLIMSTAGTPYMFGLYSGAIKSVLGYDQSTLNLISFFKDLGTN  90

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+++GLIAE+ P W VL +G+ MNF GYF+IWLSVT+++A P VW MCLYIC+GANS +
Sbjct  91    VGIIAGLIAEIMPPWVVLAIGAGMNFVGYFMIWLSVTEKVAAPPVWLMCLYICIGANSTS  150

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKN+PA RG +LG++KG+VGLSGA+ TQ Y AIYG+DS++LILLI WLPA
Sbjct  151   FANTGALVTCVKNYPARRGAVLGILKGYVGLSGAIMTQFYHAIYGDDSKSLILLIAWLPA  210

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++ +VF+ +IR MK+   PNE  VF+ +L +S+ LA  LM + + Q+   FS   Y + A
Sbjct  211   VILVVFLRTIRIMKVQHRPNELTVFYRFLYVSLALAGFLMVMIVLQQKFNFSRIEYSSSA  270

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAG------  800
              +V  LLF P  I + E+    + K  QLL+   +                  G      
Sbjct  271   AVVVFLLFFPVFIVIAEDYKFWRIKLSQLLNPSPLTIITQKPTPPPPQNLGTFGISPAVK  330

Query  799   ----DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
                   SC+    K P RGEDY+ILQAL S DM LLF+   CG G +L AIDNLGQIG S
Sbjct  331   PTSSTPSCWTTPLKPPPRGEDYTILQALFSADMFLLFLSTACGVGGTLTAIDNLGQIGAS  390

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             L YP ++I TFVSLVSIWNY GRV SGF SE  + ++K PRTL++T  LLL C G +L+A
Sbjct  391   LKYPKQSISTFVSLVSIWNYLGRVVSGFTSEIFLSKYKFPRTLILTLILLLSCVGHILIA  450

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             F  PG +Y AS+++GF YG Q  +LF IISE+FGLKYYSTL+N G +ASP+G Y +NV++
Sbjct  451   FNPPGGLYFASIVIGFCYGAQWPILFAIISEIFGLKYYSTLYNFGSVASPIGLYFVNVRV  510

Query  271   VGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G LYD EA +Q+AA G+      EL C+G  C+K+SFI++ GV L GAL S VLV RT 
Sbjct  511   AGHLYDEEAKRQLAASGMKRMPGKELNCVGVDCFKMSFIIITGVTLLGALFSFVLVLRTR  570

Query  106   AYYKTDIYKRFRDEM  62
             A+YKTDIY++FR+E+
Sbjct  571   AFYKTDIYRKFREEV  585



>ref|XP_009368999.1| PREDICTED: uncharacterized protein LOC103958461 [Pyrus x bretschneideri]
 ref|XP_009369009.1| PREDICTED: uncharacterized protein LOC103958473 [Pyrus x bretschneideri]
Length=598

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/566 (54%), Positives = 394/566 (70%), Gaps = 18/566 (3%)
 Frame = -1

Query  1699  EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSF  1520
             E  N +    Q+  GRWF +FAS LIM+ +GATY+FG+YS +IK+ LGYDQSTLNLL  F
Sbjct  11    EWSNTKTLTLQVLNGRWFTVFASLLIMSASGATYMFGLYSSDIKSVLGYDQSTLNLLSLF  70

Query  1519  KDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICV  1340
             KD G+NVGVLSGLI EVTP W VL VG  +NF GYF+IW++VTK+IAKP+VW MC+YIC+
Sbjct  71    KDFGSNVGVLSGLINEVTPPWVVLSVGGILNFFGYFMIWMAVTKKIAKPQVWHMCMYICM  130

Query  1339  GANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILL  1160
             GA SQ+FANTG+L+T VKNFP SRG +LG +KG+ GLSG++FTQLY A Y +D+++LILL
Sbjct  131   GATSQSFANTGSLITSVKNFPESRGSVLGFLKGYAGLSGSIFTQLYSAFYYDDTKDLILL  190

Query  1159  IGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHF  980
             I WLP  +S V + +IR MK+  HPNE KVF+  L IS+ LA  LM + I QK V F+  
Sbjct  191   IAWLPTAVSFVSLRTIRIMKVIRHPNELKVFYNMLYISLGLAGFLMVMIIIQKNVHFTQG  250

Query  979   AYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAG  800
              Y A A +V  LL LP  + + EE    + KK  L    +++      ++   +      
Sbjct  251   EYGASAAMVIFLLVLPLAVVIFEEFKILEGKKLGLNGGSDLKIVTEKPKSEIVSVTSDLS  310

Query  799   DY-------------SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAI  659
                            SC+  +F+ P RGEDY+ILQAL S+DML+LF+   CG G +  AI
Sbjct  311   RSKEALATTTTETEPSCWKTMFRPPDRGEDYTILQALFSIDMLILFVACICGVGGAFTAI  370

Query  658   DNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLL  479
             DNLGQIG SLGYP  +I TFVSLVSIWNY GRV SGF SE ++KR+K PR LM+T +LLL
Sbjct  371   DNLGQIGASLGYPKHSISTFVSLVSIWNYLGRVVSGFGSEILLKRYKFPRPLMLTLTLLL  430

Query  478   PCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPL  299
              CAG LL+A      +Y AS+I+GF  G    LLF IISELFGLKYYSTLFN G  ASP+
Sbjct  431   SCAGHLLIALNVKNGLYVASVIIGFCLGALWPLLFAIISELFGLKYYSTLFNFGACASPV  490

Query  298   GSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALV  134
             G Y+LNV++ G +YD EA KQ+AA+G+      ELTC+G +C+K+SFIV+A V LFG  V
Sbjct  491   GLYLLNVRLAGHIYDKEANKQLAAKGLVREAGEELTCVGGECFKLSFIVIAAVTLFGTFV  550

Query  133   SLVLVARTAAYYKTDIYKRFRDEMGA  56
             SL+LV RT  +Y++DIYK+FR++  A
Sbjct  551   SLILVMRTRKFYQSDIYKKFREKTEA  576



>ref|XP_002272074.2| PREDICTED: uncharacterized protein LOC100266758 [Vitis vinifera]
Length=599

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/566 (55%), Positives = 404/566 (71%), Gaps = 21/566 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWF++FASFLIM+ AGATY+FG+YS  IK+ LGYDQ+TLNLL  FKD+
Sbjct  15    DMKSLSVQVITGRWFVVFASFLIMSAAGATYMFGLYSGTIKSALGYDQTTLNLLSFFKDL  74

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVLSGLI EVTP W VL +G+A+NF GYF+IWL+V+++IAKP+VW MCLYIC+GAN
Sbjct  75    GANVGVLSGLINEVTPPWVVLSMGAALNFFGYFMIWLAVSQKIAKPQVWHMCLYICIGAN  134

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YGND++ LILLI W
Sbjct  135   SQAFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGNDTKALILLIAW  194

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+    NE KVF+ +L IS+ LA  LM + I +K + FS   Y 
Sbjct  195   LPAAISFAFLRTIRIMKVIRQENELKVFYNFLYISLGLAGFLMIIIIVEKELTFSQSEYG  254

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQL----------------LSSENVEDpppp  839
               A +V  LLFLP  + + EE    K K++ L                 SS ++      
Sbjct  255   GSAALVLLLLFLPLAVVIQEEFKLWKIKQEALREPPQLKIIAENLNTETSSSSLPLESTA  314

Query  838   aeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAI  659
             A +    +     + SCF N+F+ P RGEDY+ILQAL S+DML+LF    CG G +L AI
Sbjct  315   ATSSLPEQLSSQKEVSCFSNVFRPPDRGEDYTILQALFSIDMLILFFTTICGVGGTLTAI  374

Query  658   DNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLL  479
             DNLGQIG SLGYP +++ TF+SLVSIWNY GRV +GF SE ++ ++K PR LM+T  LLL
Sbjct  375   DNLGQIGSSLGYPQKSLSTFISLVSIWNYLGRVTAGFGSEIVLDKYKFPRPLMLTLILLL  434

Query  478   PCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPL  299
              C G LL+AF     +Y AS+I+GF +G Q  LLF +ISE+FGLKYYSTL+N G +ASP+
Sbjct  435   SCVGHLLIAFNIKNGLYFASIIIGFCFGAQWPLLFAVISEIFGLKYYSTLYNFGSVASPI  494

Query  298   GSYILNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALV  134
             GSY+LNV++ G LYD E  +Q+AA    R  GE L C G +C+K+SFI++    LFG+LV
Sbjct  495   GSYLLNVRVAGYLYDKEGKRQMAALGKKRKRGEDLDCTGVECFKLSFIIITAATLFGSLV  554

Query  133   SLVLVARTAAYYKTDIYKRFRDEMGA  56
             SL+LV RT  +YK DIYK+FR++  A
Sbjct  555   SLILVLRTRKFYKGDIYKKFREQAKA  580



>gb|KHN05589.1| Putative transporter MCH1 [Glycine soja]
Length=598

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/554 (55%), Positives = 395/554 (71%), Gaps = 12/554 (2%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             +++++   Q+  GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD
Sbjct  14    RDIKSLTVQVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQTTLNLLSFFKD  73

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G NVGV+SGLI EV P W VL +G+ +NF GYF+IWLSVT++IAKPKVWQMCLYIC+GA
Sbjct  74    LGTNVGVISGLINEVAPPWVVLAIGAILNFFGYFMIWLSVTQKIAKPKVWQMCLYICIGA  133

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FANTG+LVTC+KNFP   G++LG++KG++GLSGA+ TQLY AIY +D++ LILLI 
Sbjct  134   NSQTFANTGSLVTCIKNFPERNGVVLGILKGYLGLSGAIITQLYSAIYYDDTRALILLIA  193

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S   + +IR MK    PNE  VF+++L IS+ LA  L+ +   QK V F+   +
Sbjct  194   WLPAAISFASLRTIRYMKPVRQPNELNVFYKFLYISLGLAGFLLVMITVQKRVNFTQSEF  253

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV-------EDppppaeniekae  815
                + +V  LL LP  +  MEE    + K+  L+    V       E   P       + 
Sbjct  254   GVSSAMVLFLLLLPLAVVSMEEYKVWQSKRLALVDPSPVKIVTDQGEKVKPNETTNVSSN  313

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
                + D   + N+F  P RGEDY+ILQAL S+DM +LFIC+  G G +L AIDNLGQIG+
Sbjct  314   SVSSNDTRWWENVFSPPARGEDYTILQALFSIDMWILFICSIFGIGGTLTAIDNLGQIGK  373

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             SL YP ++I TFVSLVSIWNY GRVF+GFVSE  ++++K PR LM+T ++LL CAG LL+
Sbjct  374   SLRYPKKSISTFVSLVSIWNYLGRVFAGFVSEHYLQKYKFPRPLMLTLTMLLSCAGHLLI  433

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AF  P  +Y AS+I+GF +G Q  LLF IISELFG KYY+TL+N G  ASPLG Y+LNV 
Sbjct  434   AFDVPNGLYAASVIIGFCFGAQWPLLFAIISELFGHKYYATLYNFGSAASPLGLYVLNVV  493

Query  274   IVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             + G LYD EA KQ+AA G+      EL C+G  C+K+SFI++     FG +VSL+LVART
Sbjct  494   MTGHLYDKEAKKQLAALGLERKEGQELNCIGIHCFKLSFIIITAATFFGVIVSLILVART  553

Query  109   AAYYKTDIYKRFRD  68
               +YK+DIYKR+RD
Sbjct  554   RTFYKSDIYKRYRD  567



>gb|KHN05591.1| hypothetical protein glysoja_035791 [Glycine soja]
Length=583

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/552 (56%), Positives = 400/552 (72%), Gaps = 10/552 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +    + Q+  GRWF++FASFLIMA AGATY+F +YS +IK+ L YDQ+TLNLL  FKD+
Sbjct  3     DTNGLMVQVITGRWFVVFASFLIMAAAGATYMFSLYSGDIKSALAYDQTTLNLLSFFKDL  62

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G NVGVLSGLI E+TP W VL +GS +NF GYF+IWL+VTK+I KP VW MCLYIC+GAN
Sbjct  63    GGNVGVLSGLINEITPPWVVLAIGSILNFFGYFMIWLAVTKKIPKPHVWHMCLYICLGAN  122

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A Y +DS++LILLIGW
Sbjct  123   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYFAFYYDDSRSLILLIGW  182

Query  1150  LPAILSIVFIPSIRPMK-ISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             LPA +S +F+ +IR MK +   PNE  VF+++L IS+ LA  L+ + I QK V FS   Y
Sbjct  183   LPAAISFLFLRTIRYMKPLRQQPNELSVFYKFLYISLGLAGFLLVMIIVQKQVHFSQSEY  242

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE----Dppppaeniekaeeek  806
                A +V  LLFLP  +  +E+   R+ +K   ++   V+    +         K +EE 
Sbjct  243   GVSAGVVLFLLFLPLAVVFVEQYKIRESQKLAFINPSAVKIVATEGESNTPISRKIDEEI  302

Query  805   AGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
                   +  +F  P RGEDY+ILQAL S+DM+LLF    CG G +L AIDNLGQIG SLG
Sbjct  303   ITSTRWWQKVFSPPPRGEDYTILQALFSLDMILLFFAGTCGVGGTLTAIDNLGQIGTSLG  362

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP  +I TFVSLVSIWNY GRVFSGFVSE  +K++K PR LM+T +LLL C G LL+AF 
Sbjct  363   YPKASISTFVSLVSIWNYMGRVFSGFVSEHFLKKYKFPRPLMLTLTLLLSCVGHLLIAFD  422

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
                 +Y AS+I+GF +G Q  L+F IISELFGLKYYSTL+N G  ASP+G Y+LNV++ G
Sbjct  423   VANGLYVASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGAASPIGLYVLNVRVTG  482

Query  265   RLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              LYD EA+KQ+AA G+      ELTC+G+ C+K+SFI++     FGAL+SL+LVART  +
Sbjct  483   YLYDKEALKQLAATGISRKIDTELTCVGSSCFKLSFIIITAATFFGALISLILVARTIKF  542

Query  100   YKTDIYKRFRDE  65
             YK DIYKR+R++
Sbjct  543   YKGDIYKRYREQ  554



>ref|XP_011031645.1| PREDICTED: uncharacterized protein LOC105130706 [Populus euphratica]
Length=609

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/568 (54%), Positives = 392/568 (69%), Gaps = 28/568 (5%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+    Q+  GRWFM+FAS LIM+ +GATY+F +YS +IK+ LGYDQ+TLNLL  FKDV
Sbjct  17    DMKILTTQIVTGRWFMVFASLLIMSASGATYMFALYSPDIKSALGYDQTTLNLLSFFKDV  76

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGVLSGLI EVTP W VL +G+ +NF GYF+IWLSVTK+I   +VW MCLYIC+GAN
Sbjct  77    GSNVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLSVTKKITGVQVWHMCLYICIGAN  136

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQ YLA YG+D + LILLIGW
Sbjct  137   SQSFANTGSLVTCVKNFPESRGSVLGILKGYVGLSGAIITQFYLAFYGDDPKALILLIGW  196

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+   PNE KVF+ +L IS++LA  LM + I +K + F+   Y 
Sbjct  197   LPAAISFAFLRTIRIMKVIRQPNELKVFYNFLYISLSLAGFLMIMIILEKTLGFTRGEYG  256

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE---------------------  854
               A +V  +LF+P  + ++EE      KK+ L     V+                     
Sbjct  257   VGAAVVILMLFVPLAVVIVEEYKIWISKKRALNDPSPVKIVTEKPPPSHEIPAPSPPPPS  316

Query  853   --DppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQ  680
                                   SC+   F+ P RGED++ILQAL SVDML+LF+   CG 
Sbjct  317   TSSDKKLVTVESSPSTTDNNSVSCWKTAFRPPARGEDFTILQALFSVDMLILFLATICGI  376

Query  679   GCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLM  500
             G +L AIDNLGQIG SLGYP ++I TFVSLVSIWNY GRV SGF SE ++K++K  R L+
Sbjct  377   GGTLTAIDNLGQIGTSLGYPKKSISTFVSLVSIWNYLGRVVSGFGSEHVLKKYKFSRPLL  436

Query  499   MTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNC  320
              T +LLL C G LL+AF   G +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N 
Sbjct  437   FTLTLLLSCVGHLLIAFNVSGGLYVASIIIGFCFGAQWPLLFAIISELFGLKYYSTLYNF  496

Query  319   GQLASPLGSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGV  155
             G +ASP+G Y+LNV++ G LYD EA KQ+AA+G+       L C+GT C+++SFI++   
Sbjct  497   GAVASPVGLYLLNVRLTGHLYDKEAGKQLAAKGLIRKHGDALDCVGTVCFRLSFIIITAA  556

Query  154   NLFGALVSLVLVARTAAYYKTDIYKRFR  71
              LFGA VSL+LV RT  +YK+DIYK+FR
Sbjct  557   TLFGAFVSLILVYRTRKFYKSDIYKKFR  584



>ref|XP_006411146.1| hypothetical protein EUTSA_v10016410mg [Eutrema salsugineum]
 gb|ESQ52599.1| hypothetical protein EUTSA_v10016410mg [Eutrema salsugineum]
Length=598

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/559 (56%), Positives = 405/559 (72%), Gaps = 17/559 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWFM F S LIM+ AGATY+F +YS +IK TLGYDQ+TLNLLG FKD+
Sbjct  9     SMKSLTIQILTGRWFMFFGSLLIMSAAGATYMFSLYSGDIKRTLGYDQTTLNLLGFFKDL  68

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GLI EVTP WFVL++G+ +NF GYF+IWL+VT+RI+KPKVW MCLYICVGAN
Sbjct  69    GANVGVLAGLINEVTPPWFVLIIGAILNFFGYFMIWLAVTERISKPKVWHMCLYICVGAN  128

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG+D+++LIL+IGW
Sbjct  129   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGDDTKSLILMIGW  188

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+    NE KVF+ +L IS+ LA  LM   I  K   F+   + 
Sbjct  189   LPAAISFAFLRTIRMMKVVRQTNELKVFYNFLYISLGLATFLMVAIITDKLSGFTQSEFG  248

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLS-----------SENVEDppppaenie  824
               A +V  LL LP ++ V+EE     +K+    +           S ++ +     +   
Sbjct  249   GSAAVVIILLILPIIVVVLEERKLWNDKQVAFNNPAPINIVTEKPSSDLSEVKAHHDEES  308

Query  823   kaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
             K EEEK    SC+  +F  P+RG+DY+ILQAL SVDML+LF+   CG G +L AIDNLGQ
Sbjct  309   KEEEEKVKTASCWKTMFSPPERGDDYTILQALFSVDMLILFLATICGVGGTLTAIDNLGQ  368

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IG S GYP R++ TFVSLVSIWNYFGRV SG +SE  + ++K PR LM+T  LLL CAG 
Sbjct  369   IGSSFGYPKRSVSTFVSLVSIWNYFGRVVSGVISEIFLIKYKFPRPLMLTLILLLSCAGH  428

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             LL+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYY+TL+N G +ASP+GSY+L
Sbjct  429   LLIAFNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYATLYNFGSVASPIGSYLL  488

Query  283   NVKIVGRLYDGEAVKQVAARGVG------ELTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             NV++ G LYD EA KQ  A G+       +L+C GT C+K+SFI++  V L G LVS +L
Sbjct  489   NVRVAGYLYDVEAEKQNNALGIDRKEGRQDLSCKGTVCFKLSFIIITAVTLLGVLVSTIL  548

Query  121   VARTAAYYKTDIYKRFRDE  65
             V RT  +YK+DIYK++R++
Sbjct  549   VIRTKKFYKSDIYKKYREK  567



>gb|KDP30492.1| hypothetical protein JCGZ_16171 [Jatropha curcas]
Length=605

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/558 (54%), Positives = 395/558 (71%), Gaps = 16/558 (3%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+N   Q+  GRWFM+FASF+IMA +GATY+FG+YS +IK  LGYDQ+ L LL  FKD+
Sbjct  17    DMKNLTVQVINGRWFMVFASFVIMAASGATYMFGLYSNDIKTALGYDQTKLTLLSFFKDL  76

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+++GV SGLI E+TP W VL +G+ +NF GYF+IWL+V+ +I+    W MCLYI +GAN
Sbjct  77    GSSLGVFSGLINELTPPWVVLSMGAVLNFFGYFMIWLAVSGKISGVHFWHMCLYIYIGAN  136

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ FANTG+LVTCVK FP SRG ++ ++KG+VGLSGA+ TQ+Y AIYG+DS++LILLIGW
Sbjct  137   SQAFANTGSLVTCVKTFPESRGAVIVILKGYVGLSGAIITQIYHAIYGDDSKSLILLIGW  196

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             +PA +S  F+ ++R MK+   PNE KVF+ +L IS+ LA  LM + I QK ++F+   Y 
Sbjct  197   VPAAISFAFLRTVRIMKVIRQPNEFKVFYNFLYISLGLAAFLMIIIILQKRMQFTRSEYG  256

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSEN--------VEDppppaeniekae  815
             A A +V  LLFLP  I ++EE    + KK   L S N         E+    A     +E
Sbjct  257   ASAAMVLLLLFLPLAIVLIEEYKIWQSKK---LVSNNSSPLKIITTEENTATASTAVLSE  313

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
                    SC+   FK P RGEDY+ILQAL S+DML+LF+    G G +L AIDNLGQIG 
Sbjct  314   NVIEEKVSCWKTAFKPPSRGEDYTILQALFSIDMLVLFLATIFGVGGTLTAIDNLGQIGT  373

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             SLGYP R+I TFVSLVSIWNY GRV +GF SE  + ++K PR LM T  LL  C G LL+
Sbjct  374   SLGYPKRSISTFVSLVSIWNYLGRVVAGFASEHFLTKYKFPRPLMFTLILLCSCVGHLLI  433

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             A+  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N   +ASP+GS++LNV+
Sbjct  434   AYNVPGGLYVASIIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFAGMASPIGSFVLNVR  493

Query  274   IVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             + G LYD EA KQ+AA+G+      EL+C+GT+C+K+SFI++  V +F   VSL+LV RT
Sbjct  494   VAGHLYDIEAKKQLAAKGLTRQHGQELSCIGTECFKLSFIIITAVTIFSTFVSLILVLRT  553

Query  109   AAYYKTDIYKRFRDEMGA  56
               +YK+DIYK+FR+   A
Sbjct  554   RKFYKSDIYKKFREAAQA  571



>ref|XP_003555225.2| PREDICTED: uncharacterized protein LOC100819121 [Glycine max]
Length=607

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/552 (55%), Positives = 395/552 (72%), Gaps = 10/552 (2%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             ++M++   Q+  GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD
Sbjct  31    RDMKSLAVQVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQTTLNLLSFFKD  90

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G NVGV+SGLI E+ P W VL +G+ +NF GYF+IWLSVT+RIAKPKVWQMCLYIC+GA
Sbjct  91    LGTNVGVISGLINELAPPWVVLAIGAVLNFFGYFMIWLSVTQRIAKPKVWQMCLYICIGA  150

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FANTG+LVTC+KNFP   G++LG++KG++GLSGA+ TQLY AIY +D++ LILLI 
Sbjct  151   NSQTFANTGSLVTCIKNFPERNGVVLGILKGYLGLSGAIITQLYSAIYYDDTRALILLIA  210

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S   + ++R MK     NE  VF+ +L IS+ LA  L+ +   QK V F+   +
Sbjct  211   WLPAAISFASLRTVRYMKPVRQHNELNVFYRFLYISLGLAGFLLFMITIQKRVNFTQSEF  270

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAG--  800
                A IV  LL LP  +  +EE    + K+  L+    V+      E + K  E   G  
Sbjct  271   GVSAAIVLFLLLLPLSVVSIEEYKVWQSKRLALVDPTPVKIVTDEGEKVMKPIEATNGCK  330

Query  799   ---DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
                    + N+F  P+RGEDY+ILQAL S+DML+LFIC+ CG G +L AIDNLGQIG+SL
Sbjct  331   NSVSSKWWENVFSPPERGEDYTILQALFSLDMLILFICSICGIGGTLTAIDNLGQIGKSL  390

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
              YP ++I TFVSLVSIWNY GRVF+GFVSE  ++++K PR LM+T ++LL C G LL+AF
Sbjct  391   RYPKKSISTFVSLVSIWNYLGRVFAGFVSEHYLQKYKFPRPLMLTLTMLLSCVGHLLIAF  450

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
               P  +Y AS+I+GF +G Q  LLF IISELFG KYY+TL+N G  ASPLG Y+LNV + 
Sbjct  451   DVPNGLYAASVIIGFCFGAQWPLLFAIISELFGHKYYATLYNFGSAASPLGLYVLNVVMT  510

Query  268   GRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAA  104
             G LYD EA KQ+AA G+      EL C+G  C+K+SFI++     FG +VSL+LVART  
Sbjct  511   GHLYDKEAKKQLAALGLERKEGQELNCIGIHCFKLSFIIITAATFFGVIVSLILVARTRT  570

Query  103   YYKTDIYKRFRD  68
             +YK DIYKR+RD
Sbjct  571   FYKGDIYKRYRD  582



>ref|XP_006361693.1| PREDICTED: uncharacterized protein LOC102605820 [Solanum tuberosum]
Length=595

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/575 (52%), Positives = 403/575 (70%), Gaps = 37/575 (6%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             N   ++   RWFM+F + LI++ AGATY+FG+YS +IK++LGYDQ+TLNLL  FKD+G+N
Sbjct  4     NLPIRVLVSRWFMVFGTMLILSAAGATYMFGLYSSDIKSSLGYDQTTLNLLSFFKDLGSN  63

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+LSGLI E++P W VL +G+ +NF GYF+IW++VTK+++  KVW MCLYIC+G NSQ+
Sbjct  64    VGILSGLINEISPPWVVLSIGAILNFFGYFMIWMAVTKKMST-KVWLMCLYICIGGNSQS  122

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQ++ A+YGNDS++LILLIGWLPA
Sbjct  123   FANTGALVTCVKNFPESRGAVLGLLKGFVGLSGAILTQIFHALYGNDSKSLILLIGWLPA  182

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++S VF+ +IR +++    +E KVF+++L +S+ LA  LM + I QK   F+   Y   A
Sbjct  183   VISFVFLRTIRIIQVVRIAHELKVFYKFLYMSLVLAGYLMVIIILQKKFDFTRVEYGLSA  242

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLS-------SENVEDppppaeniekaeeekA  803
              +V  LLFLP  + + EE+ +   KK  L S       +EN +   P       +     
Sbjct  243   ALVIFLLFLPLGLVIKEEINSWNAKKLALDSISKVKVVTENPKSEAPQLPPPPPSSAVVT  302

Query  802   GDY------------------------SCFGNIFKKPKRGEDYSILQALLSVDMLLLFIC  695
              D                         SC+  +F+ P RGED++ILQAL S+DML+LF+ 
Sbjct  303   TDQGLDGIVQEKSKSSVVDLKDQEVSVSCWKTVFQPPARGEDFTILQALFSLDMLILFVA  362

Query  694   NFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKI  515
               CG G +L AIDNLGQIG SLGYP ++I TFVSLVSIWNY GRV +GF+SE  +K++K 
Sbjct  363   TICGVGGTLTAIDNLGQIGTSLGYPKKSISTFVSLVSIWNYLGRVVAGFLSEYFLKKYKF  422

Query  514   PRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYS  335
             PR L +T +L++ C G +L+AF  P  +Y AS+I+GF +G Q  LLF IISELFGLKYYS
Sbjct  423   PRPLALTITLVVSCIGHILIAFNVPSGLYIASIIIGFCFGAQWPLLFAIISELFGLKYYS  482

Query  334   TLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVA----ARGVGE-LTCLGTQCYKVSFI  170
             TL+N G +ASP+GSY+LNV++ G LYD EA KQ+      RG GE L C G +C+K++FI
Sbjct  483   TLYNFGSVASPIGSYVLNVRVAGYLYDREAEKQLKVLGRTRGDGEDLNCDGVECFKLAFI  542

Query  169   VLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDE  65
             ++  V +FGA VS++LV RT  +YK+DIYK+FR+E
Sbjct  543   IITLVTIFGAFVSIILVIRTRKFYKSDIYKKFREE  577



>ref|XP_009417128.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Musa 
acuminata subsp. malaccensis]
Length=645

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/565 (54%), Positives = 394/565 (70%), Gaps = 24/565 (4%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F  Q+ RGRWFM F+SFLIMA AGATY+F +YSK+IK++LGYDQSTLN L  FKD+GAN
Sbjct  24    RFAMQVVRGRWFMFFSSFLIMAAAGATYIFSIYSKDIKSSLGYDQSTLNTLSFFKDLGAN  83

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+LSGLI EVTP W VL +G+AMN  GY +I+L++T R A P V  MC+YIC+GANSQ 
Sbjct  84    VGILSGLINEVTPPWVVLSMGAAMNLFGYLMIYLAITGRTAPPHVSLMCVYICIGANSQT  143

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG++LGL+KGFVGLSGA+ TQLYLAIY +DS++L+LLI WLPA
Sbjct  144   FANTGALVTCVKNFPESRGIVLGLLKGFVGLSGAIITQLYLAIYEDDSKSLVLLIAWLPA  203

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
              +SIVF+ +IR MK+  H   TK F+ +L ISI LA+ L+ + + +K    +H      A
Sbjct  204   AVSIVFVYTIRIMKVVPHGKTTKPFYWFLYISIALAVYLLVMIVVEKTATITHTESSISA  263

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQL---------------------LSSENVEDpp  845
             T+V  LL LP  + + EEL   K+KK +L                       S++     
Sbjct  264   TVVVLLLLLPLAVVINEELKIFKQKKHELQNPQPLVIAVEKTSQPPPPPITESKHAPPTT  323

Query  844   ppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLA  665
                       +      +   ++F+ P RGEDYSILQAL+S+DM++LF    CG G +L 
Sbjct  324   ATTTTTTTTTKSNNAVVAFVADMFRPPDRGEDYSILQALVSIDMIILFFATICGVGGTLT  383

Query  664   AIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSL  485
             AIDN+GQIGESLGYP R+I TFVSL+SIWNY GRV +GF SE  + ++K PR LM+T  L
Sbjct  384   AIDNMGQIGESLGYPKRSISTFVSLISIWNYAGRVTAGFASEIFLTKYKFPRPLMLTAIL  443

Query  484   LLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLAS  305
             LL C G LL+AF    S+Y AS+++GF +G Q  LLF IISE+FGLKYYSTL+N G  AS
Sbjct  444   LLSCVGHLLIAFGLTNSLYFASVVIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGAAS  503

Query  304   PLGSYILNVKIVGRLYDGEAVKQVAA--RGVG-ELTCLGTQCYKVSFIVLAGVNLFGALV  134
             P+GSYILNV++ G LYD EA+KQ     R  G +LTC+G +C+K+SFI++  V + GALV
Sbjct  504   PIGSYILNVRVAGYLYDKEALKQNNGVRRPPGTDLTCIGVECFKLSFIIITAVTVLGALV  563

Query  133   SLVLVARTAAYYKTDIYKRFRDEMG  59
             SL+LV RT  +YK DIY +FR++M 
Sbjct  564   SLLLVYRTKDFYKGDIYAKFREQMA  588



>ref|XP_003535733.2| PREDICTED: uncharacterized protein LOC100787176 [Glycine max]
Length=622

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/545 (57%), Positives = 398/545 (73%), Gaps = 10/545 (2%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             Q+  GRWF++FASFLIMA AGATY+F +YS +IK+ L YDQ+TLNLL  FKD+G NVGVL
Sbjct  49    QVITGRWFVVFASFLIMAAAGATYMFSLYSGDIKSALAYDQTTLNLLSFFKDLGGNVGVL  108

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SGLI E+TP W VL +GS +NF GYF+IWL+VTK+I KP VW MCLYIC+GANSQ+FANT
Sbjct  109   SGLINEITPPWVVLAIGSILNFFGYFMIWLAVTKKIPKPHVWHMCLYICLGANSQSFANT  168

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             G+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A Y +DS++LILLIGWLPA +S 
Sbjct  169   GSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYFAFYYDDSRSLILLIGWLPAAISF  228

Query  1129  VFIPSIRPMK-ISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIV  953
             +F+ +IR MK +   PNE  VF+++L IS+ LA  L+ + I QK V FS   Y   A +V
Sbjct  229   LFLRTIRYMKPLRQQPNELSVFYKFLYISLGLAGFLLVMIIVQKQVHFSQSEYGVSAGVV  288

Query  952   CALLFLPFLIAVMEELATRKEKKKQLLSSENVE----DppppaeniekaeeekAGDYSCF  785
               LLFLP  +  +E+   R+ +K   ++   V+    +         K +EE       +
Sbjct  289   LFLLFLPLAVVFVEQYKIRESQKLAFINPSAVKIVATEGESNTPISRKIDEEIITSTRWW  348

Query  784   GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIG  605
               +F  P RGEDY+ILQAL S+DM+LLF    CG G +L AIDNLGQIG SLGYP  +I 
Sbjct  349   QKVFSPPPRGEDYTILQALFSLDMILLFFAGTCGVGGTLTAIDNLGQIGTSLGYPKASIS  408

Query  604   TFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYG  425
             TFVSLVSIWNY GRVFSGFVSE  +K++K PR LM+T +LLL C G LL+AF     +Y 
Sbjct  409   TFVSLVSIWNYMGRVFSGFVSEHFLKKYKFPRPLMLTLTLLLSCVGHLLIAFDVANGLYV  468

Query  424   ASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEA  245
             AS+I+GF +G Q  L+F IISELFGLKYYSTL+N G  ASP+G Y+LNV++ G LYD EA
Sbjct  469   ASVIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGAASPIGLYVLNVRVTGYLYDKEA  528

Query  244   VKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYK  80
             +KQ+AA G+      ELTC+G+ C+K+SFI++     FGAL+SL+LVART  +YK DIYK
Sbjct  529   LKQLAATGISRKIDTELTCVGSSCFKLSFIIITAATFFGALISLILVARTIKFYKGDIYK  588

Query  79    RFRDE  65
             R+R++
Sbjct  589   RYREQ  593



>gb|EPS72672.1| hypothetical protein M569_02085, partial [Genlisea aurea]
Length=548

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/549 (56%), Positives = 402/549 (73%), Gaps = 12/549 (2%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             FV Q   G+WFM+FA+ LIMA AGATYLFG+YS  IK++LGYDQ+TLNLL  FKD+G NV
Sbjct  1     FVVQFISGQWFMIFATTLIMAAAGATYLFGLYSPVIKSSLGYDQTTLNLLSFFKDLGTNV  60

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GV+SGLI EVTP WFVL++G+ MNF GYF+IWL+V++RI+ P+VWQMCLYIC+GANSQ+F
Sbjct  61    GVISGLINEVTPPWFVLVIGAGMNFVGYFMIWLAVSRRISTPRVWQMCLYICIGANSQSF  120

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVT VKNFP SRG +LGL+KG++GLSGA+ TQ+Y A+YGND + LILLIGWLPA 
Sbjct  121   ANTGALVTAVKNFPESRGALLGLLKGYLGLSGAILTQIYNALYGNDLKALILLIGWLPAA  180

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S++F+ ++R MK+     E  VF+  L IS+ LA  LM L I QK   F+   +IACA 
Sbjct  181   ISLIFLRTVRIMKVVRVSRELNVFYRILYISLGLAGFLMLLIILQKQFNFNRAEFIACAV  240

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQL----LSSENVEDppppaeniekaeeekAGDYS  791
              V  LLF P  +A+ EE+  R+ + +      +S+  V+     +        EK G  S
Sbjct  241   TVVLLLFSPLAVALKEEMDLRRNQNQDQPVNSISTNGVKIAAENSPATAPEAGEKQG-MS  299

Query  790   CFG--NIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPP  617
             C+   + F+ P RGEDY+ILQAL S+D+L+L     CG G +L A+DNLGQIG SLGYP 
Sbjct  300   CWNPRSFFRPPDRGEDYTILQALFSIDLLILIFATICGIGGTLTAVDNLGQIGTSLGYPK  359

Query  616   RTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPG  437
             ++I TFVSLVSIWNY GRV SGF+SE  +K++K PR LM+T +LL+ C G LL+AF  P 
Sbjct  360   KSISTFVSLVSIWNYLGRVVSGFLSEHFLKKYKFPRPLMLTLTLLISCVGHLLIAFNPPN  419

Query  436   SVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLY  257
              +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N G +ASP+G YILNV++ G LY
Sbjct  420   GLYVASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSVASPIGLYILNVRVAGHLY  479

Query  256   DGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
             D EA +Q+ A G       EL C+GT+C+K++FI++A V  FG L+S++LV RT  +Y++
Sbjct  480   DREANRQLIAAGQQRKHGQELNCVGTECFKLAFIIIAMVTAFGTLISILLVFRTRKFYRS  539

Query  91    DIYKRFRDE  65
             DIY++FR +
Sbjct  540   DIYRKFRQD  548



>ref|XP_004304474.1| PREDICTED: uncharacterized protein LOC101301314 [Fragaria vesca 
subsp. vesca]
Length=600

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/550 (56%), Positives = 399/550 (73%), Gaps = 9/550 (2%)
 Frame = -1

Query  1696  EQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFK  1517
              + M +F  Q+  GRWFM+FAS LI++ AGATY+FG+YS  IK +LGYDQ+TLNLL  FK
Sbjct  13    SKEMRSFGLQVLHGRWFMLFASMLILSVAGATYIFGLYSNVIKTSLGYDQTTLNLLSFFK  72

Query  1516  DVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVG  1337
             D+G NVG+++GL+ EVT  W VLL+GS MNF GYF+IWL+VT R +KP+VWQMCLYICVG
Sbjct  73    DLGGNVGIIAGLVNEVTGPWVVLLIGSVMNFFGYFMIWLAVTGRTSKPRVWQMCLYICVG  132

Query  1336  ANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLI  1157
             ANSQ F+NTGA+V+CVKNFP+SRG +LGL+KG VGLSGA+ TQLY A YG DS+ LILLI
Sbjct  133   ANSQTFSNTGAVVSCVKNFPSSRGSVLGLLKGLVGLSGAIITQLYNAFYGKDSKALILLI  192

Query  1156  GWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFA  977
              WLPA +SIVF+P +R +K    PNE ++F+  L +++ LA  LM L I Q  ++FS   
Sbjct  193   AWLPAAVSIVFLPIVRLIKTVRQPNELRIFYNLLYVTLGLAGFLMALIIMQHNLKFSRMC  252

Query  976   YIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV----EDppppaeniekaeee  809
             YI  A++V  LLFLP ++ ++EE    K K K +     +    E+P P         + 
Sbjct  253   YIGSASVVLMLLFLPIVVVIIEEFKLWKTKIKAVNEPIQLKVVAENPAPAELVPVATPQT  312

Query  808   kAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
             +    SCF  +FK P RGEDY+ILQAL S+DML+LFI   CG G +L AIDNLGQIG SL
Sbjct  313   QQKHNSCFQTVFKPPVRGEDYTILQALFSIDMLILFIATICGVGGTLTAIDNLGQIGNSL  372

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
             GYP  +I TF+SLVSIWNY GRV SGF SE ++K++K PR LM+T  LLL C G LL+AF
Sbjct  373   GYPTDSISTFISLVSIWNYLGRVTSGFSSEVLLKKYKFPRPLMLTLVLLLACVGHLLIAF  432

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
               P S+Y +S+I+GF +G Q  L+F IISELFGLKYY+TL N G  ASPLG+YILNVK+ 
Sbjct  433   GVPNSLYFSSVIIGFCFGAQWPLIFAIISELFGLKYYATLINFGGAASPLGAYILNVKVA  492

Query  268   GRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAA  104
             G LYD  A+KQ+ A G       +LTC G +CY+++FI++A V LFG+LVS +LV RT  
Sbjct  493   GNLYDAAALKQLKALGKTREAGMDLTCQGVECYRLAFIIIAAVALFGSLVSFILVIRTRK  552

Query  103   YYKTDIYKRF  74
             +Y++DIYK++
Sbjct  553   FYQSDIYKKY  562



>ref|XP_009606524.1| PREDICTED: uncharacterized protein LOC104100872 [Nicotiana tomentosiformis]
Length=568

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/552 (55%), Positives = 392/552 (71%), Gaps = 13/552 (2%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             MENF   +  GRWFM+FAS LI++ AG TY+FG+YS+E+K +LGYDQ+TLNLLG FKD+G
Sbjct  1     MENFGMHMLVGRWFMVFASLLILSVAGGTYIFGLYSEEVKTSLGYDQTTLNLLGFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVG++SGLI EVTP W VLL+G+ MNF+GYF IWL+ T ++ KPKVWQMC  I +GANS
Sbjct  61    ANVGIISGLINEVTPPWVVLLLGAIMNFSGYFSIWLATTGKLTKPKVWQMCFCIFIGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q FANTG LVTCVKNFP SRG+++GL+KGFVGLSGA+ TQLY A YGN+ ++LILLI WL
Sbjct  121   QTFANTGVLVTCVKNFPESRGIVIGLLKGFVGLSGAILTQLYHAFYGNNGKSLILLIAWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             PA++S VF+  IR MK++   NE K+F++ L +S+ LA  LM + I Q  V F+   Y +
Sbjct  181   PAVVSCVFLRVIRVMKVTRQENELKIFYQLLFMSLGLAGFLMVIIIVQNRVEFNSVGYWS  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE------Dppppaeniekaeeek  806
              A I+  LLF P ++ + EEL     KK+   SS  +E      + P  +         +
Sbjct  241   TAGIILVLLFAPIILVIKEELKLWDTKKQS--SSHPIEVKVVGIETPLQSSATVVPTNNQ  298

Query  805   AGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
                 S F N+FK P+RGEDY+ILQA+LS+DML+LFI    G G  L A+DNLGQIG++LG
Sbjct  299   TDQVSFFSNVFKPPERGEDYTILQAVLSIDMLILFIATIFGAGGLLTAMDNLGQIGKALG  358

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP  +I TFVSLVSIW Y GRV SGF SE  ++++K PR LM+T  LLL C G +L+AF 
Sbjct  359   YPKTSITTFVSLVSIWGYLGRVASGFASEIFLEKYKFPRPLMLTLVLLLSCVGHVLIAFG  418

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
                ++Y AS++ GF +G    L+F IISELFGLK+YSTL N G  ASP+G+YI NVK+ G
Sbjct  419   VTNTLYVASVLTGFCFGALWPLIFAIISELFGLKHYSTLLNFGGAASPIGAYIFNVKVAG  478

Query  265   RLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              LYD EA+KQ+AA G+      +LTC G  CYK++F ++A     G +VSLVLV RT  +
Sbjct  479   NLYDKEAIKQMAAHGIIRKPGEDLTCTGVDCYKLAFFIIAASTFVGFIVSLVLVLRTFNF  538

Query  100   YKTDIYKRFRDE  65
             YK DIYK+FR++
Sbjct  539   YKGDIYKKFREQ  550



>gb|KHN11443.1| Putative transporter MCH1 [Glycine soja]
Length=586

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/552 (55%), Positives = 394/552 (71%), Gaps = 10/552 (2%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             ++M++   Q+  GRWF++FASFLIM  AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD
Sbjct  10    RDMKSLAVQVITGRWFVVFASFLIMPAAGATYMFGLYSSDIKTTLGYDQTTLNLLSFFKD  69

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G NVGV+SGLI E+ P W VL +G+ +NF GYF+IWLSVT+RIAKPKVWQMCLYIC+GA
Sbjct  70    LGTNVGVISGLINELAPPWVVLAIGAVLNFFGYFMIWLSVTQRIAKPKVWQMCLYICIGA  129

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FANTG+LVTC+KNFP   G++LG++KG++GLSGA+ TQLY AIY +D++ LILLI 
Sbjct  130   NSQTFANTGSLVTCIKNFPERNGVVLGILKGYLGLSGAIITQLYSAIYYDDTRALILLIA  189

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S   + ++R MK     NE  VF+ +L IS+ LA  L+ +   QK V F+   +
Sbjct  190   WLPAAISFASLRTVRYMKPVRQHNELNVFYRFLYISLGLAGFLLFMITIQKRVNFTQSEF  249

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAG--  800
                A IV  LL LP  +  +EE    + K+  L+    V+      E + K  E   G  
Sbjct  250   GVSAAIVLFLLLLPLSVVSIEEYKVWQSKRLALVDPTPVKIVTDEGEKVMKPIEATNGCK  309

Query  799   ---DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
                    + N+F  P+RGEDY+ILQAL S+DML+LFIC+ CG G +L AIDNLGQIG+SL
Sbjct  310   NSVSSKWWENVFSPPERGEDYTILQALFSLDMLILFICSICGIGGTLTAIDNLGQIGKSL  369

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
              YP ++I TFVSLVSIWNY GRVF+GFVSE  ++++K PR LM+T ++LL C G LL+AF
Sbjct  370   RYPKKSISTFVSLVSIWNYLGRVFAGFVSEHYLQKYKFPRPLMLTLTMLLSCVGHLLIAF  429

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
               P  +Y AS+I+GF +G Q  LLF IISELFG KYY+TL+N G  ASPLG Y+LNV + 
Sbjct  430   DVPNGLYAASVIIGFCFGAQWPLLFAIISELFGHKYYATLYNFGSAASPLGLYVLNVVMT  489

Query  268   GRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAA  104
             G LYD EA KQ+AA G+      EL C+G  C+K+SFI++     FG +VSL+LVART  
Sbjct  490   GHLYDKEAKKQLAALGLERKEGQELNCIGIHCFKLSFIIITAATFFGVIVSLILVARTRT  549

Query  103   YYKTDIYKRFRD  68
             +YK DIYKR+RD
Sbjct  550   FYKGDIYKRYRD  561



>ref|NP_001236811.1| nitrate and chloride transporter [Glycine max]
 gb|AAW51884.1| nitrate and chloride transporter [Glycine max]
Length=598

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/554 (54%), Positives = 393/554 (71%), Gaps = 12/554 (2%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             +++++   Q+  GRWF++FASFLIMA AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD
Sbjct  14    RDIKSLTVQVITGRWFVVFASFLIMAAAGATYMFGLYSSDIKTTLGYDQTTLNLLSFFKD  73

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G NVGV+SGLI EV P W VL +G+ +NF GYF+IWLSVT++IAKPKVWQMCLYIC+GA
Sbjct  74    LGTNVGVISGLINEVAPPWVVLAIGAILNFFGYFMIWLSVTQKIAKPKVWQMCLYICIGA  133

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FANTG+LVTC+KNFP   G++LG++KG++GLSGA+ TQLY AIY +D++ LILLI 
Sbjct  134   NSQTFANTGSLVTCIKNFPERNGVVLGILKGYLGLSGAIITQLYSAIYYDDTRALILLIA  193

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S   + +IR MK    PNE  VF+++L IS+ LA  L+ +   QK V F+   +
Sbjct  194   WLPAAISFASLRTIRYMKPVRQPNELNVFYKFLYISLGLAGFLLVMITVQKRVNFTQSEF  253

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV-------EDppppaeniekae  815
                + +V  LL LP  +  MEE    + K+  L+    V       E   P       + 
Sbjct  254   GVSSAMVLFLLLLPLAVVSMEEYKVWQSKRLALVDPSPVKIVTDQGEKVKPNETTDGSSN  313

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
                + D   + N+F  P RGEDY+ILQAL S+DM++LFI    G G +L AIDNLGQIG+
Sbjct  314   SLSSNDTRWWENVFSPPARGEDYTILQALFSIDMVILFIATIFGIGGTLTAIDNLGQIGK  373

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             SL YP ++I TFVSLVSIWNY GRVF+GFVSE  ++++K PR LM+T ++LL CAG LL+
Sbjct  374   SLRYPKKSISTFVSLVSIWNYLGRVFAGFVSEHYLQKYKFPRPLMLTLTMLLSCAGHLLI  433

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AF  P  +Y AS+I+GF +G Q  LLF IISELFG KYY+TL+N G  ASP+G Y+LNV 
Sbjct  434   AFDVPNGLYAASVIIGFCFGAQWPLLFAIISELFGHKYYATLYNFGSAASPIGLYVLNVV  493

Query  274   IVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             + G LYD EA KQ+A  G+      EL C+G  C+K+SFI++     FG +VSL+LVART
Sbjct  494   MTGHLYDKEAKKQLAELGLERKEGQELNCIGIHCFKLSFIIITAATFFGVIVSLILVART  553

Query  109   AAYYKTDIYKRFRD  68
               +YK+DIYKR+RD
Sbjct  554   RTFYKSDIYKRYRD  567



>ref|XP_010673913.1| PREDICTED: uncharacterized protein LOC104890215 [Beta vulgaris 
subsp. vulgaris]
Length=598

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/547 (54%), Positives = 386/547 (71%), Gaps = 13/547 (2%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             QL  GRWFM F S LIMA +G+ Y+FG++S  IK+++GYDQ+TLNLL  FKD+G+NVGV 
Sbjct  22    QLILGRWFMAFGSILIMAMSGSGYMFGLFSNNIKSSMGYDQATLNLLSFFKDMGSNVGVF  81

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SGLI E+TP W VL +G+ MNF GY +IWL+VT R+    VWQMCLYIC+GA+SQ+FANT
Sbjct  82    SGLINEITPPWVVLFIGALMNF-GYVMIWLAVTGRLKGVPVWQMCLYICIGADSQSFANT  140

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             G LVTCVKNFP SRG++LGL+KG+VGLSGA+ TQLY   YGN+S+ LIL I WLPA +SI
Sbjct  141   GGLVTCVKNFPESRGIVLGLLKGYVGLSGAILTQLYHTFYGNNSKGLILFIAWLPAAVSI  200

Query  1129  VFIPSIRPMKISSHP--NETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATI  956
             +F+P+IR MK+  +   NE KVF+  L IS++LA  LM L + Q  + F+   Y   A +
Sbjct  201   IFLPTIRVMKVDPNQKRNEVKVFYNLLYISLSLAGFLMVLIVVQNSLIFTRIGYYTSALV  260

Query  955   VCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGD-----YS  791
             +  LLFLP  I   EE         + +    +E             +E + D      S
Sbjct  261   IIFLLFLPLAIVAKEEYCNFYLPTPRKIDDSTLEIVAKARSGENPRIKEDSNDDPKNHVS  320

Query  790   CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRT  611
             C  NIFK P RGED++ILQAL S+DM++LF+   CG G +L AIDNLGQIG+SLGYP  +
Sbjct  321   CLTNIFKPPNRGEDFTILQALFSIDMIILFVTTICGLGGTLTAIDNLGQIGKSLGYPTHS  380

Query  610   IGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSV  431
             I TFVSLVSIWNY GRV +GF SE ++ ++K PR + +T  LL  C G LL+AF  P S+
Sbjct  381   ITTFVSLVSIWNYLGRVCAGFGSEIVLAKYKFPRPMFLTIVLLFSCIGYLLIAFAVPNSL  440

Query  430   YGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDG  251
             Y AS+I+GF +G Q  L++ IISE+FGLKYY+TL+N G +ASP+GSYI NV + G+LYD 
Sbjct  441   YVASVIIGFCFGSQWPLIYAIISEIFGLKYYATLYNFGSIASPVGSYIFNVVVTGKLYDR  500

Query  250   EAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDI  86
             EA++Q+ A+G+      +L C+G +CYKVSFI++ G  LFG+LVS +LV RT  +YK DI
Sbjct  501   EALRQLYAKGLKRKTGEDLNCVGAECYKVSFIIITGATLFGSLVSFILVLRTRNFYKGDI  560

Query  85    YKRFRDE  65
             YK+FR++
Sbjct  561   YKKFRED  567



>ref|XP_007144375.1| hypothetical protein PHAVU_007G151000g [Phaseolus vulgaris]
 gb|ESW16369.1| hypothetical protein PHAVU_007G151000g [Phaseolus vulgaris]
Length=588

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/554 (53%), Positives = 390/554 (70%), Gaps = 9/554 (2%)
 Frame = -1

Query  1699  EEQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSF  1520
             E    + F+  +  GRWFM+FAS LIMA +GATY+FG+YS E+KA+LGYDQSTLNL+  F
Sbjct  6     ELAKTKAFIRHVITGRWFMIFASCLIMAVSGATYMFGLYSNEVKASLGYDQSTLNLISFF  65

Query  1519  KDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICV  1340
             KD+GAN+G+ SGLI E++P W +L +G+ MNF GYF+IWLSVT RIAKP+VWQMCLY  +
Sbjct  66    KDLGANLGIFSGLINEISPPWVILAMGATMNFVGYFMIWLSVTSRIAKPQVWQMCLYFYI  125

Query  1339  GANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILL  1160
             GANSQ+FANTGALV CV++FP SRG ++GL+KG+VGLSGA+FTQLY A YG DS+ LI L
Sbjct  126   GANSQSFANTGALVNCVQSFPRSRGSVIGLLKGYVGLSGAIFTQLYHAFYGEDSKALIFL  185

Query  1159  IGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHF  980
             IGWLPA +S +F+P++R + I+    E KVF++ L IS+ +A  LM L + Q  + F+  
Sbjct  186   IGWLPAAISFIFLPTVRVLSITPQLREIKVFYQLLYISLGVAGFLMVLIVIQNRLSFTRV  245

Query  979   AYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSEN----VEDppppaeniekaee  812
              YI    +V  LL LP  I   EE    K + +      +    +E P P   +   +  
Sbjct  246   EYIVDGMMVLFLLLLPLGIVFKEEFKLWKNQNQTFTDHADAASVMELPQPQEAHAAASSH  305

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
              +    SC  N+FK PKRGEDY+I QA+ S+DML+LFI    G G +L A+DNLGQIG S
Sbjct  306   LEGKTNSCLENVFKPPKRGEDYTIFQAIFSIDMLILFIATVFGVGGTLTALDNLGQIGNS  365

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             LGYP +++ TFVSLVSIWNY GR  SGF SE ++ ++K PR LM+T  +LL C G +L+A
Sbjct  366   LGYPKKSLTTFVSLVSIWNYLGRASSGFASEILLTKYKFPRPLMLTLVMLLSCVGHILIA  425

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             F  P S+Y +S+I+GF +G    L+F IISE+FGLKYYSTL+N G +ASP+GSYILNV+I
Sbjct  426   FGIPNSLYFSSVIIGFCFGAMWPLMFAIISEIFGLKYYSTLYNLGAVASPVGSYILNVRI  485

Query  271   VGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTA  107
              G LYD EA+KQ+  +G+      +LTCLG QC+K +FI++    L G  VS +LV RT 
Sbjct  486   TGYLYDKEALKQLGMKGLTRQNGKDLTCLGVQCFKTAFIIITASTLVGCFVSFILVLRTR  545

Query  106   AYYKTDIYKRFRDE  65
              +Y+ DIY++FR E
Sbjct  546   KFYQGDIYEKFRVE  559



>ref|XP_010435975.1| PREDICTED: uncharacterized protein LOC104719709 [Camelina sativa]
Length=587

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/558 (54%), Positives = 399/558 (72%), Gaps = 17/558 (3%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M+    Q+  GRWFM F+S LIM+ AGATY+FG+YS +IK TLGYDQ+TLNL+  FKD+G
Sbjct  1     MKGLAIQILTGRWFMFFSSILIMSTAGATYMFGIYSGDIKRTLGYDQTTLNLISFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVGVL+GL+ EVTP WF+LL+G+ +NF GYF+IWL+VTKRI+KP+VW MCLYICVGANS
Sbjct  61    ANVGVLTGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTKRISKPQVWHMCLYICVGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
               FANTG++VTCVKNFP SRG++LG++KG++GLSGA+ TQLY A YG D++ LIL+IGWL
Sbjct  121   LVFANTGSVVTCVKNFPESRGVVLGILKGYIGLSGAIITQLYHAFYGEDTKELILMIGWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             PAI+S  F+ +IR MK++   NE KV + +L IS+ LA  LM + I  K   F+   +  
Sbjct  181   PAIVSFAFLRTIRIMKVTRQTNELKVLYNFLYISLGLATFLMVVIIINKLSGFTQSEFGG  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQL------------LSSENVEDppppaenie  824
                ++  LL LP ++ V+EE     EK+  L             S ++ E      E+ +
Sbjct  241   SVAVMLVLLLLPIIVVVLEEKKLWTEKQVALNNPAPVNIVTEESSIDSSEVKDEDEESDK  300

Query  823   kaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
             + E E+    SC+  +F  P+RG+DY+ILQAL S+DML+LF+   CG G +L AIDNLGQ
Sbjct  301   EEERERVKTASCWTTMFSPPERGDDYTILQALFSIDMLILFLATICGVGGTLTAIDNLGQ  360

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IG S GYP R++ TFVSLVSIWNY+GRV SG VSE  + ++K PR LM+T  LLL CAG 
Sbjct  361   IGSSFGYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAGY  420

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             LL+AF  PG +Y AS+I+GF  G Q  LL  IISE+FGLKYY+TL+N G +A+P+GSY+L
Sbjct  421   LLIAFNVPGGLYVASVIIGFCCGAQWPLLLAIISEIFGLKYYATLYNFGAVATPIGSYLL  480

Query  283   NVKIVGRLYDGEAVKQVAA-----RGVGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
              V + G LYD EA KQ  A     RG  +L C+GT C+K+SFI++  + LFG LVS+VLV
Sbjct  481   KVWVAGYLYDVEADKQNKALGNTSRGGEDLNCVGTSCFKLSFIIITAITLFGVLVSMVLV  540

Query  118   ARTAAYYKTDIYKRFRDE  65
              RT  +YK+DI K+FR++
Sbjct  541   VRTKKFYKSDIKKKFREK  558



>ref|XP_010658344.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Vitis 
vinifera]
Length=599

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/559 (54%), Positives = 397/559 (71%), Gaps = 21/559 (4%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
              +  GRWFM+FASFLIM+ AGATY+FG+YS  +K+ LGYDQ+TLNLL  FKD+GANVGVL
Sbjct  22    HVITGRWFMVFASFLIMSAAGATYMFGLYSSTLKSVLGYDQTTLNLLSFFKDLGANVGVL  81

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SGLI EVTP W VL +G+AMNF GYF+IWL+V+ +IAKP+VW MCLYIC+GANSQ FANT
Sbjct  82    SGLINEVTPPWVVLSIGAAMNFFGYFMIWLAVSHKIAKPQVWHMCLYICIGANSQAFANT  141

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             G+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YGND++ LILLIGWLPA +S 
Sbjct  142   GSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGNDTKALILLIGWLPAAISF  201

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
              F+ +IR MK+    +E KVF+++L IS+ LA  LM + I +K + FS   Y   A +V 
Sbjct  202   AFLRTIRIMKVIRQESERKVFYKFLYISLGLAGFLMIIIIVEKQMTFSQSGYWGSAALVL  261

Query  949   ALLFLPFLIAVMEELATRKEKKKQL----------------LSSENVEDppppaenieka  818
              LLFLP  + + EE    K +++ L                 SS ++      A +    
Sbjct  262   LLLFLPLAVVIQEEFKLWKIRQQALSEPPLLKIIAGNLNTEASSSSLPPESAAATSSLPE  321

Query  817   eeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIG  638
             +     + SCF N+F+ P RGEDY+ILQAL S+DM +LF    CG G +L AIDNLGQIG
Sbjct  322   QLSSQKEVSCFSNVFRPPDRGEDYTILQALFSIDMFVLFFTTICGVGGTLTAIDNLGQIG  381

Query  637   ESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLL  458
              SLGYP +++ TF+SLVSIWNY GRV +GF SE ++ ++K PR LM+T  LLL C G LL
Sbjct  382   SSLGYPHKSLNTFISLVSIWNYLGRVTAGFGSEIVLDKYKFPRPLMLTLILLLSCVGHLL  441

Query  457   VAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNV  278
             +AF     +Y AS+I+GF +G Q  +L+ +ISE+FGLKYYSTL+N G +ASP+GSY+ NV
Sbjct  442   IAFNIKNGLYFASIIIGFCFGAQWPILYAVISEIFGLKYYSTLYNFGAVASPIGSYLFNV  501

Query  277   KIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVAR  113
              + G LYD E  +Q+AA G+      +L C G +C+K+SFI++    LFG+LVSL+LV R
Sbjct  502   MVAGYLYDKEGKRQMAALGIERKPGEDLDCTGVECFKLSFIIITAATLFGSLVSLILVLR  561

Query  112   TAAYYKTDIYKRFRDEMGA  56
             T  +YK DIYK+FR++  A
Sbjct  562   TRKFYKGDIYKKFREQAKA  580



>emb|CAN66928.1| hypothetical protein VITISV_011832 [Vitis vinifera]
Length=599

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/566 (54%), Positives = 405/566 (72%), Gaps = 21/566 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWF++FASFLIM+ AGATY+FG+YS  IK+ LGYDQ+TLNLL  FKD+
Sbjct  15    DMKSLSVQVITGRWFVVFASFLIMSAAGATYMFGLYSXTIKSALGYDQTTLNLLSFFKDL  74

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVLSGLI EVTP W VL +G+A+NF GYF+IWL+V+++IAKP+VW MCLYIC+GAN
Sbjct  75    GANVGVLSGLINEVTPPWVVLSMGAALNFFGYFMIWLAVSQKIAKPQVWHMCLYICIGAN  134

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YGND++ LILLI W
Sbjct  135   SQAFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYHAFYGNDTKALILLIAW  194

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+    NE KVF+ +L IS+ LA  LM + I +K + FS   Y 
Sbjct  195   LPAAISFAFLRTIRIMKVIRQENELKVFYNFLYISLGLAGFLMIIIIVEKELTFSQSEYG  254

Query  970   ACATIVCALLFLPFLIAVMEEL--------ATRKEKKKQLL--------SSENVEDpppp  839
               A +V  LLFLP  + + EE         A R+  + +++        SS ++      
Sbjct  255   GSAALVLLLLFLPLAVVIQEEFKLWKIXQZALREPPQLKIIAENLNTETSSSSLPLESTA  314

Query  838   aeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAI  659
             A +    +     + SCF N+F+ P RGEDY+ILQAL S+DM +LF    CG G +L AI
Sbjct  315   ATSSLPEQLSSQKEVSCFSNVFRPPDRGEDYTILQALFSIDMXILFFTTICGVGGTLTAI  374

Query  658   DNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLL  479
             DNLGQIG SLGYP +++ TF+SLVSIWNY GRV +GF SE ++ ++K PR LM+T  LLL
Sbjct  375   DNLGQIGSSLGYPQKSLSTFISLVSIWNYLGRVTAGFGSEIVLDKYKFPRPLMLTLILLL  434

Query  478   PCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPL  299
              C G LL+AF     +Y AS+I+GF +G Q  +LF +ISE+FGLKYYSTL+N G +ASP+
Sbjct  435   SCVGHLLIAFNIKNGLYFASIIIGFCFGAQWPILFAVISEIFGLKYYSTLYNFGAVASPI  494

Query  298   GSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALV  134
             GSY+L+V++ G LYD E  +Q+AA G+      +L C G +C+K+SFI++    LFG+LV
Sbjct  495   GSYLLSVRVAGYLYDKEGKRQMAALGIERKAGEDLDCTGVECFKLSFIIITAATLFGSLV  554

Query  133   SLVLVARTAAYYKTDIYKRFRDEMGA  56
             SL+LV RT  +YK DIYK+FR++  A
Sbjct  555   SLILVLRTRKFYKGDIYKKFREQAKA  580



>ref|XP_009783152.1| PREDICTED: uncharacterized protein LOC104231797 [Nicotiana sylvestris]
Length=568

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/550 (54%), Positives = 394/550 (72%), Gaps = 9/550 (2%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             MENF   +  GRWFM+FAS LI++ AG TY+FG+YS+E+K +LGYDQ+TLNLLG FKD+G
Sbjct  1     MENFGMHMLVGRWFMVFASLLILSVAGGTYIFGLYSEEVKTSLGYDQTTLNLLGFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVG++SGLI EVTP W VLL+G+ MNF+GYF IWL+ T ++ KPKVWQMC  I +GANS
Sbjct  61    ANVGIISGLINEVTPPWVVLLLGAFMNFSGYFSIWLATTGKLTKPKVWQMCFCIFIGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q FANTG LVTCVKNFP SRG+++GL+KGFVGLSGA+ TQLY A YGN+ ++LILLI WL
Sbjct  121   QTFANTGVLVTCVKNFPESRGIVIGLLKGFVGLSGAILTQLYHAFYGNNGKSLILLIAWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             PA++S VF+  IR MK++   NE K+F++ L +S+ LA  LM + I Q  V F+   Y +
Sbjct  181   PAVVSCVFLRVIRVMKVTRQENELKIFYQLLFMSLGLAGFLMVIIIVQNRVEFNSVGYWS  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE----DppppaeniekaeeekAG  800
              A I+  LLF P ++ + EEL     KK+      +V+    + P  +         +  
Sbjct  241   TAGIILVLLFAPIVLVIREELKLWDTKKQSSSHPIDVKVVGIETPLQSSATVVPTNNQTD  300

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
             + S F N+F+ P+RGEDY+ILQA+LS+DML+LFI    G G  L A+DNLGQIG++LGY 
Sbjct  301   EVSFFSNVFQPPERGEDYTILQAVLSIDMLILFIATIFGAGGLLTAMDNLGQIGKALGYS  360

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
               +I TFVSLVSIW Y GRV SGF SE  ++++K PR LM+T  LLL C G +L+AF   
Sbjct  361   KTSITTFVSLVSIWGYLGRVASGFASEIFLEKYKFPRPLMLTLVLLLSCVGHVLIAFGVT  420

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
              ++Y AS+++GF +G    L+F IISE+FGLK+YSTL N G  ASP+G+YI NVK+ G L
Sbjct  421   NTLYVASVLMGFCFGALWPLIFAIISEIFGLKHYSTLLNFGGAASPIGAYIFNVKVAGNL  480

Query  259   YDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA+KQ+AA G+      +LTC G +CYK+SF+++A     G +VSLVLV RT  +YK
Sbjct  481   YDKEAIKQMAAHGIIRKPGEDLTCTGVECYKLSFLIIAASTFVGFIVSLVLVLRTFNFYK  540

Query  94    TDIYKRFRDE  65
              DIYK+FR++
Sbjct  541   GDIYKKFREQ  550



>ref|XP_006379525.1| nodulin family protein [Populus trichocarpa]
 gb|ERP57322.1| nodulin family protein [Populus trichocarpa]
Length=609

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/568 (53%), Positives = 390/568 (69%), Gaps = 28/568 (5%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWFM+FAS LIM+ AGATY+F +YS +IK  LGYDQ+TLNLL  FKDV
Sbjct  17    DMKSLTTQIVTGRWFMVFASLLIMSAAGATYMFALYSPDIKDALGYDQTTLNLLSFFKDV  76

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGVLSGLI EVTP W VL +G+ +NF GYF+IWL+VTK+I   +VW MCLYIC+GAN
Sbjct  77    GSNVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTKKITGVQVWHMCLYICIGAN  136

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQ + A YG D++ LILLIGW
Sbjct  137   SQSFANTGSLVTCVKNFPESRGSVLGILKGYVGLSGAIITQFFHAFYGGDTKALILLIGW  196

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+   PNE KVF+ +L IS+ LA  LM + I +K + F+   Y 
Sbjct  197   LPAAISFAFLRTIRIMKVIRQPNELKVFYNFLYISLALAGFLMIVIILEKTLSFTRGEYG  256

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE---------------------  854
               A +V  +LF+P  + ++EE      K++ L     ++                     
Sbjct  257   GSAAVVILMLFVPLGVVIVEEYKIWNSKRQALNDPSPLKIVTEKPPPSQEIPAPSPPPPS  316

Query  853   --DppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQ  680
                                 + SC+   F+ P RGED++ILQAL S+DML+LF+   CG 
Sbjct  317   TSSDKKLVTVESSPSTTDNSNVSCWKTAFRPPDRGEDFTILQALFSIDMLILFLATICGI  376

Query  679   GCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLM  500
             G +L AIDNLGQIG SLGYP ++I TFVSLVSIWNY GRV SGF SE ++K++K  R L+
Sbjct  377   GGTLTAIDNLGQIGTSLGYPKKSISTFVSLVSIWNYLGRVVSGFGSEHVLKKYKFSRPLL  436

Query  499   MTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNC  320
              T +LLL C G LL+AF   G +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N 
Sbjct  437   FTLTLLLSCVGHLLIAFNVSGGLYVASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNF  496

Query  319   GQLASPLGSYILNVKIVGRLYDGEAVKQVAARGVGE-----LTCLGTQCYKVSFIVLAGV  155
             G  ASP+G Y+LNV++ G LYD EA KQ+AA+G+       L C+GT+C+++SFI++   
Sbjct  497   GAAASPVGLYLLNVRLTGHLYDKEAGKQLAAKGLKRKHGDALDCVGTECFRLSFIIITAA  556

Query  154   NLFGALVSLVLVARTAAYYKTDIYKRFR  71
              LFG  VSL+LV RT  +YK+DIYK+FR
Sbjct  557   TLFGTFVSLILVHRTRKFYKSDIYKKFR  584



>emb|CDP14418.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/549 (53%), Positives = 390/549 (71%), Gaps = 7/549 (1%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             +N   FV  L   RWFM+FA+ LIM+ +GATY+FG+YS +IK++LGYDQ+TLNL+  FKD
Sbjct  13    KNTGAFVLHLLNSRWFMVFATLLIMSMSGATYMFGIYSGDIKSSLGYDQTTLNLVSFFKD  72

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             VGAN+G+++GL+ EV P W VL  G+ MNF GYF+IWL VT RIAKP VWQ+ LYIC+GA
Sbjct  73    VGANIGIVAGLVNEVAPPWLVLSCGAIMNFFGYFMIWLVVTHRIAKPPVWQIYLYICIGA  132

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FA   ALV+CVKN P SRG++LG++KGF+GLSGA+ TQLYLA YG++S++LILL+ 
Sbjct  133   NSQTFAGVVALVSCVKNCPESRGVVLGILKGFIGLSGAIITQLYLAFYGHNSKSLILLVA  192

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +SI+F+ +IR MK+    NE ++F  +L  S++LA  LM + I Q ++ F+ F Y
Sbjct  193   WLPAAVSILFLRTIRIMKVVQQANEHRIFQNFLYSSLSLAGFLMIMIIMQNWLSFTRFEY  252

Query  973   IACATIVCALL-FLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGD  797
              A  ++V  LL F  FL+ V EE    K  KKQ+L                   +     
Sbjct  253   AASGSVVLLLLIFTNFLVVVREEFDLWKS-KKQVLDDHPPSMVELTPVEAVPKPQNHEVQ  311

Query  796   YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPP  617
              SCF N+F +PKRGED++ILQ + ++DML+LF  +  G G +L AIDNLGQIG+SLGY  
Sbjct  312   VSCFSNMFTQPKRGEDHTILQGIFNIDMLILFTVSAFGIGGTLVAIDNLGQIGKSLGYQT  371

Query  616   RTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPG  437
             + I TFV+LVSIWNY GRV +GF SE ++ ++K PR LMM   LL+ CAG LL+AF  P 
Sbjct  372   KAIATFVTLVSIWNYLGRVAAGFASEILLAKYKFPRPLMMALVLLVSCAGHLLIAFGAPN  431

Query  436   SVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLY  257
             S+Y ASLI+GF +G Q TL+F I+SELFGLKYYSTL +    A+PLG+Y+LNV++ G LY
Sbjct  432   SLYLASLIVGFCFGAQWTLIFSIVSELFGLKYYSTLISIAAGATPLGNYVLNVRVAGHLY  491

Query  256   DGEAVKQVAARGV----GE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
             D EA+ Q+ A+G+    GE LTC G +CYK+SF+++     FG+++SLVL  RT  +YK 
Sbjct  492   DMEALNQMTAKGLTRKEGEGLTCSGVECYKLSFLIVTAATFFGSVLSLVLSYRTRNFYKG  551

Query  91    DIYKRFRDE  65
             DIY +FRD+
Sbjct  552   DIYLKFRDQ  560



>ref|XP_003557448.1| PREDICTED: uncharacterized protein LOC100822987 [Brachypodium 
distachyon]
Length=626

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/568 (52%), Positives = 389/568 (68%), Gaps = 31/568 (5%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q+  GRWF +FASF I+  +GATY+FG+YSK +K++LGYDQ TLN +  FKD+GAN+
Sbjct  26    FARQVAVGRWFTVFASFAILTASGATYIFGIYSKTLKSSLGYDQQTLNTISFFKDLGANL  85

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GV SGLI EVTP W VL +G+AMN  GY +++L+V  R ++P VW +CLYI VGANSQ+F
Sbjct  86    GVFSGLINEVTPPWVVLAIGAAMNLVGYLMVYLAVDGRTSRPPVWLVCLYIFVGANSQSF  145

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRG++LG++KGFVGLSGAV+TQLYLA+YG+D+++LILLI WLPA 
Sbjct  146   ANTGALVTCVKNFPESRGIVLGILKGFVGLSGAVYTQLYLALYGDDAKSLILLIAWLPAA  205

Query  1138  LSIVFIPSIR----PMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             +S+VF+ +IR    P +          FF +L ISI LA  L+ + + QK   FSH AY 
Sbjct  206   ISVVFVHTIRIMPYPRRRGGQETSGDPFFCFLYISIALACYLLVMIVVQKQFTFSHGAYA  265

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKK------------------------KQLLSSE  863
               A+ +  +LFLP  + + +E    +E++                        +   S  
Sbjct  266   IAASALLIVLFLPLCVVIKQEYKIHRERELDRANEPPPTITVAAAADDPASQVQMSGSDS  325

Query  862   NVEDppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCG  683
               E      +    +         C   +F+ P RGEDY+ILQAL+S+DML+LF+   CG
Sbjct  326   KTEPQQQQIQGASSSSSCMGSWGGCVKKMFRPPARGEDYTILQALVSIDMLVLFVATICG  385

Query  682   QGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTL  503
              G +L AIDN+GQIG+SLGYP ++I TFVSL+SIWNY GRV SGF SE +++R+K+PRTL
Sbjct  386   VGGTLTAIDNMGQIGQSLGYPSKSINTFVSLISIWNYAGRVTSGFASEILLERYKVPRTL  445

Query  502   MMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFN  323
             M+T  LLL C G +L+A   P S+Y AS+++GF +G Q  L+F IISE+FGLKYYSTL+N
Sbjct  446   MLTGVLLLACVGHVLIALGVPHSLYAASVVIGFCFGAQWPLVFAIISEVFGLKYYSTLYN  505

Query  322   CGQLASPLGSYILNVKIVGRLYDGEAVKQVA---ARGVGELTCLGTQCYKVSFIVLAGVN  152
              G +ASP+GSYILNV++ GR+YD EA +Q     A G  +  CLG +C+K SF+++    
Sbjct  506   FGGMASPVGSYILNVRVAGRMYDAEADRQPGGGFAAGGRDKVCLGVECFKRSFLIITAAT  565

Query  151   LFGALVSLVLVARTAAYYKTDIYKRFRD  68
             +FGALVSLVLV RT A+YK DIY RFRD
Sbjct  566   VFGALVSLVLVWRTWAFYKGDIYARFRD  593



>ref|XP_011084395.1| PREDICTED: uncharacterized protein LOC105166653 [Sesamum indicum]
Length=588

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/549 (54%), Positives = 388/549 (71%), Gaps = 18/549 (3%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             Q+  GRWFM+FA+ LIM  +GATY+FG+YS EIK+ LGYDQ+TLN+L  FKD+G+NVG+L
Sbjct  21    QVLTGRWFMVFATTLIMLTSGATYMFGLYSTEIKSNLGYDQTTLNILSFFKDLGSNVGLL  80

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             S LI EVT  W VL +G+A+NF GYF+IWL+++K+I++P VW MCLYI +GANSQ+ ANT
Sbjct  81    SSLINEVTSPWVVLSIGAALNFFGYFMIWLAISKKISRPHVWHMCLYIFIGANSQSSANT  140

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             GAL+T VKNFP SRG +LGL+KGFV LSGA+  Q+Y AIYGNDS++LILLIGWLP  +S+
Sbjct  141   GALITAVKNFPESRGAVLGLLKGFVALSGAIIAQIYHAIYGNDSKSLILLIGWLPTAVSL  200

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
             VF+ +IR ++     +E KVF+ +L +S+ LA  LM   I QK V F+     A A  + 
Sbjct  201   VFLRTIRTIEAVRVAHELKVFYRFLYVSLGLAGFLMATIILQKRVTFTRSELGASAATIL  260

Query  949   ALLFLPFLIAVMEELATRKEKKKQL-------LSSENVEDppppaeniekaeeekAGDYS  791
              LLFLP  I V EE+  R+ K+          L  EN         N +   +    + S
Sbjct  261   FLLFLPVAIVVKEEIHLRRRKRDDHNLGNFSQLKFENPPPISASTTNDQARNQ----EIS  316

Query  790   CFG--NIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPP  617
             C+   +IF  P RGE+Y+ILQAL S+DML+LF    CG G +L AIDNLGQIG SLGYP 
Sbjct  317   CWSVESIFGPPGRGENYTILQALFSIDMLVLFFATTCGVGGTLTAIDNLGQIGTSLGYPT  376

Query  616   RTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPG  437
              +I TFVSLVSIWNY GRV SGF+SE  + ++K PR +M+T  L++ C G LL+A   P 
Sbjct  377   NSISTFVSLVSIWNYLGRVVSGFLSEHFLDKYKFPRPVMLTLILVMSCIGHLLIALDVPN  436

Query  436   SVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLY  257
              +Y AS+I+GF +G Q  LLF IISELFGLKYYSTL+N G  ASP+GSY+LNV++ G LY
Sbjct  437   GLYVASVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGSAASPIGSYLLNVRVAGYLY  496

Query  256   DGEAVKQV----AARGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
             D EA +Q+     AR  GE L C+G +C+K++F+++  V LFGA VSLVLV RT  +YK+
Sbjct  497   DKEAEEQLRALGRARKPGEDLNCVGVECFKMAFVIITFVTLFGAFVSLVLVVRTREFYKS  556

Query  91    DIYKRFRDE  65
             DIYK+FR E
Sbjct  557   DIYKKFRQE  565



>emb|CDP15281.1| unnamed protein product [Coffea canephora]
Length=558

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/537 (53%), Positives = 388/537 (72%), Gaps = 10/537 (2%)
 Frame = -1

Query  1645  MMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLIAEVT  1466
             M+FA+ LIMA +GATY+FG+YS++IK++LGYDQ+TLNL+G FKD+GAN+G++SGL+ EV 
Sbjct  1     MVFATILIMAMSGATYMFGIYSEDIKSSLGYDQTTLNLIGFFKDLGANLGIISGLVNEVA  60

Query  1465  PTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALVTCVK  1286
             P W VL +G+ MNF+GY +IWLSVT RIA+P VW MC YI +GANSQ F+NT ALV+CVK
Sbjct  61    PPWLVLSLGAVMNFSGYLMIWLSVTGRIARPAVWHMCFYIFIGANSQTFSNTVALVSCVK  120

Query  1285  NFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIPSIRP  1106
             NFP SRG+++GL+KGFVGLSGA+ TQLY A YG+DS++LILLIGWLPA +S++F+ ++R 
Sbjct  121   NFPESRGVVIGLLKGFVGLSGAIITQLYRAFYGHDSKSLILLIGWLPAAVSLIFLRTVRI  180

Query  1105  MKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLFLPFL  926
             M++     E  +F+ +L +S+ LA  LM   IAQ ++ F+   Y A A++V  LL +  L
Sbjct  181   MRVVRQATELNMFYRFLYVSLILAGFLMITIIAQNWLAFTRLEYGASASVVIVLLSMHLL  240

Query  925   IAVMEELATRKEKKKQL-----LSSENVEDppppaeniekaeeekAGDYSCFGNIFKKPK  761
             + + EE    K K+ +       +SE           +     ++    SC G +F+ P+
Sbjct  241   VVITEEFKLWKRKRGETSYDPPPASEFAPQAAKAETPLADPPNQEETPVSCLGKVFRPPE  300

Query  760   RGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSI  581
             RGED++ILQA+ ++DML+LF     G G +L AIDNLGQIG+SLGYP ++I TFVSLVSI
Sbjct  301   RGEDHTILQAVCTIDMLILFAATTFGVGGTLTAIDNLGQIGKSLGYPKKSIATFVSLVSI  360

Query  580   WNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFS  401
             W+Y GRV SGF SE ++ ++K PR LM+T  LL+ CAG LL+AF  P S+Y +SLI GF 
Sbjct  361   WSYLGRVASGFASEILLAKYKFPRPLMLTLVLLVSCAGHLLIAFGVPYSLYVSSLIAGFC  420

Query  400   YGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARG  221
             +G Q  L+F IISELFGLKYYSTL N G  ASP G+YILNV+I G  YD EA+KQ+AA+ 
Sbjct  421   FGAQWPLIFAIISELFGLKYYSTLINLGAGASPFGNYILNVQIAGHFYDREALKQMAAKE  480

Query  220   VG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDE  65
             V      +LTC G +CYK+SF+++    LFG +VSLVL  RT  +YK DIYK+F+++
Sbjct  481   VTRRAGEDLTCDGVECYKLSFLIITATTLFGCVVSLVLYLRTRNFYKGDIYKKFKEQ  537



>gb|KHN02305.1| Putative transporter MCH1 [Glycine soja]
Length=554

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/546 (56%), Positives = 380/546 (70%), Gaps = 16/546 (3%)
 Frame = -1

Query  1645  MMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLIAEVT  1466
             M+FAS LIM+ AGATY+FG+YS E+K +LGYDQSTLNLL  FKD+GANVGV+SGL+ EVT
Sbjct  1     MLFASLLIMSVAGATYMFGIYSNEVKTSLGYDQSTLNLLSFFKDLGANVGVISGLVNEVT  60

Query  1465  PTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALVTCVK  1286
             P + VL +G  MNF GYF+I+L+V+ RIAKP+VWQMCLYIC+GANSQ FANTGALVTCVK
Sbjct  61    PPFVVLSIGVIMNFFGYFMIFLAVSGRIAKPQVWQMCLYICIGANSQTFANTGALVTCVK  120

Query  1285  NFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGN-DSQNLILLIGWLPAILSIVFIPSIR  1109
             NFP SRG +LGL+KG+VGLSGA+ TQLY A YGN +SQ LILLI WLPA +S +F+P+IR
Sbjct  121   NFPGSRGSILGLLKGYVGLSGAIITQLYHAFYGNHNSQALILLIAWLPAAVSSLFLPTIR  180

Query  1108  PMKISSH-PNE-TKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLFL  935
              M    H P E  +VF+  L IS+ LA  LM L + Q  + FS   YI    +V   L L
Sbjct  181   IMNTVLHQPKEGNRVFYHLLYISLGLAAFLMVLILVQNKLSFSRIEYIVDGLVVFFFLLL  240

Query  934   PFLIAVMEELATRKEKKKQLLSS--------ENVEDppppaeniekaeeekAGDYSCFGN  779
             P ++   EE+   K   + L  S        E +  P    E +           SC  N
Sbjct  241   PLVVVFREEINQLKANTQCLTDSPPQLKVVTEAIPPPNVEQEEVPPTTTSSHEKSSCLRN  300

Query  778   IFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTF  599
             I   PKRGEDY+ILQAL S+DML+LFI    G G +L AIDNLGQIG SLGYP ++  TF
Sbjct  301   ISNPPKRGEDYTILQALFSIDMLILFIATTFGAGGTLTAIDNLGQIGHSLGYPNKSTTTF  360

Query  598   VSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGAS  419
             VSLVSIWNY GRV SG+ SE  + ++KIPR  M+T  LL+ C G +L+A   P S+Y AS
Sbjct  361   VSLVSIWNYLGRVASGYASEIFLTKYKIPRPYMLTLVLLVSCVGHVLIALGVPNSLYFAS  420

Query  418   LILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVK  239
             +I+GF +G Q  L+F IISE+FGLKYYSTL+N G  ASPLGSYILNVK+ G LYD EA+K
Sbjct  421   VIIGFCFGAQWPLMFAIISEVFGLKYYSTLYNFGAAASPLGSYILNVKVAGVLYDKEALK  480

Query  238   QVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRF  74
             Q+ A+G+      +LTC+G QCYK++FI++    L G L S++L  RT  +YK DIY++F
Sbjct  481   QLKAKGLTREEGKDLTCVGVQCYKMAFIIITASTLVGCLASVILALRTRKFYKGDIYRKF  540

Query  73    RDEMGA  56
             R E  A
Sbjct  541   RMEHEA  546



>ref|XP_009397027.1| PREDICTED: uncharacterized protein LOC103981971 [Musa acuminata 
subsp. malaccensis]
Length=597

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/551 (52%), Positives = 383/551 (70%), Gaps = 17/551 (3%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
              + RGRWFM FASFL+M+ AGATY+F +YSK+IK +LGY+Q TLN +  FKD+GANVG++
Sbjct  12    HVVRGRWFMAFASFLVMSTAGATYIFAIYSKDIKTSLGYNQETLNTISFFKDLGANVGIV  71

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SGL+AE+ P W +L +G+AMNF GY +I+L++T R+A  +VWQMCLYICVGANS  FANT
Sbjct  72    SGLLAELAPPWVILAMGAAMNFFGYLMIYLAITGRLAHTQVWQMCLYICVGANSGTFANT  131

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
              ALV  VKNFP SRG++LGL+KGFVGLSGA+FTQLYLA YG DS +L+LLI WLPA +S+
Sbjct  132   AALVAAVKNFPESRGIVLGLLKGFVGLSGAIFTQLYLAFYGTDSTSLVLLIAWLPAAISV  191

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
             +F+P++R MK+    NE KVF   L IS+ LA  LM + I QK V FS   Y   A +V 
Sbjct  192   LFLPTVRIMKVVRQANEFKVFCSILYISLVLAAYLMVVIIVQKRVSFSRSGYGVSAAVVL  251

Query  949   ALLFLPFLIAVMEELATRKEKKKQL----------LSSENVEDppppaeniekaeeekAG  800
              +LFLP ++ + EE+    + K+ +          +  E + +  P   +          
Sbjct  252   LILFLPLVVVIREEINVYNQNKQMVPQTPPPPSVTIDKETISEQAPTEVDSSLRSISSDE  311

Query  799   DYSCFGNIF---KKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
                    I    K PKRGEDYSILQALLS+DML++F    CG G +L AIDN+GQIGESL
Sbjct  312   KKPVLARIIEAVKPPKRGEDYSILQALLSLDMLIIFFATICGVGGTLTAIDNMGQIGESL  371

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
             GYP R+I TFVSL+SIWNY GRV +GF SE  + R+K PR L+    +   C G LL+AF
Sbjct  372   GYPTRSISTFVSLISIWNYMGRVAAGFASEIFLVRYKFPRPLLFALVMAPSCVGYLLIAF  431

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
               PGS+Y AS+I+GF +G Q+ LLF IISE+FGLKY++TL+N G LASP+ SY+LNV++ 
Sbjct  432   GVPGSLYIASVIIGFCFGAQMPLLFAIISEVFGLKYFATLYNVGGLASPVASYLLNVRVA  491

Query  268   GRLYDGEAVKQ----VAARGVGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
             G LYD EA KQ    +++     LTC+G +C+++SF+++  V + G L  L+LV RT A+
Sbjct  492   GYLYDREAAKQNAGVISSSSSKSLTCMGVRCFRLSFLIITAVTVVGVLAMLILVWRTWAF  551

Query  100   YKTDIYKRFRD  68
             Y+ DIY +F++
Sbjct  552   YRGDIYAKFKE  562



>ref|XP_010450661.1| PREDICTED: uncharacterized protein LOC104732777 [Camelina sativa]
Length=588

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/559 (54%), Positives = 398/559 (71%), Gaps = 18/559 (3%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M+    Q+  GRWFM FAS LIM+ AGATY+FG+YS +IK TLGYDQ+TLNL+  FKD+G
Sbjct  1     MKGLAIQILTGRWFMFFASILIMSTAGATYMFGIYSDDIKRTLGYDQTTLNLISFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVGVL+GL+ EVTP WF+LL+G+ +NF GYF+IWL+VTKRI+KP+VW MCLYICVGANS
Sbjct  61    ANVGVLTGLLNEVTPPWFILLIGAILNFFGYFMIWLAVTKRISKPQVWHMCLYICVGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
               FANTG++VTCVKNFP SRG++LG++KG++GLSGA+ TQLY A YG D++ LIL+IGWL
Sbjct  121   LVFANTGSVVTCVKNFPESRGVVLGILKGYIGLSGAIITQLYHAFYGEDTKELILMIGWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             PA++S  F+ +IR MK++   NE KV + +L IS+ LA  LM + I  K   F+   +  
Sbjct  181   PAVVSFAFLRTIRIMKVTRQTNELKVLYNFLYISLGLATFLMVVIIINKLSGFTQSEFGG  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQL--------LSSENVEDpppp-----aeni  827
                ++  LL LP ++ V+EE     EK+  L        ++ E+  D          +  
Sbjct  241   SVAVMLVLLLLPIIVVVLEEKKLWTEKQVALNNPSPVNIVTEESSIDSSEIKDEESDKEK  300

Query  826   ekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLG  647
             E+ E E+    SC+  +F  P+RG+DY+ILQAL S+DML+LF+   CG G +L AIDNLG
Sbjct  301   EEEERERVKTASCWTTMFNPPERGDDYTILQALFSIDMLILFLATICGVGGTLTAIDNLG  360

Query  646   QIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAG  467
             QIG S GYP R++ TFVSLVSIWNY+GRV SG VSE  + ++K PR LM+T  LLL CAG
Sbjct  361   QIGSSFGYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAG  420

Query  466   DLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI  287
              LL+AF  PG +Y AS+I+GF  G Q  LL  IISE+FGLKYY+TL+N G +A+P+GSY+
Sbjct  421   YLLIAFNVPGGLYLASVIIGFCCGAQWPLLLAIISEIFGLKYYATLYNFGAVATPIGSYL  480

Query  286   LNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             L V + G LYD EA KQ  A G       +L C+GT C+K+SFI++  + LFG LVS+VL
Sbjct  481   LKVWVAGYLYDVEANKQNKASGNTSRDGEDLNCIGTSCFKLSFIIITAITLFGVLVSMVL  540

Query  121   VARTAAYYKTDIYKRFRDE  65
             V RT  +YK+DI K+FR++
Sbjct  541   VVRTKKFYKSDIKKKFREK  559



>gb|KCW65466.1| hypothetical protein EUGRSUZ_G02876 [Eucalyptus grandis]
Length=571

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/538 (55%), Positives = 381/538 (71%), Gaps = 24/538 (4%)
 Frame = -1

Query  1597  LFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAG  1418
             +FG+YS++IK +LGYDQSTLNLL  FKD+GANVGVLSGLI EVTP W VL +G+ +NF G
Sbjct  1     MFGLYSEDIKHSLGYDQSTLNLLSFFKDLGANVGVLSGLINEVTPPWVVLSMGAVLNFFG  60

Query  1417  YFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALVTCVKNFPASRGMMLGLMKGF  1238
             YF+IWL+VTKRIAKP+VWQMCLYIC+GANSQ FANTGALVTCV+NFP SRG++LG++KG+
Sbjct  61    YFMIWLAVTKRIAKPQVWQMCLYICIGANSQAFANTGALVTCVQNFPESRGVVLGILKGY  120

Query  1237  VGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIPSIRPMKISSHPNETKVFFEY  1058
             VGLSGA+ TQL+ A Y  D++ LILLIGWLPA +S  F+ +IR MK+   PNE KVF+ +
Sbjct  121   VGLSGAIITQLFYAFYYKDTKALILLIGWLPAAISFAFVRTIRIMKVVRQPNEVKVFYRF  180

Query  1057  LGISITLALCLMGLTIAQKYVR-FSHFAYIACATIVCALLFLPFLIAVMEELATRKEKKK  881
             L IS+ LA  LM + I +K+   F+   Y   A  V  LLFLP  I V+EE     +K++
Sbjct  181   LYISLGLATFLMIMIIIEKHFNNFTRPEYGLSAAGVLFLLFLPLAIVVIEEYKQWAQKRE  240

Query  880   QLLSSENVE------------------DppppaeniekaeeekAGDYSCFGNIFKKPKRG  755
              L     +E                      P   I  + E+     SC+   F+ P RG
Sbjct  241   ALNDPSPIEITTEKPNLETSLPLPPPPPETAPPTAILNSGEQLEKQPSCWRTAFRPPDRG  300

Query  754   EDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWN  575
             EDY+ILQAL S+DML+LF+   CG G +L AIDNLGQIG+SLGY  ++  TFVSLVSIWN
Sbjct  301   EDYTILQALFSIDMLILFLSTICGVGGTLTAIDNLGQIGKSLGYATQSTSTFVSLVSIWN  360

Query  574   YFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYG  395
             Y GRV +GFVSE ++ R+K PRTLM+T  LL+ CAG LL+AF  P  +Y AS+I+GF +G
Sbjct  361   YLGRVVAGFVSEILLTRYKFPRTLMLTIILLISCAGHLLIAFDVPNGLYFASIIIGFCFG  420

Query  394   VQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARGVG  215
              Q  LLF IISE+FGLKYYSTL+N G +ASP+G Y+LNV++ G LYD EA KQ+AA G+ 
Sbjct  421   AQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGGYLLNVRVAGHLYDKEAKKQLAALGLA  480

Query  214   -----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
                  +L C G +CY++SF+++    LFGA VS +LV RT  +Y++DIYK+FR+E  A
Sbjct  481   RQPGQDLECTGVKCYQLSFLIITFATLFGAFVSFILVVRTRKFYRSDIYKKFREEAKA  538



>dbj|BAJ90449.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/561 (53%), Positives = 390/561 (70%), Gaps = 24/561 (4%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q+  GRWF +FASF I+  +GATY+F +YSK +K++LGY+Q TLN +  FKD+GAN+
Sbjct  30    FARQVAVGRWFTVFASFAILTASGATYIFSIYSKTLKSSLGYNQQTLNTISFFKDLGANL  89

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GV SGLI EVTP W VL +G+AMN  GY +++L+V  R A+P VW +CLYI +GANSQ+F
Sbjct  90    GVFSGLINEVTPPWVVLAIGAAMNLVGYLMVYLAVDGRTARPPVWLVCLYIFIGANSQSF  149

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRG++LG++KGFVGLSGAV+TQLYLA YG+D+++LILLI WLPA 
Sbjct  150   ANTGALVTCVKNFPESRGIVLGILKGFVGLSGAVYTQLYLAFYGDDTKSLILLIAWLPAA  209

Query  1138  LSIVFIPSIR----PMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             +S+VF+ +IR    P +          FF +L ISI LA  L+ + + QK   FSH AY 
Sbjct  210   ISVVFVHTIRIMPYPRRRGGQETSGDPFFCFLYISIALACYLLVMIVVQKQFTFSHGAYA  269

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYS  791
               AT +  +LFLP  + + +E    +E++       N   P       +   E   G  +
Sbjct  270   IAATALLIVLFLPLCVVIKQEYKIYRERELDAALLANDPPPTITVAGDQAQVEMSTGAKA  329

Query  790   ----------------CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAI  659
                             C  N+F+ P RGEDY+ILQAL+SVDML+LF+   CG G +L AI
Sbjct  330   EQQAEPPASPSCSFGGCVKNMFRPPARGEDYTILQALVSVDMLVLFVATICGVGGTLTAI  389

Query  658   DNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLL  479
             DN+GQIG+SLGYP ++I TFVSL+SIWNY GRV SGF SE +++R+K+PRTLM+T  LLL
Sbjct  390   DNMGQIGQSLGYPAKSINTFVSLISIWNYAGRVTSGFASEVLLERYKLPRTLMLTGVLLL  449

Query  478   PCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPL  299
              CAG +L+A   P S+Y AS+I+GF +G Q  L+F IISE+FGLKYYSTL+N G +ASP+
Sbjct  450   ACAGHVLIALGVPQSLYVASVIIGFCFGAQWPLVFAIISEVFGLKYYSTLYNFGGMASPV  509

Query  298   GSYILNVKIVGRLYDGEAVKQ----VAARGVGELTCLGTQCYKVSFIVLAGVNLFGALVS  131
             GSYILNV + GRLYD EA KQ      A G  +  CLG +C+K SF+++A   +FGALVS
Sbjct  510   GSYILNVLVAGRLYDAEADKQPGGGFTAGGGRDKVCLGVECFKRSFLIIAAATVFGALVS  569

Query  130   LVLVARTAAYYKTDIYKRFRD  68
             LVLV RT ++YK DIY RFRD
Sbjct  570   LVLVWRTWSFYKGDIYARFRD  590



>gb|KEH24041.1| MFS transporter [Medicago truncatula]
Length=618

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/567 (53%), Positives = 392/567 (69%), Gaps = 21/567 (4%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             +  + F +QL  GRWFM+FAS LIM+ AGATY+FG+YS +IK +L YDQ+TLNLL  FKD
Sbjct  16    KGTKTFTYQLLTGRWFMLFASSLIMSVAGATYMFGLYSNQIKTSLSYDQTTLNLLSFFKD  75

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +GANVGV+SGLI E+TP W VLL G+ MNF GYF+IWLSVTK+I  PKVWQMCLYIC+GA
Sbjct  76    LGANVGVISGLINEITPPWVVLLTGTIMNFFGYFMIWLSVTKKIHTPKVWQMCLYICIGA  135

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIY---GNDSQNLIL  1163
             NSQ F NTGALVTCVKNFP SRG +LGL+KG+VGLSGA+ TQ+Y ++Y    N++Q+LIL
Sbjct  136   NSQTFTNTGALVTCVKNFPNSRGSVLGLLKGYVGLSGAIITQIYHSLYYGDSNNTQSLIL  195

Query  1162  LIGWLPAILSIVFIPSIRPMKISS--HPNETKVFFEYLGISITLALCLMGLTIAQKYVRF  989
             LI WLPA +S +F+P+IR +K+++     E KVF+  L IS+ LA  LM L I Q  + F
Sbjct  196   LIAWLPAAVSFLFLPTIRILKLNNIQQQKEYKVFYNLLYISLGLACFLMVLIILQNMLTF  255

Query  988   SHFAYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV-----------EDppp  842
             S   YI     V  LL LP ++   EE+      K   +S   V            +   
Sbjct  256   SRIEYIGDGVFVILLLLLPLVVVFREEIKFNTLLKDTSISQLKVVTDVPLQNMSSHEQEA  315

Query  841   paeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAA  662
                +            SC+  IFK P RGEDY+ILQAL S+DML+LF+    G G +L A
Sbjct  316   EVSSSSTTTNSDKKSSSCWRTIFKPPNRGEDYTILQALFSIDMLILFLATTFGVGGTLTA  375

Query  661   IDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLL  482
             IDNLGQIG SLGYP ++  TFVSLVSIWNY GRV SG++SE ++ R+KIPR  ++TF +L
Sbjct  376   IDNLGQIGHSLGYPNKSTTTFVSLVSIWNYLGRVASGYISEILLTRYKIPRPYLLTFVML  435

Query  481   LPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASP  302
             L C G +L+A     S+Y AS+I+GF +G Q  L+F IISE+FGLKYYSTL+N G +ASP
Sbjct  436   LSCVGHILIALGISNSLYFASVIIGFCFGAQWPLMFAIISEIFGLKYYSTLYNFGAVASP  495

Query  301   LGSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGAL  137
             +GSYI NV++ G LYD EA+KQ+ A+G+      +LTC+G +CY+++FI++    L G  
Sbjct  496   VGSYIFNVRVAGYLYDKEALKQLEAKGLRRQKGKDLTCVGVECYRMAFIIITASTLIGCF  555

Query  136   VSLVLVARTAAYYKTDIYKRFRDEMGA  56
             +S +LV RT  +YK DIY+++R+E  A
Sbjct  556   ISFILVLRTRKFYKGDIYEKYREEFEA  582



>ref|XP_010050677.1| PREDICTED: uncharacterized protein LOC104439293 [Eucalyptus grandis]
 gb|KCW89356.1| hypothetical protein EUGRSUZ_A01652 [Eucalyptus grandis]
Length=627

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/548 (56%), Positives = 394/548 (72%), Gaps = 19/548 (3%)
 Frame = -1

Query  1657  GRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLI  1478
             GRWFM FA+FLIM+ AGATY+F +YS +IK++LGYDQ++LNLLG FKD+GANVG++SGL+
Sbjct  28    GRWFMAFAAFLIMSVAGATYIFSLYSGDIKSSLGYDQTSLNLLGFFKDLGANVGIVSGLV  87

Query  1477  AEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALV  1298
              EVTP W VL +G+AMNF GYF+IWL+VT R A+P++W MCLYICVGANSQ+FANTGALV
Sbjct  88    NEVTPPWVVLSIGAAMNFFGYFMIWLAVTGRSARPRLWLMCLYICVGANSQSFANTGALV  147

Query  1297  TCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIP  1118
             T VKNFP SRG +LGL+KGFVGLSGA+  QLY A YG+DS++LILLI WLPA +S+VF+ 
Sbjct  148   TAVKNFPESRGAILGLLKGFVGLSGAILAQLYHAFYGDDSESLILLIAWLPAAISVVFLR  207

Query  1117  SIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLF  938
             +IR +++    NE KVF++ L +S+ LA  LM + I Q  +RFS   Y   A +V  LLF
Sbjct  208   TIRILEVVRQKNELKVFYKLLYVSLGLAGFLMAIIILQNQLRFSKIEYAGSAAVVLLLLF  267

Query  937   LPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaee-------------ekAGD  797
             LP  I V EE+   K K++ +++++        AE                    +  G 
Sbjct  268   LPIFIVVKEEIVLWKRKREIVMNNDPSHHLKVVAETPPPPPPPHASEPVLALPPPQHTGA  327

Query  796   YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPP  617
               C GNI + P RGEDY+ILQAL S+DML+LF     G G +L AIDNLGQIG SLGYP 
Sbjct  328   CGC-GNILRPPDRGEDYTILQALFSIDMLILFTATTFGAGGTLTAIDNLGQIGSSLGYPS  386

Query  616   RTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPG  437
             R+  TFVSLVSIWNY GRV SGF SE ++ ++K PR L++T  LLL C G LL+AF  P 
Sbjct  387   RSTTTFVSLVSIWNYLGRVVSGFASEILLTKYKCPRPLLLTLVLLLSCVGHLLIAFGVPN  446

Query  436   SVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLY  257
             S+Y +S+I+GF +G Q  L+F IISE+FGLKYYSTL+N G  ASP+GSY+LNVK+ GRLY
Sbjct  447   SLYASSIIIGFCFGAQWPLVFAIISEIFGLKYYSTLYNLGAAASPVGSYVLNVKVAGRLY  506

Query  256   DGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
             D EA +Q+AA G+      +LTC G +CYK +F+V+ G  LFG +VS  LV RT  +Y+ 
Sbjct  507   DREAARQMAAAGLAREDGQDLTCKGVECYKTAFLVITGATLFGCMVSFFLVLRTRKFYRG  566

Query  91    DIYKRFRD  68
             DIY++FR+
Sbjct  567   DIYRKFRE  574



>ref|XP_010098800.1| hypothetical protein L484_022565 [Morus notabilis]
 gb|EXB75888.1| hypothetical protein L484_022565 [Morus notabilis]
Length=621

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/570 (53%), Positives = 391/570 (69%), Gaps = 25/570 (4%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
             Q +  F  Q+F G+WFM+FA+ LIM+  G++Y+FG+YS +IK++LGYDQSTLNL+  FKD
Sbjct  8     QELRLFALQVFAGKWFMVFATILIMSVNGSSYMFGLYSNDIKSSLGYDQSTLNLISFFKD  67

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             +G N+GVL+GLI EV+P W VL VG+AMNF GYF+IW+S+   IAKP VWQMCLYIC+ A
Sbjct  68    LGGNLGVLAGLINEVSPPWVVLSVGAAMNFFGYFMIWMSIAGHIAKPHVWQMCLYICIAA  127

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NS +F NT ALV CVKNFP SRG ++G +KG + LSGA+ TQLY AIY +DS+ L+LLI 
Sbjct  128   NSLSFPNTAALVACVKNFPESRGSVIGFLKGLIVLSGAILTQLYHAIYKDDSEALVLLIA  187

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S+VF+ +IR MK    PN+ +VF  +L +S+ +A  LM L I Q  +RF+   Y
Sbjct  188   WLPAAVSLVFLRTIRIMKRVRQPNKLRVFCNFLYVSLGVAASLMALIIIQNRLRFNRLQY  247

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKK-------KQLLSSENVE------------D  851
              A A++V  LLFL   + + EEL   K KK       K  L +EN              +
Sbjct  248   AASASVVLVLLFLSLYVVINEELKLWKHKKQGQTDPSKFTLMTENPRISEPPSHVNENPE  307

Query  850   ppppaeniekaeeekAGDYSCF-GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGC  674
                P     +A       Y C+   IFK P RGEDY+ILQA  S+DM++LF    C  G 
Sbjct  308   SSEPQPITNRALVSSQMPYLCWVKKIFKAPDRGEDYTILQAAFSIDMIILFTALTCSAGG  367

Query  673   SLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMT  494
             SL AIDNLGQ+G SLGYP  +I TF+SLVSIWN+ GRV +GF SE ++ ++  PR  M+T
Sbjct  368   SLTAIDNLGQLGSSLGYPGHSITTFISLVSIWNFLGRVTAGFASEILLAKYMFPRPSMLT  427

Query  493   FSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQ  314
               +LL C G LL+AF  P S+Y AS+I GF YG QL+LLF+IISELFGLKYYSTL+N G 
Sbjct  428   AVILLSCVGHLLIAFGVPHSLYFASIITGFCYGAQLSLLFVIISELFGLKYYSTLYNVGA  487

Query  313   LASPLGSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNL  149
             L+SPLGSYI NVK+ G LYD EA KQ+ A G+      ELTC G +CYK++F+V+    L
Sbjct  488   LSSPLGSYIFNVKVAGHLYDKEARKQMEALGLVRKAGQELTCNGGRCYKMAFLVITVATL  547

Query  148   FGALVSLVLVARTAAYYKTDIYKRFRDEMG  59
             FG LVS +LV RT  +YK+DIYK+FR+E G
Sbjct  548   FGCLVSFILVLRTRRFYKSDIYKKFREEKG  577



>ref|XP_003537006.1| PREDICTED: uncharacterized protein LOC100782396 [Glycine max]
Length=580

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/541 (54%), Positives = 388/541 (72%), Gaps = 6/541 (1%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F+  +  GRWFM+FAS LIMA +GATY+FG+YS E+KA+LGYDQSTLNL+  FKD+GAN+
Sbjct  6     FIHHVITGRWFMIFASCLIMAVSGATYMFGLYSNEVKASLGYDQSTLNLISFFKDLGANL  65

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             G+ SGLI E++P W +L +G+ MNF GYF+IWLSVT RIAKP+VWQMCLY  +GANSQ+F
Sbjct  66    GIFSGLINEISPPWVILAMGATMNFIGYFMIWLSVTSRIAKPQVWQMCLYFYIGANSQSF  125

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALV CVK+FP SRG ++GL+KG+VGLSGA+FTQ Y A YG+DS+ LI LIGWLPA 
Sbjct  126   ANTGALVNCVKSFPRSRGSVIGLLKGYVGLSGAIFTQFYHAFYGDDSKALIFLIGWLPAA  185

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S +F+P++R + I+  P E KVF++ L IS+ +A  LM L + Q  + F+   +I    
Sbjct  186   ISFIFLPTVRVLSITPQPKEIKVFYQLLYISLGVAGFLMVLIVVQNKLSFTRVEFIVDGM  245

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSCFGN  779
             +V  LL LP  I   EE    K  + Q  +                +  E+  + SC  N
Sbjct  246   VVLLLLLLPLGIVFKEEFKIWKN-QNQNFTDAAASVVELSQPEEAPSHSERKNNNSCLKN  304

Query  778   IFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTF  599
             +FK PKRGEDY+I QAL S+DML+LFI    G G +L A+DNLGQIG SLGYP +++ TF
Sbjct  305   VFKPPKRGEDYTIFQALFSIDMLILFIATVFGVGGTLTALDNLGQIGNSLGYPKKSLTTF  364

Query  598   VSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGAS  419
             VSLVSIWNY GR  SGFVSE ++ ++K PR L++T  +LL C G +L+AF  P S+Y +S
Sbjct  365   VSLVSIWNYLGRASSGFVSEYLLTKYKFPRPLLLTLVMLLSCVGHILIAFGIPNSLYFSS  424

Query  418   LILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVK  239
             +I+GF +G    L+F IISE+FGLKYYSTL+N G +ASP+GSYILNV++ G LYD EA+K
Sbjct  425   VIIGFCFGAIWPLMFAIISEIFGLKYYSTLYNFGAVASPVGSYILNVRVTGYLYDKEALK  484

Query  238   QVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRF  74
             Q+  +G+      +LTC+G QCY+++F+++    L G +VS +LV RT  +YK DIY++F
Sbjct  485   QLGVKGLIRQKGKDLTCVGVQCYRMAFLIITASTLVGCVVSFILVLRTRNFYKGDIYEKF  544

Query  73    R  71
             R
Sbjct  545   R  545



>ref|XP_002881636.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57895.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=576

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/557 (53%), Positives = 383/557 (69%), Gaps = 39/557 (7%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M++   Q+  GRWFM F S LIM+ AGATY+FG+YS +IK TLGYDQ+TLNLL  FKD+
Sbjct  9     SMKSLTIQILTGRWFMFFGSLLIMSTAGATYMFGIYSGDIKKTLGYDQTTLNLLSFFKDL  68

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVL+GL+ EVTP WF+LL+G  +NF GYF+IWL+VT+RI+KP+VW MCLYICVGAN
Sbjct  69    GANVGVLAGLLNEVTPPWFILLIGGILNFFGYFMIWLAVTERISKPQVWHMCLYICVGAN  128

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG D++ LIL+IGW
Sbjct  129   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRAFYGEDTKELILMIGW  188

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPAI+S  F+ +IR MK+    NE KVF+ +L IS+ LA  LM + I  K   F+   + 
Sbjct  189   LPAIVSFAFLRTIRIMKVKRQTNELKVFYNFLYISLGLATFLMVVIIINKLSGFTQSEFG  248

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYS  791
               A +V  LL LP ++ ++EE    +EK+  L                         D +
Sbjct  249   GSAAVVIVLLLLPIIVVILEEKKLWREKQVAL------------------------NDPA  284

Query  790   CFGNIFKKPK-RGEDYSILQALLSVDMLLLFICN---------FCGQGCSLAAIDNLGQI  641
                 + +KPK    ++         +   +   +          CG G +L AIDNLGQI
Sbjct  285   PINVVTEKPKLDSSEFKDDDEETKEEEEKVKTASCWRTVPDNTICGVGGTLTAIDNLGQI  344

Query  640   GESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDL  461
             G+SLGYP R++ TFVSLVSIWNY+GRV SG VSE  + ++K PR LM+T  LLL CAG L
Sbjct  345   GDSLGYPKRSVSTFVSLVSIWNYYGRVVSGVVSEIFLIKYKFPRPLMLTMVLLLSCAGHL  404

Query  460   LVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILN  281
             L+AF  PG +Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSY+LN
Sbjct  405   LIAFNVPGGLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLN  464

Query  280   VKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVA  116
             V++ G LYD EA KQ  A G       +L C+GT C+K+SFI++  V LFG LVS+VLV 
Sbjct  465   VRVAGYLYDVEAGKQYKALGKTRVEGQDLNCIGTSCFKLSFIIITAVTLFGVLVSMVLVI  524

Query  115   RTAAYYKTDIYKRFRDE  65
             RT  +YK+DIYK+FR++
Sbjct  525   RTKKFYKSDIYKKFREK  541



>ref|XP_010050695.1| PREDICTED: uncharacterized protein LOC104439313 [Eucalyptus grandis]
 gb|KCW89358.1| hypothetical protein EUGRSUZ_A01654 [Eucalyptus grandis]
Length=629

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/548 (56%), Positives = 393/548 (72%), Gaps = 19/548 (3%)
 Frame = -1

Query  1657  GRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLI  1478
             GRWFM FA+ LIM+ AGATY+F +YS +IK++LGYDQ++LNLLG FKD+GANVG++SGL+
Sbjct  29    GRWFMAFAALLIMSVAGATYIFSLYSGDIKSSLGYDQTSLNLLGFFKDLGANVGIVSGLV  88

Query  1477  AEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALV  1298
              EVTP W VL +G+ MNF GYF+IWL+VT R A+P++W MCLYIC+GANSQ+FANTGALV
Sbjct  89    NEVTPPWVVLSIGAVMNFFGYFMIWLAVTGRSARPRLWLMCLYICIGANSQSFANTGALV  148

Query  1297  TCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIP  1118
             T VKNFP SRG +LGL+KGFVGLSGA+  QLY A YG+DS++LILLI WLPA +S+VF+ 
Sbjct  149   TAVKNFPESRGAILGLLKGFVGLSGAILAQLYHAFYGDDSESLILLIAWLPAAMSVVFLR  208

Query  1117  SIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLF  938
             +IR +++    NE KVF++ L +S+ LA  LM + I Q  +RFS   Y   A +V  LLF
Sbjct  209   TIRILEVVRQKNELKVFYKLLYVSLGLAGFLMAVIILQNQLRFSRIGYAGSAAVVLLLLF  268

Query  937   LPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaee-------------ekAGD  797
             LP  I V EE+A  K K++ +++++        AE                    +  G 
Sbjct  269   LPIFIVVKEEIALWKRKREIVMNNDPSHHLKVVAETPPPPPPLHASEPVLALPPPQHTGA  328

Query  796   YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPP  617
              SC GNI + P RGEDY+ILQAL S+DML+LF     G G +L AIDNL QIG SLGYP 
Sbjct  329   CSC-GNILRPPDRGEDYTILQALFSIDMLILFTATTFGVGGTLTAIDNLAQIGNSLGYPS  387

Query  616   RTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPG  437
             R+  TFVSLVSIWNY GRV SGF SE ++ ++K PR L++T  LLL C G LL+AF  P 
Sbjct  388   RSTTTFVSLVSIWNYLGRVVSGFASEILLTKYKCPRPLLLTLVLLLSCVGHLLIAFGVPN  447

Query  436   SVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLY  257
             S+Y AS+I+GF +G Q  L+F IISE+FGLKYYSTL+N G  ASP+GSYILNVK+ GRLY
Sbjct  448   SLYAASIIIGFCFGAQWPLVFAIISEIFGLKYYSTLYNLGAGASPVGSYILNVKVAGRLY  507

Query  256   DGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
             D EA +Q+AA G+      +LTC G +CYK +F+V+ G  LFG +VS  LV RT  +Y+ 
Sbjct  508   DREAARQMAAAGLARKDGQDLTCKGVECYKTAFLVITGATLFGCMVSFFLVLRTRKFYRG  567

Query  91    DIYKRFRD  68
             DIY++FR+
Sbjct  568   DIYRKFRE  575



>emb|CDM84956.1| unnamed protein product [Triticum aestivum]
Length=624

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/566 (53%), Positives = 388/566 (69%), Gaps = 26/566 (5%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q+  GRWF +FASF I+  +GATY+FG+YSK +K++LGY+Q TLN +  FKD+GAN+
Sbjct  30    FARQVAVGRWFTVFASFAILTASGATYIFGIYSKTLKSSLGYNQQTLNTISFFKDLGANL  89

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GV SGLI EVTP W VL +G+ MN  GY +++L+V  R A+P VW +CLYI +GANSQ+F
Sbjct  90    GVFSGLINEVTPPWVVLAIGATMNLVGYLMVYLAVDGRTARPPVWLVCLYIFIGANSQSF  149

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRG++LG++KGFVGLSGAV+TQLYLA YG+D+++LILLI WLPA 
Sbjct  150   ANTGALVTCVKNFPESRGIVLGILKGFVGLSGAVYTQLYLAFYGDDTKSLILLIAWLPAA  209

Query  1138  LSIVFIPSIR----PMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             +S+VF+ +IR    P +          FF +L ISI LA  L+ + + QK   FSH AY 
Sbjct  210   ISVVFVHTIRIMPYPRRRGGQETSGDPFFCFLYISIALACYLLVMIVVQKQFTFSHGAYS  269

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYS  791
               A  +  +LFLP  + + +E    +E++       N   P           E   G  +
Sbjct  270   IAAAALLIVLFLPLCVVIKQEYKIYRERELDAALLANDPPPTITVAGDPAQVEMSTGAKA  329

Query  790   ------------------CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLA  665
                               C  N+F+ P RGEDY+ILQAL+SVDML+LF+   CG G +L 
Sbjct  330   EQQASSEPPPPSSCSFGGCVKNMFRPPARGEDYTILQALVSVDMLVLFVATICGVGGTLT  389

Query  664   AIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSL  485
             AIDN+GQIG+SLGYP ++I TFVSLVSIWNY GRV SGF SE +++R+K+PRTLM+T  L
Sbjct  390   AIDNMGQIGQSLGYPAKSINTFVSLVSIWNYAGRVTSGFASEVLLERYKLPRTLMLTGVL  449

Query  484   LLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLAS  305
             LL CAG +L+A   P S+Y AS+I+GF +G Q  L+F IISE+FGLKYYSTL+N G +AS
Sbjct  450   LLACAGHVLIALGVPQSLYVASVIIGFCFGAQWPLVFAIISEVFGLKYYSTLYNFGGMAS  509

Query  304   PLGSYILNVKIVGRLYDGEAVKQ----VAARGVGELTCLGTQCYKVSFIVLAGVNLFGAL  137
             P+GSYILNV + GRLYD EA KQ      A G  +  CLG +C+K SF+++    +FGAL
Sbjct  510   PVGSYILNVLVAGRLYDAEADKQPGGGFTAGGGRDKVCLGVECFKRSFLIITAATVFGAL  569

Query  136   VSLVLVARTAAYYKTDIYKRFRDEMG  59
             VSLVLV RT ++YK DIY RFRD  G
Sbjct  570   VSLVLVWRTWSFYKGDIYARFRDGAG  595



>gb|EAZ03041.1| hypothetical protein OsI_25182 [Oryza sativa Indica Group]
Length=623

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/554 (53%), Positives = 385/554 (69%), Gaps = 13/554 (2%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q+  GRWF +FAS LI+  +GATY+FG+YS  +KA+LGYDQ TLN +  FKD+GAN+
Sbjct  36    FARQVAVGRWFTVFASLLILTASGATYIFGIYSPALKASLGYDQHTLNTVSFFKDLGANL  95

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGLI EVTP W VL +G+AMN +GY +++L+V  R A P VW +CLY+ VGANSQ+F
Sbjct  96    GVLSGLINEVTPPWVVLAIGAAMNLSGYLMVYLAVAGRTAAPPVWLVCLYVFVGANSQSF  155

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRG++LG++KGFVGLSGAV+TQLYLA YG+D+++LILLI WLPA 
Sbjct  156   ANTGALVTCVKNFPESRGVVLGILKGFVGLSGAVYTQLYLAFYGDDAKSLILLIAWLPAA  215

Query  1138  LSIVFIPSIR----PMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             +S+VF+ ++R    P +          FF +L ISI LA  L+ + + Q+   FS  AY 
Sbjct  216   VSVVFVHTVRIMPYPRRRGGQETSVDPFFCFLYISIGLAAYLLVMIVVQRQFAFSRTAYS  275

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSE-----NVEDppppaeniekaeeek  806
               A  +  +LFLP  + + +E    +E+ +   ++       V +     E   +     
Sbjct  276   CAAAALLIVLFLPLCVVIKQEFKIHRERLELAAAAPPPHTITVLEMSKETERSPRPSSPA  335

Query  805   AGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
               + S    +F+ P RGEDY+ILQAL+SVDM +LF+   CG G +L AIDN+GQIG+SLG
Sbjct  336   PAETSWVKGMFRPPARGEDYTILQALVSVDMAVLFVATICGVGGTLTAIDNMGQIGQSLG  395

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP R+  TFVSL+SIWNY GRV +GF SE  V+RW++PR L++T  LLL CAG LL+A  
Sbjct  396   YPARSTNTFVSLISIWNYAGRVAAGFASEAFVERWRLPRPLVLTGILLLACAGHLLIALG  455

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
              P ++Y AS+I+GF +G Q  L+F IISE+FGLKYYSTL+N G +ASP+GSYILNV + G
Sbjct  456   VPRALYAASVIIGFCFGAQWPLVFAIISEVFGLKYYSTLYNFGGMASPVGSYILNVLVAG  515

Query  265   RLYDGEAVKQVAAR---GVG-ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYY  98
             RLYD EA +Q  A    G G +  CLG  C+K SF+++    +FGALVSLVLV RT  +Y
Sbjct  516   RLYDAEAGRQPGASLAAGAGRDKVCLGVDCFKKSFLIITAATVFGALVSLVLVWRTWRFY  575

Query  97    KTDIYKRFRDEMGA  56
             K DIY RFRD  GA
Sbjct  576   KGDIYARFRDGDGA  589



>ref|XP_007142880.1| hypothetical protein PHAVU_007G024700g [Phaseolus vulgaris]
 gb|ESW14874.1| hypothetical protein PHAVU_007G024700g [Phaseolus vulgaris]
Length=586

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/551 (56%), Positives = 391/551 (71%), Gaps = 9/551 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             N    + Q+  GRWF++FASFLIMA AGATY+F +YS +IK  L YDQ+TLNLL  FKD+
Sbjct  10    NTNGHLVQVITGRWFVVFASFLIMAAAGATYMFSLYSGDIKYALAYDQTTLNLLSFFKDL  69

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G NVG+LSGLI E+TP W VL++GS +NF GYF+IWL+VTK+I KP VW MCLYIC+GAN
Sbjct  70    GGNVGILSGLINEITPPWVVLVMGSVLNFFGYFMIWLAVTKKIPKPHVWHMCLYICIGAN  129

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A Y +DS++LILLI W
Sbjct  130   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYYAFYYDDSRSLILLIAW  189

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK    PNE  VF+++L IS+ LA  L+ + I QK + FS   Y 
Sbjct  190   LPAAISFAFLRTIRYMKPVRQPNELSVFYKFLYISLGLAGFLLLMIILQKKLSFSQSEYG  249

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV----EDppppaeniekaeeekA  803
               A +V  LLFLP  +   E+   R+ +K   +    V    E   P  E+       K 
Sbjct  250   VSAGVVLLLLFLPLAVVFDEQFKIRETQKLAFIDPNPVKIAAERELPLPESANGDSVSKI  309

Query  802   GDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGY  623
              +   +  +F  P RGEDY+ILQAL S DM+LLF    CG G +L AIDNLGQIG SLGY
Sbjct  310   EETRWWQKVFTPPARGEDYTILQALFSCDMILLFFAGTCGVGGTLTAIDNLGQIGTSLGY  369

Query  622   PPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPF  443
                +I TFVSLVSIWNY GRVFSGFVSE  ++++  PR LM+T +LLL C G LL+AF  
Sbjct  370   SKASISTFVSLVSIWNYMGRVFSGFVSEHFLQKYHFPRPLMLTLTLLLSCVGHLLIAFDV  429

Query  442   PGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGR  263
             P  +Y +S+I+GF +G Q  LLF IISELFGLKYYSTL+N G  ASP+G YILNV++ G 
Sbjct  430   PNGLYLSSVIIGFCFGAQWPLLFAIISELFGLKYYSTLYNFGGAASPIGLYILNVRVAGH  489

Query  262   LYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYY  98
             LYD EA+KQ+AA G+      EL C G  C+K+SFI++    +FGA++SL+LVART  +Y
Sbjct  490   LYDKEALKQLAAAGISRNGGQELNCTGPSCFKMSFIIITAATVFGAMISLILVARTVKFY  549

Query  97    KTDIYKRFRDE  65
             K DIYKR+R++
Sbjct  550   KGDIYKRYREQ  560



>ref|XP_010050685.1| PREDICTED: uncharacterized protein LOC104439301 [Eucalyptus grandis]
 gb|KCW89357.1| hypothetical protein EUGRSUZ_A01653 [Eucalyptus grandis]
Length=629

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/548 (56%), Positives = 392/548 (72%), Gaps = 19/548 (3%)
 Frame = -1

Query  1657  GRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVLSGLI  1478
             GRWFM FA+ LIM+ AGATY+F +YS +IK++LGYDQ++LNLLG FKD+GANVG++SGL+
Sbjct  29    GRWFMAFAALLIMSVAGATYIFSLYSGDIKSSLGYDQTSLNLLGFFKDLGANVGIVSGLV  88

Query  1477  AEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANTGALV  1298
              EVTP W VL +G+ MNF GYF+IWL+VT R A+P++W MCLYIC+GANSQ+FANTGALV
Sbjct  89    NEVTPPWVVLSIGAVMNFFGYFMIWLAVTGRSARPRLWLMCLYICIGANSQSFANTGALV  148

Query  1297  TCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSIVFIP  1118
             T VKNFP SRG +LGL+KGFVGLSGA+  QLY A YG+DS++LILLI WLPA +S+VF+ 
Sbjct  149   TAVKNFPESRGAILGLLKGFVGLSGAILAQLYHAFYGDDSESLILLIAWLPAAISVVFLR  208

Query  1117  SIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVCALLF  938
             +IR +++    NE KVF++ L +S+ LA  LM + I Q  +RFS   Y   A +V  LLF
Sbjct  209   TIRILEVVRQKNELKVFYKLLYVSLGLAGFLMAIIILQNQLRFSRIGYAGSAAVVLLLLF  268

Query  937   LPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaee-------------ekAGD  797
             LP  I V EE+A  K K++ +++++        AE                    +  G 
Sbjct  269   LPIFIVVKEEIALWKRKREIVMNNDPSHHLKVVAETPPPPPPLHGSEPVLALPPPQHTGA  328

Query  796   YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPP  617
              SC GNI + P RGEDY+ILQAL S+DML+LF     G G +L  IDNL QIG SLGYP 
Sbjct  329   CSC-GNILRPPDRGEDYTILQALFSIDMLILFTATTFGVGGTLTTIDNLAQIGNSLGYPS  387

Query  616   RTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPG  437
             R+  TFVSLVSIWNY GRV SGF SE ++ ++K PR L++T  LLL C G LL+AF  P 
Sbjct  388   RSTTTFVSLVSIWNYLGRVVSGFASEILLTKYKCPRPLLLTLVLLLSCVGHLLIAFGVPN  447

Query  436   SVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLY  257
             S+Y AS+I+GF +G Q  L+F IISE+FGLKYYSTL+N G  ASP+GSYILNVK+ GRLY
Sbjct  448   SLYAASIIIGFCFGAQWPLVFAIISEIFGLKYYSTLYNLGAGASPVGSYILNVKVAGRLY  507

Query  256   DGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
             D EA +Q+AA G+      +LTC G +CYK +F+V+ G  LFG +VS  LV RT  +Y+ 
Sbjct  508   DREAARQMAAAGLARKDGQDLTCKGVECYKTAFLVITGATLFGCMVSFFLVLRTRKFYRG  567

Query  91    DIYKRFRD  68
             DIY++FR+
Sbjct  568   DIYRKFRE  575



>ref|XP_011094731.1| PREDICTED: uncharacterized protein LOC105174351 [Sesamum indicum]
Length=578

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/555 (53%), Positives = 393/555 (71%), Gaps = 20/555 (4%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             ++   RWFM+FA  LIM+ +GATY+FGVYS +IK +LGYDQ+TLNL+G FKD+G+N+GV+
Sbjct  19    KVLTSRWFMVFACLLIMSMSGATYIFGVYSNDIKTSLGYDQTTLNLIGFFKDLGSNIGVM  78

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SG+I E+ P W VL +G AMNF+GYF+IWL+VT RIAKP VWQMCLYIC+GANSQ F+NT
Sbjct  79    SGIINELMPPWVVLAIGVAMNFSGYFMIWLAVTGRIAKPLVWQMCLYICIGANSQTFSNT  138

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             GALVTCVKNFP SRG+++GL+KGF GLSGA+ +QL+ A YG++S++LILLI WLPA +S 
Sbjct  139   GALVTCVKNFPESRGIVIGLLKGFTGLSGAIISQLFHAFYGHNSKDLILLISWLPAAVSC  198

Query  1129  VFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIVC  950
             VF+ ++R MK     NE ++F++ L  S+ LA  LM L I Q  + FS   Y    +IV 
Sbjct  199   VFLRTVRLMKGIRQENELQIFYDLLYTSLGLAGFLMILIILQNELVFSRAQYEGSTSIVL  258

Query  949   ALLFLPFLIAVMEELATRKEKK----------KQLLSSEN---VEDppppaeniekaeee  809
              LLF P  I   EE    K KK          +  ++++N   VE P P       A+  
Sbjct  259   ILLFAPLAIVFREEFKIWKSKKVTGNESNDTSRLKVTTKNPPPVEAPGPERPPQMVAQPP  318

Query  808   kAGDYSC--FGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
             K  + S   + ++FK P+RG+DY+ILQAL S+DM++LF       G +L AIDNLGQIG+
Sbjct  319   KDQEKSVPWWRDVFKPPERGQDYNILQALFSIDMIILFTAITVEGGGTLTAIDNLGQIGK  378

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             +LGYPP++I TFVSLVSIWNY G+V +GF SE  + ++K PR LM+T  LL  C G LL+
Sbjct  379   ALGYPPKSITTFVSLVSIWNYLGKVAAGFASEIFLAKYKFPRPLMLTLVLLFSCTGHLLI  438

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AF  P S+Y AS+I GF +G Q  L+F IISE+FGLKYYSTL++ G  ASPLG+YI NV+
Sbjct  439   AFGIPNSLYVASVITGFCFGAQWPLIFTIISEIFGLKYYSTLYSLGGGASPLGAYIFNVR  498

Query  274   IVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVART  110
             I G LYD EA+KQ+AA+ +      +L+C+G QCYK++F+++    L G  VS +LV RT
Sbjct  499   ITGHLYDREAMKQMAAKALNRKEGEDLSCVGVQCYKLAFLIITATTLIGCFVSSILVIRT  558

Query  109   AAYYKTDIYKRFRDE  65
               +YK DIYK+FR++
Sbjct  559   RKFYKGDIYKKFREQ  573



>gb|KDO47545.1| hypothetical protein CISIN_1g040453mg [Citrus sinensis]
Length=547

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/511 (57%), Positives = 365/511 (71%), Gaps = 20/511 (4%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             NM++   Q+  GRWFM+FASFLIMA AGATY+F +YS +IK  LGYDQ+TLNLL  FKD+
Sbjct  24    NMKSLAIQVITGRWFMVFASFLIMAAAGATYMFSLYSGDIKYALGYDQTTLNLLSFFKDL  83

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVG+LSGLI E+TP W VL++G+ +NF GYF+IWL+VTK+IA+P+VW MCLYICVGAN
Sbjct  84    GANVGILSGLINEITPPWVVLVLGAVLNFFGYFMIWLAVTKKIARPQVWHMCLYICVGAN  143

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A YG+D+++LIL IGW
Sbjct  144   SQSFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYRAFYGDDTKSLILFIGW  203

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR +K+   PNE KVF+ +L IS+ LA  LM + I +K   F+   Y 
Sbjct  204   LPAAISFAFLRTIRILKVIRQPNELKVFYNFLYISLALAGFLMMIIIVEKQTDFTRSEYG  263

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLS-----------------SENVEDppp  842
               A IV  LLF P ++ V+EE    K K+  L +                 S N+E    
Sbjct  264   VSAAIVMFLLFFPLVVVVIEEFKLWKSKQMALNNPSVEIITEKPSQEVHSPSSNLEQTVS  323

Query  841   paen---iekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCS  671
              A     +       + + SC+   F  P RGEDY+ILQAL S+DML+LF    CG G +
Sbjct  324   VAAAPEEVSSGSTSSSKEPSCWTTCFSPPDRGEDYTILQALFSLDMLILFFATICGVGGT  383

Query  670   LAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTF  491
             L AIDNLGQIG SLGYP ++I TFVSLVSIWNY GRV SGFVSE  + ++K PR LM+T 
Sbjct  384   LTAIDNLGQIGGSLGYPKKSISTFVSLVSIWNYLGRVVSGFVSEIFLAKYKFPRPLMLTI  443

Query  490   SLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQL  311
              LLL C G LL+AF  PG +Y AS+I+GF +G Q  L+F IISELFGLKYYSTL+N G  
Sbjct  444   ILLLSCIGHLLIAFNVPGGLYVASIIIGFCFGAQWPLVFAIISELFGLKYYSTLYNFGGA  503

Query  310   ASPLGSYILNVKIVGRLYDGEAVKQVAARGV  218
             ASPLGSY+LNV++ G LYD EA +Q+AA G+
Sbjct  504   ASPLGSYLLNVRVAGHLYDKEAKRQMAASGI  534



>ref|XP_009762916.1| PREDICTED: uncharacterized protein LOC104214891 [Nicotiana sylvestris]
Length=564

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/549 (51%), Positives = 385/549 (70%), Gaps = 19/549 (3%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F   L   RWFM F+S +I++ AGAT++FG+YS EIK++LGYDQ+TLN++  FKD+G N+
Sbjct  9     FSLHLLTSRWFMAFSSLMILSMAGATFIFGLYSGEIKSSLGYDQTTLNMISFFKDLGGNL  68

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
              +++GLI E+   W VL +G+ +NF GYF+IWL+VT RI+KP VW+MCLYIC+GANSQ+F
Sbjct  69    AIIAGLIMEIITPWAVLAIGAILNFFGYFMIWLAVTGRISKPHVWRMCLYICIGANSQSF  128

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGA VTCVKNFP+SRG++LGL+KG VGLSGA+ TQ+YLA YG++ ++LILLI W P +
Sbjct  129   ANTGATVTCVKNFPSSRGIVLGLLKGAVGLSGAIMTQMYLAFYGDNGKSLILLISWFPVL  188

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S  F+PSIR MK++   NE K+ +  L  S+ LA  L+ + I Q+ + F    Y     
Sbjct  189   VSFFFLPSIRIMKVTRQENEVKMLYNLLYFSLGLAGFLLIMIIIQRKLTFDRAEYSLSGA  248

Query  958   IVCALLFLPFLIAVMEELATRKEKKK------QLLSSENVEDppppaeniekaeeekAGD  797
             +V  L+F P ++ + EEL   K K++      QL  S  +E+ P  AE            
Sbjct  249   VVLVLVFSPLILVIREELNHWKSKRQVATNFSQLNVSIQMENIPSSAEPESIT-------  301

Query  796   YSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPP  617
              SCF + FK P RGED++ILQAL ++DML+LF+    G G +L AIDNLGQIG+SL Y  
Sbjct  302   -SCFKSAFKSPNRGEDHTILQALFNIDMLILFVVTTFGVGGTLTAIDNLGQIGKSLNYQD  360

Query  616   RTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPG  437
              +I TFVSLVSIWNY GRV SGF SE  ++++  PR LM+TF LLL C G LL+AF    
Sbjct  361   SSISTFVSLVSIWNYLGRVASGFASEIFLRKYNFPRPLMLTFVLLLSCGGHLLIAFGVRN  420

Query  436   SVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLY  257
             S+Y +S+++GF +G Q  L+  IISELFGLKYY+TL+N G +ASP+G YILNV++ G LY
Sbjct  421   SLYASSILIGFCFGAQWPLILAIISELFGLKYYATLYNFGSIASPIGGYILNVRVAGYLY  480

Query  256   DGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
             D EA+KQ+ A+G+      +L C+G QCYK +F+++      G++VSL+LV RT  +Y +
Sbjct  481   DKEALKQLTAKGIARKVGEDLNCVGVQCYKQAFLIITAATFAGSIVSLILVLRTRKFYAS  540

Query  91    DIYKRFRDE  65
             DIYK+F +E
Sbjct  541   DIYKKFEEE  549



>dbj|BAC83908.1| putative nodule-specific protein [Oryza sativa Japonica Group]
 dbj|BAD31842.1| putative nodule-specific protein [Oryza sativa Japonica Group]
 gb|EAZ38960.1| hypothetical protein OsJ_23380 [Oryza sativa Japonica Group]
Length=624

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/554 (53%), Positives = 385/554 (69%), Gaps = 13/554 (2%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q+  GRWF +FAS LI+  +GATY+FG+YS  +KA+LGYDQ TLN +  FKD+GAN+
Sbjct  36    FARQVAVGRWFTVFASLLILTASGATYIFGIYSPALKASLGYDQHTLNTVSFFKDLGANL  95

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GVLSGLI EVTP W VL +G+AMN +GY +++L+V  R A P VW +CLY+ VGANSQ+F
Sbjct  96    GVLSGLINEVTPPWVVLAIGAAMNLSGYLMVYLAVAGRTAAPPVWLVCLYVFVGANSQSF  155

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRG++LG++KGFVGLSGAV+TQLYLA YG+D+++LILLI WLPA 
Sbjct  156   ANTGALVTCVKNFPESRGVVLGILKGFVGLSGAVYTQLYLAFYGDDAKSLILLIAWLPAA  215

Query  1138  LSIVFIPSIR----PMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             +S+VF+ ++R    P +          FF +L ISI LA  L+ + + Q+   FS  AY 
Sbjct  216   VSVVFVHTVRIMPYPRRRGGQETSVDPFFCFLYISIGLAAYLLVMIVVQRQFAFSRTAYS  275

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSE-----NVEDppppaeniekaeeek  806
               A  +  +LFLP  + + +E    +E+ +   ++       V +     E   +     
Sbjct  276   CAAAALLIVLFLPLCVVIKQEFKIHRERLELAAAAPPPHTITVLEMSKETERSPRPSSPA  335

Query  805   AGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
               + S    +F+ P RGEDY+ILQAL+SVDM +LF+   CG G +L AIDN+GQIG+SLG
Sbjct  336   PAETSWVKGMFRPPARGEDYTILQALVSVDMAVLFVATICGVGGTLTAIDNMGQIGQSLG  395

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP R+  TFVSL+SIWNY GRV +GF SE  V+RW++PR L++T  LLL CAG LL+A  
Sbjct  396   YPARSTNTFVSLISIWNYAGRVAAGFASEAFVERWRLPRPLVLTGILLLACAGHLLIALG  455

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
              P ++Y AS+I+GF +G Q  L+F IISE+FGLKYYSTL+N G +ASP+GSYILNV + G
Sbjct  456   VPRALYAASVIIGFCFGAQWPLVFAIISEVFGLKYYSTLYNFGGMASPVGSYILNVLVAG  515

Query  265   RLYDGEAVKQ----VAARGVGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYY  98
             RLYD EA +Q    +AA    +  CLG  C+K SF+++    +FGALVSLVLV RT  +Y
Sbjct  516   RLYDAEAGRQPGAGLAAGAGRDKVCLGVDCFKKSFLIITAATVFGALVSLVLVWRTWRFY  575

Query  97    KTDIYKRFRDEMGA  56
             K DIY RFRD  GA
Sbjct  576   KGDIYARFRDGDGA  589



>ref|XP_004165702.1| PREDICTED: uncharacterized LOC101216551 [Cucumis sativus]
 gb|KGN58997.1| hypothetical protein Csa_3G742600 [Cucumis sativus]
Length=580

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/547 (54%), Positives = 388/547 (71%), Gaps = 7/547 (1%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F +Q   GRWF + AS LIM+ AGATY+F +YS +IK++LGYDQ+TLNLL  FKD+G NV
Sbjct  14    FWYQFLFGRWFSVLASILIMSVAGATYMFALYSSDIKSSLGYDQTTLNLLSFFKDLGGNV  73

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GV+SGL  EV P W VLL+G+ MN  GY +IWL+VTKRI KP++W MCLYI +GANSQ F
Sbjct  74    GVISGLTNEVAPAWVVLLIGAVMNLFGYTMIWLAVTKRIPKPQIWHMCLYITIGANSQTF  133

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ +QLY A YGN+ ++LILLI WLPA 
Sbjct  134   ANTGALVTCVKNFPESRGSVLGLLKGFVGLSGAILSQLYRAFYGNNPESLILLIAWLPAA  193

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S+V +  +R +K    PNE KVF+ +L IS+ LA  LM L I Q  +RF    Y+  A 
Sbjct  194   VSVVLLRFVRIIKDLRQPNELKVFYHFLYISLGLAGTLMVLIILQSLLRFQQIQYVGSAI  253

Query  958   IVCALLFLPFLIAVMEELATRKEK-KKQLLSSENV-EDppppaeniekaeeekAGDYSCF  785
             +V  LL LP  I   EEL+  K K    +L  E+  + PPPP  +            SCF
Sbjct  254   VVIVLLLLPLTIVFREELSVWKSKIASPVLQLESASQQPPPPLTSTVSLAPSSPPSESCF  313

Query  784   GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIG  605
              N+F  P RGEDY+I QA+ S+D+++LF+   CG G +L AIDNLGQIGESLGY   +I 
Sbjct  314   KNMFNPPSRGEDYTIPQAIFSMDLIILFMATICGVGGTLTAIDNLGQIGESLGYQSHSIT  373

Query  604   TFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYG  425
             TF+SLVSIWNY GRV SGFVSE   K++K+PR L +  +L+L C G LL+AF  P S+Y 
Sbjct  374   TFISLVSIWNYLGRVVSGFVSEYFWKKYKVPRPLFLFATLILSCVGHLLIAFGVPNSLYF  433

Query  424   ASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEA  245
             +S+++GF +G Q  L++ IISE+FGLKYY+TL +    ASP+G+YILNV++ G LYD EA
Sbjct  434   SSIVIGFCFGAQWPLIYAIISEIFGLKYYATLSSMSGGASPIGAYILNVRVAGHLYDREA  493

Query  244   VKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYK  80
              +Q+ A    R +GE L+CLG +CY+ +F+++    +FGALVSL+LV RT  +YK DIY+
Sbjct  494   QRQMEATGRRRNIGEDLSCLGVECYRKAFLIITAATVFGALVSLILVVRTWKFYKGDIYR  553

Query  79    RFRDEMG  59
             +FR+  G
Sbjct  554   KFREVEG  560



>ref|XP_006339087.1| PREDICTED: uncharacterized protein LOC102587756 [Solanum tuberosum]
Length=569

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/553 (52%), Positives = 381/553 (69%), Gaps = 9/553 (2%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             MENF   +  GRWFM FAS LI++ AG TY+FG+YS+E+K +LGYDQ+TLNLLG FKD+G
Sbjct  1     MENFGLHMLVGRWFMFFASILILSVAGGTYIFGLYSEEVKISLGYDQTTLNLLGFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
             ANVG++SGLI EVTP W V+L+G+ MNF GYF IWL+VTK+ + PKVW+MC  I +GANS
Sbjct  61    ANVGIISGLINEVTPPWVVILLGAFMNFFGYFSIWLAVTKKFSNPKVWEMCFCIFIGANS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q F NTG +VTCVKNFP SRG+++GL+KGFVGLSGA+ TQLY A YG+D ++LILLI WL
Sbjct  121   QTFVNTGVIVTCVKNFPESRGIVIGLLKGFVGLSGAILTQLYHAFYGSDGKSLILLIAWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             P ++S V +  IR MK++   NE K+F++ L +S  LA  LM + + +  V F    Y  
Sbjct  181   PTVVSCVLLRVIRTMKVNKQENEIKIFYQLLFMSFGLAGFLMAIIVVENRVEFGAIGYWL  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDY--  794
              A  +  LL  P ++ V EEL     KK+ L  +  ++           +      D   
Sbjct  241   TAGTILVLLCAPIVLVVREELNLWDVKKRNLSHTVEIKVDEIERPLQCSSAVVPINDQKE  300

Query  793   --SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
               S F ++FK P+RGEDY+ILQA+LSVDML+LFI    G G  L A+DNLGQIG++LGYP
Sbjct  301   HVSFFQDVFKPPERGEDYTILQAVLSVDMLILFIATIFGAGGLLTAMDNLGQIGKALGYP  360

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
               +I TFVSLVSIW Y GRV SGF SE  ++++K PR LM+T  L   C   +L+A   P
Sbjct  361   KTSITTFVSLVSIWGYLGRVGSGFASEIFLEKYKFPRPLMLTIVLFFSCLVHVLIALGMP  420

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
              ++Y AS+++G  +G    L+F IISE+FGLK+YSTL N G  ASP+G+YI NVK+ G L
Sbjct  421   NTLYVASVLIGLCFGALWPLIFAIISEVFGLKHYSTLLNFGGAASPIGAYIFNVKVAGNL  480

Query  259   YDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA+KQ+AA G+      +LTC G +CYK++F+++A     G +VSLVLV RT  +YK
Sbjct  481   YDREAMKQMAAHGIIRKRGEDLTCTGVECYKLAFLIIAASTFVGFIVSLVLVIRTFKFYK  540

Query  94    TDIYKRFRDEMGA  56
              DIYK+FR++  A
Sbjct  541   GDIYKKFREQAKA  553



>ref|XP_002534014.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28367.1| conserved hypothetical protein [Ricinus communis]
Length=544

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/498 (57%), Positives = 361/498 (72%), Gaps = 8/498 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +M+N   Q+  GRWFM+FASFLIM+ AGATY+F +YS +IK+ LGYDQ+TLNLL  FKD+
Sbjct  16    DMKNLTIQVITGRWFMVFASFLIMSAAGATYMFSLYSGDIKSALGYDQTTLNLLSFFKDL  75

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVGVLSGLI EVTP W VL +G+ +NF GYF+IWL+VT++I    VW MCLYIC+GAN
Sbjct  76    GANVGVLSGLINEVTPPWVVLSMGAVLNFFGYFMIWLAVTRKITGVHVWHMCLYICIGAN  135

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG+LVTCVKNFP SRG +LG++KG+VGLSGA+ TQLY A YG+DS+ LILLIGW
Sbjct  136   SQSFANTGSLVTCVKNFPESRGAVLGILKGYVGLSGAIITQLYHAFYGDDSKALILLIGW  195

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ +IR MK+   PNE KVF+ +L IS+ LA  LM + I +K ++F+   Y 
Sbjct  196   LPAAISFAFLRTIRIMKVIRQPNELKVFYNFLYISLGLAGFLMIIIIVEKQLQFNRAEYG  255

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQL--------LSSENVEDppppaeniekae  815
             A A +V  LLFLP  I  +EE    K KK  L        ++ +  +       +    +
Sbjct  256   ASAAMVIFLLFLPLAIVCIEEYKIWKSKKVALNDPSPLNIITEKPRQQEITVPSSSSIED  315

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
                + + SC+   F+ P RGEDY+ILQAL SVDML+LF+   CG G +L AIDNLGQIG 
Sbjct  316   NSSSSNVSCWKTCFRPPDRGEDYTILQALFSVDMLILFLATICGVGGTLTAIDNLGQIGT  375

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             SLGYP R+I TFVSLVSIWNY GRV +GF SE  + ++K PR LM+T  LL  C G LL+
Sbjct  376   SLGYPKRSISTFVSLVSIWNYLGRVVAGFASEHFLTKYKFPRPLMLTLILLFSCVGHLLI  435

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AF  P  +Y AS+++GF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSY+LNV+
Sbjct  436   AFNVPSGLYVASIVIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGSVASPIGSYLLNVR  495

Query  274   IVGRLYDGEAVKQVAARG  221
             + G LYD EA+KQ+ A+G
Sbjct  496   VAGHLYDKEAMKQLTAQG  513



>ref|XP_004142501.1| PREDICTED: uncharacterized protein LOC101205029 [Cucumis sativus]
Length=582

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/558 (53%), Positives = 392/558 (70%), Gaps = 32/558 (6%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +++N V  +  GRWF++FAS LIMA +G+T++FG+YS +IK+ LGY+Q+TLNLL  FKD+
Sbjct  12    DIKNIVVHVIIGRWFVVFASLLIMAVSGSTFMFGLYSGDIKSVLGYNQTTLNLLSFFKDL  71

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVG+LSGLI EVTP W +LL+G+ MNF GYF+IWLSVT+RI  PKVWQMCLYIC+G +
Sbjct  72    GANVGILSGLINEVTPPWVILLIGALMNFFGYFMIWLSVTRRIFAPKVWQMCLYICMGGS  131

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQNFANTGALVTCV NFP  RG++LGL+KG+VGLSGA+ TQL+ A YG D+++ ILLIGW
Sbjct  132   SQNFANTGALVTCVNNFPERRGIVLGLLKGYVGLSGAIITQLFHAFYGGDTKSFILLIGW  191

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S+ F+ ++R MK+   PNE KVF+ +L IS+ LA  LM + I Q    F+   Y 
Sbjct  192   LPAAISLAFLRTVRIMKVIRQPNELKVFYNFLYISLLLAGFLMLMIIVQSKTEFTQNQYG  251

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKK-----------QLLSSENVEDppppaenie  824
               A  +  LL LP  +   EE    K K K           QL  +E+ E          
Sbjct  252   GSAAAIVVLLLLPLAVVTTEEYNLWKLKTKSPNPSVQIITEQLPKTEHPEQK--------  303

Query  823   kaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
                     + SC+  IF  P+RGED++ILQA+ SVDML+LF+   CG G  L AI+NLGQ
Sbjct  304   --------EPSCWTTIFNPPQRGEDFTILQAVFSVDMLILFLSVICGTGGQLTAIENLGQ  355

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IG SLGYP ++I TFVSLVSIWNY GRV SGF SE ++ ++K PR L+++ +LLL C G 
Sbjct  356   IGMSLGYPKKSISTFVSLVSIWNYLGRVVSGFASEIVLIKYKFPRPLILSLTLLLSCIGH  415

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             L++AF  P  +Y AS+++GF  G Q  +++ IISE+FGLKYYSTL+N G  A P+G YI+
Sbjct  416   LMIAFDVPNGLYVASIVIGFCLGAQWPMIYAIISEIFGLKYYSTLYNFGAAAIPIGLYIM  475

Query  283   NVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
             NVK+ G+LYD EA KQ+ A+G+      +L C G +C+K+SFIV+  V L G  +SL+LV
Sbjct  476   NVKVTGKLYDREAEKQLKAKGIIRKAGEDLKCYGGECFKLSFIVITAVTLVGMFISLILV  535

Query  118   ARTAAYYKTDIYKRFRDE  65
              RT ++Y +DIYK+FR+E
Sbjct  536   IRTRSFYISDIYKKFREE  553



>ref|XP_004147303.1| PREDICTED: uncharacterized protein LOC101202941 [Cucumis sativus]
Length=600

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/553 (52%), Positives = 385/553 (70%), Gaps = 18/553 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             +FV Q+  GRWF +FASFL+MAGAG  YLF  YS++IK TL  DQ+TLN +G +KD+G+N
Sbjct  20    DFVRQMVAGRWFSLFASFLVMAGAGGVYLFAYYSRDIKTTLQCDQTTLNKIGFYKDLGSN  79

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV +GL+AEV PTW +LL+G+A NF GYF IW +VT +I +P V   C YI +GANSQN
Sbjct  80    VGVFAGLLAEVVPTWLLLLIGAAFNFMGYFKIWQAVTGKIVRPTVAFFCFYIMIGANSQN  139

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG LVTCVKNFP  RG+MLGL+KGFVGLSGA+ TQ Y+AIYG+D+++L+LL+ W P+
Sbjct  140   FANTGVLVTCVKNFPERRGVMLGLLKGFVGLSGAIMTQFYIAIYGHDTKSLVLLLAWFPS  199

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++S++F+ +IR +K   HPNE +VF ++L +++ L + L  +   QK + F   A+IA  
Sbjct  200   LISLLFVYTIREIKSVKHPNEFRVFIQFLCVTVLLTILLTVIIFIQKRIHFDQSAHIAIV  259

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSS-----------ENVEDppppaeniekae  815
               + ALLF+P LIA+ EE+      K+  +S+            N     P         
Sbjct  260   AAILALLFVPLLIAIREEVVLWNLNKRTRISNPFTRIKIETSQTNSPVDSPSTSQHPHPH  319

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
               +    SCF  IF KP+RGEDY++LQA+ S+DML++      G G SL AIDNLGQIGE
Sbjct  320   PPQTQPTSCFSKIFNKPERGEDYTVLQAIFSIDMLIICFTMMIGVGASLTAIDNLGQIGE  379

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             +  Y   TI   VSL+SI+N+ GR+FSGFVSE ++++++ PR LM+T  LL+ C G LLV
Sbjct  380   AQAYSSETINLLVSLMSIFNFAGRIFSGFVSEILLEKFQFPRPLMLTLILLISCLGHLLV  439

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AFPF  S+Y AS+I+GFS G Q+ L F +ISE+FGLK+YSTLFN GQL+ P+GSYILNV 
Sbjct  440   AFPFDDSLYVASIIIGFSMGSQVPLHFAMISEIFGLKHYSTLFNFGQLSCPIGSYILNVL  499

Query  274   IVGRLYDGEAVKQVAARGVGE--LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
             + G+LYD     +VA  G     L C+GT CY+ SF++LAG+    A+VSL+LV RT  +
Sbjct  500   VTGKLYD-----EVARIGSNPNMLHCVGTHCYERSFLILAGLTFMVAMVSLILVKRTREF  554

Query  100   YKTDIYKRFRDEM  62
             Y+ DIYK+FR++M
Sbjct  555   YRGDIYKKFREDM  567



>ref|XP_004161323.1| PREDICTED: uncharacterized protein LOC101224401 [Cucumis sativus]
Length=600

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/553 (52%), Positives = 385/553 (70%), Gaps = 18/553 (3%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             +FV Q+  GRWF +FASFL+MAGAG  YLF  YS++IK TL  DQ+TLN +G +KD+G+N
Sbjct  20    DFVRQMVAGRWFSLFASFLVMAGAGGVYLFAYYSRDIKTTLQCDQTTLNKIGFYKDLGSN  79

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VGV +GL+AEV PTW +LL+G+A NF GYF IW +VT +I +P V   C YI +GANSQN
Sbjct  80    VGVFAGLLAEVVPTWLLLLIGAAFNFMGYFKIWQAVTGKIVRPTVAFFCFYIMIGANSQN  139

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG LVTCVKNFP  RG+MLGL+KGFVGLSGA+ TQ Y+AIYG+D+++L+LL+ W P+
Sbjct  140   FANTGVLVTCVKNFPERRGVMLGLLKGFVGLSGAIMTQFYIAIYGHDTKSLVLLLAWFPS  199

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++S++F+ +IR +K   HPNE +VF ++L +++ L + L  +   QK + F   A+IA  
Sbjct  200   LISLLFVYTIREIKSVKHPNEFRVFIQFLCVTVLLTILLTVIIFIQKRIHFDQSAHIAIV  259

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLSS-----------ENVEDppppaeniekae  815
               + ALLF+P LIA+ EE+      K+  +S+            N     P         
Sbjct  260   AAILALLFVPLLIAIREEVVLWNLNKRTRISNPFTRIKIETSQTNSPLDSPSTSQHPHPH  319

Query  814   eekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGE  635
               +    SCF  IF KP+RGEDY++LQA+ S+DML++      G G SL AIDNLGQIGE
Sbjct  320   PPQTQPTSCFSKIFNKPERGEDYTVLQAIFSIDMLIICFTMMIGVGASLTAIDNLGQIGE  379

Query  634   SLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLV  455
             +  Y   TI   VSL+SI+N+ GR+FSGFVSE ++++++ PR LM+T  LL+ C G LLV
Sbjct  380   AQAYSSETINLLVSLMSIFNFAGRIFSGFVSEILLEKFQFPRPLMLTLILLISCLGHLLV  439

Query  454   AFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVK  275
             AFPF  S+Y AS+I+GFS G Q+ L F +ISE+FGLK+YSTLFN GQL+ P+GSYILNV 
Sbjct  440   AFPFDDSLYVASIIIGFSMGSQVPLHFAMISEIFGLKHYSTLFNFGQLSCPIGSYILNVL  499

Query  274   IVGRLYDGEAVKQVAARGVGE--LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
             + G+LYD     +VA  G     L C+GT CY+ SF++LAG+    A+VSL+LV RT  +
Sbjct  500   VTGKLYD-----EVARIGSNPNMLHCVGTHCYERSFLILAGLTFMVAMVSLILVKRTREF  554

Query  100   YKTDIYKRFRDEM  62
             Y+ DIYK+FR++M
Sbjct  555   YRGDIYKKFREDM  567



>ref|XP_004494077.1| PREDICTED: uncharacterized protein LOC101506073 [Cicer arietinum]
Length=588

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/561 (52%), Positives = 382/561 (68%), Gaps = 25/561 (4%)
 Frame = -1

Query  1684  ENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGA  1505
             ++F + L  GRWFM+FAS LIM+ AGATY+FG+YS +IK +L YDQ+TLNLL  FKD+GA
Sbjct  5     KSFTYHLLTGRWFMLFASSLIMSVAGATYMFGLYSNQIKTSLSYDQTTLNLLSFFKDLGA  64

Query  1504  NVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQ  1325
             NVGV+SGLI E+TP W VL  G  MNF GYF+IWLSVTK+I KPKVW MCLYIC+GANSQ
Sbjct  65    NVGVISGLINEITPPWVVLSTGVIMNFFGYFMIWLSVTKKIHKPKVWLMCLYICIGANSQ  124

Query  1324  NFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIY-----GNDSQNLILL  1160
              F+NTGALVTCVKNFP SRG +LG +KG+VGLSGA+ TQ+Y ++Y      N+ Q LILL
Sbjct  125   TFSNTGALVTCVKNFPNSRGSVLGFLKGYVGLSGAIITQIYHSLYYDYDDENNVQALILL  184

Query  1159  IGWLPAILSIVFIPSIRPMKISSH--PNETKVFFEYLGISITLALCLMGLTIAQKYVRFS  986
             I WLPA +S +F+P+IR +K++      E+  F+  L IS+ LAL LM L I Q    FS
Sbjct  185   IAWLPAAVSFLFLPTIRILKLNQQQFSKESNFFYNLLYISLGLALFLMVLIIVQNKFSFS  244

Query  985   HFAYIACATIVCALLFLPFLIAVMEELATRKEKK-KQL----------LSSENVEDpppp  839
                Y+     V   L LP ++   EE    K+    QL          +SS   E     
Sbjct  245   RIEYVVGGVGVIFFLLLPLVVVFREEFKLLKDNSISQLKVINELPHGNMSSHGQE--MDV  302

Query  838   aeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAI  659
              +     +       SCF  +FK P RGEDY+ILQAL S+DML+LFI    G G +L AI
Sbjct  303   PKITSTIKTNLENKNSCFKTLFKSPNRGEDYTILQALFSIDMLILFIATTFGVGGTLTAI  362

Query  658   DNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLL  479
             DNLGQIG SLGYP ++  TF+SLVSIWNY GRV +G+ SE ++ ++KIPR  ++T  +LL
Sbjct  363   DNLGQIGHSLGYPSKSTTTFMSLVSIWNYLGRVAAGYSSEILLNKYKIPRPYLLTTVMLL  422

Query  478   PCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPL  299
              C G +L+A   P S+Y +S+I+GF +G Q  L+F IISE+FGLKYYSTL+N G +ASP+
Sbjct  423   SCVGHILIALGIPNSLYFSSVIIGFCFGAQWPLMFAIISEIFGLKYYSTLYNFGAVASPV  482

Query  298   GSYILNVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALV  134
             GSYILNV++ G LYD EA+KQ+   G+      +LTC+G +CYK++FI++    L G  V
Sbjct  483   GSYILNVRLTGYLYDKEALKQLENNGLKRQEGKDLTCVGVECYKMAFIIITTSTLIGCFV  542

Query  133   SLVLVARTAAYYKTDIYKRFR  71
             S +LV RT  +YK D+++++R
Sbjct  543   SFILVLRTKEFYKGDVFRKYR  563



>ref|XP_004164226.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101231913 
[Cucumis sativus]
Length=582

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/558 (53%), Positives = 390/558 (70%), Gaps = 32/558 (6%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             +++N V  +  GRWF++FAS LIMA +G+T++FG+YS +IK+ LGY+Q+TLNLL  FKD+
Sbjct  12    DIKNIVVHVIIGRWFVVFASLLIMAVSGSTFMFGLYSGDIKSVLGYNQTTLNLLSFFKDL  71

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVG+LSGLI EVTP W +LL+G+ MNF GYF+IWLSVT+RI  PKVWQMCLYIC+G +
Sbjct  72    GANVGILSGLINEVTPPWVILLIGALMNFFGYFMIWLSVTRRIFAPKVWQMCLYICMGGS  131

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQNFANTGALVTCV NFP  RG++LGL+KG+VGLSGA+ TQL+ A Y  D+++ ILLIGW
Sbjct  132   SQNFANTGALVTCVNNFPERRGIVLGLLKGYVGLSGAIITQLFHAFYAGDTKSFILLIGW  191

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ ++R MK+   PNE KVF+ +L IS+ LA  LM + I Q    F+   Y 
Sbjct  192   LPAAISFAFLRTVRIMKVIRQPNELKVFYNFLYISLLLAGFLMLMIIVQSKTEFTQNQYG  251

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKK-----------QLLSSENVEDppppaenie  824
               A  +  LL LP  +   EE    K K K           QL  +E+ E          
Sbjct  252   GSAAAIVVLLLLPLAVVTTEEYNLWKLKTKSPNPSVQIITEQLPKTEHPEQK--------  303

Query  823   kaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
                     + SC+  IF  P+RGED++ILQA+ SVDML+LF+   CG G  L AI+NLGQ
Sbjct  304   --------EPSCWTTIFNPPQRGEDFTILQAVFSVDMLILFLSVICGTGGQLTAIENLGQ  355

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IG SLGYP  +I TFVSLVSIW+Y GRV SGF SE ++ ++K PR L+++ +LLL C G 
Sbjct  356   IGMSLGYPKXSISTFVSLVSIWSYLGRVVSGFASEIVLIKYKFPRPLILSLTLLLSCIGH  415

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             L++AF  P  +Y AS+++GF  G Q  +++ IISE+FGLKYYSTL+N G  A P+G YI+
Sbjct  416   LMIAFDVPNGLYVASIVIGFCLGAQWPMIYAIISEIFGLKYYSTLYNFGAAAIPIGLYII  475

Query  283   NVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
             NVK+ G+LYD EA KQ+ A+G+      EL C G +C+K+SFI++  V L G  +SL+LV
Sbjct  476   NVKVTGKLYDREAEKQLKAKGIIRKAGEELKCFGRECFKLSFIIITAVTLVGMFISLILV  535

Query  118   ARTAAYYKTDIYKRFRDE  65
              RT ++YK+DIYK+FR+E
Sbjct  536   IRTRSFYKSDIYKKFREE  553



>ref|XP_004137979.1| PREDICTED: uncharacterized protein LOC101216551 [Cucumis sativus]
Length=609

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/547 (54%), Positives = 388/547 (71%), Gaps = 7/547 (1%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F +Q   GRWF + AS LIM+ AGATY+F +YS +IK++LGYDQ+TLNLL  FKD+G NV
Sbjct  14    FWYQFLFGRWFSVLASILIMSVAGATYMFALYSSDIKSSLGYDQTTLNLLSFFKDLGGNV  73

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             GV+SGL  EV P W VLL+G+ MN  GY +IWL+VTKRI KP++W MCLYI +GANSQ F
Sbjct  74    GVISGLTNEVAPAWVVLLIGAVMNLFGYTMIWLAVTKRIPKPQIWHMCLYITIGANSQTF  133

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ +QLY A YGN+ ++LILLI WLPA 
Sbjct  134   ANTGALVTCVKNFPESRGSVLGLLKGFVGLSGAILSQLYRAFYGNNPESLILLIAWLPAA  193

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S+V +  +R +K    PNE KVF+ +L IS+ LA  LM L I Q  +RF    Y+  A 
Sbjct  194   VSVVLLRFVRIIKDLRQPNELKVFYHFLYISLGLAGTLMVLIILQSLLRFQQIQYVGSAI  253

Query  958   IVCALLFLPFLIAVMEELATRKEK-KKQLLSSENV-EDppppaeniekaeeekAGDYSCF  785
             +V  LL LP  I   EEL+  K K    +L  E+  + PPPP  +            SCF
Sbjct  254   VVIVLLLLPLTIVFREELSVWKSKIASPVLQLESASQQPPPPLTSTVSLAPSSPPSESCF  313

Query  784   GNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIG  605
              N+F  P RGEDY+I QA+ S+D+++LF+   CG G +L AIDNLGQIGESLGY   +I 
Sbjct  314   KNMFNPPSRGEDYTIPQAIFSMDLIILFMATICGVGGTLTAIDNLGQIGESLGYQSHSIT  373

Query  604   TFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYG  425
             TF+SLVSIWNY GRV SGFVSE   K++K+PR L +  +L+L C G LL+AF  P S+Y 
Sbjct  374   TFISLVSIWNYLGRVVSGFVSEYFWKKYKVPRPLFLFATLILSCVGHLLIAFGVPNSLYF  433

Query  424   ASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEA  245
             +S+++GF +G Q  L++ IISE+FGLKYY+TL +    ASP+G+YILNV++ G LYD EA
Sbjct  434   SSIVIGFCFGAQWPLIYAIISEIFGLKYYATLSSMSGGASPIGAYILNVRVAGHLYDREA  493

Query  244   VKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYK  80
              +Q+ A    R +GE L+CLG +CY+ +F+++    +FGALVSL+LV RT  +YK DIY+
Sbjct  494   QRQMEATGRRRNIGEDLSCLGVECYRKAFLIITAATVFGALVSLILVVRTWKFYKGDIYR  553

Query  79    RFRDEMG  59
             +FR+  G
Sbjct  554   KFREVEG  560



>ref|XP_002267992.3| PREDICTED: uncharacterized protein LOC100256418 isoform X2 [Vitis 
vinifera]
Length=581

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/572 (52%), Positives = 388/572 (68%), Gaps = 28/572 (5%)
 Frame = -1

Query  1699  EEQNMENFVFQLFRGRWFMMFASFLIM-AGAGATYLFGVYSKEIKATLGYDQSTLNLLGS  1523
                +M +  FQ+  GRW M+FA+ L+M A A AT +FG+YS  IKA LGYDQ+TLNLLG 
Sbjct  10    NRADMRSLAFQILTGRWLMVFAAILVMFAAASATSMFGLYSSAIKAALGYDQTTLNLLGF  69

Query  1522  FKDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYIC  1343
             FKD+GANVGVLSGLI EVTP W VL +G+AMN  GY +IWL+V+ ++AKP+VW MCLYIC
Sbjct  70    FKDLGANVGVLSGLINEVTPPWVVLSMGAAMNLFGYLMIWLAVSGKMAKPRVWHMCLYIC  129

Query  1342  VGANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVG-LSGAVFTQLYLAIYGNDSQNLI  1166
             +G+NSQ FA TGALVTCVKNFP +RG +LG++KG+ G L+GA+ TQ+Y A Y ND+  LI
Sbjct  130   IGSNSQAFATTGALVTCVKNFPENRGAVLGILKGYQGALTGAIITQMYHAFYRNDATALI  189

Query  1165  LLIGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFS  986
             L + WLPA +S+ F+P+IR MK+    NE KVF+ +L IS+ LA  LM + I +K ++F+
Sbjct  190   LFVAWLPAAVSLGFLPAIRIMKVDQRRNELKVFYNFLYISLGLAGFLMIIIIVEKQMKFT  249

Query  985   HFAYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSE---------NVEDp-----  848
                Y     +V  LLFLP  + + EE    K KK+ L             N ED      
Sbjct  250   QSEYGGSVAVVLFLLFLPLALVIKEEFDLWKTKKQALNEPSQLNIITERLNAEDKDASSP  309

Query  847   -------pppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNF  689
                       A +            SC  N+F+ PKRGEDY+ILQAL S DM LLF+   
Sbjct  310   PPSPPPMSAAATSSRNQLPSPQKQNSCLSNVFRPPKRGEDYTILQALFSFDMFLLFLATI  369

Query  688   CGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPR  509
             CG G +L AIDNLGQIG SLGYP  ++ TF+SL+SIWNY GRV +GFVSE  + ++K PR
Sbjct  370   CGVGGTLTAIDNLGQIGTSLGYPTDSLSTFISLMSIWNYLGRVVAGFVSEIFLTKYKFPR  429

Query  508   TLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTL  329
              LM+    LL CAG LL+AF    ++Y A +I+GF +G Q  LLF IISE+FGLKYYSTL
Sbjct  430   PLMLALVQLLACAGHLLMAFNVHNALYLAWMIIGFCFGAQWPLLFAIISEIFGLKYYSTL  489

Query  328   FNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVL  164
             +N G +ASP+GSY+LNV++ G LYD EA +Q+AA G       ELTC+G +C+K++F+++
Sbjct  490   YNFGSVASPIGSYLLNVRVAGYLYDKEAERQMAATGSHRKRGEELTCIGAECFKLAFLII  549

Query  163   AGVNLFGALVSLVLVARTAAYYKTDIYKRFRD  68
             AGV  FG L S +LV RT  +Y++DIYK+FR+
Sbjct  550   AGVTFFGTLASFILVLRTRKFYRSDIYKKFRE  581



>ref|XP_010658347.1| PREDICTED: uncharacterized protein LOC100256418 isoform X1 [Vitis 
vinifera]
Length=587

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/572 (52%), Positives = 388/572 (68%), Gaps = 28/572 (5%)
 Frame = -1

Query  1699  EEQNMENFVFQLFRGRWFMMFASFLIM-AGAGATYLFGVYSKEIKATLGYDQSTLNLLGS  1523
                +M +  FQ+  GRW M+FA+ L+M A A AT +FG+YS  IKA LGYDQ+TLNLLG 
Sbjct  16    NRADMRSLAFQILTGRWLMVFAAILVMFAAASATSMFGLYSSAIKAALGYDQTTLNLLGF  75

Query  1522  FKDVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYIC  1343
             FKD+GANVGVLSGLI EVTP W VL +G+AMN  GY +IWL+V+ ++AKP+VW MCLYIC
Sbjct  76    FKDLGANVGVLSGLINEVTPPWVVLSMGAAMNLFGYLMIWLAVSGKMAKPRVWHMCLYIC  135

Query  1342  VGANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVG-LSGAVFTQLYLAIYGNDSQNLI  1166
             +G+NSQ FA TGALVTCVKNFP +RG +LG++KG+ G L+GA+ TQ+Y A Y ND+  LI
Sbjct  136   IGSNSQAFATTGALVTCVKNFPENRGAVLGILKGYQGALTGAIITQMYHAFYRNDATALI  195

Query  1165  LLIGWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFS  986
             L + WLPA +S+ F+P+IR MK+    NE KVF+ +L IS+ LA  LM + I +K ++F+
Sbjct  196   LFVAWLPAAVSLGFLPAIRIMKVDQRRNELKVFYNFLYISLGLAGFLMIIIIVEKQMKFT  255

Query  985   HFAYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSE---------NVEDp-----  848
                Y     +V  LLFLP  + + EE    K KK+ L             N ED      
Sbjct  256   QSEYGGSVAVVLFLLFLPLALVIKEEFDLWKTKKQALNEPSQLNIITERLNAEDKDASSP  315

Query  847   -------pppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNF  689
                       A +            SC  N+F+ PKRGEDY+ILQAL S DM LLF+   
Sbjct  316   PPSPPPMSAAATSSRNQLPSPQKQNSCLSNVFRPPKRGEDYTILQALFSFDMFLLFLATI  375

Query  688   CGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPR  509
             CG G +L AIDNLGQIG SLGYP  ++ TF+SL+SIWNY GRV +GFVSE  + ++K PR
Sbjct  376   CGVGGTLTAIDNLGQIGTSLGYPTDSLSTFISLMSIWNYLGRVVAGFVSEIFLTKYKFPR  435

Query  508   TLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTL  329
              LM+    LL CAG LL+AF    ++Y A +I+GF +G Q  LLF IISE+FGLKYYSTL
Sbjct  436   PLMLALVQLLACAGHLLMAFNVHNALYLAWMIIGFCFGAQWPLLFAIISEIFGLKYYSTL  495

Query  328   FNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAARGVG-----ELTCLGTQCYKVSFIVL  164
             +N G +ASP+GSY+LNV++ G LYD EA +Q+AA G       ELTC+G +C+K++F+++
Sbjct  496   YNFGSVASPIGSYLLNVRVAGYLYDKEAERQMAATGSHRKRGEELTCIGAECFKLAFLII  555

Query  163   AGVNLFGALVSLVLVARTAAYYKTDIYKRFRD  68
             AGV  FG L S +LV RT  +Y++DIYK+FR+
Sbjct  556   AGVTFFGTLASFILVLRTRKFYRSDIYKKFRE  587



>gb|AAO37543.1| putative nodule-specific protein [Oryza sativa Japonica Group]
 gb|ABF99380.1| nodulin family protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY92205.1| hypothetical protein OsI_13924 [Oryza sativa Indica Group]
Length=628

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/576 (51%), Positives = 392/576 (68%), Gaps = 32/576 (6%)
 Frame = -1

Query  1696  EQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFK  1517
             E     F  Q+  GRWFM+FA  LI++ +GATY+FG+YSK +K++LGYDQ TLN L  FK
Sbjct  21    EVATARFARQVVLGRWFMVFACLLILSASGATYIFGIYSKVLKSSLGYDQRTLNTLSFFK  80

Query  1516  DVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVG  1337
             D+GANVGV+SGLI EVTP W VL +G+AMN AGY +I+L++  R A+P VW MC+YICVG
Sbjct  81    DLGANVGVISGLINEVTPPWVVLAMGAAMNLAGYLMIYLAIDGRTARPPVWLMCIYICVG  140

Query  1336  ANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLI  1157
             ANSQ+FANTGALVTCVKNFP SRG++LGL+KGFVGLSGA+FTQLY+AIYG+D+++L+LLI
Sbjct  141   ANSQSFANTGALVTCVKNFPESRGIVLGLLKGFVGLSGAIFTQLYVAIYGDDAKSLVLLI  200

Query  1156  GWLPAILSIVFIPSIRPMKI-------------SSHPNETKVFFEYLGISITLALCLMGL  1016
              WLPA +SI+F+ ++R M               +S       FF +L ISI LA  L+ +
Sbjct  201   AWLPAAISILFVHTVRIMPYLPSRRRRADGELEASAATSNDAFFCFLYISIALATYLLTM  260

Query  1015  TIAQKYVRFSHFAYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV--EDppp  842
              + Q    FSH AY+  AT +  +LFLP ++ + +E   +KE    L     V  E P  
Sbjct  261   IVVQNQTNFSHTAYVVSATALLLVLFLPLVVVIKQEYQIKKELDDSLREPPTVTIEKPAA  320

Query  841   paeniekaeeekAGDY----------------SCFGNIFKKPKRGEDYSILQALLSVDML  710
              A  +     +   +                 SC  ++F  P +GEDY+ILQAL+SVDML
Sbjct  321   AAMQMSAITTKPKTETPSSSSPAPAPPSCCLGSCLKHMFNPPAQGEDYTILQALVSVDML  380

Query  709   LLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIV  530
             +LF+   CG G +L AIDN+GQIG+SLGYP ++I TF+SL+SIWNY GRV SGF SE  +
Sbjct  381   VLFLATICGVGGTLTAIDNMGQIGQSLGYPAKSIKTFISLISIWNYAGRVTSGFASEMFL  440

Query  529   KRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFG  350
              R++ PR LM+T  LLL C G LL+AF    S+Y AS+I+GF +G Q  LLF IISE+FG
Sbjct  441   ARYRFPRPLMLTAVLLLACVGHLLIAFGVAQSLYAASVIIGFCFGAQWPLLFAIISEVFG  500

Query  349   LKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAAR-GVGELTCLGTQCYKVSF  173
             LKYYSTL+N G +ASP+G+Y+LNV++ G LYD EA +Q       G+ TCLG QC++ +F
Sbjct  501   LKYYSTLYNFGSVASPVGAYVLNVRVAGYLYDVEAARQHGGSLAGGDKTCLGVQCFRKAF  560

Query  172   IVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDE  65
             +++    + GAL+SLVLV RT  +YK DIY +FR+ 
Sbjct  561   LIITAATVAGALISLVLVWRTRNFYKGDIYAKFREN  596



>ref|XP_002464077.1| hypothetical protein SORBIDRAFT_01g011890 [Sorghum bicolor]
 gb|EER91075.1| hypothetical protein SORBIDRAFT_01g011890 [Sorghum bicolor]
Length=647

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/581 (52%), Positives = 387/581 (67%), Gaps = 43/581 (7%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + RGRWFM FAS LIMA AG TY+FG+YSK IK +LGYDQ TLN L  FKDVGAN
Sbjct  23    RFALHVMRGRWFMFFASILIMAAAGGTYIFGIYSKAIKTSLGYDQQTLNTLSFFKDVGAN  82

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+L GLI EVTP W VLL G+ MN  GY +I+L++T R A+P VW MC+YI VGANSQ+
Sbjct  83    VGILPGLINEVTPPWVVLLCGAGMNLVGYLMIYLAITGRTAQPPVWLMCVYIAVGANSQS  142

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYG--NDSQNLILLIGWL  1148
             FANTG+LVT VKNFP  RG++LGL+KGFVGLSGA+FTQLY AIYG  ND  +L+LL+ WL
Sbjct  143   FANTGSLVTAVKNFPEDRGVVLGLLKGFVGLSGAIFTQLYRAIYGTDNDGADLVLLMAWL  202

Query  1147  PAILSIVFIPSIRPMKISSHPN-----------ETKVFFEYLGISITLALCLMGLTIAQ-  1004
             PA +S+VFIP+IR M                  E K FF +L  SI LA  L+ + + + 
Sbjct  203   PAAISLVFIPTIRIMPRQRDAAAAAARGERRQRERKAFFLFLYASIVLAAYLLVMNVVEL  262

Query  1003  KYVRFSHFAYIACATIVCALLFLPFLIAVMEELAT-------------------RKEKKK  881
             + + F   AY   A ++  L+F P +I V +EL T                     + +K
Sbjct  263   EVIHFPKTAYYVTAVVLLLLIFFPIVIVVKQELKTYLAAAPATATTSSATIVTITVDDEK  322

Query  880   QLLSSENV---------EDppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQAL  728
                S+ NV               A    +AE+      SCF ++F+ P RG+DY+ILQAL
Sbjct  323   TRASNNNVAPESSSPDHRRGHHQAAVAAEAEDISRRSPSCFQDVFRPPARGQDYTILQAL  382

Query  727   LSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGF  548
              SVDML+LF+   CG G +L A+DNLGQIG+SLGYP RTI TFVSLVSIWNY GRV SGF
Sbjct  383   FSVDMLVLFVATICGVGGTLTAVDNLGQIGQSLGYPQRTISTFVSLVSIWNYAGRVVSGF  442

Query  547   VSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFII  368
              SE ++ R+K+PR L +T  LLL C G  L+AF     +Y AS+ILGF +G Q  LLF I
Sbjct  443   ASEYVLARYKVPRPLALTVVLLLACVGHALIAFGVGNGLYAASVILGFCFGAQWPLLFAI  502

Query  367   ISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAA-RGVGELTCLGTQ  191
             ISE+FGLKYYSTL+N G +ASP+GSYILNV++ GR+YD EA++Q    RG  +LTC+G +
Sbjct  503   ISEVFGLKYYSTLYNFGSVASPVGSYILNVRVAGRMYDQEALRQAGGRRGSKDLTCIGVR  562

Query  190   CYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRD  68
             C++ SF+++ GV L GALVSLVL  RT  +Y+ D+Y +FR+
Sbjct  563   CFRESFLIITGVTLLGALVSLVLAWRTRNFYRGDLYGQFRE  603



>ref|XP_004164227.1| PREDICTED: uncharacterized protein LOC101232127 [Cucumis sativus]
Length=582

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/547 (54%), Positives = 391/547 (71%), Gaps = 10/547 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             ++++ V  +  GRWF++FAS LIMA  G T+LFG+YS +IK+ LGY+Q+TLNLL  FKD+
Sbjct  12    DIKSIVVYVITGRWFVVFASLLIMAVFGTTFLFGLYSSDIKSALGYNQTTLNLLSFFKDL  71

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GANVG+L GLI E  P W VLL+G+ MNF GYF+IWL VT+RI+ PKVWQMC YIC+G N
Sbjct  72    GANVGILPGLINEFMPPWVVLLIGAVMNFFGYFMIWLGVTRRISTPKVWQMCFYICMGGN  131

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG++VTCV NFP  RG++LGL+KG++GLSGA+ TQL+ A YG D+++LIL IGW
Sbjct  132   SQSFANTGSMVTCVNNFPERRGVVLGLLKGYIGLSGAIITQLFHAFYGGDTKSLILFIGW  191

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LPA +S  F+ ++R MK+   PNE KVF+ +L IS+ LA  LM + I Q    F+   Y 
Sbjct  192   LPAAISFAFLRTVRIMKVIRQPNELKVFYNFLYISLLLAGFLMLMIIVQSKTEFTQNQYG  251

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYS  791
               A  +  LL LP  +  +EE   +K K K   SS  +       E + K E  K  + S
Sbjct  252   GSAAAIVVLLLLPLAVVTIEECNLQKLKTKSPNSSVQI-----ITEKLPKTEHSKQKEPS  306

Query  790   CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRT  611
             C+  IF  P+RGED+++LQA+ SVDML+LFI   CG G +L A+DNLGQIG SLGYP R+
Sbjct  307   CWTTIFNPPQRGEDFTVLQAVFSVDMLILFISVICGAGGTLTAVDNLGQIGMSLGYPKRS  366

Query  610   IGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSV  431
             I TFVSLVSIWNY GRV SGFVSE ++ ++K PR LM++ +LLL C G L++AF  P  +
Sbjct  367   ISTFVSLVSIWNYLGRVVSGFVSEIVLIKYKFPRPLMLSLNLLLSCVGYLIIAFDVPNGL  426

Query  430   YGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDG  251
             Y AS+++GF  G Q  L++ IISE+FGLKYYSTL+N G +A P+G YI+NVK+ G  YD 
Sbjct  427   YVASIVIGFCVGAQWPLIYAIISEIFGLKYYSTLYNFGIVAMPIGLYIMNVKVAGNFYDR  486

Query  250   EAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDI  86
             EA KQ+ A+G+      +L C G +C+K+SFIV+  V L G  +SL+LV RT ++YK+DI
Sbjct  487   EAEKQLKAKGIIRKAGEDLKCYGGECFKLSFIVITAVTLMGMFISLILVIRTRSFYKSDI  546

Query  85    YKRFRDE  65
             YK+FRDE
Sbjct  547   YKKFRDE  553



>ref|XP_003541428.1| PREDICTED: uncharacterized protein LOC100814000 [Glycine max]
Length=588

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/548 (54%), Positives = 391/548 (71%), Gaps = 12/548 (2%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F+  +  GRWFM+FAS LIMA +GATY+FG+YS E+K +LGYDQSTLNL+  FKD+GAN+
Sbjct  6     FIHHVITGRWFMIFASCLIMAVSGATYMFGLYSNEVKTSLGYDQSTLNLISFFKDLGANL  65

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             G+ SGLI E++P W +L +G+ MNF GYF+IWLSVT RIAKP+VWQMCLY  +GANSQ+F
Sbjct  66    GIFSGLINEISPPWVILAMGATMNFIGYFMIWLSVTSRIAKPQVWQMCLYFYIGANSQSF  125

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             ANTGALV CVK+FP SRG ++GL+KG+VGLSGA+FTQ Y A YG+DS+ LI LIGWLPA 
Sbjct  126   ANTGALVNCVKSFPRSRGSVIGLLKGYVGLSGAIFTQFYHAFYGDDSKALIFLIGWLPAA  185

Query  1138  LSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACAT  959
             +S VF+P++R + I+  P E KVF++ L IS+ +A  LM L I Q  + F+   YI    
Sbjct  186   ISFVFLPTVRVLSITPQPKEIKVFYQLLYISLGVAGFLMVLIIIQNKLSFTRVEYIGDGM  245

Query  958   IVCALLFLPFLIAVMEELATRKEKKKQLLSSEN------VE-DppppaeniekaeeekAG  800
             +V  LL LP  +   EE    K + +    + +      VE   P  A  +     E+  
Sbjct  246   VVLLLLLLPLGVVFSEEFKLWKNQNQNQTFTNHAGAASVVELPQPEEAHAVAPTHSERKN  305

Query  799   DYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYP  620
             + SC  N+FK PKRGEDY+I QAL S+DML+LFI    G G +L A+DNLGQIG SLGYP
Sbjct  306   NNSCLKNVFKPPKRGEDYTIFQALFSIDMLILFIATVFGVGGTLTALDNLGQIGNSLGYP  365

Query  619   PRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFP  440
              +++ TFVSLVSIWNY GR  SGF SE ++ ++K PR L++T  +LL C G +L+AF  P
Sbjct  366   RKSLTTFVSLVSIWNYLGRASSGFASEYLLTKYKFPRPLLLTLVMLLSCVGHILIAFGIP  425

Query  439   GSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRL  260
              S+Y +S+I+GF +G    L+F IISE+FGLKYYSTL+N G +ASP+GSYILNVK+ G L
Sbjct  426   NSLYFSSVIIGFCFGAIWPLMFAIISEIFGLKYYSTLYNFGAVASPVGSYILNVKVTGYL  485

Query  259   YDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYK  95
             YD EA+KQ+  +G+      +LTC+G QCY+++F+++    L G +VS +LV RT  +YK
Sbjct  486   YDKEALKQLGVKGLIRQKGKDLTCVGVQCYRMAFLIITASTLVGCVVSFILVLRTRNFYK  545

Query  94    TDIYKRFR  71
              DIY++FR
Sbjct  546   GDIYEKFR  553



>ref|XP_004986309.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Setaria 
italica]
Length=629

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/558 (53%), Positives = 386/558 (69%), Gaps = 21/558 (4%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + RGRWFM FAS LIMA AG TY+FG+YSK +K++LGYDQ TLN L  FKDVGAN
Sbjct  23    RFALHVMRGRWFMFFASILIMAAAGGTYIFGIYSKAVKSSLGYDQQTLNTLSFFKDVGAN  82

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+L GLI EVTP W VL  G+ MN AGY +I+L+V+ R A+P VW MC+YI VGANSQ+
Sbjct  83    VGILPGLINEVTPPWVVLACGAGMNLAGYLMIYLAVSGRTARPPVWLMCVYIAVGANSQS  142

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYG--NDSQNLILLIGWL  1148
             FANTGALVT VKNFP  RG++LGL+KGFVGLSGA+FTQLY AIYG  ND   L+LL+ WL
Sbjct  143   FANTGALVTAVKNFPEDRGVVLGLLKGFVGLSGAIFTQLYRAIYGTDNDGAELVLLMAWL  202

Query  1147  PAILSIVFIPSIRPMKI-----SSHPNETKVFFEYLGISITLALCLMGLTIAQ-KYVRFS  986
             PA +S++FIP+IR M            E + FF +L  SI LA+ L+ + + + + +RF 
Sbjct  203   PAAISLLFIPTIRIMPRRDAAGQERGRERRAFFLFLYASIVLAIYLLIMNVVELEVIRFP  262

Query  985   HFAYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENV----EDppppaenieka  818
               AY   A ++  L+F P +I V +EL T  +     +++ ++     D      +  + 
Sbjct  263   KPAYYVTAAVLLLLIFFPIVIVVKQELKTYLQPPAPAITTSSIVTITVDHEKTHPSSAQV  322

Query  817   eeekAGDY--------SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAA  662
                 A D         SCF ++F+ P RG+DY+ILQAL SVDML+LF+   CG G +L A
Sbjct  323   TPPPASDQAAAAGTSPSCFQDVFRPPARGQDYTILQALFSVDMLVLFVATICGIGGTLTA  382

Query  661   IDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLL  482
             IDN+GQIG+SLGY  R+I TFVSLVSIWNY GRV SGF SE ++ R+K+PR L +T  LL
Sbjct  383   IDNMGQIGQSLGYAQRSITTFVSLVSIWNYAGRVVSGFASEHLLARYKVPRPLALTVVLL  442

Query  481   LPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASP  302
             L C G  L+A      +Y AS+ILGF +G Q  LLF IISE+FGLKYYSTL+N G +ASP
Sbjct  443   LACVGHGLIASGVSNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGAVASP  502

Query  301   LGSYILNVKIVGRLYDGEAVKQVAARGVGELTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             +GSYILNV++ GR+YD EA++Q   +G  +LTC+G +C++ SF+++ GV L GALVSLVL
Sbjct  503   VGSYILNVRVAGRMYDREALRQGGRKGR-DLTCIGVRCFRESFLIITGVTLLGALVSLVL  561

Query  121   VARTAAYYKTDIYKRFRD  68
               RT  +Y+ D+Y RFR+
Sbjct  562   AWRTREFYRGDLYGRFRE  579



>ref|XP_003540770.1| PREDICTED: uncharacterized protein LOC100799928 [Glycine max]
Length=589

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/546 (54%), Positives = 384/546 (70%), Gaps = 7/546 (1%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+ Q+ +GRWFM+ ASF I+AGAG  Y+FG YS+ IK + GYDQSTLN LG  KD+G N
Sbjct  20    KFIAQVIQGRWFMLCASFFILAGAGGVYVFGSYSEAIKRSQGYDQSTLNFLGFCKDLGGN  79

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             +G   G I EVTP W VLL+GS +NF GYF+IWL VT RI+KP VWQ+ LYI +GA+SQN
Sbjct  80    LGAPIGFIGEVTPPWLVLLIGSVLNFGGYFMIWLVVTGRISKPHVWQVGLYIAIGASSQN  139

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG + TCVKNFP SRG +LG++KG++GLSGA+ TQLYLA YGNDS++LILLI WLPA
Sbjct  140   FANTGVITTCVKNFPESRGTILGILKGYLGLSGAIMTQLYLAFYGNDSESLILLIAWLPA  199

Query  1141  ILSIVFIPSIRPMKI-SSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
              +SI F   IR MKI +  PNE K    +L   I LAL +M + IAQ+ + FS  AY   
Sbjct  200   AISIAFASVIRIMKIGTRQPNEQKTMNNFLFAPIVLALFIMAMIIAQRQIPFSKAAYAGS  259

Query  964   ATIVCALL-FLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSC  788
             AT+VC LL  LP  IAV +E +     +K L  + N      P     K + +   + SC
Sbjct  260   ATVVCVLLIILPLFIAVRKEFSPWNIMEKVLAHAANEVIIEKPQIVEAKEKAKDDPNGSC  319

Query  787   FGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTI  608
             F NIF KP+RGED++ILQALLS+DMLLL I +F G G ++  +DNLGQIGESLGY   T+
Sbjct  320   FSNIFNKPERGEDHTILQALLSIDMLLLLISSFAGYGTNVTVVDNLGQIGESLGYTGNTV  379

Query  607   GTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVY  428
              +FVSLVSIWN+FGRV SGFVSE ++ ++K+PR +++ FS  + C G LL+ FP PGSVY
Sbjct  380   RSFVSLVSIWNFFGRVLSGFVSEILLHKYKVPRPMLLVFSHFVTCIGHLLIVFPAPGSVY  439

Query  427   GASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGE  248
              AS+I+GFS+GV   + + ++SELFGLK+++TL NC  +  PL SY+LNV++ G  YD E
Sbjct  440   FASVIIGFSFGVVWPIFYALVSELFGLKHFATLQNCVLMVIPLASYVLNVRVTGFFYDRE  499

Query  247   AVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIY  83
             A  Q+   G       ELTC+GT+CYK+  I++A V+ F  + SL+ V RT  +YK+DIY
Sbjct  500   AKNQLIKSGKEWVKGTELTCIGTECYKLPLIIMACVSFFAGVTSLIFVMRTREFYKSDIY  559

Query  82    KRFRDE  65
             K+F ++
Sbjct  560   KKFTEK  565



>ref|XP_004250040.1| PREDICTED: uncharacterized protein LOC101265191 [Solanum lycopersicum]
Length=604

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/583 (51%), Positives = 404/583 (69%), Gaps = 45/583 (8%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
             N   ++   RWFM+F + LI++ AGATY+FG+YS +IK++LGYDQ+TLNLL  FKD+G+N
Sbjct  4     NLSIRVLVSRWFMVFGTMLILSAAGATYMFGLYSGDIKSSLGYDQTTLNLLSFFKDLGSN  63

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+LSGLI E++P W VL +G+ +NF GYF+IW++VTK+++  KVW MCLYIC+G NSQ+
Sbjct  64    VGILSGLINEISPPWVVLSIGAILNFFGYFMIWMAVTKKMS-TKVWLMCLYICIGGNSQS  122

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTGALVTCVKNFP SRG +LGL+KGFVGLSGA+ TQ+Y AIYGNDS++LILLIGWLPA
Sbjct  123   FANTGALVTCVKNFPESRGAVLGLLKGFVGLSGAIITQIYHAIYGNDSKSLILLIGWLPA  182

Query  1141  ILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             ++S+VF+ +IR +++    +E KVF+ +L +S+ LA  LM + I QK   F+   Y   A
Sbjct  183   VISLVFLRTIRIIQVVRITHELKVFYRFLYMSLVLAGYLMVIIILQKKFNFTQMEYGLSA  242

Query  961   TIVCALLFLPFLIAVMEELATRKEKKKQLLS-------SEN-------------------  860
              +V  LLFLP  + + EE+ +   KK  L S       +EN                   
Sbjct  243   ALVVFLLFLPLGLVIKEEINSWNAKKLALDSISKVKVVTENPKSEGPQLPLPAPAPAAAS  302

Query  859   ------VEDppppaeniekaeeekAGDY-------SCFGNIFKKPKRGEDYSILQALLSV  719
                    E          K++     D+       SC+  +F+ P RGED++ILQAL S+
Sbjct  303   VITDTTFEKQDLDGIVEGKSKSSFDVDFKDSEVSISCWKTVFQPPARGEDFTILQALFSL  362

Query  718   DMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSE  539
             DML+LF+   CG G +L AIDNLGQIG SLGYP ++I TFVSLVSIWNY GRV +GF+SE
Sbjct  363   DMLILFVATICGVGGTLTAIDNLGQIGTSLGYPKKSISTFVSLVSIWNYLGRVVAGFLSE  422

Query  538   TIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISE  359
               +K++K PR L +T +L++ C G +L+AF  P  +Y AS+I+GF +G Q  LLF IISE
Sbjct  423   YFLKKYKFPRPLALTITLIVSCIGHILIAFNVPSGLYIASIIIGFCFGAQWPLLFAIISE  482

Query  358   LFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVA----ARGVGE-LTCLGT  194
             LFGLKYYSTL+N G +ASP+GSY+LNV++ G LYD EA KQ+      R  GE L C G 
Sbjct  483   LFGLKYYSTLYNFGSVASPIGSYVLNVRVAGYLYDKEAEKQLKILRRIRREGEDLNCDGV  542

Query  193   QCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDE  65
             +C+K++FI++  V +FGA +S++LV RT  +YK+DIYK+FR+E
Sbjct  543   ECFKLAFIIITLVTIFGAFISIILVIRTRKFYKSDIYKKFREE  585



>dbj|BAO45884.1| nitrate and chloride transporter [Acacia mangium]
Length=630

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/557 (57%), Positives = 401/557 (72%), Gaps = 15/557 (3%)
 Frame = -1

Query  1693  QNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKD  1514
              +++    Q+   RWF++FASFL+MA AGATY+FG+YS +IK+ +GYDQ+TLNLL  FKD
Sbjct  17    SDVKGLAIQVILSRWFVVFASFLVMAAAGATYMFGLYSPDIKSAMGYDQTTLNLLSFFKD  76

Query  1513  VGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGA  1334
             VGANVGVLSGLI E+TP W VL++G+ +NF GYF+IWL+VT++I KPKV  M LYI +GA
Sbjct  77    VGANVGVLSGLINELTPPWVVLMIGAVLNFFGYFMIWLAVTQKIPKPKVGLMYLYILIGA  136

Query  1333  NSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIG  1154
             NSQ FANTG+LVTCVKNFP SRG++LG++KG+VGLSGA+ TQLY A Y +D+  LILLIG
Sbjct  137   NSQTFANTGSLVTCVKNFPESRGVVLGILKGYVGLSGAIITQLYYAFYYDDTXALILLIG  196

Query  1153  WLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             WLPA +S  F+ +IR +    +PNE KVF+ +L IS+ LA  LM + I QK   F    Y
Sbjct  197   WLPAAISFAFLRTIRYITPVRNPNELKVFYNFLYISLGLAGFLMLIIIVQKQTHFHQSQY  256

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSEN---VEDppppaen-------ie  824
                A +V  LLFLP  I  +EE    + K+  L    N   V++PPPP          I 
Sbjct  257   GLSAAVVLFLLFLPLTIVYIEEFKVWQTKRLALQDPVNNIVVDNPPPPPATINNAFGDIT  316

Query  823   kaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQ  644
             KA  E   +   + NIF  P RGEDY+ILQAL S+DM++LF+ + CG G +L AIDNLGQ
Sbjct  317   KARREGEPETKWWQNIFSPPARGEDYTILQALFSIDMIVLFMASICGIGGTLTAIDNLGQ  376

Query  643   IGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGD  464
             IG SLGYP  +I TFVSLVSIWNY GRVF+GFVSE  + ++K PRTLM+T +LL+ CAG 
Sbjct  377   IGASLGYPKTSISTFVSLVSIWNYLGRVFAGFVSEYYLAKYKFPRTLMLTLTLLVSCAGH  436

Query  463   LLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYIL  284
             LL+AF     +Y AS+I+GF +G Q  L+F IISELFGLKYYSTL+N G  ASP+G YIL
Sbjct  437   LLIAFNVKDGLYVASVIIGFCFGAQWPLIFAIISELFGLKYYSTLYNFGGSASPIGLYIL  496

Query  283   NVKIVGRLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLV  119
             NV+I G LYD EA KQ+AA G+      EL C+GT+C+++SFI++     FGAL+SL+LV
Sbjct  497   NVRITGHLYDKEAKKQLAALGLRRDPGKELNCVGTECFRLSFIIITAATFFGALISLILV  556

Query  118   ARTAAYYKTDIYKRFRD  68
             ART  +YK DIYKRFR+
Sbjct  557   ARTRKFYKGDIYKRFRE  573



>ref|XP_008464809.1| PREDICTED: uncharacterized protein LOC103502605 [Cucumis melo]
Length=596

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/550 (53%), Positives = 393/550 (71%), Gaps = 10/550 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
              + +F+ Q+  GRWF +FASFL+M GAG  YLF  YS++IK TL  DQ+TLN +G +KD+
Sbjct  17    ELADFIGQVVVGRWFSLFASFLVMTGAGGVYLFAYYSRDIKTTLQCDQTTLNRIGFYKDL  76

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             G+NVGV++GL+AEV PTW VLL+G+A NF GYF IW +VT +I +P V   C YI +GAN
Sbjct  77    GSNVGVIAGLLAEVAPTWLVLLIGAAFNFIGYFKIWQAVTGKIVRPTVAFFCFYIMIGAN  136

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQNFANTG LVTCVKNFP  RG+MLGL+KGFVGLSGA+ TQLY+AIYG+D+++LILLI W
Sbjct  137   SQNFANTGVLVTCVKNFPERRGVMLGLLKGFVGLSGAIMTQLYIAIYGHDTKSLILLIAW  196

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
              P+I+S++F+ +IR +K   HPNE +VF ++L +++ LAL L  L   QK V F   A+I
Sbjct  197   FPSIVSLIFVYTIREIKFVKHPNEFRVFVQFLCVTVLLALLLTALIFVQKRVHFDQSAHI  256

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSS-------ENVEDppppaeniekaee  812
             A    + ALLF+P LIA+ EE+      K+  +S+       E+ +  PP          
Sbjct  257   AIVAAILALLFVPLLIAIREEVVIWNLNKRTPISNPFIRIGIESSQPKPPIHSPSTPQHP  316

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
              +    SCF NIF KP+RGEDY++LQA+ S+DML++      G G SL AIDNLGQIGE+
Sbjct  317   LQTQPTSCFSNIFNKPERGEDYTVLQAIFSIDMLIICSTMLIGVGASLTAIDNLGQIGEA  376

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
              GYP  TI  FVSL+SI N+ GR+FSGFVSE ++++++ PR LM+T  LL+   G LLVA
Sbjct  377   QGYPSETINLFVSLISISNFTGRIFSGFVSEILLEKFQFPRPLMLTLILLISSLGHLLVA  436

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             FPF  S+Y AS+I+GFS G Q+ L F +ISE+FGLK+YSTLFN GQL+ P+GSYILNV +
Sbjct  437   FPFDDSLYLASIIIGFSMGSQVPLHFAMISEIFGLKHYSTLFNFGQLSCPIGSYILNVMV  496

Query  271   VGRLYDGEAVKQVAARGVGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKT  92
              G+LYD   V ++ +    +  C+GT CY+ SF++LAG+    A++SL+LV RT  +Y+ 
Sbjct  497   TGKLYD--EVARIGSNP-NKSHCVGTHCYEQSFLILAGLTFIVAMISLILVQRTREFYRG  553

Query  91    DIYKRFRDEM  62
             DIYK+F+++M
Sbjct  554   DIYKKFKEDM  563



>gb|KHN21070.1| hypothetical protein glysoja_006549 [Glycine soja]
Length=589

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/546 (54%), Positives = 384/546 (70%), Gaps = 7/546 (1%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F+ Q+ +GRWFM+ ASF I+AGAG  Y+FG YS+ IK + GYDQSTLN LG  KD+G N
Sbjct  20    KFIAQVIQGRWFMLCASFFILAGAGGVYVFGSYSEAIKRSQGYDQSTLNFLGFCKDLGGN  79

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             +G   G I EVTP W VLL+GS +NF GYF+IWL VT RI+KP VWQ+ LYI +GA+SQN
Sbjct  80    LGAPIGFIGEVTPPWVVLLIGSVLNFGGYFMIWLVVTGRISKPHVWQVGLYIAIGASSQN  139

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPA  1142
             FANTG + TCVKNFP SRG +LG++KG++GLSGA+ TQLYLA YGNDS++LILLI WLPA
Sbjct  140   FANTGVITTCVKNFPESRGTILGILKGYLGLSGAIMTQLYLAFYGNDSESLILLIAWLPA  199

Query  1141  ILSIVFIPSIRPMKI-SSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIAC  965
              +SI F   IR MKI +  PNE K    +L   I LAL +M + IAQ+ + FS  AY   
Sbjct  200   AISIAFASVIRIMKIGTRQPNEQKTMNNFLFAPIVLALFIMAMIIAQRQIPFSKAAYAGS  259

Query  964   ATIVCALL-FLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYSC  788
             AT+VC LL  LP  IAV +E +     +K L  + N      P     K + +   + SC
Sbjct  260   ATVVCVLLIILPLFIAVRKEFSPWNIMEKVLAHAANEVIIEKPQIVEAKEKAKDDPNGSC  319

Query  787   FGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRTI  608
             F NIF KP+RGED++ILQALLS+DMLLL I +F G G ++  +DNLGQIGESLGY   T+
Sbjct  320   FSNIFNKPERGEDHTILQALLSIDMLLLLISSFAGYGTNVTVVDNLGQIGESLGYTGNTV  379

Query  607   GTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSVY  428
              +FVSLVSIWN+FGRV SGFVSE ++ ++K+PR +++ FS  + C G LL+ FP PGSVY
Sbjct  380   RSFVSLVSIWNFFGRVLSGFVSEILLHKYKVPRPMLLVFSHFVTCIGHLLIVFPAPGSVY  439

Query  427   GASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDGE  248
              AS+I+GFS+GV   + + ++SELFGLK+++TL NC  +  PL SY+LNV++ G  YD E
Sbjct  440   FASVIIGFSFGVVWPIFYALVSELFGLKHFATLQNCVLMVIPLASYVLNVRVTGFFYDRE  499

Query  247   AVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIY  83
             A  Q+   G       ELTC+GT+CYK+  I++A V+ F  + SL+ V RT  +YK+DIY
Sbjct  500   AKNQLIKSGKEWVKGTELTCIGTECYKLPLIMMACVSFFAGVTSLIFVMRTREFYKSDIY  559

Query  82    KRFRDE  65
             K+F ++
Sbjct  560   KKFTEK  565



>ref|XP_006651692.1| PREDICTED: uncharacterized protein LOC102719372 [Oryza brachyantha]
Length=631

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/584 (52%), Positives = 390/584 (67%), Gaps = 54/584 (9%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + RGRWFM FAS LIMA AG TY+FG+YSK IK +LGYDQ TLN L  FKDVGAN
Sbjct  19    RFGAHVVRGRWFMFFASILIMAAAGGTYIFGIYSKAIKTSLGYDQQTLNTLSFFKDVGAN  78

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+L GLI EVTP W VL  G+ MN AGY +I+L+V+   A+P VW MC+YI VGANSQ+
Sbjct  79    VGILPGLINEVTPPWVVLACGAGMNLAGYLMIYLAVSGHTARPPVWLMCVYIAVGANSQS  138

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYG--NDSQNLILLIGWL  1148
             FANTGALVT VKNFP  RG++LGL+KGFVGLSGA+FTQLY AIYG  +D  +L+LL+ WL
Sbjct  139   FANTGALVTAVKNFPEDRGVVLGLLKGFVGLSGAIFTQLYRAIYGVEDDGASLVLLMAWL  198

Query  1147  PAILSIVFIPSIRPMKISSHPN---------ETKVFFEYLGISITLALCLMGLTIAQ-KY  998
             PA +S++FIP+IR M  S             E K FF +L  SI LA+ L+ + + + + 
Sbjct  199   PAAISLLFIPTIRIMPRSPAAAGAGPAARRRERKAFFYFLYASIVLAVYLLVMNVVELEV  258

Query  997   VRFSHFAYIACATIVCALLFLPFLIAVMEEL------------ATR--------KEKKKQ  878
             + F   AY   AT++  L+F P +I V +EL            ATR         EKK++
Sbjct  259   LGFPKPAYYVTATVLLLLIFFPLVIVVKQELSTYLNPSPATTPATRSAVTVITVDEKKEK  318

Query  877   LLSSENVEDppppaeniekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFI  698
               ++E+  D                   +C  ++F+ P RGEDY+ILQAL SVDML+LF+
Sbjct  319   PQAAEDDGDDKAAPSP------------TCLQDVFRPPARGEDYTILQALFSVDMLVLFV  366

Query  697   CNFCGQGCSLAAIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWK  518
                CG G +L AIDN+GQIG+SLGYP R+I TFVSLVSIWNY GRV +GF SE ++ R+K
Sbjct  367   ATICGVGGTLTAIDNMGQIGQSLGYPQRSISTFVSLVSIWNYAGRVVAGFASEYVLARYK  426

Query  517   IPRTLMMTFSLLLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYY  338
             +PR L +T  L+L CAG LL+A      +Y AS+ILGF +G Q  LLF IISE+FGLKYY
Sbjct  427   VPRPLALTVVLVLACAGHLLIALGVSNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYY  486

Query  337   STLFNCGQLASPLGSYILNVKIVGRLYDGEAVKQVAA----------RGVGELTCLGTQC  188
             ST++N G +ASP+ SYILNV++ GRLYD EA +Q+AA          +G  +LTC+G  C
Sbjct  487   STIYNFGAVASPVSSYILNVRVTGRLYDREAERQLAAGAVAVAGAARKGGRDLTCVGVGC  546

Query  187   YKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDIYKRFRDEMGA  56
             ++VSF+++A V L GA VSL+L  RT  +Y+ D+Y +FR+   A
Sbjct  547   FRVSFLIIAAVTLLGAAVSLLLAWRTRNFYRGDLYGKFREVAAA  590



>ref|XP_003559578.1| PREDICTED: uncharacterized protein LOC100828435 [Brachypodium 
distachyon]
Length=609

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/547 (55%), Positives = 383/547 (70%), Gaps = 10/547 (2%)
 Frame = -1

Query  1681  NFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGAN  1502
              F   + RGRWFM FAS LIMA AG TY+FG+YSK IK +LGYDQ TLN L  FKDVGAN
Sbjct  14    QFASHVLRGRWFMFFASILIMAAAGGTYIFGIYSKAIKTSLGYDQQTLNTLSFFKDVGAN  73

Query  1501  VGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQN  1322
             VG+L GLI EVTP W VL  G+ MN AGY +I+LSV+ R A+P VW MC+YI VGANSQ+
Sbjct  74    VGILPGLINEVTPPWVVLACGAGMNLAGYLMIYLSVSGRTARPPVWLMCVYIAVGANSQS  133

Query  1321  FANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYG--NDSQNLILLIGWL  1148
             FANTGALVT VKNFP  RG++LGL+KGFVGLSGA+FTQLY AIYG  +D  +L+LL+ WL
Sbjct  134   FANTGALVTAVKNFPEDRGVVLGLLKGFVGLSGAIFTQLYRAIYGAGDDGASLVLLMAWL  193

Query  1147  PAILSIVFIPSIRPMKIS------SHPNETKVFFEYLGISITLALCLMGLTIAQKYVR-F  989
             PA +S+VFIP+IR M  +      +   E K FF +L  SI LA+ L+ + + +  V  F
Sbjct  194   PAAISLVFIPTIRIMPRALGRSQEASGRERKAFFYFLYASIVLAVYLLVMNVVELEVPGF  253

Query  988   SHFAYIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeee  809
                A+   AT++  L+F P +I V +EL T  +       +  +     P   +E A  E
Sbjct  254   PKPAFYVTATVLLLLIFFPLVIVVQQELKTYLQPPTPTPVNLTITVDNDPKTPVEPAPAE  313

Query  808   kAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESL  629
              +   SCF ++ + P RGEDY+ILQAL SVDML+LF+   CG G +L AIDN+GQIG+SL
Sbjct  314   SSTSASCFQDVLRPPARGEDYTILQALFSVDMLVLFVATICGVGGTLTAIDNMGQIGQSL  373

Query  628   GYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAF  449
             GYP R+I TFVSLVSIWNY GRV +GF SE ++ R+K+PR L +T  LLL C G LL+A 
Sbjct  374   GYPQRSISTFVSLVSIWNYAGRVVAGFASEYVLARYKMPRPLALTLVLLLACVGHLLIAV  433

Query  448   PFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIV  269
                  +Y AS+ILGF +G Q  LLF IISE+FGLKYYSTL+N G +ASP+GSYILNV+I 
Sbjct  434   GVSNGLYAASVILGFCFGAQWPLLFAIISEVFGLKYYSTLYNFGAVASPVGSYILNVRIA  493

Query  268   GRLYDGEAVKQVAARGVGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
             GR YD EA++Q   RG  +LTC+G +C++ SF ++A V L GA VSL+L  RT  +Y+ D
Sbjct  494   GRFYDREALRQGGKRG-KDLTCIGVRCFRESFYIIAAVTLLGAGVSLLLAWRTREFYRGD  552

Query  88    IYKRFRD  68
             +Y +F++
Sbjct  553   LYGKFKE  559



>ref|XP_010933270.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Elaeis 
guineensis]
Length=626

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/556 (56%), Positives = 393/556 (71%), Gaps = 28/556 (5%)
 Frame = -1

Query  1669  QLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANVGVL  1490
             Q+ RGRWFM FASFLIMA +GATY+F +YS +IK +LGYDQSTLN L  FKD+GANVG+L
Sbjct  24    QVIRGRWFMFFASFLIMAASGATYIFSIYSNDIKTSLGYDQSTLNTLSFFKDLGANVGIL  83

Query  1489  SGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNFANT  1310
             SGLI EVTP W VL +GS MN  GY +I+ ++T RIA+P VWQMCLYIC+GANSQ+FANT
Sbjct  84    SGLINEVTPPWVVLAIGSVMNLFGYLMIYFAITGRIARPAVWQMCLYICIGANSQSFANT  143

Query  1309  GALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAILSI  1130
             G+LVTCVKNFP SRG++LGL+KGFVGLSGA+FTQLY AIYG+DS++L+LLI WLPA +SI
Sbjct  144   GSLVTCVKNFPESRGVVLGLLKGFVGLSGAIFTQLYSAIYGDDSKSLVLLIAWLPAAISI  203

Query  1129  VFIPSIRPMKISSHPNET-KVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACATIV  953
             VF+ +IR MK +S P +T K F+ +L ISI LA  LM + + ++   FS       A IV
Sbjct  204   VFVRTIRLMKAASVPYKTSKPFYCFLYISIALATFLMVIIVVEQRFSFSRPESSIAAVIV  263

Query  952   CALLFLPFLIAVMEELATRKEKKKQLLS----SENVEDppppaeniekaeeekAGDY---  794
               LLFLP  + V EEL   +++K+ L +    S +VE P        + ++  A      
Sbjct  264   LLLLFLPLAVVVKEELKIFRQEKEALENPAPLSVSVEKPAITEPPPPEPKQVPATTPSTI  323

Query  793   -----------------SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLA  665
                              S   +  K P+RGEDYSILQAL S+DM +LF    CG G +L 
Sbjct  324   PTTTTTTTTSTKKKSAISGVIDTLKPPERGEDYSILQALFSIDMFVLFFATICGVGGTLT  383

Query  664   AIDNLGQIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSL  485
             AIDN+GQIG+SL YP R+I TFVSL+SIWNY GRV +GFVSE I+ ++K PR L +TF L
Sbjct  384   AIDNMGQIGQSLEYPDRSIKTFVSLISIWNYAGRVTAGFVSEIILAKYKFPRPLALTFVL  443

Query  484   LLPCAGDLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLAS  305
             LL C G LL+AF    S+Y AS+I+GF +G Q  LLF IISE+FGLKYYSTL+N G +AS
Sbjct  444   LLSCVGHLLIAFGVSQSLYVASVIIGFCFGAQWPLLFAIISEIFGLKYYSTLYNFGGVAS  503

Query  304   PLGSYILNVKIVGRLYDGEAVKQVA--ARGVG-ELTCLGTQCYKVSFIVLAGVNLFGALV  134
             P+GSYILNV++ G LYD EA KQ +   R  G +LTC+G +C+K+SFI++    +FGA V
Sbjct  504   PIGSYILNVRVAGHLYDREANKQNSGLTRTDGKDLTCVGVECFKLSFIIITAATVFGAFV  563

Query  133   SLVLVARTAAYYKTDI  86
             SL+LV RT  +YK DI
Sbjct  564   SLILVWRTRNFYKGDI  579



>ref|XP_006339088.1| PREDICTED: uncharacterized protein LOC102588077 [Solanum tuberosum]
Length=567

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/546 (55%), Positives = 384/546 (70%), Gaps = 7/546 (1%)
 Frame = -1

Query  1687  MENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVG  1508
             M  F       +WFM+FAS LIM+ AGATYLF +YS EIK++LGYDQ+TLNLL  FKD+G
Sbjct  1     MLGFSIHFLMSKWFMVFASLLIMSMAGATYLFSLYSNEIKSSLGYDQTTLNLLSFFKDLG  60

Query  1507  ANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANS  1328
              NVG++SG I EVTP W VLL+G+ MNF GYF++WL++  RIAKP VWQMC YIC+GA+S
Sbjct  61    GNVGMISGFINEVTPPWVVLLMGAIMNFFGYFMVWLAIIGRIAKPPVWQMCFYICIGASS  120

Query  1327  QNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWL  1148
             Q FANTG LVTCVKNFP SRG++LGL+KGFVGLSGA+ TQLY A YGND ++L+LLIGWL
Sbjct  121   QTFANTGVLVTCVKNFPESRGIVLGLLKGFVGLSGAIITQLYHAFYGNDVKSLVLLIGWL  180

Query  1147  PAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIA  968
             P ++S  F+ ++R MK+    NE ++F++ L IS+ LA  +M + + Q  V F+   Y  
Sbjct  181   PCVVSCFFLRTVRVMKVDKQANELRIFYKLLFISLGLAGFIMVVIVVQNKVSFTKLEYAG  240

Query  967   CATIVCALLFLPFLIAVMEELATRKEKKKQLLSSE--NVEDppppaeniekaeeekAGDY  794
              A +V  LLF P ++   EE    K K++ L  +   NV    P +   E  E       
Sbjct  241   SAVVVLILLFAPLILVFKEEFTLWKCKQQVLHDTPQVNVVTETPCSVQPEPEEISDLKPN  300

Query  793   SCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPR  614
               F N+FK P RGEDY+ILQA+ S+D L+LF     G G +L AIDNLGQIG++LGYP  
Sbjct  301   IWFSNVFKPPPRGEDYTILQAIFSLDFLILFTTTTFGVGGTLTAIDNLGQIGKALGYPST  360

Query  613   TIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGS  434
             +I TFVSL+SIWNY GRV SGFVSE  + ++K PR LM+T  LLL C G LL+AF  P S
Sbjct  361   SITTFVSLLSIWNYLGRVVSGFVSEIFLSKYKFPRPLMLTLVLLLSCTGHLLIAFGVPNS  420

Query  433   VYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYD  254
             +Y AS+I GF +G Q  L+F I+SELFGLKYYSTL+N    ASP G+YILNV++ G+LYD
Sbjct  421   LYIASIITGFCFGAQWPLIFAIVSELFGLKYYSTLYNLSGGASPFGAYILNVRVAGQLYD  480

Query  253   GEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTD  89
               A++Q+ A    RGVGE LTC+G +CYKV+F+V+ G  L   +VSLVL  RT  +YK D
Sbjct  481   KMALRQMTAKGFTRGVGEDLTCIGVECYKVAFLVITGATLISCVVSLVLAIRTREFYKGD  540

Query  88    IYKRFR  71
             IYK+FR
Sbjct  541   IYKKFR  546



>ref|XP_008241388.1| PREDICTED: uncharacterized protein LOC103339814 [Prunus mume]
Length=631

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/562 (55%), Positives = 401/562 (71%), Gaps = 15/562 (3%)
 Frame = -1

Query  1696  EQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFK  1517
              + M +F  Q+  GRWFM+FAS LI++ AGATY+FG+YS +IK +LGYDQ+T+NLL  FK
Sbjct  15    HKEMRSFGLQVVHGRWFMVFASMLILSVAGATYMFGLYSNDIKTSLGYDQTTVNLLSFFK  74

Query  1516  DVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVG  1337
             D+G NVGV++GLI E T  W VLL+G+ MNF GYF+IWL+VT R +KP+VWQMCLYIC+G
Sbjct  75    DLGGNVGVIAGLINEFTAPWVVLLIGAVMNFFGYFMIWLAVTGRTSKPRVWQMCLYICIG  134

Query  1336  ANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLI  1157
             ANSQ F+NTGA+V+CVKNFP SRG +LGL+KG VGLSGA+ TQL+ A YG DS+ LILLI
Sbjct  135   ANSQTFSNTGAVVSCVKNFPESRGSVLGLLKGLVGLSGAIITQLFSAFYGGDSKALILLI  194

Query  1156  GWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFA  977
             GWLPA +S++F+P IR +K+   PNE +VF+  L +++ LA  LM L I Q  +RFS   
Sbjct  195   GWLPAAVSMLFLPIIRLLKVVRQPNELRVFYNLLYVTLGLAGFLMFLIIIQHNLRFSRIG  254

Query  976   YIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE----------Dppppaeni  827
             YI  A++V  LLFLP  + + EE    K K + L     ++              P+   
Sbjct  255   YIGSASVVLVLLFLPLAVVIFEEFKIWKSKMRALNDQSQLKVVAENPAPPVQVALPSVAA  314

Query  826   ekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLG  647
               + + +    SC  N+F  P RGEDY+ILQA+ S+DML+LFI   CG G +L AIDNLG
Sbjct  315   PPSPQTQQKPNSCLQNVFSPPDRGEDYTILQAVFSIDMLILFIAITCGAGGTLTAIDNLG  374

Query  646   QIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAG  467
             QIG SLGYP  +I TF+SLVSIWNY GRV SGF SE ++K++K PR L++T  LLL C G
Sbjct  375   QIGGSLGYPTHSISTFISLVSIWNYLGRVTSGFSSEVLLKKYKFPRPLLLTLVLLLSCVG  434

Query  466   DLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI  287
              LL+AF  P S+Y AS+I+GF +G Q  L+F IISE+FGLKYY+TL N G  ASP+G+Y+
Sbjct  435   HLLIAFGVPNSLYVASVIIGFCFGAQWPLIFAIISEIFGLKYYATLINVGGAASPIGAYL  494

Query  286   LNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             LNVK+ G LYD EA+KQ+ A    R  GE LTC G  CY+++FI++A V LFG+LVS +L
Sbjct  495   LNVKVAGNLYDAEALKQLKALGKVRKAGEDLTCEGVHCYRLAFIIMAAVALFGSLVSFIL  554

Query  121   VARTAAYYKTDIYKRFRDEMGA  56
             V RT  +Y++DIYK+FR+   A
Sbjct  555   VIRTRKFYRSDIYKKFREAAEA  576



>gb|EPS59101.1| hypothetical protein M569_15705, partial [Genlisea aurea]
Length=549

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/549 (53%), Positives = 379/549 (69%), Gaps = 14/549 (3%)
 Frame = -1

Query  1678  FVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDVGANV  1499
             F  Q    RWFM+FA  LIM+ +GA+Y+FG+YS ++K  LGYDQ+TLNL+G FKD+G N+
Sbjct  1     FARQFLTSRWFMVFACLLIMSMSGASYIFGIYSNDMKRALGYDQTTLNLVGFFKDLGGNI  60

Query  1498  GVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGANSQNF  1319
             G++SG+I EVTP W VL +G +MNFAGYFLIWL+VT R AKP +WQMC+YIC+GANSQ F
Sbjct  61    GIVSGVINEVTPPWVVLAIGMSMNFAGYFLIWLAVTGRTAKPPLWQMCMYICIGANSQTF  120

Query  1318  ANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGWLPAI  1139
             +NTGALVTCVKNFP SRG+++GL+KGF GLSGA+ TQ++   +GNDS  LILLI WLPA 
Sbjct  121   SNTGALVTCVKNFPESRGIVIGLLKGFTGLSGAIITQIFRGFFGNDSSALILLIAWLPAA  180

Query  1138  LSIVFIPSIRPMKISSHPN-ETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYIACA  962
             +S +F+ ++R MK +     E +VF+  L +S+ LA  LM L I Q  + F+   YIA A
Sbjct  181   VSFLFLRTVRLMKPAKQEEKEIRVFYNLLFVSLGLAGFLMLLIILQNGLVFTRSEYIASA  240

Query  961   TIVCALLFLPFLIAVMEELATRKEKK--KQLLSSENVE------Dppppaeniekaeeek  806
              +V  +LF P  +   EEL  RK KK  ++  S+  ++      +   P           
Sbjct  241   AVVMFMLFTPLAVVFAEELKRRKLKKLAERTDSTSPLKIALDDGNSSSPPAPATPPPPRN  300

Query  805   AGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLG  626
                   + +IF  P+RGEDY+I QAL S+DML LF+    G G +L AIDNLGQIG+SLG
Sbjct  301   RDHVPWWRDIFNPPERGEDYTIPQALFSIDMLFLFVTITMGAGGTLTAIDNLGQIGKSLG  360

Query  625   YPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFP  446
             YP ++I TFVSLVSIW Y GRV SGF SE ++ +++ PR LM+T  LLL CAG LL+AF 
Sbjct  361   YPSKSITTFVSLVSIWGYLGRVSSGFASEILLSKYRFPRPLMLTIVLLLSCAGHLLIAFG  420

Query  445   FPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVG  266
              P S+Y AS+I+GF +G Q  L+F IISELFGLKYYSTL++ G  ASPLG+YI NVK+ G
Sbjct  421   IPNSLYAASVIVGFCFGAQWPLIFSIISELFGLKYYSTLYSIGGGASPLGAYIFNVKVTG  480

Query  265   RLYDGEAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              LYD EA +Q+AA G+      +L+C G  CY+V+F ++A  +  G + SL LV RT  +
Sbjct  481   YLYDREARRQMAAAGIVRAAGEDLSCAGVHCYRVAFFIIAATSFAGCVTSLALVLRTRKF  540

Query  100   YKTDIYKRF  74
             Y  DIYK+F
Sbjct  541   YGGDIYKKF  549



>ref|XP_010933280.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Elaeis 
guineensis]
Length=576

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/549 (51%), Positives = 388/549 (71%), Gaps = 10/549 (2%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             N  N + Q+ RGRWF +FASFLI A +G+ Y+F +YSK+IK++LGYDQ  LN +  FKD+
Sbjct  4     NPLNRIIQVLRGRWFTVFASFLINATSGSLYVFAIYSKDIKSSLGYDQRQLNTVSFFKDL  63

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GA+VG+L+GLI EV P WFVL +GS MN  GY +I+L++T R+A P +WQ+CLYIC+GAN
Sbjct  64    GASVGILAGLIYEVAPPWFVLALGSVMNLFGYLMIYLAITGRLAHPSLWQVCLYICIGAN  123

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ F+NTG +VTC+KNFP SRG +LGL+KGF GLSGA+F QLYLA YG+DS++++LLI W
Sbjct  124   SQTFSNTGVVVTCLKNFPGSRGTVLGLLKGFAGLSGAIFAQLYLAFYGDDSKSMVLLIAW  183

Query  1150  LPAILSIVFIPSIRPMKISSHPNE-TKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAY  974
             LP  ++I+F+ +IR +K+   P + TK F+ +L  S+ LA+ LM + I QK V F+  A+
Sbjct  184   LPTAVTIMFLFTIRILKVVQQPGDPTKPFYYFLCFSVALAVYLMVMIIVQKQVIFTLAAH  243

Query  973   IACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDpppp------aeniekaee  812
                A I   LL LP  I + EEL   K K++ L +S ++ +                   
Sbjct  244   RISAAIEVLLLVLPIAIVIKEELKIHKSKEQLLQNSPSLTEALSTPQPPLLPAAPSIVPT  303

Query  811   ekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGES  632
               +   S   NIF+ P++GED+SILQAL+S+DM++LFI   CG G +L AIDN+GQIGES
Sbjct  304   TTSSMLSYITNIFRTPRKGEDHSILQALVSIDMMVLFIGMICGIGGTLTAIDNMGQIGES  363

Query  631   LGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVA  452
             LGY  +TIGTFVSL+SIWN+ GRV +GF S+ +++++K+PR LM+T  LLL CAG LL+A
Sbjct  364   LGYSSQTIGTFVSLISIWNFGGRVAAGFASDILLEQYKLPRPLMLTIVLLLSCAGHLLIA  423

Query  451   FPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKI  272
             F  P ++Y AS+I+G  +G ++ L F I+SE+FGLKYYSTL+N   +AS +G+Y+LNV++
Sbjct  424   FGVPSALYIASVIIGSCFGAEMPLFFAILSEVFGLKYYSTLYNILPMASSIGTYVLNVRV  483

Query  271   VGRLYDGEAVK---QVAARGVGELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAY  101
              G LYD EA K   Q+       LTC+G +CYK++F+++    +FGALV LVLV RT   
Sbjct  484   AGYLYDREAAKQNLQLLQSSQKSLTCMGVRCYKLTFLIITAATVFGALVLLVLVWRTWDL  543

Query  100   YKTDIYKRF  74
             Y+ DIY RF
Sbjct  544   YRRDIYARF  552



>ref|XP_007204603.1| hypothetical protein PRUPE_ppa002810mg [Prunus persica]
 gb|EMJ05802.1| hypothetical protein PRUPE_ppa002810mg [Prunus persica]
Length=631

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/562 (55%), Positives = 400/562 (71%), Gaps = 15/562 (3%)
 Frame = -1

Query  1696  EQNMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFK  1517
              + M +F  Q+  GRWFM+FAS LI++ AGATY+F +YS +IK +LGYDQ+T+NLL  FK
Sbjct  15    HKEMRSFGLQVVHGRWFMVFASMLILSVAGATYMFALYSNDIKKSLGYDQTTINLLSFFK  74

Query  1516  DVGANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVG  1337
             D+G NVGV++GLI E T  W VLL+G+ MNF GYF+IWL+VT R +KP+VWQMCLYIC+G
Sbjct  75    DLGGNVGVIAGLINEFTAPWVVLLIGAVMNFFGYFMIWLAVTGRTSKPRVWQMCLYICIG  134

Query  1336  ANSQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLI  1157
             ANSQ F+NTGA+V+CVKNFP SRG +LGL+KG VGLSGA+ TQL+LA YG DS+ LILLI
Sbjct  135   ANSQTFSNTGAVVSCVKNFPESRGSVLGLLKGLVGLSGAIITQLFLAFYGRDSKALILLI  194

Query  1156  GWLPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFA  977
             GWLPA +S+VF+P IR +K+   PNE +VF+  L +++ LA  +M L I Q  +RFS   
Sbjct  195   GWLPAAVSMVFLPIIRLLKVVRQPNELRVFYNLLYVTLGLAGFIMFLIIIQHKLRFSRIE  254

Query  976   YIACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVE----------Dppppaeni  827
             YI  A++V  LLFLP  + + EE    K K + L     ++              P    
Sbjct  255   YIGSASVVLVLLFLPLAVVIFEEFKIWKSKMRALNDQSQLKVVAENPAPPVQVALPPVAA  314

Query  826   ekaeeekAGDYSCFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLG  647
               + + +    SC  N+F+ P RGEDY+ILQA+ S+DML+LFI   CG G +L AIDNLG
Sbjct  315   PPSPQTQQKPNSCLQNVFRPPDRGEDYTILQAVFSIDMLILFIAITCGAGGTLTAIDNLG  374

Query  646   QIGESLGYPPRTIGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAG  467
             QIG SLGYP  +I TF+SLVSIWNY GRV SGF SE ++K++K PR L++T  LLL C G
Sbjct  375   QIGGSLGYPTHSISTFISLVSIWNYLGRVTSGFSSEVLLKKYKFPRPLLLTLVLLLSCVG  434

Query  466   DLLVAFPFPGSVYGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYI  287
              LL+AF  P S+Y AS+I+GF +G Q  L+F IISE+FGLKYY+TL N G  ASP+G+Y+
Sbjct  435   HLLIAFGVPNSLYVASVIIGFCFGAQWPLIFAIISEIFGLKYYATLINVGGAASPIGAYL  494

Query  286   LNVKIVGRLYDGEAVKQVAA----RGVGE-LTCLGTQCYKVSFIVLAGVNLFGALVSLVL  122
             LNVK+ G LYD EA+KQ+ A    R  GE LTC G  CY+++F ++A V LFG+LVS +L
Sbjct  495   LNVKVAGNLYDAEALKQLKALGKVRKAGEDLTCEGVPCYRLAFCIMAAVALFGSLVSFIL  554

Query  121   VARTAAYYKTDIYKRFRDEMGA  56
             V RT  +Y++DIYK+FR+   A
Sbjct  555   VIRTRKFYRSDIYKKFREAAEA  576



>ref|XP_004142500.1| PREDICTED: uncharacterized protein LOC101204538 [Cucumis sativus]
Length=581

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/548 (54%), Positives = 393/548 (72%), Gaps = 5/548 (1%)
 Frame = -1

Query  1690  NMENFVFQLFRGRWFMMFASFLIMAGAGATYLFGVYSKEIKATLGYDQSTLNLLGSFKDV  1511
             ++ + V  +   RWF++FAS LIM  AG+TY+F +YS +IK+TLGYDQ+TLNLL   KD+
Sbjct  12    DIRSIVVHVITRRWFVLFASLLIMGVAGSTYIFSLYSNDIKSTLGYDQTTLNLLSFSKDL  71

Query  1510  GANVGVLSGLIAEVTPTWFVLLVGSAMNFAGYFLIWLSVTKRIAKPKVWQMCLYICVGAN  1331
             GAN+GVLSGLI EVTP W VL +G+ MNF GYF+IWL++T RI+ PKVWQMCLYIC+GAN
Sbjct  72    GANIGVLSGLINEVTPPWVVLSIGALMNFFGYFMIWLAITNRISTPKVWQMCLYICIGAN  131

Query  1330  SQNFANTGALVTCVKNFPASRGMMLGLMKGFVGLSGAVFTQLYLAIYGNDSQNLILLIGW  1151
             SQ+FANTG++VTCV NFP SRG++LG++KG+ GLSGA+ TQL+ A YG D+++L+L IGW
Sbjct  132   SQSFANTGSMVTCVMNFPESRGVVLGILKGYAGLSGAIITQLFHAFYGADTKSLVLFIGW  191

Query  1150  LPAILSIVFIPSIRPMKISSHPNETKVFFEYLGISITLALCLMGLTIAQKYVRFSHFAYI  971
             LP  +S   +  IR +K+   PNE KVF+ +L IS+ LA  LM + I +   +F+   Y 
Sbjct  192   LPTAVSFASLRIIRIIKVIRQPNELKVFYNFLYISLALAGFLMLMIIVESKKQFNQNEYG  251

Query  970   ACATIVCALLFLPFLIAVMEELATRKEKKKQLLSSENVEDppppaeniekaeeekAGDYS  791
               A +V  LL LP LI VMEE    K K   + S               +  +++  + S
Sbjct  252   GSAAVVLLLLLLPLLIVVMEEYKLWKLKTALIQSPNPSVQIVTEQLPKTEHPKQEHKEPS  311

Query  790   CFGNIFKKPKRGEDYSILQALLSVDMLLLFICNFCGQGCSLAAIDNLGQIGESLGYPPRT  611
             C+  IF  P+RGED++ILQ L SVDML+LF    CG G +L AIDNLGQIG SLGYP R+
Sbjct  312   CWRTIFSPPERGEDFTILQGLFSVDMLILFTSAACGMGGTLTAIDNLGQIGVSLGYPKRS  371

Query  610   IGTFVSLVSIWNYFGRVFSGFVSETIVKRWKIPRTLMMTFSLLLPCAGDLLVAFPFPGSV  431
             I TFV+LVSIWNY GRV  GF+SE +++++K PRTL+++  LLL C G L++AF  P  +
Sbjct  372   ISTFVTLVSIWNYLGRVACGFLSEIVLRKYKCPRTLILSLILLLSCVGHLMIAFDVPNGL  431

Query  430   YGASLILGFSYGVQLTLLFIIISELFGLKYYSTLFNCGQLASPLGSYILNVKIVGRLYDG  251
             Y AS+++GF +G Q  L+F IISELFGLKYYSTL+N G +ASP+G Y+LNVK+ G  YD 
Sbjct  432   YVASIVIGFCFGAQWPLIFAIISELFGLKYYSTLYNFGSVASPIGLYVLNVKVAGNFYDR  491

Query  250   EAVKQVAARGV-----GELTCLGTQCYKVSFIVLAGVNLFGALVSLVLVARTAAYYKTDI  86
             EA KQ+ A+G+      EL C+G  C+K+SFIV+ GV L G LVSL+LV RT ++Y++DI
Sbjct  492   EAEKQLEAKGIIRKAGEELKCIGGACFKLSFIVITGVTLLGMLVSLILVIRTRSFYRSDI  551

Query  85    YKRFRDEM  62
             YK+FR+E+
Sbjct  552   YKKFREEV  559



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5108831831048